WO2020257516A2 - Specific nuclear-anchored independent labeling system - Google Patents
Specific nuclear-anchored independent labeling system Download PDFInfo
- Publication number
- WO2020257516A2 WO2020257516A2 PCT/US2020/038520 US2020038520W WO2020257516A2 WO 2020257516 A2 WO2020257516 A2 WO 2020257516A2 US 2020038520 W US2020038520 W US 2020038520W WO 2020257516 A2 WO2020257516 A2 WO 2020257516A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sequence
- sunl
- tagged
- nucleic acid
- polypeptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- G—PHYSICS
- G06—COMPUTING OR CALCULATING; COUNTING
- G06N—COMPUTING ARRANGEMENTS BASED ON SPECIFIC COMPUTATIONAL MODELS
- G06N20/00—Machine learning
- G06N20/10—Machine learning using kernel methods, e.g. support vector machines [SVM]
-
- G—PHYSICS
- G06—COMPUTING OR CALCULATING; COUNTING
- G06N—COMPUTING ARRANGEMENTS BASED ON SPECIFIC COMPUTATIONAL MODELS
- G06N3/00—Computing arrangements based on biological models
- G06N3/02—Neural networks
- G06N3/04—Architecture, e.g. interconnection topology
- G06N3/045—Combinations of networks
-
- G—PHYSICS
- G06—COMPUTING OR CALCULATING; COUNTING
- G06N—COMPUTING ARRANGEMENTS BASED ON SPECIFIC COMPUTATIONAL MODELS
- G06N3/00—Computing arrangements based on biological models
- G06N3/02—Neural networks
- G06N3/04—Architecture, e.g. interconnection topology
- G06N3/0464—Convolutional networks [CNN, ConvNet]
-
- G—PHYSICS
- G06—COMPUTING OR CALCULATING; COUNTING
- G06N—COMPUTING ARRANGEMENTS BASED ON SPECIFIC COMPUTATIONAL MODELS
- G06N3/00—Computing arrangements based on biological models
- G06N3/02—Neural networks
- G06N3/04—Architecture, e.g. interconnection topology
- G06N3/047—Probabilistic or stochastic networks
-
- G—PHYSICS
- G06—COMPUTING OR CALCULATING; COUNTING
- G06N—COMPUTING ARRANGEMENTS BASED ON SPECIFIC COMPUTATIONAL MODELS
- G06N3/00—Computing arrangements based on biological models
- G06N3/02—Neural networks
- G06N3/04—Architecture, e.g. interconnection topology
- G06N3/0475—Generative networks
-
- G—PHYSICS
- G06—COMPUTING OR CALCULATING; COUNTING
- G06N—COMPUTING ARRANGEMENTS BASED ON SPECIFIC COMPUTATIONAL MODELS
- G06N3/00—Computing arrangements based on biological models
- G06N3/02—Neural networks
- G06N3/08—Learning methods
- G06N3/09—Supervised learning
-
- G—PHYSICS
- G06—COMPUTING OR CALCULATING; COUNTING
- G06N—COMPUTING ARRANGEMENTS BASED ON SPECIFIC COMPUTATIONAL MODELS
- G06N3/00—Computing arrangements based on biological models
- G06N3/02—Neural networks
- G06N3/08—Learning methods
- G06N3/094—Adversarial learning
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- G—PHYSICS
- G06—COMPUTING OR CALCULATING; COUNTING
- G06N—COMPUTING ARRANGEMENTS BASED ON SPECIFIC COMPUTATIONAL MODELS
- G06N3/00—Computing arrangements based on biological models
- G06N3/02—Neural networks
- G06N3/08—Learning methods
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B30/00—ICT specially adapted for sequence analysis involving nucleotides or amino acids
- G16B30/10—Sequence alignment; Homology search
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B40/00—ICT specially adapted for biostatistics; ICT specially adapted for bioinformatics-related machine learning or data mining, e.g. knowledge discovery or pattern finding
Definitions
- This document relates to materials and methods for labeling and subsequently isolating particular cell types from mixed cell populations.
- the brain and other tissues consist of heterogeneous populations of cells with specialized properties and functions. Genetically and epigenetically distinguishable cell types are likely to play different roles and exhibit different responses in disease and other conditions.
- genomic assays are conducted on bulk tissue and not individual cell types, making the results of such assays difficult to interpret and disentangle for cell type-specific mechanisms. Improved techniques for nuclei labeling and isolation are needed to solve this problem .
- SNAIL Specific uclear- Anchored Independent Labeling
- cSNAIL Cell-Specific Nuclear-Anchored Independent Labeling
- cSNAIL and SNAIL provide improvements over current methods for nuclear isolation methods, as they are easier, more time-efficient, and more cost-effective, without any loss of selection.
- cSNAIL and SNAIL have the added benefits of being compatible with multiplexing and other transgenic models, extending to new cell types, and being transferrable across species. The availability of this technology increases the practicality of cell type-specific genomics, and allow's these approaches to be used in other mammals, including humans.
- this document features a nucleic acid construct containing (a) a sequence encoding a tagged Sunl fusion polypeptide, where the tagged Sunl fusion polypeptide comprises, consists of, or consists essentially of (i) an N -truncated fragment of a Sun 1 gene, where the fragment encodes at least a portion of a portion of a Sun !
- the portion of the Sunl protein is 400 to 600 amino acids in length, and (ii) a sequence encoding a tag polypeptide, and (b) a promoter sequence specific for a selected cell type, where the promoter sequence is operably linked to the sequence encoding the tagged Sunl fusion polypeptide, and is effective to drive expression of the sequence encoding the tagged Sunl fusion polypeptide in the selected cell type.
- the N-truncated fragment of the Sunl gene can encode a polypeptide with at least 95% sequence identity to amino acids 208-757 of the mouse Sunl protein having the amino acid sequence set forth m SEQ ID NO: 1.
- the tag polypeptide can be a fluorescent polypeptide (e.g., a green fluorescent protein (GFP), such as a GFP with an ammo acid sequence that at least 95% identical to the superfolder GFP sequence set forth in SEQ ID NO:2)
- the construct can further include virus sequences (e.g., adeno-associated virus (AAV) sequences or lenti virus sequences) ’
- virus sequences e.g., adeno-associated virus (AAV) sequences or lenti virus sequences
- AAV adeno-associated virus
- PV+ parvalbumin positive
- PV- parvalbumin negative
- this document features a nucleic acid construct containing (a) a sequence encoding a tagged Sun l fusion polypeptide, where the tagged Sun! fusion polypeptide comprises, consists of, or consists essentially of (i) an N-truncated fragment of a Sunl gene, where the fragment encodes a portion of a Siml protein, and where the portion of the Sunl protein is 400 to 600 amino acids in length, and (ii) a sequence encoding a tag polypeptide, (b) a first lox sequence flanking the 5' end of the sequence encoding the tagged Sunl fusion polypeptide and a second lox sequence flanking the 3' end of the sequence encoding the tagged Sunt fusion polypeptide, and (c) a promoter sequence downstream of the lox sequence flanking the 3' end of the sequence encoding the tagged Sunl fusion polypeptide, such that the sequence encoding the tagged Sunl fusion polypeptide is in reverse orientation with respect to the promoter
- the N-truncated fragment of the Sunl gene can encode a polypeptide with at least 95% sequence identity to amino acids 208-757 of the mouse Sunl protein having the amino acid sequence set forth in SEQ ID NO: 1.
- the tag polypeptide can be a fluorescent polypeptide (e.g., a GFP, such as a GFP having an amino acid sequence that is at least 95% identical to the superfolder GFP sequence set forth in SEQ ID NO:2).
- the construct can further include virus sequences (e.g., AAV sequences or lentivirus sequences).
- virus particles e.g., AAV or lentivirus particles
- nucleic acid constructs as described herein.
- this document features a method for labeling a selected cell type within a population of different cell types, where the method includes introducing into the population of different cell types a nucleic acid construct containing (a) a sequence encoding a tagged Sun! fusion polypeptide, where the tagged Sunl fusion polypeptide comprises, consists of, or consists essentially of (i) an N-truncated fragment of a Sunl gene, where the fragment encodes at least a portion of a portion of a Sun 1 protein, and where the portion of the Sunl protein is 400 to 600 amino acids in length, and (ii) a sequence encoding a tag polypeptide, and (b) a promoter sequence specific for a selected cel!
- Tire N-truncated fragment of the Sunl gene can encode a polypeptide with at least 95% sequence identity to amino acids 208-757 of the mouse Sunl protein having the amino acid sequence set forth in SEQ ID NO: ! .
- the tag polypeptide can be a fluorescent polypeptide (e.g., a GFP, such as a GFP having an amino acid sequence that is at least 95% identical to the superfolder GFP sequence set forth in SEQ ID NO:2).
- the construct can further include virus sequences (e.g., AAV sequences or lentivirus sequences).
- the promoter sequence can be specific for PV+ neurons, such that the sequence encoding the tagged Sunl fusion polypeptide is expressed in PV+ neurons but not expressed in at least 90% of PV- neurons.
- this document features a method for labeling a selected cell type within a population of different ceil types, where the method includes (a) introducing into the population of different cell types (i) a first nucleic acid construct containing (1 ) a sequence encoding a tagged Sunl fusion polypeptide and (2) a sequence encoding a tag polypeptide, where the tagged Sunl fusion polypeptide comprises, consists of, or consists essentially of an N-truncated fragment of a Sunl gene, where the fragment encodes a portion of a Sunl protein, and wherein the portion of the Sunl protein is 400 to 600 amino acids in length, and (2) a first lox sequence flanking the 5' end of the sequence encoding tire tagged Sunl fusion polypeptide and a second lox sequence flanking the 3' end of the sequence encoding the tagged Sunl fusion polypeptide, and (3) a promoter sequence downstream of the lox sequence flanking the 3 ' end of the sequence encoding the tagged Sunl
- the N -truncated fragment of the Sunl gene can encode a polypeptide with at least 95% sequence identity to amino acids 208-757 of the mouse Sunl protein having the amino acid sequence set forth in SEQ ID NO: 1.
- the tag polypeptide can be a fluorescent polypeptide (e.g., a GFP, such as a GFP having an amino acid sequence that is at least 95% identical to the superfolder GFP sequence set forth in SEQ ID NO: 2)
- the construct can further include virus sequences (e.g., AAV sequences or lenti virus sequences).
- this document features a method for generating, by a data processing system, data representing a synthetic genetic sequence configured for labeling at least one cell type by causing expression of a marker in the at least one cell type.
- the method can include: receiving training data associating at least one feature of a genetic sequence of the at least one cell type with expression of a hallmark of the at least one cell type; training, based on the training data, a model configured to generate data representing a synthetic genetic sequence; receiving input data comprising the at least one feature; and generating the synthetic genetic sequence in response to receiving the input data comprising the at least one feature.
- the model can include a generative adversarial network (GAN).
- the GAN can be a deep convolutional GAN (DCGAN).
- the GAN can include: a generator network configured to receive latent random noise data as the input data and generate the synthetic genetic sequence; and a discriminator network configured to generate a probability value representing whether the input sequence is drawn from the synthetic genetic sequence from the generator network or from a distribution of natural genetic sequences.
- the method can include training the generator network and the discriminator network of the GAN by alternating tire input data between synthetic sequence derived from the latent noise data input to die generator network and natural genetic sequence data.
- the method can include: receiving input data representing endogenous genomic sequences underlying previously profiled open chromatin regions of at least two cell types: and updating the discriminator network for distinguishing between the at least two cell types.
- the at least two cell types can include parva!humin positive (PV+) and pan albumin negative (PV-) neurons, where the discriminator network is configured to distinguish between the PV+ and PV- neurons based on the input data.
- the method can include optimizing a feature of the synthetic genetic sequence by applying a class label to both the generator network and the discriminator network.
- the class label can be configured to force a first probability value for a first input type and a second probability value for a second input type that is different from the first input type.
- the feature can represent an enhancer of an activity in a cell type.
- Tire method can further include generating a nucleic acid sequence comprising the synthetic genetic sequence.
- the nucleic acid sequence can include the synthetic genetic sequence operabiy linked to a nucleotide sequence encoding a marker (e.g., a tagged Sun! fusion polypeptide).
- the nucleic acid sequence can further include a virus nucleic acid sequence (e.g., an AAV or lentivirus sequence).
- the method can include: receiving results data representing a delivery ' of a nucleic acid including the synthetic genetic sequence to an organism, the results data representing a successful l abeling of the at least one cell type or an unsuccessful labeling of the at least one cell type; updating the model using the results data: and generating an updated synthetic genetic sequence based on the updated model.
- the method can further include: receiving training data including the hallmark representing marker positive results marker negative results, or both; extracting at least one feature corresponding to the marker positive result or to the marker negative result; and adding the at least one feature to the model.
- the at least one feature can be a set of k-mer or gapped k-mer counts, and wherein extracting the at least one feature comprises scanning the sequence to determine the set of k-mer counts that form the sequence.
- the model can include a support vector machine that includes: a feature space; and a support vector representing a classification border in the feature space, where the method includes adding, to the support vector of the support vector machine, a given set of k-mer counts within a predefined distance of the classification border in the feature space of the support vector machine.
- the model can include a neural network.
- the neural network can be a convolutional neural network.
- the neural network can include one or more weight values each associated with a feature of the synthetic genetic sequence.
- the feature can include a set of k-mer counts of the genetic sequence.
- the feature can represent a transcription factor binding motif.
- the synthetic genetic sequence can be configured to distinguish between pan albumin positive (PV+) and parvalbumin negati ve (PV-) neurons; PV+ and excitatory (EXC) neurons; or PV+ and vasoactive intestinal peptide-expressing (VIP+) neurons.
- FIGS. 1A-1D demonstrate validation of the cSNAIL probe system in a non limiting example of a neuron subtype in mice, with imaging and molecular data.
- FIG. IA is a schematic of the Cre -dependent mechanism of the c SNAIL viral probe.
- the Sun!GFP coding sequence between the LoxP sites is expressed in the presence of Cre (left), but not in the absence of Cre (right).
- FIGS. IB and 1C are images of brain tissue (Ml region) from a PVcre/ail4 mouse injected with the cSNATL Sun !GFP virus. Viral labeling was indicated by green fluorescent protein (GFP), in direct comparison with transgenically labeled Cre (PV+) cells (originally in red).
- FIGS, IE and I F are schematics showing that when compared with the INTACT (Isolation of Nuclei TAgged in Specific Cell Types) method, Assay for Transposase-Accessible Chromatin (ATAC- seq) data from cSNAIL probes yielded similar cell type-specific open chromatin profiles.
- FIG, 2A is a flow diagram of a process for generating synthetic enhancers by a machine learning model
- FIG. 2B is a schematic of a conditional generative adversarial network (GAN) for generating synthetic enhancers to label cell types using SNAIL.
- GAN conditional generative adversarial network
- FIG. 3 is a series of graphs plotting the performance of gapped k-rner support vector machine (SVM) and convolutional neural network (CNN) models on predicting cell type-specific regulatory activity of genomic sequences in PV+ neurons relative to PV- neurons, excitatory neurons, and VIP+ neurons.
- SVM gapped k-rner support vector machine
- CNN convolutional neural network
- FIG. 4A is a set of images showing validation of two SNAIL probes for parva!bumin positive neurons, alongside a non-specific control virus.
- the images show Sun 1 GFP labeled cells and parvalbumin-immunoreactive neurons (Swant PV27/Alexa Fluor 594) within mouse cortical tissue.
- the scale bars measure 100 pm.
- FIGS. 4B and 4C show that open chromatin signatures derived from SNAIL-isolated PV+ ceils recapitulate known PV+ features from cSNAIL and single nucleus ATAC-seq data.
- FIG 4C depicts hypergeometric enrichment significance of the overlap between cell type- specific SNAIL open chromatin regions and cluster-specific snATAC-seq open chromatin regions (data from data.nemoarchive.org/
- FIG. 5A is a schematic depicting the structure of the pAAV-Efla-DIO- SUN 1 GFP-WPRE-p A construct.
- FIGS. 6A-6C show that cSNAIL targets Cre+ nuclei with high precision.
- FIG. 6A is an image showing that SUN1GFP expression from cSNAIL correctly localized to the nuclear envelope in tissue. Specifically, SUN 1 GFP (yielding green fluorescence) from cSNAIL was expressed in a Cre+ cell in cortical tissue from a Pvalb-2A-Cre/Ail4 mouse that expresses tdTomato as a reporter of Cre (yielding magenta fluorescence).
- FIG. 6B is an image showing that SUN1GFP expression from cSNAIL was sufficient to bind anti- GFP-coated magnetic beads for affinity purification.
- FIG. 6C is a series of images showing that SUN1GFP expression from cSNAIL was restricted to Cre+ ceils in the cortex, striatum, and GPe.
- FIGS. 7A-7C show that cSNAIL-isoiated nuclei from Pvalb-2A-Cre mice recapitulate PV+ transcriptomic and epigenomic signals from external data.
- FIG. 7 A is a genome browser visualization of ATAC-seq and RNA-seq signal at the Pvalb locus from pooled p-value tracks.
- cSNAIL data is labeled in black and is compared with publicly available data (Mo et ai.. Neuron 86: 1369-1384, 2015) labeled in grey.
- FIG. 7 A is a genome browser visualization of ATAC-seq and RNA-seq signal at the Pvalb locus from pooled p-value tracks.
- cSNAIL data is labeled in black and is compared with publicly available data (Mo et ai.. Neuron 86: 1369-1384, 2015) labeled in grey.
- FIG. 7B shows enrichment of mouse cortical snATAC-seq cluster markers (LFC > 0.25 and p ⁇ 0.05 relative to all other clusters) within cell type-specific ATAC-seq peaks in the data by the hypergeometric test (data and method from Signac vignette, available online at grthub.com/timoast/signac).
- FIG. 7C shows expression of cortical cSNAIL PV+ gene signatures per cell of external mouse cortex snRNA-seq (data from
- FIGS. 8A-8F show molecular signatures of PV+ neurons across brain regions.
- FIG. 8A shows the numbers of differentially expressed genes (DESeq2 p ad ⁇ ⁇ 0.01 and iLFCj > 1) between cSNAIL-isoiated PV+ and PV- fractions from the cortex, striatum, and GPe of sham animals.
- FIG. 8B shows normalized read counts from example marker transcripts in each sample. DESeq2 normalized counts were converted to the proportion that they represent of the total read count for that transcript within the given brain region.
- FIG. 8A shows the numbers of differentially expressed genes (DESeq2 p ad ⁇ ⁇ 0.01 and iLFCj > 1) between cSNAIL-isoiated PV+ and PV- fractions from the cortex, striatum, and GPe of sham animals.
- FIG. 8B shows normalized read counts from example marker transcripts in each sample. DESeq2 normalized counts were converted to the proportion that they
- FIG. 8C show's representative pathway enrichments for pan-PV+ and pan-PV- marker genes by g:Profiler (Peterson et al., Nucleic Acids Res 47:W191 -W198, 2019).
- the size of the bubble represents the negative log of the adjusted p-value after multiple hypotheses correction.
- FIG. 8D shows the numbers of cell type-enriched ATAC-seq peaks (p 3.dj ⁇
- FIG. 8E show's DESeq2 normalized counts of ATAC-seq reads within 5kb of tire transcription start site of marker genes. Again, counts were normalized to the total counts for that transcript in the cortex, striatum, or GPe.
- FIG. 8F shows examples of motifs enriched in PV+ specific or PV- specific ATAC-seq peaks relative to all peaks in that cell type by AME (McLeay and Bailey, BMC Bioinformatics 11 : 165, 2010). Each brain region was assessed separately, and these motifs were significantly enriched in PV+ or PV- sequences across all brain regions.
- FIGS. 9A-9D show that di vergent gene expression in dopamine depleted mice is largely restricted to GPe PV+ neurons and implicates the HIF pathway.
- FIG. 9A is a table showing the numbers of genes that have differential expression with dopamine depletion (DD) in each cell type.
- FIG. 9B. is a volcano plot of DD-affected genes in GPe PV+ neurons. Genes meeting the significance threshold of p adj ⁇ 0.05 (above the dotted line) are listed in order of significance.
- FIG. 9C shows that DD is associated with a specific increase in Hi£2a (Epasl) transcription and its target genes in GPe PV+ neurons.
- FIG. 9D is a graph plotting the proportion of GPe PV+ cells that express Hif2a protein, demonstrating that there was a significant increase between the images from healthy tissue and DD tissue (t-test).
- FIGS. 10A-10G show that open chromatin changes associated with DD showed cell type-specific HIF motif enrichment.
- FIG. 1QA is a table showing the numbers of ATAC-seq regions in each cell type that were differentially open in DD animals compared to sham animals in a categorical analysis.
- FIG. 1QB shows HIF family transcription factor binding motifs as defined in j AS PAR 2018 (Khan et al.. Nucleic Acids Res 46:260-266, 2018).
- FIG. IOC is a series of graphs plotting cell type-specific HIF family motif enrichments among sets of sequences underlying ATAC-seq peak summits that increase in accessibility in DD animals.
- FIGS. 11A-11B show the quantification of dopamine depletion per hemisphere.
- FIG. HA is a graph plotting tire levels of striatal tyrosine hydroxylase for each hemisphere of four 6-QHDA lesioned animals and two sham animals. Hie p-values reflect a significant difference in populations by the standard t-test.
- FIG. 11B includes examples of the quantified images, indicated by the arrows in FIG. 11 A.
- FIGS. 12A-12D show that the ATAC-seq data w3 ⁇ 4s high quality.
- FIGS. 12A and 12D show that the ATAC-seq data w3 ⁇ 4s high quality.
- FIG. 12G is a graph demonstrating that the data exhibited the characteristic periodicity in fragment length distributions of high quality ATAC-seq data, reflecting nucleosome positioning. The plot shown is a representative example from one GPe PV+ sample.
- FIG. 12D shows that the ATAC-seq signal was enriched at the transcription start sites (TSS), indicati ve of high signal -to-noise. The displayed data are a representative example from one GPe PV+ sample.
- FIGS. 13A and 13B show additional properties of the mouse cortex snRNA-seq data.
- FIG. 13A shows cluster annotations per cell of the snRNA-seq data with UMAP embedding.
- FIG. 13B shows that Pvalb gene expression is highest within the Pvalb intemeuron cluster (circled).
- FIGS. 14A and 14B show that PV+ and PV- marker genes from cSNAIL were expressed in relevant cell clusters from scRNA-seq.
- DropViz was used to define scRNA- seq clusters in the frontal cortex, striatum, and globus pallidus. Per cell expression of each indicated gene is shown by the size of the points. Where meta-cell expression of a gene was greater than 70% of the maximum expression in that meta-cell, the cluster is labeled by its cluster number
- FIGS. 15A and 15B show RNA-seq sample similarities
- FIG. 15A is a graph showing that the first two principal components separated samples by brain region and cell type.
- FIG. 15B shows that in hierarchical clustering, samples mainly clustered by brain region and then cell type.
- FIG. 16 is a series of images showing that w ith dopamine depletion, the proportion of GPe PV+ neurons that express HifZa protein increases.
- Example images from healthy and DD GPe tissue are shown.
- Some instances of PV+Hif2a- cells are highlighted by white arrow's.
- the scale bars measure IOOmhi.
- FIG. 17 shows the overlap between DD-affected ATAC-seq peaks of different cell types.
- the width of each outer segment of the circle shows how many DD-affected peaks were recovered in that cell type.
- Bidirectional arcs between two cell types signify shared DD-affected peaks where tire width of the connection represents the number of shared peaks.
- the data were plotted with circlize (Gu et al, Bioinformatics 30:281 1-2812, 2014).
- FIG. 18 is a summary of enriched annotations in DD-affected ATAC-seq peak sets. Enrichments were determined using GREAT for each differential set of peaks against a background of all peaks in that cell type. Die arrow of a term indicates that it was enriched in DD-inereasing peaks (up arrow) or DD-decreasing peaks (down arrow)
- FIG, 19 is a graph plotting TSS accessibility trends with differential gene expression in GPe PV+ neurons (t-test).
- Genomic assays of specific cell types first require identifying and separating the cells of interest from the rest of the tissue. In brain tissue, for example, this can be especially difficult due to the high diversity of cell types that are tightly packed together and connected with long, fragile projections. In the adult brain, it is impractical to separate whole cells in sufficient quantities because these projections can break off, spilling their contents into the media. Instead, researchers have turned to sorting the nuclei of cell types of interest.
- One method for isolation of nuclei without using fixatives (which are incompatible with some genomic assays) is the INTACT method (Mo et ah, supra), which requires a double transgenic mouse.
- the first transgene expresses Cre recombinase in a cell type-specific manner, and the second expresses the SunlGFP fusion protein only in the presence of Cre recombinase.
- An INTACT mouse therefore expresses SunlGFP exclusively in the ceils of interest.
- Sun ! is a mammalian nuclear envelope protein that can serve as a robust tool for cell labeling and isolation from homogenized tissues, due to its localization.
- the Sun! coding sequence can be fused with sequences encoding two copies of super-folder GFP, which reliably folds into the correct conformation even in protein fusions.
- the result of SunlGFP expression is GFP that is tightly anchored to the nuclear envelope.
- Tissue e.g., brain tissue
- SunlGFP in one or more particular cell types (e.g., particular neuron types)
- GFP+ nuclei can be separated from GFP- nuclei using affinity purification in which magnetic beads coated with an anti-GFP antibody bind GFP+ nuclei, but not GFP- nuclei.
- the beads with GFP+ nuclei can then be pulled aw'ay from the GFP- nuclei with a magnet and used for further studies.
- the INTACT method has been instrumental for studying specific subsets of neurons in isolation. Its reliance on double transgenic mice has limited its use, however, because transgenic breeding can be highly variable and resource-intensive, and because transgenic strains are often only feasible for cell types that can be characterized by a single marker locus, leaving many populations inaccessible. The current technology is limited mainly to the laboratory Mus musculus species, and the difficult nature of creating new transgenic organisms means that it is impractical to extend the framework to non model organisms. In addition, multiple transgenic breeding makes it problematic to use cell type-specific mouse lines conjunction with other transgenic traits, including disease models or strains that label an additional cell population of interest.
- SNAIL and cSNAIL materials and methods provided herein utilize an affinity purification strategy that is similar to the INTACT method for
- viruses can be used to deliver a simple, compact labeling gene that is sufficient to achieve success.
- AAV Adeno-associated vims
- the probes can be introduced into any appropriate mammals (e.g., mice, rats, sheep, pigs, dogs, or non-human primates) through intravenous injection, direct injection into the brain, or any other appropriate method.
- AAV Adeno-associated vims
- This delivery procedure is a much more time and resource-efficient way to tag cell populations when compared with the intricacies of transgenic breeding. The method also drastically minimizes the number of collateral animals that are bred for an experiment but cannot be used due to undesirable genotypes.
- the probes provided herein include, for example, Cre-dependent (cSNAIL) viral probes that are immediately compatible with existing strains of Cre transgenic mice, as well as Cre -independent (SNAIL) viral probes, which are developed individually for different cell types and, as described more fully below, accomplish complete
- Both probe types contain a newly designed sequence that includes an N-truncated exon-only version of the SunlGFP fusion protein. This sequence is 1/16 m the size of the INTACT sequence (2,367 bp), and was sufficient to achieve successful nuclear envelope GFP labeling for affinity purification even in vivo (e.g., in the brain), which was rather surprising.
- the smaller size enables much more flexibility in gene deliver ⁇ ' , including compatibility with AAV virus.
- the cell type specificity of the cSNAIL viral probe is conferred through its dependence on DNA rearrangement by Cre recombinase (FIG, lA), which is only present in certain cells.
- Cre recombinase FOG, lA
- a double-floxed inverted orientation (DIO) system (Atasoy et ah, J. Neurosci. 28:7025-7030, 2008) is used, in which the Sun lGFP sequence is delivered in the reverse orientation, such that it cannot be transcribed.
- Cre recombinase protein Cre can excise the Sun lGFP sequence and irreversibly re-insert it in the correct orientation for expression.
- This system is more tightly regulated than the lox-flanked stop codon system that is used to confer Cre dependence in the INTACT transgenic mouse strain (Atasoy et al., supra).
- a cell type-specific regulatory' element is required to drive targeted gene expression in the desired cell type of interest.
- a regulatory element was designed to label one specific cell type - parvalbumin positive (PV+) inhibitory' intemeurons - using in silica screening. Profiles of cell type-specific open chromatin were used for this neuron subtype to train machine learning models that link genome sequence to parva!bumin-speeific regulatory activity'.
- three gapped k-mer support vector machines were built to discriminate between the comparative regulatory sequence activity in PV+ vs. PV- neurons, PV+ vs. excitatory neurons, and PV+ vs.
- vasoactive intestinal peptide-expressing (U ⁇ R+) neurons vasoactive intestinal peptide-expressing (U ⁇ R+) neurons.
- CNNs convolutional neural networks
- All of these models were used to screen PV+ neuron-specific regions of open chromatin for their ability to independently drive cell type-specific gene expression.
- a top candidate was chosen based on the predicted cell type-specificity, its length, and its proximity to cell type-specific genes. That candidate regulatory' sequence was cloned into a plasmid vector in which it could drive the expression of SunlGFP, and the vector was transduced into the mouse brain using AAV-PHP.eB (Chan et al., Nat. Neurosci. 20: 1172-1179, 2017).
- nucleic acid constructs that contain sequences encoding fusion polypeptides that include a Sun! portion and a tag portion.
- the Sunl portion enables the fusion polypeptide to localize to the nuclear membrane, while the tag portion enables cells and/or nuclei containing the expressed fusion polypeptide to be identified and isolated away from ceils and/or nuclei that do not express the fusion polypeptide.
- the nucleic acids provided herein can further include other sequences, such as sequences to control expression of the fusion polypeptide (e.g., sequences to promote expression in particular types of cells, and/or sequences to prevent expression unless Cre is present).
- nucleic acid and“polynucleotide” can be used interchangeably', and refer to both RNA and DNA, including cDNA, genomic DNA, synthetic (e.g., chemically synthesized) DNA, and DNA (or RNA) containing nucleic acid analogs.
- Polynucleotides can have any three-dimensional structure.
- a nucleic acid can be double-stranded or single -stranded (i.e., a sense strand or an antisense single strand).
- Non-limiting examples of polynucleotides include genes, gene fragments, exons, introns, messenger RNA (niR A), transfer RNA, ribosoinal RNA, ribozymes, cDNA, recombinant
- polynucleotides polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers, as well as nucleic acid analogs.
- nucleic acid when in reference to a nucleic acid, refers to a nucleic acid that is separated from other nucleic acids that are present in a genome, including nucleic acids that normally flank one or both sides of the nucleic acid in the genome.
- isolated as used herein with respect to nucleic acids also includes any non- naturally-occurring sequence, since such non-naturally-occurring sequences are not found in nature and do not have immediately contiguous sequences in a naturally-occurring genome.
- an isolated nucleic acid can be, for example, a DNA molecule, provided one of the nucleic acid sequences normally found immediately flanking that DNA molecule in a naturally-occurring genome is removed or absent.
- an isolated nucleic acid includes, without limitation, a DNA molecule that exists as a separate molecule (e.g., a chemically synthesized nucleic acid, or a cDNA or genomic DNA fragment produced by PCR or restriction endonuclease treatment) independent of other sequences, as well as DNA that is incorporated into a vector, an autonomously replicating plasmid, a virus (e.g., a pararetrovirus, a retrovirus, lenti virus, adenovirus, or herpes virus), or the genomic DNA of a prokaryote or eukaryote.
- a virus e.g., a pararetrovirus, a retrovirus, lenti virus, adenovirus, or herpes virus
- an isolated nucleic acid can include a recombinant nucleic acid such as a DNA molecule that is part of a hybrid or fusion nucleic acid.
- a nucleic acid can be made by, for example, chemical synthesis or polymerase chain reaction (PCR).
- PCR refers to a procedure or technique in which target nucleic acids are amplified. PCR can be used to amplify specific sequences from DNA as well as RN A, including sequences from total genomic DN A or total cellular RNA.
- RN A sequences from total genomic DN A or total cellular RNA.
- sequence information from the ends of the region of interest or beyond is employed to design oligonucleotide primers that are identical or similar in sequence to opposite strands of the template to be amplified.
- V arious PCR strategies also are available by which site-specific nucleotide sequence modifications can be introduced into a template nucleic acid.
- Isolated nucleic acids also can be obtained by mutagenesis.
- a naturally occurring nucleic acid sequence can be mutated using standard techniques, including oligonucleotide-directed mutagenesis and site-directed mutagenesis through PCR. See, Short Protocols in Molecular Biology. Chapter 8, Green Publishing Associates and John Wiley & Sons, edited by Ausubel ei al , 1992.
- Recombinant nucleic acid constructs containing sequences encoding the tagged Sunl fusion polypeptides also are provided herein.
- A“vector” is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment.
- Vector backbones include, for example, plasmids, viruses, artificial chromosomes, bacterial artificial chromosomes (BACs), yeast artificial chromosomes (YACs), and phage artificial chromosomes (PACs), as well as RNA vectors, and linear or circular DN A or RNA molecules that include chromosomal, non- chromosomal, semi-synthetic, or synthetic nucleic acids.
- Vectors include those capable of autonomous replication (episomal vectors) and/or expression of nucleic acids to which they are linked (expression vectors). Generally, a vector is capable of replication when associated with the proper control elements.
- Vector includes cloning and expression vectors, as well as viral vectors and integrating vectors.
- An“expression vector” is a vector that includes one or more expression control sequences to control and regulate the transcription and/or translation of another DNA sequence.
- Suitable expression vectors include, without limitation, plasmids and viral vectors derived from, for example, bacteriophage, baculovirases, tobacco mosaic virus, herpes viruses, cytomegalovirus, retroviruses, vaccinia viruses, adenoviruses, and adeno-associated viruses. Numerous vectors and expression systems are commercially available.
- Viral vectors include, without limitation, retrovirus, adenovirus, parvovirus (e.g., adeno associated viruses), coronavirus, negative strand RNA viruses such as orthomyxovirus (e.g., influenza vims), rhabdovirus (e.g., rabies and vesicular stomatitis virus), paramyxovirus (e.g., measles and Sendai), positive strand RNA viruses such as picor- navirus and aiphavims, and double-stranded DNA viruses including adenovirus, herpesvirus (e.g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxvirus (e.g., vaccinia, fowlpox and canarypox).
- orthomyxovirus e.g., influenza vims
- rhabdovirus e.g., rabies and vesicular
- viruses include Norwalk vims, togavims, flavi virus, reoviruses, papovavirus, hepadnavirus, and hepatitis virus, for example.
- retroviruses include: avian leukosis-sarcoma, mammalian C-type, B-type viruses, D type viruses, HTLV-BLV group, lentivirus, spumavirus (Coffin,“Retroviridae: Tlie viruses and their replication,” in Fundamental Virology.
- regulatory region refers to nucleotide sequences that influence transcription or translation initiation and rate, and stability and/or mobility' of the transcript or polypeptide product.
- Regulatory regions include, without limitation, promoter sequences, enhancer sequences, response elements, protein recognition sites, inducible elements, promoter control elements, protein binding sequences, 5' and 3' untranslated regions (UTRs), transcriptional start sites, termination sequences, polyadenylation sequences, introns, and other regulator regions that can reside within coding sequences, such as secretory signals, Nuclear Localization Sequences (NLS) and protease cleavage sites.
- NLS Nuclear Localization Sequences
- “operabiy linked” means incorporated into a genetic construct so that expression control sequences effectively control expression of a coding sequence of interest.
- a coding sequence is“operabiy linked” and“under the control” of expression control sequences in a cell when RNA polymerase is able to transcribe the coding sequence into RNA, which if an mRNA, then can be translated into the protein encoded by the coding sequence.
- a regulatory region can modulate, e.g., regulate, facilitate or drive, transcription in the plant cell, plant, or plant tissue in which it is desired to express a modified target nucleic acid.
- a promoter is an expression control sequence composed of a region of a DNA molecule, typically (but not always) within 100 nucleotides upstream of the poin t at which transcription starts (generally near the initiation she for RNA polymerase II). Promoters are involved in recognition and binding of RNA polymerase and other proteins to initiate and modulate transcription. To bring a coding sequence under the control of a promoter, it typically is necessary to position the translation initiation site of the translational reading frame of the polypeptide between one and about fifty nucleotides downstream of the promoter. A promoter can, however, be positioned as much as about 5,000 nucleotides upstream of the translation start site, or about 2,000 nucleotides upstream of the transcription start site.
- a promoter typically includes at least a core (basal) promoter.
- a promoter also may include at least one control element such as an upstream element.
- Such elements include upstream activation regions (UARs) and, optionally, other DNA sequences that affect transcription of a polynucleotide such as a synthetic upstream element.
- UARs upstream activation regions
- promoters The choice of promoters to be included depends upon several factors, including, but not limited to, efficiency, selectabiiity, rnducibility, desired expression level, and cell or tissue specificity.
- tissue-, organ- and cell-specific promoters that confer transcription only or predominantly in a particular tissue, organ, and cell type, respectively, can be used.
- a promoter that is active in a particular type of cell e.g., a particular type of neuron
- Such promoters - or other expression control sequences - can be identified using methods such as those described herein, and can be used in the SNAIL constructs provided herein.
- constitutive promoters can promote transcription of an operably linked nucleic acid in essentially any tissue of an organism. Such promoters can be used in the cSNAIL constructs provided herein.
- Other classes of promoters include, without limitation, inducible promoters that confer transcription in response to external stimuli such as chemical agents,
- a 5’ untranslated region is transcribed, but is not translated, and lies between the start site of the transcript and the translation initiation codon and may include the +1 nucleotide.
- a 3’ UTR can be positioned between the translation termination codon and the end of the transcript. UTRs can have particular functions such as increasing mRNA message stability or translation attenuation. Examples of 3’ UTRs include, but are not limited to, polyadenylation signals and transcription termination sequences.
- a polyadenylation region at the 3'-end of a coding region can also be operably linked to a coding sequence.
- Recombinant nucleic acid constructs can include a polynucleotide sequence inserted into a vector suitable for transformation of cells (e.g., plant cells or animal cells).
- Recombinant vectors can be made using, for example, standard recombinant DNA techniques ⁇ see, e.g., Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY).
- a recombinant nucleic acid sequence as described herein can integrate into the genome of a cell via illegitimate (i.e., random, non-homologous, non site-specific) recombination, or a recombinant nucleic acid sequence as described herein can be adapted to integrate into the genome of a cell via homologous recombination.
- Nucleic acid sequences adapted for integration via homologous recombination are flanked on both sides with sequences drat are similar or identical to endogenous target nucleotide sequences, which facilitates integration of the recombinant nucleic acid at the particular site(s) in the genome containing the endogenous target nucleotide sequences.
- Nucleic acid sequences adapted for integration via homologous recombination also can include a recognition site for a sequence-specific nuclease.
- the recognition site for a sequence-specific nuclease can be located in the genome of the cell to be transformed.
- the nucleic acid constructs described herein typically contain a sequence encoding a tagged Sunl fusion polypeptide.
- the tenn“polypeptide” as used herein refers to a compound of two or more subunit amino acids, regardless of post-translational modification (e.g., phosphorylation or glycosylation).
- the subunits may be linked by- peptide bonds or other bonds such as, for example, ester or ether bonds.
- the term“amino acid” refers to either natural and/or unnatural or synthetic amino acids, including D/L optical isomers.
- polypeptide By“isolated” or“purified” with respect to a polypeptide it is meant that the polypeptide is separated to some extent from cellular components with which it is normally found in nature (e.g., other polypeptides, lipids, carbohydrates, and nucleic acids).
- An purified polypeptide can yield a single major band on a non-reducing polyacrylamide gel.
- a purified polypeptide can be at least about 75% pure (e.g., at least 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% pure).
- Purified polypeptides can be obtained by, for example, extraction from a natural source, by chemical synthesis, or by recombinant production in a host ceil or transgenic plant, and can be purified using, for example, affinity chromatography, immunoprecipitation, size exclusion chromatography, and ion exchange chromatography. The extent of purification can be measured using any appropriate method, including, without limitation, column chromatography,
- the Sun 1 portion of the fusion polypeptides provided herein (and encoded by the nucleic acids provided here) can include a fragment of a mouse Sunl protein.
- a representative Sunl protein sequence is provided in SEQ ID NO: 1: Mus musculus Sunl (NCBI Ref. NM 001256118.1)
- the Sunl fragment included in a fusion polypeptide as provided herein can have a length between about 20 amino acids and about 750 amino acids (e.g., about 20 to 50 amino acids, about 50 to about 100 amino acids, about 100 to about 200 amino acids, about 200 to about 400 ammo acids, about 400 to about 600 amino acids, or about 600 to about 750 amino acids).
- the Sunl portion of a tagged Sunl fusion polypeptide can include about 400 to about 600 consecutive amino acids from SEQ ID NO: 1.
- the Sunl portion of the tagged Sunl fusion polypeptide can have at least 90% sequence identity (e.g., at least 92%, 93%, 95%, 97%, 98%, or 99% sequence identity) to a fragment of SEQ ID NO: 1 that is about 20 to about 800 amino acids in length (e.g., about 20 to 50, about 50 to about 100, about 100 to about 200, about 200 to about 400, about 400 to about 600, or about 600 to about 750 amino acids in length).
- a Sun l fragment can include amino acids 208 to 757 of SEQ ID NO: 1, or can have a sequence that is at least 90% (e.g., at least 92%, 93%, 95%, 97%, 98%, or 99%) identical to ammo acids 208 to 757 of SEQ ID NO: 1.
- a Sunl fragment can include a portion of the fragment containing amino acids 208 to 757 of SEQ ID NO: 1 (e.g., a portion that is 20 to 50, 50 to 100, 100 to 300, or 300 to 500 amino acids in length), or a Sunl fragment can have a sequence that is at least 90% (e.g., at least 92%, 93%, 95%, 97%, 98%, or 99%) identical to a portion of the fragment containing ammo acids 208 to 757 of SEQ ID NO: 1.
- the percent sequence identity between a particular amino acid sequence and a sequence referenced by a particular sequence identification number is determined as follows.
- an amino acid sequence is compared to the sequence set forth in a particular query sequence using the BLAST 2 Sequences (B12seq) program from the stand-alone version of BLASTZ containing BLASTP version 2.0.14.
- This stand-alone version of BLASTZ can be obtained online at fr.com/blast or at ncbi.nlm.nih.gov.
- B12seq performs a comparison between two sequences using the BLASTN or BLASTP algorithm
- BLASTN is used to compare nucleic acid sequences
- BLASTP is used to compare amino acid sequences.
- B12seq are set as follows: -i is set to a file containing the first amino acid sequence to be compared (e.g., C: ⁇ seql.txt); -j is set to a file containing the second amino acid sequence to be compared (e.g., C: ⁇ seq2.txt); -p is set to biastp; -o is set to any desired file name (e.g., C: ⁇ output.txt); and all other options are left at their default setting.
- -i is set to a file containing the first amino acid sequence to be compared (e.g., C: ⁇ seql.txt)
- -j is set to a file containing the second amino acid sequence to be compared (e.g., C: ⁇ seq2.txt)
- -p is set to biastp
- -o is set to any desired file name (e.g., C: ⁇ output.txt); and all other options
- the following command can be used to generate an output file containing a comparison between two amino acid sequences: C: ⁇ B12seq -i c: ⁇ seql.txt -j c: ⁇ seq2.txt -p biastp -o c: ⁇ output.txt. If the two compared sequences share homology, then the designated output file will present those regions of homology as aligned sequences. If the two compared sequences do not share homology, then the designated output file will not present aligned sequences.
- the number of matches is determined by counting the number of positions where an identical nucleotide or amino acid residue is presented in both sequences.
- the percent sequence identity is determined by dividing the number of matches either by the length of the sequence set forth in the identified sequence or by an articulated length (e.g., 100 consecutive amino acid residues from a sequence set forth in an identified sequence), followed by multiplying the resulting value by 100.
- the reference mouse Sunl ammo acid sequence set forth in SEQ ID NO: 1 is 757 residues in length.
- the fusion polypeptides provided herein can include a tag sequence designed to facilitate manipulation or detection (e.g., localization, purification, and/or isolation) of the expressed polypeptide. Any suitable tag can be included. In some cases, a fluorescent tag can be used (e.g., GFP, yellow fluorescent protein, or mCheny).
- a representative amino acid sequence for a superfolder GFP is provided in SEQ ID NO:2:
- VLLEFVTAAGITHGMDELYK SEQ ID NO:2
- a tagged Sun ! fusion polypeptide can include an amino acid sequence that is at least 90% (e.g., at least 92%, 93%, 95%, 97%, 98%, or 99%) identical to the sequence set forth in SEQ ID NO: 2.
- Other suitable tags that can be included in the fusion polypeptides provided herein include, without limitation, glutathione S-transferase (GST), polyhistidine, c-myc, hemagglutinin, or FlagTM tag (Kodak, New Haven, CT).
- GST glutathione S-transferase
- polyhistidine polyhistidine
- c-myc hemagglutinin
- FlagTM tag Kodak, New Haven, CT.
- the tag sequence can be located within the Sunl portion of the fusion polypeptide, or can be at or adjacent to the carboxyl or amino terminus of the Sunl portion of the fusion polypeptide.
- the cSNAIL constructs provided herein can include a promoter sequence (e.g., a constitutive promoter, an organ specific promoter, or a promoter that is activated by neural activity or a particular disease state such as oxidative stress or cancer, such as an lEG-sensitive promoter as disclosed by Sorensen et al., eLife 5x13918, 2016) and loxP sites flanking either side of the sequence encoding the fusion polypeptide, such that one of the loxP sites separates the sequence encoding the fusion polypeptide from the promoter.
- a promoter sequence e.g., a constitutive promoter, an organ specific promoter, or a promoter that is activated by neural activity or a particular disease state such as oxidative stress or cancer, such as an lEG-sensitive promoter as disclosed by Sorensen et al., eLife 5x13918, 2016
- loxP sites flanking either side of the sequence encoding the fusion polypeptide such that
- the sequence encoding the tagged Sunl fusion polypeptide can be inverted between the loxP sequences, such that the fusion polypeptide is not expressed until after the coding sequence is excised by a Cre recombinase and reinserted in die“correct” orientation.
- the SNAIL constructs provided herein lack loxP sequences, and contain promoter and/or enhancer sequences that drive expression of the tagged Sunl fusion polypeptide in a specific cell type, thus allowing for identification and isolation of cells of the specific, selected type.
- synthetic enhancer sequences can be constructed purely through computational optimization, and can be paired with SNAIL to generate more specific and efficient ceil type labels than endogenous genomic sequences prioritized using the CNNs and SVMs.
- DCGANs deep convolutional generative adversarial networks
- Sequence classification tasks share many parallels with image classification.
- CNNs are the state-of-the-art model for both tasks, and DCGANs, which utilize CN s under the hood for discrimination, are therefore an ideal choice for generating realistic sequences.
- conditional DCGANs which are a variant of GANs, can be utilized to generate sequences on the condition that they confer specific activity in a given cell type of interest versus other surrounding cell types. These can be trained on any neural cell type for which high resolution open chromatin or enhancer activity measurements exist. The generated sequences can then be cloned into the SNAIL vector to screen and generate high quality AAV-delivered cell type labels.
- machine learning models can be used for generating data representing a synthetic genetic sequence configured for labeling at least one cell type by causing expression of a marker in the at least one cell type.
- the models can include GANs, such as DCGANs, CNNs, support vector machines (SVMs), and so forth.
- the machine learning models are configured for generating the synthetic genetic sequences that are candidates for the SNAIL process (e.g., as viral probes).
- FIG. 2A shows an example process 250 for training and executing the machine learning model to generate the synthetic genetic sequences.
- the process 250 includes receiving (252) training data associating at least one feature of a genetic sequence of the at least one cell type with expression of a hallmark of the at least one cell type.
- the process 250 includes training (254), based on the training data, a model configured to generate data representing a synthetic genetic sequence.
- the process 250 includes receiving (256) input data including the at least one feature of the genetic sequence.
- the process 250 includes generating (258) the synthetic genetic sequence in response to receiving the input data comprising the at least one feature .
- the machine learning model includes a GAN.
- the GAN generally includes a generator network configured to receive latent random noise data as the input data and generate the synthetic genetic sequence and a discriminator network configured to generate a probability value representing whether the input sequence is drawn from the synthetic genetic sequence from the generator network or from a distribution of natural genetic sequences.
- FIG. 2B an example machine learning model 200 is shown for generating data representing a synthetic genetic sequence configured for labeling at least one cell type by causing expression of a marker in the at least one ceil type.
- the machine learning model 200 is configured to generate data that models the SNAIL constructs (e.g., viral probes) discussed throughout this specification.
- the model 200 is a particular model including a DCGAN that has a generator G, a sequence S, and a discriminator D.
- DCGAN support vector machines
- NN neural networks
- the models for generating regulatory sequences is not specific for SVM and CNNs, but also can utilize generative components to the CNNs that relate genomic sequences to regulator ⁇ ' activity and use them to construct synthetic enhancer sequences.
- Machine learning models, such as model 200 are configured to construct synthetic enhancer sequences that are computationally optimized to drive cell type-specific labeling when used in an AAV construct, more so than the endogenous genomic sequences that were used to train the CNN classifiers.
- the machine learning model is configured for generating a nucleic acid sequence comprising the synthetic genetic sequence.
- the nucleic acid sequence comprises the synthetic genetic sequence operably linked to a nucleotide sequence encoding a marker.
- the marker can include a SunlGFP fusion polypeptide.
- the nucleic acid sequence further comprises a virus nucleic acid sequence.
- the virus can include an adeno-associated vims (AAV).
- the machine learning model is configured for receiving results data representing a delivery' of a nucleic acid including the synthetic genetic sequence to an organism .
- Tire results data represents a successful labeling of the at least one cell type or an unsuccessful labeling of the at least one cell type.
- the model is updated using the results data.
- the model is then configured to generate an updated synthetic genetic sequence based on the updated model. Updating the model can also be done by receiving training data including the hallmark representing marker positive results marker negative results, or both.
- the at least one feature corresponding to the marker positive result or to the marker negative result is extracted.
- the at least one feature is then added to the model.
- the feature is a set of k-mer or gapped k-mer counts . Extracting the at least one feature can include scanning the sequence to determine the set of k-mer counts that form the sequence.
- a support vector machine includes a feature space a support vector representing a classification border in the feature space.
- the model is executed to add, to the support vector of the support vector machine, a given set of k-mer counts within a predefined distance of tire classification border in the feature space of the support vector machine.
- the machine learning model includes a neural network.
- the machine learning model can include a convolutional neural network.
- the neural network is loaded with one or more weight values (also called activation values) each associated with a feature of the synthetic genetic sequence.
- a feature of the neural network can include a set of k-mer counts of the genetic sequence.
- the feature represents a transcription factor binding motif.
- the synthetic genetic sequence that is generated from the model is configured to distinguish between ceil types.
- the particular cell types are based on the training data used.
- the genetic sequence that is generated from the model can be configured to distinguish between parvalbumin positive (PV+) and parvalbumin negative (PV-) cells (e.g., the generated sequence can lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% of all PV+ neurons that are transduced by the virus and have the chance to express the machinery, but would not lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% ofPV- ceils).
- PV+ parvalbumin positive
- PV- parvalbumin negative
- the genetic sequence that is generated from the model can be configured to distinguish between PV+ and excitatory (EXC) neurons (e.g., the generated sequence can lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% of all PV+ neurons that are transduced by tire virus and have the chance to express the machinery, but would not lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% of EXC neurons).
- EXC excitatory
- the generated genetic sequence that is generated from the model can be configured to distinguish between PV+ and vasoactive intestinal peptide-expressing (VIP+) neurons (e.g., the generated sequence can lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% of all PV+ neurons that are transduced by the virus and have the chance to express the machinery, but would not lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% of VIP+ neurons).
- VIP+ vasoactive intestinal peptide-expressing
- other cell types can be distinguished by the generated genetic sequence based on the training data used. These examples are non-exhaustive and illustrate possible examples from hundreds or thousands of cell types.
- the regulatory sequence features learned may extend beyond cell types as well as to cellular states, such as neurons that in the process or responding to neural activity or cells that are responding to DNA damage.
- the DCGAN for labeling at least one cell type by causing expression of a marker in the at least one cell type includes two neural network modules, a generator network G and a discriminator network D.
- the generator G receives latent random noise input (z) and outputs a synthetic sequence.
- the discriminator network is configured to generate probability value representing a probability that an input sequence is drawn from a distribution of real sequences.
- the parameters of both G and D can be tuned together using alternating phases of training with real sequences from existing data sources and synthetic sequences generated from G As the models are trained, G generally generates synthetic sequences that are closer to the real data distribution than before. The discriminator is more likely to classify these generate sequences as genuine.
- the generator is training G to generate realistic sequence data.
- a GAN could be applied to generate synthetic enhancers that are likely highly active in PV + or PV- neurons by training on real data drawn from endogenous genomic sequences underlying previously profiled open chromatin regions in PV+ and PV- neurons.
- a conditional GAN can be used where an additional class label (y) is input to both G and D.
- y additional class label
- a GAN could be trained on real sequences active in both PV and PV -neurons, but the generation can be forced to be specific to PV+ neurons by setting y to be 1 for all sequences active in PV+ neurons and 0 for all sequences active in PV- neurons. This enables discriminative generation of sequences, where the optimized property is enhancer activity in a cell type relative to surrounding or background cell types.
- using die GAN includes training the generator network and die discriminator network of the GAN by alternating die input data between synthetic sequence derived from the latent noise data input to the generator network and natural genetic sequence data.
- the GAN receives input data representing endogenous genomic sequences underlying previously profiled open chromatin regions of at least two cell types and then updates the discriminator network for distinguishing between the at least two cell types.
- the at least two cell types include parvalbumin positive (PV+) and pan-albumin negative (PV-) neurons; however, other cell types can be used, and are described throughout this specification .
- the discriminator network is configured to distinguish between the PV+ and PV- neurons based on the input data, but other ceil types can be used as well, such as excitatory (EXC) neurons, vasoactive intestinal peptide-expressing (VIP+) neurons, and so forth.
- EXC excitatory
- VIP+ vasoactive intestinal peptide-expressing
- the GAN is configured for optimizing a feature of the synthetic genetic sequence by applying a class label to both the generator network and the discriminator network.
- the class label is configured to force a first probability value for a first input type and a second probability value for a second input t pe that is different from the first input type.
- the feature represents an enhancer of an activity in a cell type.
- the model 200 is configured to receive (212) the noise and condition input together to generate a compressed representation of the output sequence.
- Tire compressed representation is unpacked (210) using a deconvolution process.
- Fully connected layers can be used in the model 200 to generate a synthetic sequence.
- the model 200 is configured to generate (208) sequence binary encoding to input to the discriminator.
- the discriminator is configured to determine whether the sequence it receives is a synthetic sequence or a naturally occurring sequence.
- the discriminator includes a one dimensional (ID) convolution layer configured to scan (206) the received sequences for paterns. Max pooling can be used (204) to down-sample the input sequence. This convolution and max pooling process can be iterated as needed.
- the class label (e.g., condition) and compressed output from multiple fully connected layers are output (202) into an output unit.
- a cell type-specific regulatory ' element is required to drive targeted gene expression in the desired cell type of interest.
- a regulatory element can be configured to label one specific cell type, parvalbumin positi ve (PV+) inhibi tory intemeurons.
- PV+ parvalbumin positi ve
- profiles of cell type-specific open chromatin were used for this neuron subtype to train machine learning models that link genome sequence to parvalbumin-specific regulatory activity.
- three gapped k-mer support vector machines were built that discriminate between the comparative regulatory' sequence activity in PV+ vs. PY- neurons, PV+ vs. excitatory neurons, and PV+ vs. vasoactive intestinal peptide-expressing (VIP+) neurons.
- CNNs convolutional neural networks
- All of these models were used to screen PV+ neuron- specific regions of open chromatin for their ability to independently drive cell type- specific gene expression.
- the resulting data 300 are shown in graphs 302, 304, 306, and 308 of FIG. 3 and subsequently described.
- a top candidate is chosen based on the predicted cell type-specificity, its length, and its proximity to cell type-specific genes. That candidate regulatory sequence was cloned into a plasmid vector in which it drives the expression of SunlGFP and the vector was transduced into the mouse brain using AAV-PHP.eB.
- This document also provides methods for using the constructs described herein to label and isolate nuclei and/or cells of a select type.
- the methods can include, for example providing a cSNAIL or SNAIL nucleic acid construct as described herein, introducing the construct into a population of different cell types, and culturing or incubating the cells under conditions which a tagged Sun ! fusion polypeptide encoded by the c SNAIL or SNAIL construct is expressed in the selected cell type (and is not expressed in cells that are not of the selected type), thereby labeling the selected cell type.
- the methods also include introducing a nucleic acid construct encoding a Cre recombinase into the population of different cell types, where the sequence encoding the Cre recombinase is operably linked to a promoter that is specific for the selected cell type.
- the conditions under which the cell population is cultured or incubated permit the Cre recombinase to be expressed in the selected cell type, thus leading to excision of the sequence encoding the tagged Sun 1 fusion polypeptide from its nucleic acid construct and re-insertion of the tagged Sunl fusion polypeptide coding sequence in the correct orientation for expression.
- the population of cells is within a mammal.
- any appropriate method can be used to introduce the SNAIL construct or the cSNAIL and Cre recombinase constructs into a population of cells.
- ‘transformed” and“transfected” encompass the introduction of one or more nucleic acid molecules (e.g., one or more expression vectors) into a cell by any of a number of techniques. Suitable methods for transforming and transfecting host cells can be found, for example, in Sambrook et al., Molecular Cloning: A Laboratory ' Manual (2nd edition), Cold Spring Harbor Laboratory, New York (1989). For example, calcium phosphate precipitation, electroporation, heat shock, lipofection, microinjection, and virus-mediated nucleic acid transfer can be used introduce nucleic acid molecules into cells.
- naked DNA can be delivered directly to cells in vivo (see, e.g., U.S. Patent Nos.
- the isolated nucleic acid molecule transformed into a host cell can be integrated into the genome of the cell or maintained in an episomal state.
- host cells can be stably or transiently transfected with a construct containing an isolated nucleic acid molecule provided herein.
- one or more nucleic acid constructs can be incorporated into virus particles (e.g., AAV or lentivirus particles), and the vims particles can be delivered to cells in order to transfer their nucleic acid contents to the cells.
- a cSNAlL viral probe was injected into PVcre mice, and SunlGFP expression was selectively activated in Cre+ cells due to viral expression of SunlGFP in PV+ neurons (FIGS. IB and 1C). The success of this probe was quantified against the traditional double-transgenic strategy using different fluorophores in the same mouse.
- N 1088 cells
- the efficiency was expected to be substantially less than 100% because it w3 ⁇ 4s limited by viral transduction rates, as AAV PHP.eB reportedly transduces 55-70% of neurons in the cortex (Chan et ah, supra).
- the data for these neuron subtypes were in concordance or more optimistic than tins characterization.
- cSNAIL technology PV+ and PV- were isolated neurons from the mouse cortex, open chromatin assays (Buenrostro et al., Curr. Protoc. Mol. Biol. 109:21.29.1-21.29.9, 2015; and Buenrostro et al., Nat. Methods 10: 1213-1218, 2013) were performed to identify active gene regulatory elements in these populations (FIGS.
- a SNAIL viral probe for nuclei isolation of PV+ neurons also was validated. When a successful candidate sequence is cloned upstream of the modified SunlGFP gene in the virus construct, it can only activate fluorescence expression in cells that can recognize and activate the promoter sequence. Thus, while a SNAIL viral probe will transduce cells indiscriminately, it will only express SunlGFP in the targeted cell population.
- PV+ neuron-specific enhancer candidates To prioritize PV+ neuron-specific enhancer candidates, predictions from the SVM and CNN models were used. Three pairwise classifiers of each type (SVM and CNN) were built to discriminate sequences of open chromatin specific to PV+ versus PV- cell, excitatory neurons (EXC), and vasoactive intestinal peptide-expressing (VIP) neurons.
- the training data for the PV+ vs. PV- models were based on ATAC-seq collected using cS AlL in Pvalb-2A-Cre transgenic mice.
- the training data for the two other models were based on published ATAC-seq conducted with the double-transgenic INTACT method (Mo et al., supra).
- chromosomes 1 and 2 were filtered to remove promoters, because promoters tend to be less cell type-specific than enhancers and may have different sequence properties. Regions that overlapped with super enhancers were also removed, as they are too long for viral constructs and may exhibit unique sequence features. To be able to test for over-fiting of the models, the data were divided by chromosome into separate training (chromosomes 3, 4, 5, 6, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and X), validation (chromosomes 8 and 9), and test sets (chromosomes 1 and 2).
- the SVM models were built using the center weighted gapped k-mer kernel (Ghandi et al., PLoS Comp Bio 10:e 1003711 , 2014; code available at
- Rank58 and Rank72 Two of four viruses were successful at restricting SunlGFP expression to PV+ neurons, hereafter referred to as Rank58 and Rank72 (FIG. 4A). Using affinity purification and ATAC-seq, it also was determined that the Rank58 and Rank72 viruses had chromatin landscapes that were similar to PV+ signatures collected with cSNAIL (FIG. 4B) or single nucleus ATAC-seq (FIG. 4C), indicating shared identity.
- the materials and methods described herein have the striking benefit of strain independence. Because of this, the materials and methods can be used in wild type mice or any organism for winch AAV can be used as a deliver ⁇ ' method. Additionally, they can be used in conjunction with transgenic strains, such as disease models, which generally cannot be interbred with INTACT transgenic mice.
- cSNAIL and SN AIL are wide-ranging.
- cSNAIL viral probes are an immediate alternative to double transgenic mice for cell isolation. These can be used with any existing ceil type-specific Cre mouse strain that researchers may already be using. SNAIL probes provide an extremely powerful tool for cell isolation in any strain of mouse, and potentially other mammals.
- AAV-based ceil type-specific label of parvalbumin positive neurons can be used to therapeutically manipulate this specific neuron population in humans. This particular cell type has been causally linked to schizophrenia, Parkinson's disease, and Alzheimer’s disease. Additionally, AAV-based therapies have shown promise in human subjects.
- the exon-only sequence encoding the N-truncated version of SunlGFP (SEQ ID NO:3), the Rank72 candidate PV specific enhancer (SEQ ID NO:4), the full plasrnid including Rank72 and SunlGFP (SEQ ID NQ:5), and the SunlGFP amino acid sequence (SEQ ID NO:6) were as follows:
- AGJTHGMDELYK SEQ ID NO:6 [residues 2-551 are amino acids 208-757 of the Mus muscuius Sunl transcript variant 5 (GENBANK® Accession No. NM_0012561 18.1), and residues 552-789 (in italics) are the superfolder GFP amino acid sequence]
- Example 2 Cell tvpe-specific oxidative stress genomic signatures in the globus pallidus of dopamine depleted mice
- Neuron subtype dysfunction is a key contributor to the motor deficits observed in dopamine depleted mouse models of Parkinson’s disease.
- GPe external globus pallidus
- PV+ parvalbumin-expressing neurons
- the molecular correlates of GPe PV+ neuron performance after DD remain unknown due to the difficulty of isolating specific neuron subtypes in the brain.
- the cSNAIL viral affinity purification strategy was developed to isolate Cre recombinase- expressing (Cre+) nuclei from the adult mouse brain.
- cSNAIL was used to isolate PV+ neurons from the cortex, striatum, and GPe of 6-hydroxydopamine (6- OHDA) lesioned mice and sham controls.
- 6-hydroxydopamine 6-hydroxydopamine
- the Cre-dependent mechanism was adjusted from a loxp-flanked stop codon to the double inverted orientation (DIO) system.
- DIO double inverted orientation
- the SUN! GFP gene is m the reverse orientation with respect to the promoter such that the gene cannot be expressed.
- Cre Cre recombinase protein
- it acts on the double flanking lox sites to excise the SUN 1 GFP gene and re-insert it in the correct orientation for transcription (FIG. 1A).
- the modified SUN 1 GFP fusion sequence fragment wus synthesized by Integrated DNA Technologies (IDT; Coralville, IA) and contained flanking restriction sites for Sgsl and Bspol.
- the SUN 1 GFP sequence was inserted into an AAV DIO backbone vector with an FT! a promoter using standard restriction cloning pAAV-Efla-DIO-EGFP-WPRE-pA was obtained from Bernardo Sabatim
- the AAV was produced by triple co-transfection of pAA V-
- pUCmini-iCAP-PHP.eB was obtained from Viviana Gradinaru (http://n2t.net/addgene : 103005; RRID: Addgene 103005) (Chan et al., supra). After cell expansion, the AAV particles were precipitated with polyethylene glycol (PEG) and purified with
- the virus was titrated using the AAVpro(R) Titration Kit (Takara, cat #6233), diluted in PBS to a concentration of 8.0 x 10 9 vg/pl, and stored at -80° until injection.
- AAV delivery Mice were anesthetized with isoflutane for 2-5 minutes until breathing slowed and the animal had no pedal reflex. AAV (4 x 10 1u vg) was injected into the retro-orbital cavity. The mice received 0.5% Proparacame Hydrochloride Ophthalmic Solution for comfort and were monitored for physical and behavioral abnormalities post procedure, but no such abnormalities were observed. Tire virus incubated for 21 to 28 days to reach peak expression before downstream experiments.
- tissue for imaging wus preserved by 4% paraformaldehyde (PFA) perfusion.
- PFA paraformaldehyde
- the brains were dissected and incubated overnight at 4°C in 4% PFA. Shortly after, they were sectioned coronaliy with a vibratome at 100 pm for antibody staining and slide mounting.
- cSNAIL specificity FIG. 6B-6D
- primary anti-NeuN Cell Signaling Technology, Danvers, MA; #12943
- secondary Alexaf!uor 405 Invitrogen, Waltham, MA; #A-31556
- Tissues were stained with primary anti-tyrosine hydroxylase (Pelfreez, Rogers, AR; #P40101-150) and secondary Alexafluor 647 (Tnvitrogen, #A-31573) to assess dopamine levels in the striatum. All imaging sections were mounted onto slides using ProLong Diamond Antifade mounting media (Life Technologies Corp., Rockville, MD; #P36961) and imaged with con local microscopy.
- Nuclei collection Fresh mouse brain tissue was sliced on a vibratome in cold, oxygenated artificial cerebrospinal fluid. Brain regions of interest were then dissected under a light microscope and transferred into cold ATAC-seq lysis buffer (Buenrostro et al. 2015, supra). The nuclei were extracted from each tissue using 30 strokes of loose pestle dounce homogenization, followed by 70 pm filtration and one centrifugation wash for 10 minutes at 2000 x g.
- SUN1GFP+ nuclei Affinity Purification of SUN1GFP+ nuclei.
- the nuclei suspension was pre-cleared for 10-15 minutes with Protein G Dynabeads (Thermo Fisher Scientific, Waltham, MA; cat. 10004D) to remove nuclei or debris that had native affinity for the beads.
- Free nuclei were incubated with anti-GFP antibody (Invitrogen, #G10362) for 30 minutes before fresh beads were added to the reaction and incubated for another 20 minutes. All incubations took place at 4°C with 40 rpm end-to-end rotation.
- the bead-bound nuclei (SUN 1GFP+ fraction) were purified and washed on a magnet, while the unbound nuclei were spun down and resuspended in water to preserve the SU 1GFP- fraction.
- RNA-seq library construction After setting aside 50,000 nuclei for ATAC-seq, total RNA was extracted from all remaining nuclei in each sample using the QIAGEN
- RNA 10 pg to 10 ng per sample
- OVATION® SoLo RNA-seq System with mouse AnyDeplete® (T ' ecan, Redwood City, CA; cat. 0501-32) to remove ribosomal RNA. Because many nuclear transcripts are immature, no poly A selection was performed. Libraries were paired-end sequenced at 3-9 million reads per sample on the NEXTSEQTM 500 System (!ilumina, Inc., San Diego, CA).
- RN A -seq processing The sequencing output files were mapped to the mm 1 mouse genome assembly using Hisat2 and sorted. Duplicate UMIs were removed using NiiDup (online at gitlmb.com/tecangenomics/nudup). The quality of the filtered data was assessed using Picard CoileetRnaSeqMetrics (online at broadinstitute.github.io/picard). A counts per gene per sample matrix was constructed using Rsubread featureCounts (Liao and Smyth, Nucleic Acids Res 47:e47, 2019) for input into DESeq2 (Love et al., supra).
- a side qPCR reaction was evaluated for each sample to determine the optimal number of PCR cycles for each sample to reach 1/3 maximum intensity.
- the samples were pooled and paired-end sequenced on a Novaseq 6000 (Alumina) to about 25 million unique, non-mitochondrial reads per sample.
- the UMI count values were normalized using pooled size factor normalization (Lun et al., Genome Biol 17:75, 2016) implemented in the Scran package (Lun et al., FI 000 Res 5:2122, 2016). Size factor normalization requires a preclustering step which was computed using the Scanpy (Wolf et al ., Genome Biol 19: 15, 2018) package’s Leiden community detection algorithm (Traag et al., Sci Rep 9:5233, 2018). To create the l MA P (Meinnes et al., arXiv 1802.03426, 2018) for visualization the Scanpy package was also used. Principle components were computed on the top 7500 most variable genes. The UMAP was then computed based on the PCA reduced single nucleus gene expression matrix.
- the hypergeometric enrichment test was used, sampling cell type-specific cSNAIL peaks in each brain region from an expected frequency of cluster-specific snATAC-seq peaks. Only the set of peaks present in both data (112,082) were evaluated. For simplicity, cluster-specific peaks from all excitatory neuron clusters were combined into one category'.
- the hypergeometric test enrichments were converted into a z-score for each cSNAIL cell population and plotted using gplots heatmap.2 m R (online at github.com/talgalili/gplots). Annotation enrichments were assessed in differentia] gene sets using g:Profiler (FIG. 8C) (Peterson et al, supra).
- DD- affected ATAC-seq peak sets were subjected to pathway enrichment analysis using GREAT version 3.0.0 (McLean et al., Nat Biotechnol 28:495-501, 2010) and motif enrichment using AME as described above.
- cSNAIL isolates Cre ⁇ nuclei with high precision.
- cSNA!L technology is a viral strategy for labeling and isolating the nuclei of Cre-expressing cells.
- the cSNAIL viral genome expresses a nuclear envelope anchored GFP fusion protein a Cre-dependent manner.
- SIJN1 is a highly conserved nuclear envelope protein that helps connect the nucleoskeleton and the cytoskeieton (Haque et al., supra).
- the SUN 1 GFP fusion protein localizes the GFP protein on the nuclear surface. This positioning allows for affini ty purification of nuclei, whereby after tissue is homogenized into a single-nuclei suspension, magnetic beads coated with anti-GFP antibody specifically bind SUN1GFP+ nuclei, thus separating them from SUN1GFP- nuclei.
- INTACT mouse transgene design described above to package the cSNAIL SUN1GFP vector into AAV variant PHP.eB, which is capable of crossing the blood brain barrier to broadly transduce many cells in the central nervous system (Chan et al ., supra).
- cSNAIL The ability of cSNAIL to drive Cre-specific nuclear anchored independent labeling in Pvalb-2 A-Cre mouse lines was evaluated using imaging and molecular data (FIGS. 6A-6C and 7A-7C). Fluorescent imaging confirmed that cSNAIL promoted SUNTGFP expression that was properly localized to the nuclear envelope in tissue (FIG. 6A). The expression was sufficient to bind anti-GFP coated magnetic beads after tissue dissociation (FIG. 6B). To quantify the ability ' of cSNAIL to correctly target Cre+ cells, the expression of cSNAIL was compared to the expression of Cre reporter tdTomato of the Ail4 mouse strain (FIG. 6C).
- virus specificity was defined as the percent of SUNTGFP+ ceils that also expressed tdTomato
- virus efficiency was defined as the percent of tdTomato+ cells that also expressed SUN 1 GFP.
- cSNAIL exhibited very strong (>94%) specificity in the cortex, striatum, and GPe. The efficiency ranged from 53% to 81%, reflecting the expected transduction of the viral capsid in these brain regions (Chan et al., supra).
- affinity purification bead-bound nuclei and free nuclei were counted using a manual hemocytometer on a fluorescent microscope to determine the purity and yield of cSNAIL nuclei isolation. Of the nuclei bound to beads, 97.18% had observable
- cSNAIL SUN1GFP+ and cSNAIL SUN1GFP- gene expression signatures were defined in the cortex.
- snRNA-seq cells were then assessed for similar expression patterns by scoring their expression of the cSNAIL SUN 1GFP+ gene signature (FIGS. 7C, 13A, and 13B).
- the SUN 1GFP+ scores were computed by averaging across the scaled (0 mean centered, unit variance) expression of signature genes across all cells. As expected, cells in the PV+ intemeuron cluster (circled in FIG.
- the PV+ marker genes Coro6, Flt3, and Cacna2d2 also tended to be restricted to PV+ clusters in Drop Viz snRNA-seq from the mouse cortex, striatum, and globus pallidus, although Cacna2d2 also was prevalent in Chat neurons (FIG. 14 A) (Saunders et al, Cell 174: 1015- 1030. e!6, 2018) This further demonstrated that cSNAIL enrichment for PV+ neurons was generalized to brain regions outside the cortex. PV- gene expression signatures that were consistent across all three brain regions appeared to be dominated by glial cells, especially oligodendrocytes (e.g , Hepacam and Kcnj 10) (FIG. 14B).
- OHDA lesioned animals had significantly lower levels of dopamine production enzyme tyrosine hydroxylase than sham animals, indicating successful depletions (FIGS. 11A- IIB). All depletions were bilateral except in one animal, DD2, where one hemisphere was only weakly depleted. The RNA-seq data was high quality for all samples except one striatum PV- sample from a DD animal, winch was excluded from the analysis. Samples were separated by tissue and cell type in PCA and hierarchical clustering, indicating higher variability between cell types than between biological replicates (FIGS. 15A and 15B).
- DD-seq data from DD and sham animals very few significant DD- affected genes were recovered in any cortical cell types, striatal cell types, or the GPe PV- population.
- GPe PV+ neurons contained 29 differentially expressed genes in DD (p a j ⁇ 0.05) (FIGS. 9 A and 9B). It was readily apparent that there were many genes involved in cellular oxygen homeostasis and neuroprotection among the fourteen genes that were upregulated in the GPe PV+ neurons of DD animals.
- Epasl which encodes for Hypoxia-inducible factor 2 alpha (transcription factor Hif2a), and three of its targets: Cp, Slc2al, and Fit I (Schofield and Ratcliffe, Nat Rev Mol 5:343-354,
- the downregulated set also included Elob, a moderator of free oxygen sensing that inhibits Hif2a (Ohh et ah, Nat Cell Biol 2:423-427, 2000). These results suggested that GPe PV+ neurons may react to DD through hypoxia- inducible factor (HIT) signaling and associated transcriptional response.
- HIT hypoxia- inducible factor
- Timp3 a key inhibitor of matrix metalloproteinases that contribute to dopaminergic neuron apoptosis in PD (Kim et al., FASEB .721 : 179-187, 2007), was observed. Timp3 expression in neurons is protective against blood-brain barrier damage, but high levels of Timp3 can lead to cell death (Rosenberg, Lancet
- Lpcat3 a gene found to have reduced expression in GPe PV+ neurons upon DD, is necessary for ferroptosis, which has been linked to
- HIF-related transcripts Due to the increased expression of HIF-related transcripts in GPe PV+ neurons in DD, it was hypothesized that changing open chromatin regions in this cell type would contain H1F transcription factor binding motif sites. Upon acti vation, Hifa subunits heterodimerize with Hifb and the complex binds regulatory elements in the genome to affect transcription. Therefore, a motif enrichment analysis was conducted for four HIF family motifs with Fisher’s exact test statistics.
- DD-affected open chromatin regions in other cell types contained enrichments for several additional transcription factor binding motifs. Notably, DD-increasing peak sets in every cell population except for GPe PV+ were all enriched for the binding motifs of glucocorticoid receptor transcription factors Nr3cl , Nr3c2, and Ar (p adj ⁇ 0.01).
- Glucocorticoid receptors are emerging as key regulators of neuroinflammation and disruption of their proper regulation is thought to play a role in the onset of PD by allowing the infiltration of eytotoxins in the SNpc (Herrero et al., Front Neuroamt 9: 1- 12, 2015). These findings were consistent with similar stressors in the cortex, striatum, and GPe, which may contribute to the progression of PD.
Landscapes
- Engineering & Computer Science (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Physics & Mathematics (AREA)
- Theoretical Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Software Systems (AREA)
- General Physics & Mathematics (AREA)
- Evolutionary Computation (AREA)
- Mathematical Physics (AREA)
- Data Mining & Analysis (AREA)
- Computing Systems (AREA)
- Artificial Intelligence (AREA)
- Zoology (AREA)
- Computational Linguistics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Virology (AREA)
- Microbiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Medicinal Chemistry (AREA)
- Plant Pathology (AREA)
- Medical Informatics (AREA)
- Computer Vision & Pattern Recognition (AREA)
- Probability & Statistics with Applications (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Analytical Chemistry (AREA)
Abstract
Materials and methods for labeling and isolating particular cell types from mixed cell populations are provided herein. Also provided herein are methods for generating data representing a synthetic genetic sequence configured for labeling at least one cell type by causing expression of a marker in the at least one cell type.
Description
SPECIFIC NUCLEAR-ANCHORED INDEPENDENT LABELING SYSTEM
CROSS-REFERENCE TO RELATED APPLICATIONS
This application claims benefit of priority from U.S. Provisional Application Serial No 62/921,452, filed June 18, 2019. The disclosure of the prior application is considered part of (and is incorporated by reference in) the disclosure of this application.
TECHNICAL FIELD
This document relates to materials and methods for labeling and subsequently isolating particular cell types from mixed cell populations.
BACKGROUND
The brain and other tissues consist of heterogeneous populations of cells with specialized properties and functions. Genetically and epigenetically distinguishable cell types are likely to play different roles and exhibit different responses in disease and other conditions. The vast majority of genomic assays, however, are conducted on bulk tissue and not individual cell types, making the results of such assays difficult to interpret and disentangle for cell type-specific mechanisms. Improved techniques for nuclei labeling and isolation are needed to solve this problem .
SUMMARY
This document is based, at least in part, on the development of compositions and methods for labeling and isolating specific populations of cells. The methods are referred to herein as SNAIL (Specific uclear- Anchored Independent Labeling) and cSNAIL (Cre-Specific Nuclear-Anchored Independent Labeling). cSNAIL and SNAIL provide improvements over current methods for nuclear isolation methods, as they are easier, more time-efficient, and more cost-effective, without any loss of selection. Moreover, cSNAIL and SNAIL have the added benefits of being compatible with multiplexing and other transgenic models, extending to new cell types, and being transferrable across species. The availability of this technology increases the practicality of cell type-specific genomics, and allow's these approaches to be used in other mammals, including humans.
In a first aspect, this document features a nucleic acid construct containing (a) a sequence encoding a tagged Sunl fusion polypeptide, where the tagged Sunl fusion
polypeptide comprises, consists of, or consists essentially of (i) an N -truncated fragment of a Sun 1 gene, where the fragment encodes at least a portion of a portion of a Sun ! protein, and where the portion of the Sunl protein is 400 to 600 amino acids in length, and (ii) a sequence encoding a tag polypeptide, and (b) a promoter sequence specific for a selected cell type, where the promoter sequence is operably linked to the sequence encoding the tagged Sunl fusion polypeptide, and is effective to drive expression of the sequence encoding the tagged Sunl fusion polypeptide in the selected cell type. (By “consists essentially of’ is meant that a nucleic acid or a polypeptide contains specified components, and can contain additional sequences that do not materially affect the basic and novel characteristics of the nucleic acid or polypeptide.) The N-truncated fragment of the Sunl gene can encode a polypeptide with at least 95% sequence identity to amino acids 208-757 of the mouse Sunl protein having the amino acid sequence set forth m SEQ ID NO: 1. The tag polypeptide can be a fluorescent polypeptide (e.g., a green fluorescent protein (GFP), such as a GFP with an ammo acid sequence that at least 95% identical to the superfolder GFP sequence set forth in SEQ ID NO:2) The construct can further include virus sequences (e.g., adeno-associated virus (AAV) sequences or lenti virus sequences) ’lire promoter sequence can be specific for parvalbumin positive (PV+) neurons, such the sequence encoding the tagged Sun l fusion polypeptide is expressed in PV+ neurons but not expressed in at least 90% of parvalbumin negative (PV- ) neurons.
In another aspect, this document features a nucleic acid construct containing (a) a sequence encoding a tagged Sun l fusion polypeptide, where the tagged Sun! fusion polypeptide comprises, consists of, or consists essentially of (i) an N-truncated fragment of a Sunl gene, where the fragment encodes a portion of a Siml protein, and where the portion of the Sunl protein is 400 to 600 amino acids in length, and (ii) a sequence encoding a tag polypeptide, (b) a first lox sequence flanking the 5' end of the sequence encoding the tagged Sunl fusion polypeptide and a second lox sequence flanking the 3' end of the sequence encoding the tagged Sunt fusion polypeptide, and (c) a promoter sequence downstream of the lox sequence flanking the 3' end of the sequence encoding the tagged Sunl fusion polypeptide, such that the sequence encoding the tagged Sunl fusion polypeptide is in reverse orientation with respect to the promoter. The N-truncated fragment of the Sunl gene can encode a polypeptide with at least 95% sequence identity to amino acids 208-757 of the mouse Sunl protein having the amino acid sequence set
forth in SEQ ID NO: 1. The tag polypeptide can be a fluorescent polypeptide (e.g., a GFP, such as a GFP having an amino acid sequence that is at least 95% identical to the superfolder GFP sequence set forth in SEQ ID NO:2). The construct can further include virus sequences (e.g., AAV sequences or lentivirus sequences).
This document also features virus particles (e.g., AAV or lentivirus particles) containing one or more nucleic acid constructs as described herein.
In another aspect, this document features a method for labeling a selected cell type within a population of different cell types, where the method includes introducing into the population of different cell types a nucleic acid construct containing (a) a sequence encoding a tagged Sun! fusion polypeptide, where the tagged Sunl fusion polypeptide comprises, consists of, or consists essentially of (i) an N-truncated fragment of a Sunl gene, where the fragment encodes at least a portion of a portion of a Sun 1 protein, and where the portion of the Sunl protein is 400 to 600 amino acids in length, and (ii) a sequence encoding a tag polypeptide, and (b) a promoter sequence specific for a selected cel! type, where the promoter sequence is operab!y linked to the sequence encoding the tagged Sunl fusion polypeptide, and is effective to drive expression of the sequence encoding the tagged Sunl fusion polypeptide in the selected cell type, and wherein the tagged Sunl fusion polypeptide is expressed in and thereby labels the selected cell type. Tire N-truncated fragment of the Sunl gene can encode a polypeptide with at least 95% sequence identity to amino acids 208-757 of the mouse Sunl protein having the amino acid sequence set forth in SEQ ID NO: ! . The tag polypeptide can be a fluorescent polypeptide (e.g., a GFP, such as a GFP having an amino acid sequence that is at least 95% identical to the superfolder GFP sequence set forth in SEQ ID NO:2). The construct can further include virus sequences (e.g., AAV sequences or lentivirus sequences). The promoter sequence can be specific for PV+ neurons, such that the sequence encoding the tagged Sunl fusion polypeptide is expressed in PV+ neurons but not expressed in at least 90% of PV- neurons.
In another aspect, this document features a method for labeling a selected cell type within a population of different ceil types, where the method includes (a) introducing into the population of different cell types (i) a first nucleic acid construct containing (1 ) a sequence encoding a tagged Sunl fusion polypeptide and (2) a sequence encoding a tag polypeptide, where the tagged Sunl fusion polypeptide comprises, consists of, or consists essentially of an N-truncated fragment of a Sunl gene, where the fragment encodes a
portion of a Sunl protein, and wherein the portion of the Sunl protein is 400 to 600 amino acids in length, and (2) a first lox sequence flanking the 5' end of the sequence encoding tire tagged Sunl fusion polypeptide and a second lox sequence flanking the 3' end of the sequence encoding the tagged Sunl fusion polypeptide, and (3) a promoter sequence downstream of the lox sequence flanking the 3 ' end of the sequence encoding the tagged Sunl fusion polypeptide, such that the sequence encoding the tagged Sun l fusion polypeptide is in reverse orientation with respect to the promoter, and (ii) a second nucleic acid construct comprising a sequence encoding a Cre recombinase operab!y linked to a promoter sequence specific for the selected cell type, and (b) incubating the population of different cell types under conditions in which the Cre recombinase is expressed in the selected cell type, where the expressed Cre recombinase excises the sequence encoding the tagged Sun ! fusion polypeptide from the nucleic acid construct and irreversibly re-inserts the sequence encoding the tagged Sunl fusion polypeptide in the correct orientation for expression in the selected cell type. The N -truncated fragment of the Sunl gene can encode a polypeptide with at least 95% sequence identity to amino acids 208-757 of the mouse Sunl protein having the amino acid sequence set forth in SEQ ID NO: 1. The tag polypeptide can be a fluorescent polypeptide (e.g., a GFP, such as a GFP having an amino acid sequence that is at least 95% identical to the superfolder GFP sequence set forth in SEQ ID NO: 2) The construct can further include virus sequences (e.g., AAV sequences or lenti virus sequences).
In still another aspect, this document features a method for generating, by a data processing system, data representing a synthetic genetic sequence configured for labeling at least one cell type by causing expression of a marker in the at least one cell type. The method can include: receiving training data associating at least one feature of a genetic sequence of the at least one cell type with expression of a hallmark of the at least one cell type; training, based on the training data, a model configured to generate data representing a synthetic genetic sequence; receiving input data comprising the at least one feature; and generating the synthetic genetic sequence in response to receiving the input data comprising the at least one feature. The model can include a generative adversarial network (GAN). The GAN can be a deep convolutional GAN (DCGAN). The GAN can include: a generator network configured to receive latent random noise data as the input data and generate the synthetic genetic sequence; and a discriminator network configured to generate a probability value representing whether the input sequence is drawn from the
synthetic genetic sequence from the generator network or from a distribution of natural genetic sequences. The method can include training the generator network and the discriminator network of the GAN by alternating tire input data between synthetic sequence derived from the latent noise data input to die generator network and natural genetic sequence data. The method can include: receiving input data representing endogenous genomic sequences underlying previously profiled open chromatin regions of at least two cell types: and updating the discriminator network for distinguishing between the at least two cell types. The at least two cell types can include parva!humin positive (PV+) and pan albumin negative (PV-) neurons, where the discriminator network is configured to distinguish between the PV+ and PV- neurons based on the input data. The method can include optimizing a feature of the synthetic genetic sequence by applying a class label to both the generator network and the discriminator network. The class label can be configured to force a first probability value for a first input type and a second probability value for a second input type that is different from the first input type. The feature can represent an enhancer of an activity in a cell type. Tire method can further include generating a nucleic acid sequence comprising the synthetic genetic sequence.
The nucleic acid sequence can include the synthetic genetic sequence operabiy linked to a nucleotide sequence encoding a marker (e.g., a tagged Sun! fusion polypeptide). The nucleic acid sequence can further include a virus nucleic acid sequence (e.g., an AAV or lentivirus sequence). The method can include: receiving results data representing a delivery' of a nucleic acid including the synthetic genetic sequence to an organism, the results data representing a successful l abeling of the at least one cell type or an unsuccessful labeling of the at least one cell type; updating the model using the results data: and generating an updated synthetic genetic sequence based on the updated model. The method can further include: receiving training data including the hallmark representing marker positive results marker negative results, or both; extracting at least one feature corresponding to the marker positive result or to the marker negative result; and adding the at least one feature to the model. The at least one feature can be a set of k-mer or gapped k-mer counts, and wherein extracting the at least one feature comprises scanning the sequence to determine the set of k-mer counts that form the sequence. The model can include a support vector machine that includes: a feature space; and a support vector representing a classification border in the feature space, where the method includes adding, to the support vector of the support vector machine, a given set
of k-mer counts within a predefined distance of the classification border in the feature space of the support vector machine. The model can include a neural network. The neural network can be a convolutional neural network. The neural network can include one or more weight values each associated with a feature of the synthetic genetic sequence. The feature can include a set of k-mer counts of the genetic sequence. The feature can represent a transcription factor binding motif. The synthetic genetic sequence can be configured to distinguish between pan albumin positive (PV+) and parvalbumin negati ve (PV-) neurons; PV+ and excitatory (EXC) neurons; or PV+ and vasoactive intestinal peptide-expressing (VIP+) neurons.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Although methods and materials similar or equivalent to those described herein can be used to practice the invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims.
DESCRIPTION OF DRAWINGS
FIGS. 1A-1D demonstrate validation of the cSNAIL probe system in a non limiting example of a neuron subtype in mice, with imaging and molecular data. FIG. IA is a schematic of the Cre -dependent mechanism of the c SNAIL viral probe. The Sun!GFP coding sequence between the LoxP sites is expressed in the presence of Cre (left), but not in the absence of Cre (right). FIGS. IB and 1C are images of brain tissue (Ml region) from a PVcre/ail4 mouse injected with the cSNATL Sun !GFP virus. Viral labeling was indicated by green fluorescent protein (GFP), in direct comparison with transgenically labeled Cre (PV+) cells (originally in red). FIG. ID is an image showing nuclei in suspension after brain tissue homogenization. Nuclei were stained blue with 4', 6- diamidino-2-phenylindole (DAPI) stain, and virally tagged PV+ nuclei were co-labeled
with GFP. The GFP+ cells adhered to magnetic heads (straight arrow), while GFP- ceils did not (curved arrows), allowing for separation of the two groups FIGS, IE and I F are schematics showing that when compared with the INTACT (Isolation of Nuclei TAgged in Specific Cell Types) method, Assay for Transposase-Accessible Chromatin (ATAC- seq) data from cSNAIL probes yielded similar cell type-specific open chromatin profiles.
FIG, 2A is a flow diagram of a process for generating synthetic enhancers by a machine learning model
FIG. 2B is a schematic of a conditional generative adversarial network (GAN) for generating synthetic enhancers to label cell types using SNAIL.
FIG. 3 is a series of graphs plotting the performance of gapped k-rner support vector machine (SVM) and convolutional neural network (CNN) models on predicting cell type-specific regulatory activity of genomic sequences in PV+ neurons relative to PV- neurons, excitatory neurons, and VIP+ neurons.
FIG. 4A is a set of images showing validation of two SNAIL probes for parva!bumin positive neurons, alongside a non-specific control virus. The images show Sun 1 GFP labeled cells and parvalbumin-immunoreactive neurons (Swant PV27/Alexa Fluor 594) within mouse cortical tissue. The scale bars measure 100 pm. FIGS. 4B and 4C show that open chromatin signatures derived from SNAIL-isolated PV+ ceils recapitulate known PV+ features from cSNAIL and single nucleus ATAC-seq data. FIG 4C depicts hypergeometric enrichment significance of the overlap between cell type- specific SNAIL open chromatin regions and cluster-specific snATAC-seq open chromatin regions (data from data.nemoarchive.org/
biccn/assay/chromatin/cemba/scell/processed/analysis/EckerRen Mouse MOp methylati on_ATAC/).
FIG. 5A is a schematic depicting the structure of the pAAV-Efla-DIO- SUN 1 GFP-WPRE-p A construct. FIGS. 5B and 5C depict the structures of two PV SNAIL pAAV constructs.
FIGS. 6A-6C show that cSNAIL targets Cre+ nuclei with high precision. FIG.
6A is an image showing that SUN1GFP expression from cSNAIL correctly localized to the nuclear envelope in tissue. Specifically, SUN 1 GFP (yielding green fluorescence) from cSNAIL was expressed in a Cre+ cell in cortical tissue from a Pvalb-2A-Cre/Ail4 mouse that expresses tdTomato as a reporter of Cre (yielding magenta fluorescence). FIG. 6B is an image showing that SUN1GFP expression from cSNAIL was sufficient to bind anti-
GFP-coated magnetic beads for affinity purification. FIG. 6C is a series of images showing that SUN1GFP expression from cSNAIL was restricted to Cre+ ceils in the cortex, striatum, and GPe. These images show SUN1GFP expression from cSNAIL in a Pvaib-2A-Cre/Ail4 mouse. The tissue slices were also stained for NeuN, a pan-neuronal marker with blue fluorescence. cSNAIL virus specificity and efficiency within each brain region are indicated below the images. Standard errors were calculated across four independent images. The total SUN 1GFP+ and/or Cre+ cells in the analysis were cortex N = 1088 cells, striatum N = 107 cells, and GPe N = 773 cells. The expected neuron transduction metrics were reported elsewhere (Chan et ah, Nat. Neurosci. 20: 1172-1 179, 2017). ND ::= no data.
FIGS. 7A-7C show that cSNAIL-isoiated nuclei from Pvalb-2A-Cre mice recapitulate PV+ transcriptomic and epigenomic signals from external data. FIG. 7 A is a genome browser visualization of ATAC-seq and RNA-seq signal at the Pvalb locus from pooled p-value tracks. cSNAIL data is labeled in black and is compared with publicly available data (Mo et ai.. Neuron 86: 1369-1384, 2015) labeled in grey. FIG. 7B shows enrichment of mouse cortical snATAC-seq cluster markers (LFC > 0.25 and p < 0.05 relative to all other clusters) within cell type-specific ATAC-seq peaks in the data by the hypergeometric test (data and method from Signac vignette, available online at grthub.com/timoast/signac). FIG. 7C shows expression of cortical cSNAIL PV+ gene signatures per cell of external mouse cortex snRNA-seq (data from
portal . nemoarchive . org) .
FIGS. 8A-8F show molecular signatures of PV+ neurons across brain regions. FIG. 8A shows the numbers of differentially expressed genes (DESeq2 pad· < 0.01 and iLFCj > 1) between cSNAIL-isoiated PV+ and PV- fractions from the cortex, striatum, and GPe of sham animals. FIG. 8B shows normalized read counts from example marker transcripts in each sample. DESeq2 normalized counts were converted to the proportion that they represent of the total read count for that transcript within the given brain region. FIG. 8C show's representative pathway enrichments for pan-PV+ and pan-PV- marker genes by g:Profiler (Peterson et al., Nucleic Acids Res 47:W191 -W198, 2019). The size of the bubble represents the negative log of the adjusted p-value after multiple hypotheses correction. FIG. 8D shows the numbers of cell type-enriched ATAC-seq peaks (p3.dj <
0.01 and jLFCj > 1) in PV+ populations from each brain region. FIG. 8E show's DESeq2 normalized counts of ATAC-seq reads within 5kb of tire transcription start site of marker
genes. Again, counts were normalized to the total counts for that transcript in the cortex, striatum, or GPe. FIG. 8F shows examples of motifs enriched in PV+ specific or PV- specific ATAC-seq peaks relative to all peaks in that cell type by AME (McLeay and Bailey, BMC Bioinformatics 11 : 165, 2010). Each brain region was assessed separately, and these motifs were significantly enriched in PV+ or PV- sequences across all brain regions.
FIGS. 9A-9D show that di vergent gene expression in dopamine depleted mice is largely restricted to GPe PV+ neurons and implicates the HIF pathway. FIG. 9A is a table showing the numbers of genes that have differential expression with dopamine depletion (DD) in each cell type. FIG. 9B. is a volcano plot of DD-affected genes in GPe PV+ neurons. Genes meeting the significance threshold of padj < 0.05 (above the dotted line) are listed in order of significance. FIG. 9C shows that DD is associated with a specific increase in Hi£2a (Epasl) transcription and its target genes in GPe PV+ neurons. The animals are referred to as SI and S2 for sham animals and DD1-4 for 6-QHDA treated animals in order of depletion severity. FIG. 9D is a graph plotting the proportion of GPe PV+ cells that express Hif2a protein, demonstrating that there was a significant increase between the images from healthy tissue and DD tissue (t-test).
FIGS. 10A-10G show that open chromatin changes associated with DD showed cell type-specific HIF motif enrichment. FIG. 1QA is a table showing the numbers of ATAC-seq regions in each cell type that were differentially open in DD animals compared to sham animals in a categorical analysis. FIG. 1QB shows HIF family transcription factor binding motifs as defined in j AS PAR 2018 (Khan et al.. Nucleic Acids Res 46:260-266, 2018). FIG. IOC is a series of graphs plotting cell type-specific HIF family motif enrichments among sets of sequences underlying ATAC-seq peak summits that increase in accessibility in DD animals.
FIGS. 11A-11B show the quantification of dopamine depletion per hemisphere. FIG. HA is a graph plotting tire levels of striatal tyrosine hydroxylase for each hemisphere of four 6-QHDA lesioned animals and two sham animals. Hie p-values reflect a significant difference in populations by the standard t-test. FIG. 11B includes examples of the quantified images, indicated by the arrows in FIG. 11 A.
FIGS. 12A-12D show that the ATAC-seq data w¾s high quality. FIGS. 12A and
12B show that ATAC-seq samples tended to cluster with other samples of the same tissue and cell type by principal component analysis and hierarchical clustering of genome-wide
open chromatin profiling FIG. 12G is a graph demonstrating that the data exhibited the characteristic periodicity in fragment length distributions of high quality ATAC-seq data, reflecting nucleosome positioning. The plot shown is a representative example from one GPe PV+ sample. FIG. 12D shows that the ATAC-seq signal was enriched at the transcription start sites (TSS), indicati ve of high signal -to-noise. The displayed data are a representative example from one GPe PV+ sample.
FIGS. 13A and 13B show additional properties of the mouse cortex snRNA-seq data. FIG. 13A shows cluster annotations per cell of the snRNA-seq data with UMAP embedding. FIG. 13B shows that Pvalb gene expression is highest within the Pvalb intemeuron cluster (circled).
FIGS. 14A and 14B show that PV+ and PV- marker genes from cSNAIL were expressed in relevant cell clusters from scRNA-seq. DropViz was used to define scRNA- seq clusters in the frontal cortex, striatum, and globus pallidus. Per cell expression of each indicated gene is shown by the size of the points. Where meta-cell expression of a gene was greater than 70% of the maximum expression in that meta-cell, the cluster is labeled by its cluster number
FIGS. 15A and 15B show RNA-seq sample similarities FIG. 15A is a graph showing that the first two principal components separated samples by brain region and cell type. FIG. 15B shows that in hierarchical clustering, samples mainly clustered by brain region and then cell type.
FIG. 16 is a series of images showing that w ith dopamine depletion, the proportion of GPe PV+ neurons that express HifZa protein increases. Example images from healthy and DD GPe tissue are shown. Some instances of PV+Hif2a- cells are highlighted by white arrow's. The scale bars measure IOOmhi.
FIG. 17 shows the overlap between DD-affected ATAC-seq peaks of different cell types. The width of each outer segment of the circle shows how many DD-affected peaks were recovered in that cell type. Bidirectional arcs between two cell types signify shared DD-affected peaks where tire width of the connection represents the number of shared peaks. The data were plotted with circlize (Gu et al, Bioinformatics 30:281 1-2812, 2014).
FIG. 18 is a summary of enriched annotations in DD-affected ATAC-seq peak sets. Enrichments were determined using GREAT for each differential set of peaks against a background of all peaks in that cell type. Die arrow of a term indicates that it
was enriched in DD-inereasing peaks (up arrow) or DD-decreasing peaks (down arrow)
FIG, 19 is a graph plotting TSS accessibility trends with differential gene expression in GPe PV+ neurons (t-test).
DETAILED DESCRIPTION
Genomic assays of specific cell types first require identifying and separating the cells of interest from the rest of the tissue. In brain tissue, for example, this can be especially difficult due to the high diversity of cell types that are tightly packed together and connected with long, fragile projections. In the adult brain, it is impractical to separate whole cells in sufficient quantities because these projections can break off, spilling their contents into the media. Instead, researchers have turned to sorting the nuclei of cell types of interest. One method for isolation of nuclei without using fixatives (which are incompatible with some genomic assays) is the INTACT method (Mo et ah, supra), which requires a double transgenic mouse. The first transgene expresses Cre recombinase in a cell type-specific manner, and the second expresses the SunlGFP fusion protein only in the presence of Cre recombinase. An INTACT mouse therefore expresses SunlGFP exclusively in the ceils of interest.
Sun ! is a mammalian nuclear envelope protein that can serve as a robust tool for cell labeling and isolation from homogenized tissues, due to its localization. The Sun! coding sequence can be fused with sequences encoding two copies of super-folder GFP, which reliably folds into the correct conformation even in protein fusions. The result of SunlGFP expression is GFP that is tightly anchored to the nuclear envelope. Tissue (e.g., brain tissue) from transgenic mice expressing SunlGFP in one or more particular cell types (e.g., particular neuron types) can be homogenized into a suspension of single nuclei, and GFP+ nuclei can be separated from GFP- nuclei using affinity purification in which magnetic beads coated with an anti-GFP antibody bind GFP+ nuclei, but not GFP- nuclei. The beads with GFP+ nuclei can then be pulled aw'ay from the GFP- nuclei with a magnet and used for further studies.
The INTACT method has been instrumental for studying specific subsets of neurons in isolation. Its reliance on double transgenic mice has limited its use, however, because transgenic breeding can be highly variable and resource-intensive, and because transgenic strains are often only feasible for cell types that can be characterized by a single marker locus, leaving many populations inaccessible. The current technology is
limited mainly to the laboratory Mus musculus species, and the difficult nature of creating new transgenic organisms means that it is impractical to extend the framework to non model organisms. In addition, multiple transgenic breeding makes it problematic to use cell type-specific mouse lines conjunction with other transgenic traits, including disease models or strains that label an additional cell population of interest.
As described herein, viral delivery of cell type-specific labels can provide much more flexibility across cell types and species, as compared to transgene expression. In general, the SNAIL and cSNAIL materials and methods provided herein utilize an affinity purification strategy that is similar to the INTACT method for
immunopurification of nuclei, but without the need for double transgenic animals. In some eases, instead of transgenesis, viruses can be used to deliver a simple, compact labeling gene that is sufficient to achieve success. When this non-limiting embodiment is paired with a virus e.g., Adeno-associated vims (AAV) or lentivirus] deliver}' method, the probes can be introduced into any appropriate mammals (e.g., mice, rats, sheep, pigs, dogs, or non-human primates) through intravenous injection, direct injection into the brain, or any other appropriate method. This delivery procedure is a much more time and resource-efficient way to tag cell populations when compared with the intricacies of transgenic breeding. The method also drastically minimizes the number of collateral animals that are bred for an experiment but cannot be used due to undesirable genotypes.
The probes provided herein include, for example, Cre-dependent (cSNAIL) viral probes that are immediately compatible with existing strains of Cre transgenic mice, as well as Cre -independent (SNAIL) viral probes, which are developed individually for different cell types and, as described more fully below, accomplish complete
independence from animal strain. Both probe types contain a newly designed sequence that includes an N-truncated exon-only version of the SunlGFP fusion protein. This sequence is 1/16m the size of the INTACT sequence (2,367 bp), and was sufficient to achieve successful nuclear envelope GFP labeling for affinity purification even in vivo (e.g., in the brain), which was rather surprising. The smaller size enables much more flexibility in gene deliver}', including compatibility with AAV virus.
The cell type specificity of the cSNAIL viral probe is conferred through its dependence on DNA rearrangement by Cre recombinase (FIG, lA), which is only present in certain cells. Specifically, a double-floxed inverted orientation (DIO) system (Atasoy et ah, J. Neurosci. 28:7025-7030, 2008) is used, in which the Sun lGFP sequence is
delivered in the reverse orientation, such that it cannot be transcribed. When the DNA encounters Cre recombinase protein, Cre can excise the Sun lGFP sequence and irreversibly re-insert it in the correct orientation for expression. This system is more tightly regulated than the lox-flanked stop codon system that is used to confer Cre dependence in the INTACT transgenic mouse strain (Atasoy et al., supra).
For SNAIL viral probes, a cell type-specific regulatory' element is required to drive targeted gene expression in the desired cell type of interest. As described in the Examples below, a regulatory element was designed to label one specific cell type - parvalbumin positive (PV+) inhibitory' intemeurons - using in silica screening. Profiles of cell type-specific open chromatin were used for this neuron subtype to train machine learning models that link genome sequence to parva!bumin-speeific regulatory activity'. In particular, three gapped k-mer support vector machines were built to discriminate between the comparative regulatory sequence activity in PV+ vs. PV- neurons, PV+ vs. excitatory neurons, and PV+ vs. vasoactive intestinal peptide-expressing (UΊR+) neurons. In addition to gapped k-mer support vector machines, another example embodiment trained similar convolutional neural networks (CNNs), which are the state-of-the-art model for relating raw genomic sequence to regulatory function. All of these models were used to screen PV+ neuron-specific regions of open chromatin for their ability to independently drive cell type-specific gene expression. A top candidate was chosen based on the predicted cell type-specificity, its length, and its proximity to cell type-specific genes. That candidate regulatory' sequence was cloned into a plasmid vector in which it could drive the expression of SunlGFP, and the vector was transduced into the mouse brain using AAV-PHP.eB (Chan et al., Nat. Neurosci. 20: 1172-1179, 2017).
This document provides nucleic acid constructs that contain sequences encoding fusion polypeptides that include a Sun! portion and a tag portion. The Sunl portion enables the fusion polypeptide to localize to the nuclear membrane, while the tag portion enables cells and/or nuclei containing the expressed fusion polypeptide to be identified and isolated away from ceils and/or nuclei that do not express the fusion polypeptide. The nucleic acids provided herein can further include other sequences, such as sequences to control expression of the fusion polypeptide (e.g., sequences to promote expression in particular types of cells, and/or sequences to prevent expression unless Cre is present).
The terms“nucleic acid” and“polynucleotide” can be used interchangeably', and refer to both RNA and DNA, including cDNA, genomic DNA, synthetic (e.g., chemically
synthesized) DNA, and DNA (or RNA) containing nucleic acid analogs. Polynucleotides can have any three-dimensional structure. A nucleic acid can be double-stranded or single -stranded (i.e., a sense strand or an antisense single strand). Non-limiting examples of polynucleotides include genes, gene fragments, exons, introns, messenger RNA (niR A), transfer RNA, ribosoinal RNA, ribozymes, cDNA, recombinant
polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers, as well as nucleic acid analogs.
As used herein,“isolated,” when in reference to a nucleic acid, refers to a nucleic acid that is separated from other nucleic acids that are present in a genome, including nucleic acids that normally flank one or both sides of the nucleic acid in the genome. The term“isolated” as used herein with respect to nucleic acids also includes any non- naturally-occurring sequence, since such non-naturally-occurring sequences are not found in nature and do not have immediately contiguous sequences in a naturally-occurring genome.
An isolated nucleic acid can be, for example, a DNA molecule, provided one of the nucleic acid sequences normally found immediately flanking that DNA molecule in a naturally-occurring genome is removed or absent. Thus, an isolated nucleic acid includes, without limitation, a DNA molecule that exists as a separate molecule (e.g., a chemically synthesized nucleic acid, or a cDNA or genomic DNA fragment produced by PCR or restriction endonuclease treatment) independent of other sequences, as well as DNA that is incorporated into a vector, an autonomously replicating plasmid, a virus (e.g., a pararetrovirus, a retrovirus, lenti virus, adenovirus, or herpes virus), or the genomic DNA of a prokaryote or eukaryote. In addition, an isolated nucleic acid can include a recombinant nucleic acid such as a DNA molecule that is part of a hybrid or fusion nucleic acid. A nucleic acid existing among hundreds to millions of other nucleic acids within, for example, cDNA libraries or genomic libraries, or gel slices containing a genomic DNA restriction digest, is not to be considered an isolated nucleic acid.
A nucleic acid can be made by, for example, chemical synthesis or polymerase chain reaction (PCR). PCR refers to a procedure or technique in which target nucleic acids are amplified. PCR can be used to amplify specific sequences from DNA as well as RN A, including sequences from total genomic DN A or total cellular RNA. Various PCR methods are described, for example, in PCR Primer: A Laboratory Manual. Dieffenhach
and Dveksler, eds., Cold Spring Harbor Laboratory Press, 1995. Generally, sequence information from the ends of the region of interest or beyond is employed to design oligonucleotide primers that are identical or similar in sequence to opposite strands of the template to be amplified. V arious PCR strategies also are available by which site-specific nucleotide sequence modifications can be introduced into a template nucleic acid.
Isolated nucleic acids also can be obtained by mutagenesis. For example, a naturally occurring nucleic acid sequence can be mutated using standard techniques, including oligonucleotide-directed mutagenesis and site-directed mutagenesis through PCR. See, Short Protocols in Molecular Biology. Chapter 8, Green Publishing Associates and John Wiley & Sons, edited by Ausubel ei al , 1992.
Recombinant nucleic acid constructs (e.g., vectors) containing sequences encoding the tagged Sunl fusion polypeptides also are provided herein. A“vector” is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. Vector backbones include, for example, plasmids, viruses, artificial chromosomes, bacterial artificial chromosomes (BACs), yeast artificial chromosomes (YACs), and phage artificial chromosomes (PACs), as well as RNA vectors, and linear or circular DN A or RNA molecules that include chromosomal, non- chromosomal, semi-synthetic, or synthetic nucleic acids. Vectors include those capable of autonomous replication (episomal vectors) and/or expression of nucleic acids to which they are linked (expression vectors). Generally, a vector is capable of replication when associated with the proper control elements. The term‘Vector” includes cloning and expression vectors, as well as viral vectors and integrating vectors. An“expression vector” is a vector that includes one or more expression control sequences to control and regulate the transcription and/or translation of another DNA sequence. Suitable expression vectors include, without limitation, plasmids and viral vectors derived from, for example, bacteriophage, baculovirases, tobacco mosaic virus, herpes viruses, cytomegalovirus, retroviruses, vaccinia viruses, adenoviruses, and adeno-associated viruses. Numerous vectors and expression systems are commercially available.
Viral vectors include, without limitation, retrovirus, adenovirus, parvovirus (e.g., adeno associated viruses), coronavirus, negative strand RNA viruses such as orthomyxovirus (e.g., influenza vims), rhabdovirus (e.g., rabies and vesicular stomatitis virus), paramyxovirus (e.g., measles and Sendai), positive strand RNA viruses such as picor- navirus and aiphavims, and double-stranded DNA viruses including adenovirus,
herpesvirus (e.g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxvirus (e.g., vaccinia, fowlpox and canarypox). Other viruses include Norwalk vims, togavims, flavi virus, reoviruses, papovavirus, hepadnavirus, and hepatitis virus, for example. Examples of retroviruses include: avian leukosis-sarcoma, mammalian C-type, B-type viruses, D type viruses, HTLV-BLV group, lentivirus, spumavirus (Coffin,“Retroviridae: Tlie viruses and their replication,” in Fundamental Virology.
Third Edition, B. N. Fields, et al., eds., Lippincott-Raven Publishers, Philadelphia, 1996).
The terms“regulatory region,”“control element,” and“expression control sequence” refer to nucleotide sequences that influence transcription or translation initiation and rate, and stability and/or mobility' of the transcript or polypeptide product. Regulatory regions include, without limitation, promoter sequences, enhancer sequences, response elements, protein recognition sites, inducible elements, promoter control elements, protein binding sequences, 5' and 3' untranslated regions (UTRs), transcriptional start sites, termination sequences, polyadenylation sequences, introns, and other regulator regions that can reside within coding sequences, such as secretory signals, Nuclear Localization Sequences (NLS) and protease cleavage sites.
As used herein,“operabiy linked” means incorporated into a genetic construct so that expression control sequences effectively control expression of a coding sequence of interest. A coding sequence is“operabiy linked” and“under the control” of expression control sequences in a cell when RNA polymerase is able to transcribe the coding sequence into RNA, which if an mRNA, then can be translated into the protein encoded by the coding sequence. Thus, a regulatory region can modulate, e.g., regulate, facilitate or drive, transcription in the plant cell, plant, or plant tissue in which it is desired to express a modified target nucleic acid.
A promoter is an expression control sequence composed of a region of a DNA molecule, typically (but not always) within 100 nucleotides upstream of the poin t at which transcription starts (generally near the initiation she for RNA polymerase II). Promoters are involved in recognition and binding of RNA polymerase and other proteins to initiate and modulate transcription. To bring a coding sequence under the control of a promoter, it typically is necessary to position the translation initiation site of the translational reading frame of the polypeptide between one and about fifty nucleotides downstream of the promoter. A promoter can, however, be positioned as much as about 5,000 nucleotides upstream of the translation start site, or about 2,000 nucleotides upstream of the
transcription start site. A promoter typically includes at least a core (basal) promoter. A promoter also may include at least one control element such as an upstream element.
Such elements include upstream activation regions (UARs) and, optionally, other DNA sequences that affect transcription of a polynucleotide such as a synthetic upstream element.
The choice of promoters to be included depends upon several factors, including, but not limited to, efficiency, selectabiiity, rnducibility, desired expression level, and cell or tissue specificity. For example, tissue-, organ- and cell-specific promoters that confer transcription only or predominantly in a particular tissue, organ, and cell type, respectively, can be used. In some cases, a promoter that is active in a particular type of cell (e.g., a particular type of neuron) can be used. Such promoters - or other expression control sequences - can be identified using methods such as those described herein, and can be used in the SNAIL constructs provided herein. Alternatively, constitutive promoters can promote transcription of an operably linked nucleic acid in essentially any tissue of an organism. Such promoters can be used in the cSNAIL constructs provided herein. Other classes of promoters include, without limitation, inducible promoters that confer transcription in response to external stimuli such as chemical agents,
developmental stimuli, or environmental stimuli.
A 5’ untranslated region (UTR) is transcribed, but is not translated, and lies between the start site of the transcript and the translation initiation codon and may include the +1 nucleotide. A 3’ UTR can be positioned between the translation termination codon and the end of the transcript. UTRs can have particular functions such as increasing mRNA message stability or translation attenuation. Examples of 3’ UTRs include, but are not limited to, polyadenylation signals and transcription termination sequences. A polyadenylation region at the 3'-end of a coding region can also be operably linked to a coding sequence.
Recombinant nucleic acid constructs can include a polynucleotide sequence inserted into a vector suitable for transformation of cells (e.g., plant cells or animal cells). Recombinant vectors can be made using, for example, standard recombinant DNA techniques {see, e.g., Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY). In some cases, a recombinant nucleic acid sequence as described herein can integrate into the genome of a cell via illegitimate (i.e., random, non-homologous, non site-specific) recombination, or a
recombinant nucleic acid sequence as described herein can be adapted to integrate into the genome of a cell via homologous recombination. Nucleic acid sequences adapted for integration via homologous recombination are flanked on both sides with sequences drat are similar or identical to endogenous target nucleotide sequences, which facilitates integration of the recombinant nucleic acid at the particular site(s) in the genome containing the endogenous target nucleotide sequences. Nucleic acid sequences adapted for integration via homologous recombination also can include a recognition site for a sequence-specific nuclease. Alternatively, the recognition site for a sequence-specific nuclease can be located in the genome of the cell to be transformed.
The nucleic acid constructs described herein typically contain a sequence encoding a tagged Sunl fusion polypeptide. The tenn“polypeptide” as used herein refers to a compound of two or more subunit amino acids, regardless of post-translational modification (e.g., phosphorylation or glycosylation). The subunits may be linked by- peptide bonds or other bonds such as, for example, ester or ether bonds. The term“amino acid” refers to either natural and/or unnatural or synthetic amino acids, including D/L optical isomers.
By“isolated” or“purified” with respect to a polypeptide it is meant that the polypeptide is separated to some extent from cellular components with which it is normally found in nature (e.g., other polypeptides, lipids, carbohydrates, and nucleic acids). An purified polypeptide can yield a single major band on a non-reducing polyacrylamide gel. A purified polypeptide can be at least about 75% pure (e.g., at least 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% pure). Purified polypeptides can be obtained by, for example, extraction from a natural source, by chemical synthesis, or by recombinant production in a host ceil or transgenic plant, and can be purified using, for example, affinity chromatography, immunoprecipitation, size exclusion chromatography, and ion exchange chromatography. The extent of purification can be measured using any appropriate method, including, without limitation, column chromatography,
polyacrylamide gel electrophoresis, or high-performance liquid chromatography.
The Sun 1 portion of the fusion polypeptides provided herein (and encoded by the nucleic acids provided here) can include a fragment of a mouse Sunl protein. A representative Sunl protein sequence is provided in SEQ ID NO: 1:
Mus musculus Sunl (NCBI Ref. NM 001256118.1)
MDFSRLHTYTPPQCVPENTGYTYALSSSYSSDALDFETEHKLEPVFDSPRMSRRS
LRLVTTASYSSGDSQAIDSHISTSRATPAKGRETRTVKQRRSASKPAFSINHLSGK
GLSSSTSHDSSCSLRSATVLRHPVLDESLIREQTKVDHFWGLDDDGDLKGGNKA
ATQGNGELAAEVASSNGYTCRDCRMLSARTDALTAHSAJHGTTSRVYSRDRTLK
PRKAASGTFWWLGSGWYQFVTLISWLNVFLLTRCLRNICKVFVLLLPLLLLLGA
GVSLWGQGNFFSLLPVLNWTAMQPTQRVDDSKGMHRPGPLPPSPPPKVDHKAS
QWPQESDMGQKVASLSAQCHNHDERLAELTVLLQKLQIRVDQVDDGREGLSLW
VKNWGQHLQEMGTIEPPDAKTDFMTFHHDHEYRLSNLEDVLRKLTEKSEAIQK
ELEETKLKAGSRDEEQPLLDRVQHLELELNLLKSQLSDWQHLKTSCEQAGARIQE
TVQLMFSEDQQGGSLEWLLEKLSSRFVSKDELQVLLHDLELKLLQNITHHITVTG
QAPTSEArVSAVNQAGISGITEAQAHIIVNNALKLYSQDKTGMVDFALESGGGSrL
STRCSETYETKTALLSLFGVPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLWR
LSMKJYPTTFTMEHiPKTLSPTGNISSAPKDFAVYGLETEYQEEGQPLGRFTYDQE
GDSLQMFHTLERPDQAFQIVELRVLSNWGHPEYTCLYRFRVHGEPIQ (SEQ ID
NO: I)
The Sunl fragment included in a fusion polypeptide as provided herein can have a length between about 20 amino acids and about 750 amino acids (e.g., about 20 to 50 amino acids, about 50 to about 100 amino acids, about 100 to about 200 amino acids, about 200 to about 400 ammo acids, about 400 to about 600 amino acids, or about 600 to about 750 amino acids). In some cases, for example, the Sunl portion of a tagged Sunl fusion polypeptide can include about 400 to about 600 consecutive amino acids from SEQ ID NO: 1. In some cases, the Sunl portion of the tagged Sunl fusion polypeptide can have at least 90% sequence identity (e.g., at least 92%, 93%, 95%, 97%, 98%, or 99% sequence identity) to a fragment of SEQ ID NO: 1 that is about 20 to about 800 amino acids in length (e.g., about 20 to 50, about 50 to about 100, about 100 to about 200, about 200 to about 400, about 400 to about 600, or about 600 to about 750 amino acids in length). In some cases, as described in the Examples, a Sun l fragment can include amino acids 208 to 757 of SEQ ID NO: 1, or can have a sequence that is at least 90% (e.g., at least 92%, 93%, 95%, 97%, 98%, or 99%) identical to ammo acids 208 to 757 of SEQ ID NO: 1. In some cases, a Sunl fragment can include a portion of the fragment containing amino acids 208 to 757 of SEQ ID NO: 1 (e.g., a portion that is 20 to 50, 50 to 100, 100 to 300, or 300 to 500 amino acids in length), or a Sunl fragment can have a sequence that is at least 90% (e.g., at least 92%, 93%, 95%, 97%, 98%, or 99%) identical to a portion of the fragment containing ammo acids 208 to 757 of SEQ ID NO: 1.
The percent sequence identity between a particular amino acid sequence and a sequence referenced by a particular sequence identification number is determined as follows. First, an amino acid sequence is compared to the sequence set forth in a particular query sequence using the BLAST 2 Sequences (B12seq) program from the stand-alone version of BLASTZ containing BLASTP version 2.0.14. This stand-alone version of BLASTZ can be obtained online at fr.com/blast or at ncbi.nlm.nih.gov.
Instructions explaining how to use the B12seq program can be found in the readme file accompanying BLASTZ. B12seq performs a comparison between two sequences using the BLASTN or BLASTP algorithm BLASTN is used to compare nucleic acid sequences, while BLASTP is used to compare amino acid sequences. To compare two To compare two amino acid sequences, the options of B12seq are set as follows: -i is set to a file containing the first amino acid sequence to be compared (e.g., C:\seql.txt); -j is set to a file containing the second amino acid sequence to be compared (e.g., C:\seq2.txt); -p is set to biastp; -o is set to any desired file name (e.g., C:\output.txt); and all other options are left at their default setting. For example, the following command can be used to generate an output file containing a comparison between two amino acid sequences: C:\B12seq -i c:\seql.txt -j c:\seq2.txt -p biastp -o c:\output.txt. If the two compared sequences share homology, then the designated output file will present those regions of homology as aligned sequences. If the two compared sequences do not share homology, then the designated output file will not present aligned sequences.
Once aligned, the number of matches is determined by counting the number of positions where an identical nucleotide or amino acid residue is presented in both sequences. The percent sequence identity is determined by dividing the number of matches either by the length of the sequence set forth in the identified sequence or by an articulated length (e.g., 100 consecutive amino acid residues from a sequence set forth in an identified sequence), followed by multiplying the resulting value by 100. For example, the reference mouse Sunl ammo acid sequence set forth in SEQ ID NO: 1 is 757 residues in length. An amino acid sequence that has 740 matches when aligned with the reference sequence is 97.8 percent identical to the reference sequence (i.e., 740/757 x 100 = 97 8).
It is noted that the percent sequence identity value is rounded to the nearest tenth. For example, 75.11, 75.12, 75.13, and 75.14 are rounded down to 75.1, while 75.15, 75.16, 7.17, 75.18, and 7.19 are rounded up to 7.2. It also is noted that the length value will always be an integer.
In addition to the Sunl portion, the fusion polypeptides provided herein can include a tag sequence designed to facilitate manipulation or detection (e.g., localization, purification, and/or isolation) of the expressed polypeptide. Any suitable tag can be included. In some cases, a fluorescent tag can be used (e.g., GFP, yellow fluorescent protein, or mCheny). A representative amino acid sequence for a superfolder GFP is provided in SEQ ID NO:2:
MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPV
PWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKBDGTYKTR
AEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKAN
FKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHM
VLLEFVTAAGITHGMDELYK (SEQ ID NO:2)
In some cases, a tagged Sun ! fusion polypeptide can include an amino acid sequence that is at least 90% (e.g., at least 92%, 93%, 95%, 97%, 98%, or 99%) identical to the sequence set forth in SEQ ID NO: 2. Other suitable tags that can be included in the fusion polypeptides provided herein include, without limitation, glutathione S-transferase (GST), polyhistidine, c-myc, hemagglutinin, or Flag™ tag (Kodak, New Haven, CT). The tag sequence can be located within the Sunl portion of the fusion polypeptide, or can be at or adjacent to the carboxyl or amino terminus of the Sunl portion of the fusion polypeptide.
In addition to the sequence encoding the tagged Sunl fusion polypeptide, the cSNAIL constructs provided herein can include a promoter sequence (e.g., a constitutive promoter, an organ specific promoter, or a promoter that is activated by neural activity or a particular disease state such as oxidative stress or cancer, such as an lEG-sensitive promoter as disclosed by Sorensen et al., eLife 5x13918, 2016) and loxP sites flanking either side of the sequence encoding the fusion polypeptide, such that one of the loxP sites separates the sequence encoding the fusion polypeptide from the promoter. As depicted in FIGS. 1A and 5A, for example, the sequence encoding the tagged Sunl fusion polypeptide can be inverted between the loxP sequences, such that the fusion polypeptide is not expressed until after the coding sequence is excised by a Cre recombinase and reinserted in die“correct” orientation.
The SNAIL constructs provided herein {see, e.g., FIGS. 5B and 5C) lack loxP sequences, and contain promoter and/or enhancer sequences that drive expression of the tagged Sunl fusion polypeptide in a specific cell type, thus allowing for identification and isolation of cells of the specific, selected type. In some applications of SNAIL, synthetic enhancer sequences can be constructed purely through computational optimization, and
can be paired with SNAIL to generate more specific and efficient ceil type labels than endogenous genomic sequences prioritized using the CNNs and SVMs. In addition to other generative models, deep convolutional generative adversarial networks (DCGANs) that have been applied successfully for deep generative design of realistic faces, objects, and art can be used. Sequence classification tasks share many parallels with image classification. CNNs are the state-of-the-art model for both tasks, and DCGANs, which utilize CN s under the hood for discrimination, are therefore an ideal choice for generating realistic sequences. Further, conditional DCGANs, which are a variant of GANs, can be utilized to generate sequences on the condition that they confer specific activity in a given cell type of interest versus other surrounding cell types. These can be trained on any neural cell type for which high resolution open chromatin or enhancer activity measurements exist. The generated sequences can then be cloned into the SNAIL vector to screen and generate high quality AAV-delivered cell type labels.
Generally, as previously discussed, machine learning models can be used for generating data representing a synthetic genetic sequence configured for labeling at least one cell type by causing expression of a marker in the at least one cell type. The models can include GANs, such as DCGANs, CNNs, support vector machines (SVMs), and so forth. The machine learning models are configured for generating the synthetic genetic sequences that are candidates for the SNAIL process (e.g., as viral probes).
FIG. 2A shows an example process 250 for training and executing the machine learning model to generate the synthetic genetic sequences. The process 250 includes receiving (252) training data associating at least one feature of a genetic sequence of the at least one cell type with expression of a hallmark of the at least one cell type. The process 250 includes training (254), based on the training data, a model configured to generate data representing a synthetic genetic sequence. The process 250 includes receiving (256) input data including the at least one feature of the genetic sequence. The process 250 includes generating (258) the synthetic genetic sequence in response to receiving the input data comprising the at least one feature .
In some implementations, the machine learning model includes a GAN. The GAN generally includes a generator network configured to receive latent random noise data as the input data and generate the synthetic genetic sequence and a discriminator network configured to generate a probability value representing whether the input sequence is drawn from the synthetic genetic sequence from the generator network or from a
distribution of natural genetic sequences. Turning briefly to FIG. 2B, an example machine learning model 200 is shown for generating data representing a synthetic genetic sequence configured for labeling at least one cell type by causing expression of a marker in the at least one ceil type.
Generally, the machine learning model 200 is configured to generate data that models the SNAIL constructs (e.g., viral probes) discussed throughout this specification. The model 200 is a particular model including a DCGAN that has a generator G, a sequence S, and a discriminator D. However, as previously described, while the DCGAN is shown for illustrative purposes, other machine learning models are possible, such as support vector machines (SVNs), neural networks (NN) such as CNNs, and so forth. The models for generating regulatory sequences is not specific for SVM and CNNs, but also can utilize generative components to the CNNs that relate genomic sequences to regulator}' activity and use them to construct synthetic enhancer sequences. Machine learning models, such as model 200, are configured to construct synthetic enhancer sequences that are computationally optimized to drive cell type-specific labeling when used in an AAV construct, more so than the endogenous genomic sequences that were used to train the CNN classifiers.
Returning to FIG. 2A, in some implementations, the machine learning model is configured for generating a nucleic acid sequence comprising the synthetic genetic sequence. In this example, the nucleic acid sequence comprises the synthetic genetic sequence operably linked to a nucleotide sequence encoding a marker. For example, the marker can include a SunlGFP fusion polypeptide. In another example, the nucleic acid sequence further comprises a virus nucleic acid sequence. Here, the virus can include an adeno-associated vims (AAV).
The machine learning model is configured for receiving results data representing a delivery' of a nucleic acid including the synthetic genetic sequence to an organism . Tire results data represents a successful labeling of the at least one cell type or an unsuccessful labeling of the at least one cell type. To tra the model, the model is updated using the results data. The model is then configured to generate an updated synthetic genetic sequence based on the updated model. Updating the model can also be done by receiving training data including the hallmark representing marker positive results marker negative results, or both. The at least one feature corresponding to the marker positive result or to the marker negative result is extracted. The at least one feature is then added to the model.
In some implementations, the feature is a set of k-mer or gapped k-mer counts . Extracting the at least one feature can include scanning the sequence to determine the set of k-mer counts that form the sequence.
Other models besides the GAN of FIG. 2B can be used. For example, a support vector machine includes a feature space a support vector representing a classification border in the feature space. The model is executed to add, to the support vector of the support vector machine, a given set of k-mer counts within a predefined distance of tire classification border in the feature space of the support vector machine.
In another example, the machine learning model includes a neural network. For example, the machine learning model can include a convolutional neural network. The neural network is loaded with one or more weight values (also called activation values) each associated with a feature of the synthetic genetic sequence. For example, a feature of the neural network can include a set of k-mer counts of the genetic sequence. In some implementations, the feature represents a transcription factor binding motif.
In any of the machine learning models described in this specification, the synthetic genetic sequence that is generated from the model is configured to distinguish between ceil types. The particular cell types are based on the training data used. For example, the genetic sequence that is generated from the model can be configured to distinguish between parvalbumin positive (PV+) and parvalbumin negative (PV-) cells (e.g., the generated sequence can lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% of all PV+ neurons that are transduced by the virus and have the chance to express the machinery, but would not lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% ofPV- ceils). For example, the genetic sequence that is generated from the model can be configured to distinguish between PV+ and excitatory (EXC) neurons (e.g., the generated sequence can lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% of all PV+ neurons that are transduced by tire virus and have the chance to express the machinery, but would not lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% of EXC neurons). For example, the generated genetic sequence that is generated from the model can be configured to distinguish between PV+ and vasoactive intestinal peptide-expressing (VIP+) neurons (e.g., the generated sequence can lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% of all PV+ neurons that are transduced by the virus and have the chance to express the
machinery, but would not lead to expression in at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% of VIP+ neurons). However, other cell types can be distinguished by the generated genetic sequence based on the training data used. These examples are non-exhaustive and illustrate possible examples from hundreds or thousands of cell types. The regulatory sequence features learned may extend beyond cell types as well as to cellular states, such as neurons that in the process or responding to neural activity or cells that are responding to DNA damage.
As shown in FIG. 2B, the DCGAN for labeling at least one cell type by causing expression of a marker in the at least one cell type includes two neural network modules, a generator network G and a discriminator network D. The generator G receives latent random noise input (z) and outputs a synthetic sequence. The discriminator network is configured to generate probability value representing a probability that an input sequence is drawn from a distribution of real sequences. The parameters of both G and D can be tuned together using alternating phases of training with real sequences from existing data sources and synthetic sequences generated from G As the models are trained, G generally generates synthetic sequences that are closer to the real data distribution than before. The discriminator is more likely to classify these generate sequences as genuine.
The generator is training G to generate realistic sequence data. For example, a GAN could be applied to generate synthetic enhancers that are likely highly active in PV + or PV- neurons by training on real data drawn from endogenous genomic sequences underlying previously profiled open chromatin regions in PV+ and PV- neurons. Further, to optimize specific properties of the sequence, a conditional GAN can be used where an additional class label (y) is input to both G and D. For example, to generate sequences specific to PV+ neurons relative to PV- neurons, a GAN could be trained on real sequences active in both PV and PV -neurons, but the generation can be forced to be specific to PV+ neurons by setting y to be 1 for all sequences active in PV+ neurons and 0 for all sequences active in PV- neurons. This enables discriminative generation of sequences, where the optimized property is enhancer activity in a cell type relative to surrounding or background cell types.
Generally, using die GAN includes training the generator network and die discriminator network of the GAN by alternating die input data between synthetic sequence derived from the latent noise data input to the generator network and natural genetic sequence data. The GAN receives input data representing endogenous genomic
sequences underlying previously profiled open chromatin regions of at least two cell types and then updates the discriminator network for distinguishing between the at least two cell types. In an example, the at least two cell types include parvalbumin positive (PV+) and pan-albumin negative (PV-) neurons; however, other cell types can be used, and are described throughout this specification . In this example, the discriminator network is configured to distinguish between the PV+ and PV- neurons based on the input data, but other ceil types can be used as well, such as excitatory (EXC) neurons, vasoactive intestinal peptide-expressing (VIP+) neurons, and so forth.
The GAN is configured for optimizing a feature of the synthetic genetic sequence by applying a class label to both the generator network and the discriminator network.
The class label is configured to force a first probability value for a first input type and a second probability value for a second input t pe that is different from the first input type. In some implementations, the feature represents an enhancer of an activity in a cell type.
The model 200 is configured to receive (212) the noise and condition input together to generate a compressed representation of the output sequence. Tire compressed representation is unpacked (210) using a deconvolution process. Fully connected layers can be used in the model 200 to generate a synthetic sequence. The model 200 is configured to generate (208) sequence binary encoding to input to the discriminator. The discriminator is configured to determine whether the sequence it receives is a synthetic sequence or a naturally occurring sequence. The discriminator includes a one dimensional (ID) convolution layer configured to scan (206) the received sequences for paterns. Max pooling can be used (204) to down-sample the input sequence. This convolution and max pooling process can be iterated as needed. The class label (e.g., condition) and compressed output from multiple fully connected layers are output (202) into an output unit.
For SNAIL viral probes, a cell type-specific regulatory' element is required to drive targeted gene expression in the desired cell type of interest. In one embodiment, a regulatory element can be configured to label one specific cell type, parvalbumin positi ve (PV+) inhibi tory intemeurons. In an experiment, profiles of cell type-specific open chromatin were used for this neuron subtype to train machine learning models that link genome sequence to parvalbumin-specific regulatory activity. Specifically, three gapped k-mer support vector machines were built that discriminate between the comparative regulatory' sequence activity in PV+ vs. PY- neurons, PV+ vs. excitatory neurons, and
PV+ vs. vasoactive intestinal peptide-expressing (VIP+) neurons. In addition to gapped k~ mer support vector machines, another example embodiment trained similar convolutional neural networks (CNNs) which are the state-of-the-art model for relating raw genomic sequence to regulatory function. All of these models were used to screen PV+ neuron- specific regions of open chromatin for their ability to independently drive cell type- specific gene expression. The resulting data 300 are shown in graphs 302, 304, 306, and 308 of FIG. 3 and subsequently described. A top candidate is chosen based on the predicted cell type-specificity, its length, and its proximity to cell type-specific genes. That candidate regulatory sequence was cloned into a plasmid vector in which it drives the expression of SunlGFP and the vector was transduced into the mouse brain using AAV-PHP.eB.
This document also provides methods for using the constructs described herein to label and isolate nuclei and/or cells of a select type. The methods can include, for example providing a cSNAIL or SNAIL nucleic acid construct as described herein, introducing the construct into a population of different cell types, and culturing or incubating the cells under conditions which a tagged Sun ! fusion polypeptide encoded by the c SNAIL or SNAIL construct is expressed in the selected cell type (and is not expressed in cells that are not of the selected type), thereby labeling the selected cell type. When a cSNAIL nucleic acid construct is used, the methods also include introducing a nucleic acid construct encoding a Cre recombinase into the population of different cell types, where the sequence encoding the Cre recombinase is operably linked to a promoter that is specific for the selected cell type. In addition, when a cSNAIL construct is used, the conditions under which the cell population is cultured or incubated permit the Cre recombinase to be expressed in the selected cell type, thus leading to excision of the sequence encoding the tagged Sun 1 fusion polypeptide from its nucleic acid construct and re-insertion of the tagged Sunl fusion polypeptide coding sequence in the correct orientation for expression. It is to be noted that in some cases, the population of cells is within a mammal.
Any appropriate method can be used to introduce the SNAIL construct or the cSNAIL and Cre recombinase constructs into a population of cells. As used herein,‘transformed” and“transfected” encompass the introduction of one or more nucleic acid molecules (e.g., one or more expression vectors) into a cell by any of a number of techniques. Suitable methods for transforming and transfecting host cells can be found,
for example, in Sambrook et al., Molecular Cloning: A Laboratory' Manual (2nd edition), Cold Spring Harbor Laboratory, New York (1989). For example, calcium phosphate precipitation, electroporation, heat shock, lipofection, microinjection, and virus-mediated nucleic acid transfer can be used introduce nucleic acid molecules into cells. In addition, naked DNA can be delivered directly to cells in vivo (see, e.g., U.S. Patent Nos.
5,580,859 and 5,589,466) The isolated nucleic acid molecule transformed into a host cell can be integrated into the genome of the cell or maintained in an episomal state. Thus, host cells can be stably or transiently transfected with a construct containing an isolated nucleic acid molecule provided herein. In some cases, one or more nucleic acid constructs can be incorporated into virus particles (e.g., AAV or lentivirus particles), and the vims particles can be delivered to cells in order to transfer their nucleic acid contents to the cells.
The invention will be further described in the following examples, which do not limit tire scope of the invention described in the claims.
EXAMPLES
Example 1
A cSNAlL viral probe was injected into PVcre mice, and SunlGFP expression was selectively activated in Cre+ cells due to viral expression of SunlGFP in PV+ neurons (FIGS. IB and 1C). The success of this probe was quantified against the traditional double-transgenic strategy using different fluorophores in the same mouse. In the primary motor cortex (Ml) of PVcre mice, the viral probe had an efficiency of 80.5% and a specificity of 94.1% (N = 1088 cells). In SSTcre mice, the cSNAIL probe labeled SST neurons in Ml with an efficiency of 67.9% and a specificity of 94.7% (N = 3359 cells). The efficiency was expected to be substantially less than 100% because it w¾s limited by viral transduction rates, as AAV PHP.eB reportedly transduces 55-70% of neurons in the cortex (Chan et ah, supra). The data for these neuron subtypes were in concordance or more optimistic than tins characterization. Using cSNAIL technology, PV+ and PV- were isolated neurons from the mouse cortex, open chromatin assays (Buenrostro et al., Curr. Protoc. Mol. Biol. 109:21.29.1-21.29.9, 2015; and Buenrostro et al., Nat. Methods 10: 1213-1218, 2013) were performed to identify active gene regulatory elements in these populations (FIGS. IE and IF). The resulting data were high quality and exhibited characteristic PV+ or PV- gene regulator ' activity as previously described
using INTACT. This demonstrated that the probes and methods provided herein are capable of generating comparable data as current state -of-the art technology.
A SNAIL viral probe for nuclei isolation of PV+ neurons also was validated. When a successful candidate sequence is cloned upstream of the modified SunlGFP gene in the virus construct, it can only activate fluorescence expression in cells that can recognize and activate the promoter sequence. Thus, while a SNAIL viral probe will transduce cells indiscriminately, it will only express SunlGFP in the targeted cell population.
To prioritize PV+ neuron-specific enhancer candidates, predictions from the SVM and CNN models were used. Three pairwise classifiers of each type (SVM and CNN) were built to discriminate sequences of open chromatin specific to PV+ versus PV- cell, excitatory neurons (EXC), and vasoactive intestinal peptide-expressing (VIP) neurons. The training data for the PV+ vs. PV- models were based on ATAC-seq collected using cS AlL in Pvalb-2A-Cre transgenic mice. The training data for the two other models were based on published ATAC-seq conducted with the double-transgenic INTACT method (Mo et al., supra). All ATAC-seq data were processed using the ENCODE ATAC-seq pipeline (github.com/kimdajelab/atac_dnasejpipelines), and reproducible peaks were called on 2-3 replicates of each cell type. Peak regions were tested for differential accessibility between two cell types using the negative binomial model in DESeq2 (Love et al., Genome Biol 15: 1-21). Differential peaks (adjusted p < 0.01 and jiogZFo!dDiffereneej) were summit centered and unified to 500 bp in length. Where more than one peak summit was called within a differential region and it these summits were further than 100 bp apart, both were included in the training data. These regions were filtered to remove promoters, because promoters tend to be less cell type-specific than enhancers and may have different sequence properties. Regions that overlapped with super enhancers were also removed, as they are too long for viral constructs and may exhibit unique sequence features. To be able to test for over-fiting of the models, the data were divided by chromosome into separate training (chromosomes 3, 4, 5, 6, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and X), validation (chromosomes 8 and 9), and test sets (chromosomes 1 and 2).
The SVM models were built using the center weighted gapped k-mer kernel (Ghandi et al., PLoS Comp Bio 10:e 1003711 , 2014; code available at
github.com/Dongwon-Lee/lsgkm), option -t 4. The models with the best performance
were constructed using the with the following parameters, PV+ vs. PV- model: -1 8 -d 2 -c 0.4 -k 6, PV+ vs. EXC model: -1 8 -d 2 -c 0.4 -k 6, PV+ vs. VIP model: -3 7 -d 1 -c 0.3 -k 6. After the training period, the models were evaluated on the held out validation set of enhancers with known cell type-specific activity. All three SVMs achieved a validation set AUROC > 0.9 and AUPRC > 0.83, shown in graphs 302 and 304 (FIG. 3). Of the top 300 most confident PV+ neuron-specific predictions in each model, 97-100 were true positives. Model performance on the PV+ and excitatory ATAC-seq peaks (Mo et al, supra) also was evaluated. On this independent data, the PV+ vs. PV- classifier achieved an accuracy of 77% and an FI of 0.76. All three CNN models also achieved strong performance on the training set, as well as a held-out validation chromosome (AUROC > 0.94, AUPRC > 0.74), shown in graphs 306 and 308 (FIG. 3).
Using scores across all models and manual curation, four highly consistent PV+ neuron-specific regulator}' sequences were identified as being most likely to induce PV+ specific SunlGFP expression m an independent viral probe. These candidate sequences were incorporated into separate pAAV vectors, operably linked to the expression of a SunlGFP fusion gene A non-specific control vector also was designed with the same sequence except for the promoter region, winch was replaced with a constitutive Efla promoter. After packaging into vims, these probes were assessed for their ability to drive PV+ specific expression of SunlGFP in AAV by comparing Sunl GFP to PV neurons identified with antibodies against parvalbumin. Two of four viruses were successful at restricting SunlGFP expression to PV+ neurons, hereafter referred to as Rank58 and Rank72 (FIG. 4A). Using affinity purification and ATAC-seq, it also was determined that the Rank58 and Rank72 viruses had chromatin landscapes that were similar to PV+ signatures collected with cSNAIL (FIG. 4B) or single nucleus ATAC-seq (FIG. 4C), indicating shared identity.
The materials and methods described herein have the striking benefit of strain independence. Because of this, the materials and methods can be used in wild type mice or any organism for winch AAV can be used as a deliver}' method. Additionally, they can be used in conjunction with transgenic strains, such as disease models, which generally cannot be interbred with INTACT transgenic mice.
Thus, applications of cSNAIL and SN AIL are wide-ranging. For example, cSNAIL viral probes are an immediate alternative to double transgenic mice for cell isolation. These can be used with any existing ceil type-specific Cre mouse strain that
researchers may already be using. SNAIL probes provide an extremely powerful tool for cell isolation in any strain of mouse, and potentially other mammals.
Beyond cell labeling and isolation, applications of this viral gene driving technology also include, without limitation, cell type-specific CRISPR Cas9 expression, gene overexpression, and optogenetie stimuli. The SNAIL platform will give users unprecedented control over circuit manipulation at the resolution of individual neuronal subtypes. In one example, the AAV -based ceil type-specific label of parvalbumin positive neurons can be used to therapeutically manipulate this specific neuron population in humans. This particular cell type has been causally linked to schizophrenia, Parkinson's disease, and Alzheimer’s disease. Additionally, AAV-based therapies have shown promise in human subjects.
The exon-only sequence encoding the N-truncated version of SunlGFP (SEQ ID NO:3), the Rank72 candidate PV specific enhancer (SEQ ID NO:4), the full plasrnid including Rank72 and SunlGFP (SEQ ID NQ:5), and the SunlGFP amino acid sequence (SEQ ID NO:6) were as follows:
N -truncated exon-only version of SunlGFP (SNAIL SunlGFP DNA sequence)
ATGACCTCCAGGGTGTACTCCAGAGACAGGACTCTCAAACCACGGAAGGCAG
CCTCGGGAACCTTCTGGTGGCTAGGGAGCGGCTGGTACCAATTTGTTACTTTG
ATTTCTTGGCTGAATGTCTTTCTTCTTACCAGGTGCCTTCGAAATATTTGCAAG
GTTTTTGTCTTGCTCCTCCCACTCCTACTTTTACTAGGTGCTGGTGTCTCCCTG
TGGGGCCAGGGAAACTTCTTCTCACTCCTACCAGTGCTGAACTGGACGGCCAT
GCAGCCAACACAGAGGGTGGACGATTCCAAGGGCATGCATAGACCTGGCCCT
CTTCCCCCGAGCCCACCTCCAAAGGTTGATCACAAGGCTTCCCAGTGGCCTCA
GGAGAGTGACATGGGGCAGAAGGTAGCTTCTTTGAGTGCGCAGTGCCACAAC
CATGATGAGAGACTTGCAGAGCTGACAGTCCTGCTTCAGAAACTACAGATAC
GGGTAGACCAAGTGGATGACGGCAGGGAAGGGCTGTCACTGTGGGTCAAGA
ATGTGGTTGGACAGCACCTGCAGGAGATGGGCACCATAGAACCACCTGATGC
TAAGACTGACTTCATGACTTTCCACCATGACCATGAAGTGCGTCTCTCCAACT
TGGAAGATGTTCTTAGAAAACTGACAGAAAAATCTGAGGCTATCCAGAAGGA
GCTGGAAGAAACCAAGCTGAAAGCAGGCAGCAGGGATGAAGAGCAGCCCCT
CCTTGACCGTGTGCAGCACCTAGAACTGGAACTGAACCTGTTGAAGTCACAG
CTGTCAGACTGGCAGCATCTGAAGACCAGCTGTGAGCAGGCTGGGGCCCGCA
TCCAGGAGACTGTGCAGCTCATGTTCTCTGAGGATCAGCAGGGCGGTTCCCTC
GAGTGGCTATTAGAGAAGCTTTCTTCTCGGTTCGTGAGCAAGGATGAGCTGC
AGGTGCTCTTACATGACCTTGAGCTGAAACTGCTGCAGAATATCACACACCA
CATCACCGTGACAGGACAGGCCCCGACATCCGAGGCTATTGTGTCTGCCGTG
AATCAGGCAGGGATTTCAGGAATCACAGAAGCGCAAGCACATATCATTGTGA
ACAATGCTCTGAAGCTGTACTCCCAAGACAAGACGGGGATGGTGGACTTTGC
TCTGGAGTCTGGAGGTGGCAGCATCCTAAGCACTCGGTGCTCTGAGACCTAT
GAGACCAAGACGGCACTGCTGAGCCTGTTTGGGGTCCCACTGTGGTACTTCTC
ACAGTCACCTCGAGTGGTGATCCAGCCCGACATCTACCCAGGGAATTGCTGG
GCGTTCAAAGGTTCCCAGGGGTACCTGGTGGTGCGGTTGTCCATGAAGATCT
ACCCAACCACATTCACCATGGAACACATTCCAAAGACACTATCACCCACTGG
TAACATCTCCAGTGCCCCCAAAGACTTTGCAGTCTATGGACTGGAAACGGAG
TATCAAGAAGAGGGGCAGCCTCTGGGACGGTTCACCT'ATGACCAGGAAGGAG
ACTCACTCCAGATGTTCCACACACTGGAAAGACCTGACCAAGCCTTCCAGAT
AGTAGAGCTCCGGGTCCTGTCCAACTGGGGCCACCCTGAGTACACTTGCCTCT
ACCGGTTCCGAGTCCACGGAGAGCCCATCCAGATGAGCAAAGGAGAAGAAC
TnTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGG
CACAAATTTTCTGTCCGTGGAGAGGGTGAAGGTGATGCTACAAACGGAAAAC
TCACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACA
CTTGTCACTACTCTGACCTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCAC
ATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGG
AACGCACTATATCTTTCAAAGATGACGGGACCTACAAGACGCGTGCTGAAGT
CAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAAGGTATTGATT
TTAAAGAAGATGGAAACATTCTCGGACACAAACTCGAGTACAACTTTAACTC
ACACAATGTATACATCACGGCAGACAAACAAAAGAATGGAATCAAAGCTAA
CTTCAAAATTCGCCACAACGTTGAAGATGGTTCCGTTCAACTAGCAGACCATT
ATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCAT
TACCTGTCGACACAATCTGTCCTTTCGAAAGATCCCAACGAAAAGCGTGACC
ACATGGTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGAT
GAGCTCTACAAAT AA (SEQ ID NO:3)
Rank72 candidate PV specific enhancer (SNAIL Rank72 PromoterSequence)
attggtttgcctacacgctttgttgaactgcatttgccatgactccatagagaaaaacacgccgaaaagcttetctaggtggttccc acatettetgtggatccgtggactcgggteaactagcagagtgatgtcagctgctatacatagacteacatggagttttgctaaga caggctcacgtgctgaggcaagacacgtggtaaggcaagacctgtagaggacacttggtgttttgaggcagtataaataggact caacggacggtgatggaggctgggcttgctgcataactagctttgcagtgcttcttggtctegcgtcttoactgaccttegattgtt gagagcggcacagttgagaactteccctggcatccctggtggtcctaattcctcctgctaactecagccaatteggctgaagcctg gcagtttctgctaggtcgggccaccgctgctgattcgtatttgctatcccaactctaccaatctg (SEQ ID NO:4)
Full plasmid including Rank72 and SunlGFP (SNAIL Rank72.dna)
CCTGCAGGCAGCTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCC
CGGGCGTCGGGCGACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGC
AGAGAGGGAGTGGCCAACTCCATCACTAGGGGTTCCTGCGGCCGCACGCGTG
CGATCGCCATATGAGGCCTCATTGGCCATTGTAATTGGTTTGCCTTACACGCT
TTGTTGAACTGCATTTGCCATGACTCCATAGAGAAAAACACGCCGAAAAGCT
TCTCTAGGTGGTTCCCACATCTTCTTGTGGATTCCGTGGACTCGGGTCAACTA
GCAGAGTGATGTCAGCTGCTATACATAGACTCACATGGAGTTTTGCTAAGAC
AGGCTCACGTGCTGAGGCAAGACACGTGGTAAGGCAAGACCTGTAGAGGAC
ACTTGGTGTTTTGAGGCAGTATAAATAGGACTCAACGGACGGTGATGGAGGC
TGGGCTTGCTTGCATAACTAGCTTTGCAGTGCTTCTTGGTCTCGCGTCTTCACT
GACCTTCGATTTGTTGAGAGCGGCACAGTTGAGAACTTCCCCTGGCATCCCTG
GTGGTCCTAATTCCTCCTGCTAACTCCAGCCAATTCGGCTGAAGCCTGGCAGT
TTCTGCTAGGTCGGGCCACCGCTGCTGATTCGTATTTGCTATCCCAACTCTAC
CAATCTGGAATTAATTCGCTGTCTGCGAGGGCCAGCTGTTGGGGTGAGTACTC
CCTCTCAAAAGCGGGCATGACTTCTGCGCTAAGATTGTCAGTTTCCAAAAACG
AGGAGGAITTGATATTCACCTGGCCCGCGGTGATGCCTTTGAGGGTGGCCGC
GTCCATCTGGTCAGAAAAGACAATCTTTTTGTTGTCAAGCTTGAGGTGTGGCA
GGCTTGAGATCTGGCCATACACTTGAGTGACAATGACATCCACTTTGCCTTTC
TCTCCACAGGTGTCCACTCCCAGGTCCAACTGCAGGTCGCGACTAGCGGATCC
AATGACCTCCAGGGTGTACTCCAGAGACAGGACTCTCAAACCACGGAAGGCA
GCCTCGGGAACCTTCTGGTGGCTAGGGAGCGGCTGGTACCAATTTGTTACTTT
GATTTCTTGGCTGAATGTCTTTCTTCTTACCAGGTGCCTTCGAAATATTTGCAA
GGTTTTTGTCTTGCTCCTCCCACTCCTACITITACTAGGTGCTGGTGTCTCCCT
GTGGGGCCAGGGAAACTTCTTCTCACTCCTACCAGTGCTGAACTGGACGGCC
ATGCAGCCAACACAGAGGGTGGACGATTCCAAGGGCATGCATAGACCTGGCC
CTCTTCCCCCGAGCCCACCTCCAAAGGTTGATCACAAGGCTTCCCAGTGGCCT
CAGGAGAGTGACATGGGGCAGAAGGTAGCTTCTTTGAGTGCGCAGTGCCACA
ACCATGATGAGAGACTTGCAGAGCTGACAGTCCTGCTTCAGAAACTACAGAT
ACGGGTAGACCAAGTGGATGACGGCAGGGAAGGGCTGTCACTGTGGGTCAA
GAATGTGGTTGGACAGCACCTGCAGGAGATGGGCACCATAGAACCACCTGAT
GCTAAGACTGACTTCATGACTTTCCACCATGACCATGAAGTGCGTCTCTCCAA
CTTGGAAGATGTTCTTAGAAAACTGACAGAAAAATCTGAGGCTATCCAGAAG
GAGCTGGAAGAAACCAAGCTGAAAGCAGGCAGCAGGGATGAAGAGCAGCCC
CTCCTTGACCGTGTGCAGCACCTAGAACTGGAACTGAACCTGTTGAAGTCAC
AGCTGTCAGACTGGCAGCATCTGAAGACCAGCTGTGAGCAGGCTGGGGCCCG
CATCCAGGAGACTGTGCAGCTCATGTTCTCTGAGGATCAGCAGGGCGGTTCC
CTCGAGTGGCTATTAGAGAAGCTTTCTTCTCGGTTCGTGAGCAAGGATGAGCT
GCAGGTGCTCTTACATGACCTTGAGCTGAAACTGCTGCAGAATATCACACAC
CACATCACCGTGACAGGACAGGCCCCGACATCCGAGGCTATTGTGTCTGCCG
TGAATCAGGCAGGGATTTCAGGAATCACAGAAGCGCAAGCACATATCATTGT
GAACAATGCTCTGAAGCTGTACTCCCAAGACAAGACGGGGATGGTGGACTTT
GCTCTGGAGTCTGGAGGTGGCAGCATCCTAAGCACTCGGTGCTCTGAGACCT
ATGAGACCAAGACGGCACTGCTGAGCCTGTTTGGGGTCCCACTGTGGTACTTC
TCACAGTCACCTCGAGTGGTGATCCAGCCCGACATCTACCCAGGGAATTGCT
GGGCGTTCAAAGGTTCCCAGGGGTACCTGGTGGTGCGGTTGTCCATGAAGAT
CTACCCAACCACATTCACCATGGAACACATTCCAAAGACACTATCACCCACT
GGTAACATCTCCAGTGCCCCCAAAGACTTTGCAGTCTATGGACTGGAAACGG
AGTATCAAGAAGAGGGGCAGCCTCTGGGACGGTTCACCTATGACCAGGAAGG
AGACTCACTCCAGATGTTCCACACACTGGAAAGACCTGACCAAGCCTTCCAG
ATAGTAGAGCTCCGGGTCCTGTCCAACTGGGGCCACCCTGAGTACACTTGCCT
CTACCGGTTCCGAGTCCACGGAGAGCCCATCCAGATGAGCAAAGGAGAAGA
ACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATG
ACTCACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAA
ACATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACA"
GGAACGCACTATATCTTTCAAAGATGACGGGACCTACAAGACGCGTGCTGAA
GTCAAGTITGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAAGGTATTGA
TTTTAAAGAAGATGGAAACATTCTCGGACACAAACTCGAGTACAACTTTAAC
TCACACAATGTATACATCACGGCAGACAAACAAAAGAATGGAATCAAAGCTA
ACTTCAAAATTCGCCACAACGTTGAAGATGGTTCCGTTCAACTAGCAGACCAT
TATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCA
TTACCTGTCGACACAATCTGTCCTTTCGAAAGATCCCAACGAAAAGCGTGACC
ACATGGTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGAT
GAGCTCTACAAATAAGGCGCGGAATTCGATATCAAGCTTATCGATAATCAAC
CTCTGGATTACAAAATTTGTGAAAGATTGACTGGTATTCTTAACTATGTTGCT
CCTTITACGCTATGTCGATACGCTGCTTrAATGCCTTIGTATCATGCTATrGCT
TCCCGTATGGCTTTCATTTTCTCCTCCTTGTATAAATCCTGGTTGCTGTCTCTTT
ATGAGGAGTTGTGGCCCGTTGTCAGGCAACGTGGCGTGGTGTGCACTGTGTTT
GCTGACGCAACCCCCACTGGTTGGGGCATTGCCACCACCTGTCAGCTCCTTTC
CGGGACTTTCGCTTTCCCCCTCCCTATTGCCACGGCGGAACTCATCGCCGCCT
GCCTTGCCCGCTGCTGGACAGGGGCTCGGCTGTTGGGCACTGACAATTCCGTG
GTGTTGTCGGGGAAATCATCGTCCTTTCCTTGGCTGCTCGCCTGTGTTGCCAC
CTGGATTCTGCGCGGGACGTCCTTCTGCTACGTCCCTTCGGCCCTCAATCCAG
CGGACCTTCCTTCCCGCGGCCTGCTGCCGGCTCTGCGGCCTCTTCCGCGTCTTC
GCCTTCGCCCTCAGACGAGTCGGATCTCCCTTTGGGCCGCCTCCCCGCATCGA
TACCGAGCGCTGCTCGAGAGATCTACGGGTGGCATCCCTGTGACCCCTCCCCA
GTGCCTCTCCTGGCCCTGGAAGITGCCACTCCAGTGCCCACCAGCCTTGTCCT
AATAAAATTAAGTrGCATCATTTTGTCTGACTAGGTGTCCTTCTATAATATTAT
GGGGTGGAGGGGGGTGGTATGGAGCAAGGGGCAAGTTGGGAAGACAACCTG
TAGGGCCTGCGGGGTCTATTGGGAACCAAGCTGGAGTGCAGTGGCACAATCT
TGGCTCACTGCAATCTCCGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAGCC
TCCCGAGTTGTTGGGATTCCAGGCATGCATGACCAGGCTCAGCTAATTTTTGT
TmTTGGTAGAGACGGGGTTTCACCATATTGGCCAGGCTGGTCTCCAACTCC
TAATCTCAGGTGATCTACCCACCTTGGCCTCCCAAATTGCTGGGATTACAGGC
GTGAACCACTGCTCCCTTCCCTGTCCTTCTGATnTGTAGGTAACCACGTGCG
GACCGAGCGGCCGCAGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTG
CGCGCTCGCTCGCTCACTGAGGCCGGGCGACCAAAGGTCGCCCGACGCCCGG
GCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGAGCGCGCAGCTGCCTGCAGGG
GCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCA
TACGTCAAAGC AAC C ATAGTAC GC GC C CTGTAGCGGCGC ATTAAGC GCGGC G
GGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGC
CCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCG
TCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGC
ACCTCGACCCCAAAAAACTTGATTTGGGTGATGGTTCACGTAGTGGGCCATC
GTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGGCTATTCT
TTTGATTTATAAGGGA nTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCT
GATTTAACAAAAATTTAACGCGAATTTTAACAAAATATTAACGTTTACAATTT
TATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGCCC
CGACACCCGCCAACACCCGCTGACGCGCCCTGACGGGCTTGTCTGCTCCCGG
CATCCGCTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGCATGTGTCAGAG
GTTTTCACCGTCATCACCGAAACGCGCGAGACGAAAGGGCCTCGTGATACGC
CTATTT1TATAGGTTAATGTCATGATAATAATGGTTTCTTAGACGTCAGGTGG
ATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAA
TATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTATTCC
CTTTTTTGCGGCATTTTGCCTTCCTCTTTTTGCTCACCCAGAAACGCTGGTGAA
AGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTG
GATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCC
AATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTATTG
ACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTT
GGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTA
AGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACT
CATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAA
GCCATACCAAACGACGAGCGTGACACCACGATGCCTGTAGCAATGGCAACAA
CGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAA
TTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGG
CCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGG
TCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGT
AGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAG
TTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTG
AGATCCTTTTTTTCTGTCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGC
TACCAGCGGTGGXrrGTTTGCCGGATCAAGAGCTACCAACTCrmTCCGAAG
GTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCC
GTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTC
TGCTAATCCTG1TACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACC
GGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAA
CGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACT
GAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGA
AAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACG
CCTTTTGCTCACATGT (SEQ ID NO:5)
SunlGFP polypeptide
MTSRVYSRDRTLK5PRKAASGTFWWLGSGWYQFVTLISWLNVFLLTRCLRNICKV
FVLLLPLLLLLGAGVSLWGQGNFFSLLPVLNWTAMQPTQRVDDSKGMHRPGPLP
PSPPPKVDHKASQWPQESDMGQKVASLSAQCHNHDERLAELTVLLQKLQIRVDQ
VDDGREGLSLWVKNVVGQHLQEMGTIEPPDAKTDFMTFHHDHEVRLSNLEDVL
RKLTEKSEAIQKELEETKLKAGSRDEEQPLLDRVQHLELELNLLKSQLSDWQHLK
TSCEQAGARIQETVQLMFSEDQQGGSLEWLLEKLSSRFVSKDELQVLLHDLELKL
LQNITHFnTVTGQAPTSEAIVSAVNQAGISGfTEAQAHUVNNALKLYSQDKTGMV
DFALESGGGSILSTRCSETYETKTALLSLFGVPLWYFSQSPRVVIQPDIYPGNCWA
FKGSQGYLVVRLSMKIYPTTFTMEHIPKTLSPTGNISSAPKDFAVYGLETEYQEEG
QPLGRFIYDQEGDSLQMFHTLERPDQAFQIVELRVLSNWGHPEYTCLYRFRVHG
WIQMSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLP
VPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGWQERTISFKDDGTYKTRAE
VKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRH
NVEDGSVQI DHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVU EFVTA
AGJTHGMDELYK (SEQ ID NO:6) [residues 2-551 are amino acids 208-757 of the Mus muscuius Sunl transcript variant 5 (GENBANK® Accession No. NM_0012561 18.1), and residues 552-789 (in italics) are the superfolder GFP amino acid sequence]
Example 2 - Cell tvpe-specific oxidative stress genomic signatures in the globus pallidus of dopamine depleted mice
Neuron subtype dysfunction is a key contributor to the motor deficits observed in dopamine depleted mouse models of Parkinson’s disease. For example, cell type-specific optogenetic stimulation of external globus pallidus (GPe) parvalbumin-expressing neurons (PV+) - but not global GPe stimulation - rescues normal motor behavior in dopamine depleted mice. Despite the importance of these cells in the disease process, the molecular correlates of GPe PV+ neuron performance after DD remain unknown due to the difficulty of isolating specific neuron subtypes in the brain. To address this issue, the cSNAIL viral affinity purification strategy was developed to isolate Cre recombinase- expressing (Cre+) nuclei from the adult mouse brain. Specifically, cSNAIL was used to
isolate PV+ neurons from the cortex, striatum, and GPe of 6-hydroxydopamine (6- OHDA) lesioned mice and sham controls. In parallel RNA-seq and ATAC-seq
(Buenrostro et al. 2013, supra,· and Buenrostro et al. 2015, supra) were conducted on cSNAIL-isolated PV+ populations and the remaining PV- cells in each brain region. With this strategy, GPe PV+ neuron-specific epigenetic and transcriptional responses to DD were identified that are related to cellular oxygen sensing and oxidative stress, providing new' insight into the molecular pathology of PD.
Materials and Methods
AA V design. Several modifications were made to die INTACT system to allow' it to be delivered using AAV. First, an N-truncated version of the human SUN1 gene (amino acids 208-913) w¾s used. This version retained the ability to localize to the nuclear envelope in a manner that was resistant to detergent tissue homogenization as characterized by Haque et al. (JBiol Chem 285:3487-3498, 2010). Second, only the DNA sequence of exonic regions of SUN1 was incorporated into the construct. Third, the SUN 1GFP fusion gene included one copy of superfolder GFP instead of two. Finally, the Cre-dependent mechanism was adjusted from a loxp-flanked stop codon to the double inverted orientation (DIO) system. In the initial cSNAIL genome, the SUN! GFP gene is m the reverse orientation with respect to the promoter such that the gene cannot be expressed. When the virus encounters Cre recombinase protein (Cre), it acts on the double flanking lox sites to excise the SUN 1 GFP gene and re-insert it in the correct orientation for transcription (FIG. 1A).
Vector construction. The modified SUN 1 GFP fusion sequence fragment wus synthesized by Integrated DNA Technologies (IDT; Coralville, IA) and contained flanking restriction sites for Sgsl and Bspol. The SUN 1 GFP sequence was inserted into an AAV DIO backbone vector with an FT! a promoter using standard restriction cloning pAAV-Efla-DIO-EGFP-WPRE-pA was obtained from Bernardo Sabatim
(n2t.net/addgene : 37084; RRID: Addgene 37084) (Saunders et al, Front Neural Circuits 6:47, 2012). The ligation was transformed into electrocompetent bacteria, and positive clones were selected and sequences were confirmed with Sanger sequencing. The cSNAIL genome vector (pAAV-Efla-DIO-SUN IGFP-WPRE-pA) is shown in FIG. 5A.
AA V production. The AAV was produced by triple co-transfection of pAA V-
Ef 1 a-DIQ-SUN 1 GFP-WPRE-pA, an AAV helper plasmid, and pUCmim-iCAP-PHP.eB
into AAVpro(R) 293T ceils (Takara Bio USA, Inc , Mountain View, CA; cat #632273) pUCmini-iCAP-PHP.eB was obtained from Viviana Gradinaru (http://n2t.net/addgene : 103005; RRID: Addgene 103005) (Chan et al., supra). After cell expansion, the AAV particles were precipitated with polyethylene glycol (PEG) and purified with
ultracentrifugation on an iodixanoi gradient. The virus was titrated using the AAVpro(R) Titration Kit (Takara, cat #6233), diluted in PBS to a concentration of 8.0 x 109vg/pl, and stored at -80° until injection.
Animals. All molecular experiments were performed on Pvalb-2A-Cre mice (B6.Cg-Pvalbtmi KCS)A*S/J. -]¾e Jackson Laboratory, Bar Harbor, ME, stock no: 012358) (Madisen et al., Nat Neurosci 13: 133-140, 2010). Imaging experiments for the validation of cSNAIL (FIGS. 6A-6C) were performed w'ith double -transgenic Pvalb-2A-Cre and Ail4 mice (Ail 4 strain; B6.Cg-Gt(ROSA)26Sor,m34(CA&<dToma,0)Hze/J; Jackson Stock No: 007914) (Madisen et al., supra). Experiments related to Hi£2a staining (FIG. 9D) were conducted on wild type mice (C57BL/6J; Jackson Stock No: 000664).
AAV delivery. Mice were anesthetized with isoflutane for 2-5 minutes until breathing slowed and the animal had no pedal reflex. AAV (4 x 101u vg) was injected into the retro-orbital cavity. The mice received 0.5% Proparacame Hydrochloride Ophthalmic Solution for comfort and were monitored for physical and behavioral abnormalities post procedure, but no such abnormalities were observed. Tire virus incubated for 21 to 28 days to reach peak expression before downstream experiments.
Dopamine depletion surgery. The molecular experiments were designed to reproduce previous conditions and maximize cell yield. Therefore, bilateral acute 6- OHDA or saline injections were administered to the medial forebrain bundle as described elsew'here (Mastro et al., Nat Neurosci 20:815-823, 2017).
Immunofluorescence staining and imaging. Wherever possible, tissue for imaging wus preserved by 4% paraformaldehyde (PFA) perfusion. The brains were dissected and incubated overnight at 4°C in 4% PFA. Shortly after, they were sectioned coronaliy with a vibratome at 100 pm for antibody staining and slide mounting. To visualize cSNAIL specificity (FIG. 6B-6D) tissues 'ere stained with primary anti-NeuN (Cell Signaling Technology, Danvers, MA; #12943) and secondary Alexaf!uor 405 (Invitrogen, Waltham, MA; #A-31556) to label neurons. For images related to FIG. 91), tissues were stained wdth primary anti-Pvalb (Sw'ant, PV 27) paired with secondary Alexafluor 405
(Invitrogen, #A-31556) or Alexafluor 488 (Cell Signaling Technology, #44088) and
primary anti-Hi£2a (Noviis Biologicals, Centennial, CO; #NB 100-132) paired with secondar ' Alexafluor 594 (Ceil Signaling Technology, #8890S). For tissues involved in both genomic assays and imaging, one fresh coronal slice including caudate putamen, hut anterior to the GPe, was fixed in 4% PFA for 24 hours. Tissues were stained with primary anti-tyrosine hydroxylase (Pelfreez, Rogers, AR; #P40101-150) and secondary Alexafluor 647 (Tnvitrogen, #A-31573) to assess dopamine levels in the striatum. All imaging sections were mounted onto slides using ProLong Diamond Antifade mounting media (Life Technologies Corp., Rockville, MD; #P36961) and imaged with con local microscopy.
Image analysis. Single-channel and co-labeled ceils were manually counted for FIGS. 6A-6C and FIG. 91). To quantify the levels of tyrosine hydroxylase as a proxy for dopamine depletion, mean pixel intensity was measured with Fiji (Schindelin et al , Nat Methods 9:676-682, 2019). Measurements were performed on one 500 x 500um square from the striatum of each hemisphere.
Nuclei collection. Fresh mouse brain tissue was sliced on a vibratome in cold, oxygenated artificial cerebrospinal fluid. Brain regions of interest were then dissected under a light microscope and transferred into cold ATAC-seq lysis buffer (Buenrostro et al. 2015, supra). The nuclei were extracted from each tissue using 30 strokes of loose pestle dounce homogenization, followed by 70 pm filtration and one centrifugation wash for 10 minutes at 2000 x g.
Affinity Purification of SUN1GFP+ nuclei. The nuclei suspension was pre-cleared for 10-15 minutes with Protein G Dynabeads (Thermo Fisher Scientific, Waltham, MA; cat. 10004D) to remove nuclei or debris that had native affinity for the beads. Free nuclei were incubated with anti-GFP antibody (Invitrogen, #G10362) for 30 minutes before fresh beads were added to the reaction and incubated for another 20 minutes. All incubations took place at 4°C with 40 rpm end-to-end rotation. After this process, the bead-bound nuclei (SUN 1GFP+ fraction) were purified and washed on a magnet, while the unbound nuclei were spun down and resuspended in water to preserve the SU 1GFP- fraction.
RNA-seq library construction. After setting aside 50,000 nuclei for ATAC-seq, total RNA was extracted from all remaining nuclei in each sample using the QIAGEN
RNEASY® Micro Kit. (QIAGEN, Germantown, MD). Total RNA (10 pg to 10 ng per sample) was processed using the OVATION® SoLo RNA-seq System with mouse
AnyDeplete® (T'ecan, Redwood City, CA; cat. 0501-32) to remove ribosomal RNA. Because many nuclear transcripts are immature, no poly A selection was performed. Libraries were paired-end sequenced at 3-9 million reads per sample on the NEXTSEQ™ 500 System (!ilumina, Inc., San Diego, CA).
RN A -seq processing. The sequencing output files were mapped to the mm 1 mouse genome assembly using Hisat2 and sorted. Duplicate UMIs were removed using NiiDup (online at gitlmb.com/tecangenomics/nudup). The quality of the filtered data was assessed using Picard CoileetRnaSeqMetrics (online at broadinstitute.github.io/picard). A counts per gene per sample matrix was constructed using Rsubread featureCounts (Liao and Smyth, Nucleic Acids Res 47:e47, 2019) for input into DESeq2 (Love et al., supra).
AT AC -seq library construction. A small subset of nuclei was stained with DAPI and fluorescent nuclei were manually counted using a hemocytometer. About 50,000 nuclei were transferred to a new tube in 22.5pl water and mixed with 2,5m1 Tagment DNA Enzyme 1 and 25 mΐ Tagment DNA Buffer (i!lumina, cat. 20034198). The tn5 transposition reaction was carried out at 37°C, 300 rpm for 30 minutes. After tagmentation, the samples were taken through column purification, amplification, and double-sided size selection (100-1000 bp) with AmpureXP beads (Beckman Coulter, Indianapolis, IN; cat. A63881). To reduce amplification bias, a side qPCR reaction was evaluated for each sample to determine the optimal number of PCR cycles for each sample to reach 1/3 maximum intensity. The samples were pooled and paired-end sequenced on a Novaseq 6000 (Alumina) to about 25 million unique, non-mitochondrial reads per sample.
ATAC-seq processing. The fastq files from each sample were processed with the ENCODE ATAC-seq pipeline (online at github.com/kundajelab/atac dnase pipelines). Peaks were called on biological replicates of the same cell type, brain region, and treatment with an Irreproducible Discovery Rate (IDR) threshold 0.1
(github.com/kundajelab/idr; Li et al., Annals Appl Stat 5(3): 1752-1779, 2011). The merged union of IDR peaks of the relevant cell populations were evaluated for differential accessibility using DESeq2 (Love et al., supra), where the reads per peak for each sample were quantified using Rsubread featureCounts (Liao and Smyth, supra) on the filtered bam alignments. For analysis of cellular identity (FIGS. 7A-7C and 8A-8F), the regions tested were the union of IDR peaks from all sham animal samples. For FIG.
8E, instead of ATAC-seq peaks, counts were computed over lOkb windows around the
transcription start sites for all genes assessed in the RNA-seq analysis. For assessment of DD-affected regions (FIG, 1Q), six separate count tables were constructed for the six cell populations and represented the union of IDR peaks from sham and DD animals for the given cell type and brain region
snATAC-seq and snRNA-seq processing. To compare cSNAIL-isolated cell types with single nucleus sequencing data, two publicly available datasets from adult mouse cortex were reprocessed lOx snATAC-seq data was downloaded and processed following the Signac vignete for the purposes of FIG. 7B (online at github.com/timoast/signac).
For the snRNA-seq comparison, raw count matrices derived from lOx chromium v3 experiments conducted in primar motor cortex were downloaded from NEMO
(portal.nemoarchive.org). The sample meta data is provided online at
drive .google .com/open ?id= 1 uDeGI-IPZoiX4aY GNZ 1 WFcGWj aNqTHCd. Empty droplets were removed using the DropletUtils package (Griffiths et al., Nat Commun 9:2667, 2018) defaultDrops method. Doublets were predicted and removed using the SCDS package (Bars et al.. Bioinformatics 36: 1 150-1 158, 2019) cxds foods hybrid method with score cutoff of 1 .0. The UMI count values were normalized using pooled size factor normalization (Lun et al., Genome Biol 17:75, 2016) implemented in the Scran package (Lun et al., FI 000 Res 5:2122, 2016). Size factor normalization requires a preclustering step which was computed using the Scanpy (Wolf et al ., Genome Biol 19: 15, 2018) package’s Leiden community detection algorithm (Traag et al., Sci Rep 9:5233, 2018). To create the l MA P (Meinnes et al., arXiv 1802.03426, 2018) for visualization the Scanpy package was also used. Principle components were computed on the top 7500 most variable genes. The UMAP was then computed based on the PCA reduced single nucleus gene expression matrix.
Experimental Design and Statistical Analysis. The statistical methods used for the quantification of cSNAIL specificity and efficiency by imaging co-fluorescence are described in the description of FIG. 6A-6D. For molecular assessment of cSNAIL isolated cell fractions (FIGS. 7A-7C and 8A-8F), data were collected from two sham animals, one male and one female. Differentially expressed genes and differentially accessible ATAC-seq regions between SUN 1GFP+ and SUN1GFP- samples in each brain region were assessed using the negative binomial model in DESeq2: read count = ~ sex + SUNlGFPstatus. To restrict DESeq2 dispersion estimates to the relevant samples, each model was built separately and only included the samples from one brain region.
For comparing cSNAIL ATAC-seq markers to snATAC-seq cluster markers (FIG. 7B), the hypergeometric enrichment test was used, sampling cell type-specific cSNAIL peaks in each brain region from an expected frequency of cluster-specific snATAC-seq peaks. Only the set of peaks present in both data (112,082) were evaluated. For simplicity, cluster-specific peaks from all excitatory neuron clusters were combined into one category'. For visualization, the hypergeometric test enrichments were converted into a z-score for each cSNAIL cell population and plotted using gplots heatmap.2 m R (online at github.com/talgalili/gplots). Annotation enrichments were assessed in differentia] gene sets using g:Profiler (FIG. 8C) (Peterson et al, supra).
Differential motif enrichment analyses was performed with AME (McLeay and Bailey, supra), with peak sets of interest summit-centered and unified to 500 bp. Where more than one summit was called within a peak and these summits were more than 100 bp apart, both entries were included in the analysis. Enrichments were assessed relative to a background of all ATAC-seq peaks in that ceil type or population.
Unless otherwise noted, molecular comparisons between DD and sham animals were conducted with data from two sham animals and four DD animals. Both treatment groups consisted of equal numbers of males and females. The three female animals were littermates at 12 weeks of age at endpoint and the three male animals were littennates 9 weeks of age, all from the same colony. Animals were euthanized consistently in the morning, 2-3 hours after the light cycle began. ATAC-seq and RNA-seq were performed on partitions of the same source pools of nuclei.
Sample similarities for RNA-seq and ATAC-seq were assessed by principal component analysis (PCA) and hierarchical clustering in DESeq2 (FIGS. 11A-11B, and 12A-12D). Because transcript levels are quantitative, the RNA-seq counts were modeled continuously according to the anti-TH imaging intensities of each animal, which reflect the extent of DD: DESeq2 read count = ~ sex + THintensity. To follow up on RNA-seq results related to Hif2a, image quantification was performed as noted in the description of FIGS. 10A-10C and related results. For DD-affected open chromatin analyses (Fig. 10A- 10C), a binary' model of treatment state (DD vs. saline) was used, controlling for sex differences: DESeq2 read count ::: ~ sex + treatment. Again, models for each cell population were built separately and only included samples for one comparison. DD- affected ATAC-seq peak sets were subjected to pathway enrichment analysis using
GREAT version 3.0.0 (McLean et al., Nat Biotechnol 28:495-501, 2010) and motif enrichment using AME as described above.
Results
cSNAIL isolates Cre÷ nuclei with high precision. cSNA!L technology is a viral strategy for labeling and isolating the nuclei of Cre-expressing cells. The cSNAIL viral genome expresses a nuclear envelope anchored GFP fusion protein a Cre-dependent manner. To achieve nuclei isolation compatible epigenomic profiling, a similar strategy to the SUN1GFP INTACT transgenic mouse strain (Mo et al , supra) was used. SIJN1 is a highly conserved nuclear envelope protein that helps connect the nucleoskeleton and the cytoskeieton (Haque et al., supra). Because of its tight association with the inner nuclear envelope, the SUN 1 GFP fusion protein localizes the GFP protein on the nuclear surface. This positioning allows for affini ty purification of nuclei, whereby after tissue is homogenized into a single-nuclei suspension, magnetic beads coated with anti-GFP antibody specifically bind SUN1GFP+ nuclei, thus separating them from SUN1GFP- nuclei. Several modifications to the INTACT mouse transgene design (described above) to package the cSNAIL SUN1GFP vector into AAV variant PHP.eB, which is capable of crossing the blood brain barrier to broadly transduce many cells in the central nervous system (Chan et al ., supra).
The ability of cSNAIL to drive Cre-specific nuclear anchored independent labeling in Pvalb-2 A-Cre mouse lines was evaluated using imaging and molecular data (FIGS. 6A-6C and 7A-7C). Fluorescent imaging confirmed that cSNAIL promoted SUNTGFP expression that was properly localized to the nuclear envelope in tissue (FIG. 6A). The expression was sufficient to bind anti-GFP coated magnetic beads after tissue dissociation (FIG. 6B). To quantify the ability' of cSNAIL to correctly target Cre+ cells, the expression of cSNAIL was compared to the expression of Cre reporter tdTomato of the Ail4 mouse strain (FIG. 6C). For the purposes of tins analysis, virus specificity was defined as the percent of SUNTGFP+ ceils that also expressed tdTomato, and virus efficiency was defined as the percent of tdTomato+ cells that also expressed SUN 1 GFP. cSNAIL exhibited very strong (>94%) specificity in the cortex, striatum, and GPe. The efficiency ranged from 53% to 81%, reflecting the expected transduction of the viral capsid in these brain regions (Chan et al., supra).
After affinity purification, bead-bound nuclei and free nuclei were counted using a manual hemocytometer on a fluorescent microscope to determine the purity and yield of cSNAIL nuclei isolation. Of the nuclei bound to beads, 97.18% had observable
SUN 1GFP expression. Based on the numbers of SUN 1GFP+ nuclei in the bound and unbound fractions, it was estimated that the bound fraction captured up to 65% of the total SUN1GFP+ nuclei. These results demonstrated that nuclei isolation with cSNAIL was as good as SUN1GFP nuclei affinity purification using transgenic expression.
To confirm the molecular identity of the cSNAIL-isolated nuclei from Pvaih-2A- Cre mice, ATAC-seq and RNA-seq from sham animal SUN1GFP+ and SUN1GFP- fractions were compared to publicly available PV+ and PV- data. cSNAIL ATAC-seq and RNA-seq exhibited the expected cell type-specific patterns at the Pvalb locus compared with signals from INTACT -isolated populations (Mo et a!., supra) (FIG. 7A). When comparing die identified cell type-specific ATAC-seq markers to single nucleus
(sn)ATAC-seq clusters from the adult mouse cortex (github.com/timoast/signac), the SUN 1GFP+ peaks from each brain region were enriched for PV+ cluster markers (FIG. 7B). Aligning with the expected ceil type proportions in each brain region, SUNIGFP- fractions were most enriched for snATAC-seq markers of excitatory neuron clusters (cortex only) and glial clusters.
Comparison of cSNAIL RNA-seq in Pvalb-2A-Cre mice with mouse cortex snRNA-seq further corroborated the desired enrichment. For this analysis, cSNAIL SUN1GFP+ and cSNAIL SUN1GFP- gene expression signatures (i.e., strongly differentially expressed genes) were defined in the cortex. snRNA-seq cells were then assessed for similar expression patterns by scoring their expression of the cSNAIL SUN 1GFP+ gene signature (FIGS. 7C, 13A, and 13B). The SUN 1GFP+ scores were computed by averaging across the scaled (0 mean centered, unit variance) expression of signature genes across all cells. As expected, cells in the PV+ intemeuron cluster (circled in FIG. 13B) had the strongest expression of the cSNAIL SUN 1GFP+ gene signature, followed by other intemeuron clusters. These comparisons provided evidence that cSNAIL SUN1GFP+ samples are indeed strongly enriched for PV+ neurons. Therefore, throughout the remainder of this Example, cSNAIL SUN1GFP+ and SUN1GFP- cells are referred to as PV+ and PV- cells, respectively.
Molecular signatures of cSNAIL-isolated PV+ andPV- cells. In each brain region, hundreds of differentially expressed genes and thousands of differentially accessible
ATAC-seq regions were recovered between PV+ and PV- ceil populations (FIGS. BA SF) 35 PV+ and 29 PV- marker genes with high specificity (DESeq2 padj < 0.01 and iLFCj > 1 ) across all three tissues were defined. Of these genes, a small number also had corresponding cell type-specific chromatin accessibility within a lOkb window around the gene transcription start site, including those highlighted in FIGS. SB and 8E. The PV+ marker genes Coro6, Flt3, and Cacna2d2 also tended to be restricted to PV+ clusters in Drop Viz snRNA-seq from the mouse cortex, striatum, and globus pallidus, although Cacna2d2 also was prevalent in Chat neurons (FIG. 14 A) (Saunders et al, Cell 174: 1015- 1030. e!6, 2018) This further demonstrated that cSNAIL enrichment for PV+ neurons was generalized to brain regions outside the cortex. PV- gene expression signatures that were consistent across all three brain regions appeared to be dominated by glial cells, especially oligodendrocytes (e.g , Hepacam and Kcnj 10) (FIG. 14B). This was not surprising given that neuron composition varies greatly between the cortex, striatum, and GPe. Functional gene enrichment on pan-PV+ and pan-PV- differential genes was consistent with these observations, implicating neuron-related pathways among PV+ genes and glial pathways among PV- genes (FIG. 8C).
Next, studies were conducted to identify transcription factor binding motifs that might play a role in epigeneticaliy defining PV neurons, by testing for enriched motifs in sequences underlying PV+ and PV- specific ATAC-seq peaks each brain region (FIG. 8F). Among the most significantly enriched PV+ motifs in all three brain regions was Tcef3, which was previously implicated in PV+ neuron-specific gene regulation (Mo et al, supra). Additionally, consistent PV+ enrichment for the Esrrg and Hoxa2 motifs was observed. The Esrrg transcript itself also was upregulated in PV+ neurons in all three brain regions (padj < 0.001), but Tcef3 or Hoxa2 were not. Consistent PV- motif enri chments across all brain regions included the motif for Sox 10, which is necessary for the differentiation and survival of oligodendrocytes (Pozniak et al., Proc Natl Acad Sci USA 107:21795-21800, 2010; and Takada et al., Glia 58:996-1006, 2010). There also were significant enrichments for many other Sox family motifs and the Meisl motif among PV- ATAC-seq sequences. The representation of glial signatures among PV- cell ATAC-seq and RNA-seq indicates that the nuclei dissociation during cSNAIL affinity purification was not restricted to neurons.
Gene expression differences in dopamine depleted animals. Striatal tissue from 6-
OHDA lesioned animals had significantly lower levels of dopamine production enzyme
tyrosine hydroxylase than sham animals, indicating successful depletions (FIGS. 11A- IIB). All depletions were bilateral except in one animal, DD2, where one hemisphere was only weakly depleted. The RNA-seq data was high quality for all samples except one striatum PV- sample from a DD animal, winch was excluded from the analysis. Samples were separated by tissue and cell type in PCA and hierarchical clustering, indicating higher variability between cell types than between biological replicates (FIGS. 15A and 15B).
In the RNA-seq data from DD and sham animals, very few significant DD- affected genes were recovered in any cortical cell types, striatal cell types, or the GPe PV- population. In contrast, GPe PV+ neurons contained 29 differentially expressed genes in DD (pa j < 0.05) (FIGS. 9 A and 9B). It was readily apparent that there were many genes involved in cellular oxygen homeostasis and neuroprotection among the fourteen genes that were upregulated in the GPe PV+ neurons of DD animals. These included Epasl, which encodes for Hypoxia-inducible factor 2 alpha (transcription factor Hif2a), and three of its targets: Cp, Slc2al, and Fit I (Schofield and Ratcliffe, Nat Rev Mol 5:343-354,
2004; Dengler et a!., Crit Rev Biochem Mol Biol 49: 1-15, 2015; and Smeyne et al, Neurosci 295:23-38, 2015) (FIG. 9C). The downregulated set also included Elob, a moderator of free oxygen sensing that inhibits Hif2a (Ohh et ah, Nat Cell Biol 2:423-427, 2000). These results suggested that GPe PV+ neurons may react to DD through hypoxia- inducible factor (HIT) signaling and associated transcriptional response.
To see whether increased Epasl transcription in GPe PV+ neurons was accompanied by increased Hif2a protein levels, double immuno-fluorescent staining for Pvalb and Hi£2a was performed in healthy and DD mouse tissue. Indeed, a higher proportion of GPe PV+ neurons expressed Hif2a in images from DD animals compared with healthy animals (FIGS. 91) and 16). The change in mean proportion was 1 1.3% and this difference was significant (t-test, p = 0.007).
Other differentially expressed genes in the GPe PV+ neurons of DD mice have also been implicated in processes of neurodegeneration and/or neuroprotection. For example, overexpression of Timp3, a key inhibitor of matrix metalloproteinases that contribute to dopaminergic neuron apoptosis in PD (Kim et al., FASEB .721 : 179-187, 2007), was observed. Timp3 expression in neurons is protective against blood-brain barrier damage, but high levels of Timp3 can lead to cell death (Rosenberg, Lancet
Neurol 8:205-216, 2009). Lpcat3, a gene found to have reduced expression in GPe PV+
neurons upon DD, is necessary for ferroptosis, which has been linked to
neurodegeneration in PD and Alzheimer’s disease (Angeli et al.. Cell 171 :273-285, 2017). Due to the small number of regulated genes, functional enrichment for specific pathways was low.
Open chromatin differences in dopamine depleted animals. Based on standard QC metrics (see above), the ATAC-seq data was high quality for all samples except one cortex PV+ sample from a DD animal, which was excluded from the analysis (FIGS. 12A-12D). In DD animals, a small number of confident open chromatin changes were observed in PV+ cell types, and many changes were observed within PV- cell types that met significance at a cutoff of adj < 0.05 (FIG, lOA). The DD-affected open chromatin regions in different cell types had some redundancy, but the majority were cell type- specific at the level of the individual regulatory element (FIG. 17). However, DD- affected regions in multiple cell types tended to converge around areas of the genome enriched for certain functions including neurotransmission, immune response, and the methionine cycle (FIG. 18)
Further studies were conducted to assess whether the observed differences in open chromatin could be responsible for the transcriptional differences observed in the GPe PV+ population. Genes with increased expression in DD had higher levels of open chromatin nearby (hypergeometric p=0 0003), while genes that decreased in expression had lower levels (hypergeometric p=Q.002) (FIG. 19). However, there were no overlaps in the most significantly differential genes and peaks.
Due to the increased expression of HIF-related transcripts in GPe PV+ neurons in DD, it was hypothesized that changing open chromatin regions in this cell type would contain H1F transcription factor binding motif sites. Upon acti vation, Hifa subunits heterodimerize with Hifb and the complex binds regulatory elements in the genome to affect transcription. Therefore, a motif enrichment analysis was conducted for four HIF family motifs with Fisher’s exact test statistics. These included the JASPAR motifs for (i) Hifla (MAI 106.1), which has core motif redundancy with Hi£2a (Schodei et ah, Nat Rev Mol 5:343-354, 201 1), (ii) Amt aka Hiflb (MA0004.1), (iii) the Hifa-Hifb complex (MA0259.1), and a related Hifa binding partner Arntl (M0603.1 ) (FIG. 10B). Because there are few examples of DD-affected PV+ peaks at this threshold, PV+ enrichments were assessed within peaks that met a more lenient threshold of adjusted p-value < 0.2 in
DESeq2. As predicted, all four motifs were highly enriched within GPe PV+ DD-
increasing peaks (the set of ATAC-seq peaks with increased accessibility upon DD)
(FIG. IOC). Moreover, the motifs were not enriched in DD-increasing peak sets from other cell types with the exception of some weaker enrichment in Striatal PV+ neurons. Finally, sets of ATAC-seq peaks with decreased accessibility in DD (DD-decreasmg) were not enriched for HIF motifs in any cell type including GPe PV+. These results provided further support for a cell type-specific induction of HIF signaling in GPe PV+ neurons upon DD.
To assess which additional transcription factors may be involved in the epigenetic response to DD, the analysis was extended to all motifs within the non-redundant IAS PAR 2018 core vertebrates database (Khan et al., supra). Specific to DD-increasing GPe PV+ peaks and to a lesser extent also DD-increasing Striatal PV+ peaks, an enrichment for Ets-related transcription factor motifs including Gabpa was observed (GPe Padj ::: 1.25e-30; Striatum padj ::: 1.41e-10). Gabpa is an essential regulator of many cellular respiration genes, including multiple cytochrome c oxidase subunits (Ongwijitwat et al., Gene 374:39-49, 2006).
DD-affected open chromatin regions in other cell types contained enrichments for several additional transcription factor binding motifs. Notably, DD-increasing peak sets in every cell population except for GPe PV+ were all enriched for the binding motifs of glucocorticoid receptor transcription factors Nr3cl , Nr3c2, and Ar (padj < 0.01).
Glucocorticoid receptors are emerging as key regulators of neuroinflammation and disruption of their proper regulation is thought to play a role in the onset of PD by allowing the infiltration of eytotoxins in the SNpc (Herrero et al., Front Neuroamt 9: 1- 12, 2015). These findings were consistent with similar stressors in the cortex, striatum, and GPe, which may contribute to the progression of PD.
OTHER EMBODIMENTS
It is to be understood that while the invention has been described in conj unction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
Claims
1. A nucleic acid construct comprising;
(a) a sequence encoding a tagged Sunl fusion polypeptide, wherein the tagged Sunl fusion polypeptide consists essentially of (i) an N -truncated fragment of a Sunl gene, wherein the fragment encodes at least a portion of a portion of a Sunl protein, and wherein the portion of the Sun l protein is 400 to 600 amino acids in length, and (li) a sequence encoding a tag polypeptide, and
(b) a promoter sequence specific for a selected ceil type,
wherein the promoter sequence is operably linked to the sequence encoding the tagged Sunl fusion polypeptide, and is effective to drive expression of the sequence encoding the tagged Sunl fusion polypeptide in the selected cell type.
2. The nucleic acid construct of claim 1, wherein the N-truncated fragment of the Sunl gene encodes a polypeptide with at least 95% sequence identity to amino acids 208- 757 of the mouse Sunl protein having the amino acid sequence set forth in SEQ ID NO: 1.
3. The nucleic acid construct of claim 1, wherein the tag polypeptide is a fluorescent polypeptide.
4. The nucleic acid construct of claim 3, wherein the fluorescent polypeptide is a green fluorescent protein (GFP).
5. Hie nucleic acid construct of claim 4, wherein the amino acid sequence of the GFP is at least 95% identical to the superfolder GFP sequence set forth in SEQ ID NO:2.
6. The nucleic acid construct of claim 1, wherein the construct further comprises virus sequences.
7. The nucleic acid construct of claim 6, wherein the vims sequences are adeno- associated virus (AAV) sequences or !entivirus sequences.
8. The nucleic acid construct of claim 1, wherein the promoter sequence is specific for parvalbumin positive (PV+) neurons, such that the sequence encoding the tagged Sunl fusion polypeptide is expressed in PV+ neurons but not expressed in at least 90% of parvalbumin negative (PV-) neurons.
9. A nucleic acid construct comprising:
(a) a sequence encoding a tagged Sun ! fusion polypeptide, wherein the tagged Sun! fusion polypeptide consists essentially of (i) an N-tnincated fragment of a Sun! gene, wherein the fragment encodes a portion of a Sun! protein, and wherein the portion of the Sim! protein is 400 to 600 amino acids in length, and (ii) a sequence encoding a tag polypeptide,
(b) a first lox sequence flanking the 5' end of tire sequence encoding the tagged Sim! fusion polypeptide and a second lox sequence flanking the 3' end of the sequence encoding the tagged Sun 1 fusion polypeptide, and
(c) a promoter sequence downstream of the lox sequence flanking the 3' end of the sequence encoding the tagged Sun! fusion polypeptide, such that the sequence encoding the tagged Suni fusion polypeptide is in reverse orientation with respect to the promoter.
10. The nucleic acid construct of claim 9, wherein the N-tnmcated fragment of the Sunl gene encodes a polypeptide with at least 95% sequence identity to amino acids 208- 757 of the mouse Sunl protein having tire ammo acid sequence set forth in SEQ ID NQ: 1.
11. The nucleic acid construct of claim 9, wherein the tag polypeptide is a fluorescent polypeptide.
12. The nucleic acid construct of claim 11, wherein the fluorescent polypeptide is a
GFP.
13. The nucleic acid construct of claim 12, wherein the ammo acid sequence of the GFP is at least 95% identical to the superfolder GFP sequence set forth in SEQ !D NO:2.
14. The nucleic acid constract of claim 9, wherein the construct further comprises vims sequences.
15. The nucleic acid construct of claim 14, wherein the virus sequences are AAV sequences or lentivirus sequences.
16. A virus particle comprising the nucleic acid construct of claim 1
17. The vims particle of claim 16, wherein the virus is AAV or lentivirus.
18 A virus particle comprising the nucleic acid construct of claim 9.
19. The vims particle of claim 18, wherein the virus is AAV or lentivirus.
20. A method for labeling a selected cell type within a population of different cell types, comprising introducing into the population of different cell types a nucleic acid construct comprising:
(a) a sequence encoding a tagged Sunl fusion polypeptide, wherein the tagged Sunl fusion polypeptide consists essentially of (i) an N -truncated fragment of a Sunl gene, wherein the fragment encodes at least a portion of a portion of a Sunl protein, and wherein the portion of the Sun l protein is 400 to 600 amino acids in length, and (li) a sequence encoding a tag polypeptide, and
(b) a promoter sequence specific for a selected cell type,
wherein the promoter sequence is operably linked to the sequence encoding the tagged Sunl fusion polypeptide, and is effective to drive expression of the sequence encoding the tagged Sunl fusion polypeptide in the selected cell type, and
wherein the tagged Sunl fusion polypeptide is expressed in and thereby labels the selected cell type.
21. The method of claim 20, wherein the N -truncated fragment of the Sunl gene encodes a polypeptide with at least 95% sequence identity to ammo acids 208-757 of the mouse Sunl protein having the amino acid sequence set forth in SEQ ID NO: 1.
22. The method of claim 20, wherein the tag polypeptide is a fluorescent polypeptide.
23. The method of claim 22, wherein the fluorescent polypeptide is a GFP.
24. The method of claim 23, wherein the amino acid sequence of the GFP is at least
95% identical to the superfolder GFP sequence set forth in SEQ ID NO:2.
25. The method of claim 20, wherein the construct further comprises virus sequences.
26. The method of claim 25, wherein the virus sequences are AAV sequences or lentivirus sequences.
27. The method of claim 20, wherein the promoter sequence is specific for PV+ neurons, such that the sequence encoding the tagged Sunl fusion polypeptide is expressed in PV+ neurons but not expressed in at least 90% of PV- neurons.
28. A method for labeling a selected cell type within a population of different cell types, comprising:
(a) introducing into the popul ation of different cell types:
(i) a first nucleic acid construct comprising:
(1) a sequence encoding a tagged Sunl fusion polypeptide and (2) a sequence encoding a tag polypeptide, wherein the tagged Sunl fusion polypeptide consists essentially of an N-tnincated fragment of a Sunl gene, wlierein the fragment encodes a portion of a Sunl protein, and wherein the portion of the Sunl protein is 400 to 600 amino acids in length, and
(2) a first lox sequence flanking the 5' end of the sequence encoding the tagged Sunl fusion polypeptide and a second lox sequence flanking the 3' end of the sequence encoding the tagged Sunl fusion polypeptide, and
(3) a promoter sequence downstream of the lox sequence flanking the 3' end of the sequence encoding the tagged Sunl fusion polypeptide, such that the sequence encoding the tagged Sun l fusion polypeptide is in reverse orientation with respect to the promoter, and
(ii) a second nucleic acid construct comprising a sequence encoding a Cre recombinase operab!y linked to a promoter sequence specific for the selected cell type, and
(fa) incubating the population of different cell types under conditions in which the Cre recombinase is expressed in the selected cell type, wherein the expressed Cre recombinase excises the sequence encoding the tagged Sunl fusion polypeptide from the nucleic acid construct and irreversibly re-inserts the sequence encoding the tagged Sunl fusion polypeptide in the correct orientation for expression in the selected cell type.
29. The method of claim 28, wherein the N-truncated fragment of the Sun! gene encodes a polypeptide with at least 95% sequence identity to amino acids 208-757 of the mouse Sunl protein having the amino acid sequence set forth in SEQ ID NO: 1.
30. Die method of claim 28, wherein the tag polypeptide is a fluorescent polypeptide.
31. The method of claim 30, wherein the fluorescent polypeptide is a GFP.
32. The method of claim 31, wherein the am ino acid sequence of the GFP is at least
95% identical to the superfolder GFP sequence set forth m SEQ ID NO:2.
33. The method of claim 28, wherein the construct further comprises virus sequences.
34. The method of claim 33, wherein the virus sequences are AAV sequences or lentivirus sequences.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/618,798 US12624073B2 (en) | 2019-06-18 | 2020-06-18 | Specific nuclear-anchored independent labeling system |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962921452P | 2019-06-18 | 2019-06-18 | |
| US62/921,452 | 2019-06-18 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2020257516A2 true WO2020257516A2 (en) | 2020-12-24 |
| WO2020257516A3 WO2020257516A3 (en) | 2021-01-28 |
Family
ID=74037326
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/038520 Ceased WO2020257516A2 (en) | 2019-06-18 | 2020-06-18 | Specific nuclear-anchored independent labeling system |
| PCT/US2020/038528 Ceased WO2020257520A1 (en) | 2019-06-18 | 2020-06-18 | Specific nuclear-anchored independent labeling system |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/038528 Ceased WO2020257520A1 (en) | 2019-06-18 | 2020-06-18 | Specific nuclear-anchored independent labeling system |
Country Status (2)
| Country | Link |
|---|---|
| US (2) | US20220310206A1 (en) |
| WO (2) | WO2020257516A2 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12624073B2 (en) | 2019-06-18 | 2026-05-12 | Carnegie Mellon University | Specific nuclear-anchored independent labeling system |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024133344A1 (en) * | 2022-12-20 | 2024-06-27 | Novozymes A/S | A method for providing a candidate biological sequence and related electronic device |
| WO2024173944A1 (en) * | 2023-02-17 | 2024-08-22 | Carnegie Mellon University | Prioritizing candidate cell type-specific enhancers through comparative genomics |
| CN117976097B (en) * | 2024-02-05 | 2025-05-06 | 广州质量监督检测研究院 | Establishment and application method, device and equipment of glucocorticoid mass spectrum database |
| WO2025184402A1 (en) * | 2024-02-27 | 2025-09-04 | Carnegie Mellon University | Regulatory elements for targeted expression of cargo genes in neurons |
| CN119920311B (en) * | 2025-01-24 | 2025-12-26 | 广州国家实验室 | Single-cell data quality control processing method and system |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA1293460C (en) * | 1985-10-07 | 1991-12-24 | Brian Lee Sauer | Site-specific recombination of dna in yeast |
| US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
| WO2006091638A2 (en) | 2005-02-22 | 2006-08-31 | The Regents Of University Of California | Circular permutant gfp insertion folding reporters |
| WO2011159713A2 (en) * | 2010-06-14 | 2011-12-22 | Fred Hutchinson Cancer Research Center | Compositions and methods for gene expression and chromatin profiling of individual cell types within a tissue |
| US8429102B2 (en) | 2011-03-31 | 2013-04-23 | Mitsubishi Electric Research Laboratories, Inc. | Data driven frequency mapping for kernels used in support vector machines |
| GB201701438D0 (en) * | 2017-01-30 | 2017-03-15 | Univ Durham | Skine tissue |
| WO2019143300A1 (en) * | 2018-01-19 | 2019-07-25 | Agency For Science, Technology And Research | Disrupting the linc complex for treating laminopathy |
| US20220310206A1 (en) | 2019-06-18 | 2022-09-29 | Carnegie Mellon University | Specific Nuclear-Anchored Independent Labeling System |
-
2020
- 2020-06-18 US US17/619,783 patent/US20220310206A1/en active Pending
- 2020-06-18 WO PCT/US2020/038520 patent/WO2020257516A2/en not_active Ceased
- 2020-06-18 US US17/618,798 patent/US12624073B2/en active Active
- 2020-06-18 WO PCT/US2020/038528 patent/WO2020257520A1/en not_active Ceased
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12624073B2 (en) | 2019-06-18 | 2026-05-12 | Carnegie Mellon University | Specific nuclear-anchored independent labeling system |
Also Published As
| Publication number | Publication date |
|---|---|
| US20220310206A1 (en) | 2022-09-29 |
| WO2020257516A3 (en) | 2021-01-28 |
| US12624073B2 (en) | 2026-05-12 |
| WO2020257520A1 (en) | 2020-12-24 |
| US20220235102A1 (en) | 2022-07-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12624073B2 (en) | Specific nuclear-anchored independent labeling system | |
| Otero et al. | Transcriptome alterations in myotonic dystrophy frontal cortex | |
| Bertolini et al. | Mapping the global chromatin connectivity network for Sox2 function in neural stem cell maintenance | |
| Hale et al. | FMRP regulates mRNAs encoding distinct functions in the cell body and dendrites of CA1 pyramidal neurons | |
| Zheng et al. | Massively parallel in vivo Perturb-seq reveals cell-type-specific transcriptional networks in cortical development | |
| Riccomagno et al. | The RacGAP β2-Chimaerin selectively mediates axonal pruning in the hippocampus | |
| JP2022513426A (en) | Artificial expression constructs for selectively regulating gene expression in cortical excitatory neurons | |
| Kolanczyk et al. | NOA1 is an essential GTPase required for mitochondrial protein synthesis | |
| Daswani et al. | MicroRNA-138 controls hippocampal interneuron function and short-term memory in mice | |
| Cardeira-da-Silva et al. | Antigen presentation plays positive roles in the regenerative response to cardiac injury in zebrafish | |
| Smith et al. | Expanded insights into mechanisms of gene expression and disease related disruptions | |
| Yin et al. | Genes and signaling networks regulated during zebrafish optic vesicle morphogenesis | |
| Lawler et al. | Cell type-specific oxidative stress genomic signatures in the globus pallidus of dopamine-depleted mice | |
| JP2022525477A (en) | Multiplexing of regulatory elements to identify cell-type-specific regulatory elements | |
| Rehn et al. | PTBP1 promotes hematopoietic stem cell maintenance and red blood cell development by ensuring sufficient availability of ribosomal constituents | |
| WO2009114700A2 (en) | Cell model of neurodegenerative disease and methods of use thereof for identifying inhibitors of mitochondrial fusion | |
| US20160298114A1 (en) | Haplotype Based Generalizable Allele Specific Silencing for Therapy of Cardiovascular Disease | |
| US10702589B2 (en) | Compositions and methods of treating neurological disorder and stress-induced conditions | |
| JP2024534496A (en) | mRNA regulon therapy for the treatment of haploinsufficiency disorders | |
| Baulina et al. | Circular RNAs: biogenesis, functions, and role in myocardial hypertrophy | |
| CN108239642A (en) | A kind of relevant long non-coding RNA of Adipocyte Differentiation and its application | |
| CN104650214B (en) | Pulmonary hypertension pathogenic gene ACVRL1 mutation site and application thereof | |
| JP2025538153A (en) | Muscle-specific base editor for correcting mutations causing dilated cardiomyopathy | |
| CN116376975A (en) | Method for activating heterochromatin genes and application thereof | |
| JP2023518809A (en) | Method for modifying and isolating adeno-associated virus |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20827384 Country of ref document: EP Kind code of ref document: A2 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 20827384 Country of ref document: EP Kind code of ref document: A2 |