WO2020223475A1 - Methods and compositions involving tert activating therapies - Google Patents
Methods and compositions involving tert activating therapies Download PDFInfo
- Publication number
- WO2020223475A1 WO2020223475A1 PCT/US2020/030699 US2020030699W WO2020223475A1 WO 2020223475 A1 WO2020223475 A1 WO 2020223475A1 US 2020030699 W US2020030699 W US 2020030699W WO 2020223475 A1 WO2020223475 A1 WO 2020223475A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- tert
- subject
- polypeptide
- neurons
- therapy
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 107
- 238000002560 therapeutic procedure Methods 0.000 title claims abstract description 54
- 230000003213 activating effect Effects 0.000 title claims abstract description 39
- 239000000203 mixture Substances 0.000 title abstract description 43
- 208000024827 Alzheimer disease Diseases 0.000 claims abstract description 96
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 35
- 208000015122 neurodegenerative disease Diseases 0.000 claims abstract description 21
- 208000035475 disorder Diseases 0.000 claims abstract description 17
- 206010063493 Premature ageing Diseases 0.000 claims abstract description 13
- 208000032038 Premature aging Diseases 0.000 claims abstract description 13
- 108010017842 Telomerase Proteins 0.000 claims description 148
- 108090000623 proteins and genes Proteins 0.000 claims description 89
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 75
- 210000002569 neuron Anatomy 0.000 claims description 74
- 229920001184 polypeptide Polymers 0.000 claims description 64
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 64
- 150000007523 nucleic acids Chemical class 0.000 claims description 46
- 102000039446 nucleic acids Human genes 0.000 claims description 44
- 108020004707 nucleic acids Proteins 0.000 claims description 44
- 102000004169 proteins and genes Human genes 0.000 claims description 43
- 241000282414 Homo sapiens Species 0.000 claims description 35
- 230000000694 effects Effects 0.000 claims description 19
- 108020004414 DNA Proteins 0.000 claims description 14
- 230000013016 learning Effects 0.000 claims description 13
- -1 EHMTl Proteins 0.000 claims description 12
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 claims description 10
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 claims description 10
- 101000687346 Homo sapiens PR domain zinc finger protein 2 Proteins 0.000 claims description 9
- 102100024885 PR domain zinc finger protein 2 Human genes 0.000 claims description 9
- 208000025500 Hutchinson-Gilford progeria syndrome Diseases 0.000 claims description 8
- 208000007932 Progeria Diseases 0.000 claims description 8
- 230000009467 reduction Effects 0.000 claims description 8
- 102100023696 Histone-lysine N-methyltransferase SETDB1 Human genes 0.000 claims description 7
- 101000684609 Homo sapiens Histone-lysine N-methyltransferase SETDB1 Proteins 0.000 claims description 7
- 238000011374 additional therapy Methods 0.000 claims description 7
- PZPPOCZWRGNKIR-PNVYSBBASA-N chaetocin Chemical compound N([C@@H]1N2C(=O)[C@]3(CO)SS[C@]2(C(N3C)=O)C2)C3=CC=CC=C3[C@]12[C@@]12C[C@]3(SS4)C(=O)N(C)[C@]4(CO)C(=O)N3[C@H]2NC2=CC=CC=C12 PZPPOCZWRGNKIR-PNVYSBBASA-N 0.000 claims description 7
- PZPPOCZWRGNKIR-UHFFFAOYSA-N chaetocin Natural products C1C2(C(N3C)=O)SSC3(CO)C(=O)N2C2NC3=CC=CC=C3C21C12CC3(SS4)C(=O)N(C)C4(CO)C(=O)N3C2NC2=CC=CC=C12 PZPPOCZWRGNKIR-UHFFFAOYSA-N 0.000 claims description 7
- 239000003112 inhibitor Substances 0.000 claims description 7
- 230000015654 memory Effects 0.000 claims description 7
- 108010059128 rabies virus glycoprotein peptide Proteins 0.000 claims description 7
- 102100035043 Histone-lysine N-methyltransferase EHMT1 Human genes 0.000 claims description 6
- 108010033040 Histones Proteins 0.000 claims description 6
- 101000613629 Homo sapiens Lysine-specific demethylase 4B Proteins 0.000 claims description 6
- 101001088893 Homo sapiens Lysine-specific demethylase 4C Proteins 0.000 claims description 6
- 101001088895 Homo sapiens Lysine-specific demethylase 4D Proteins 0.000 claims description 6
- 101001050886 Homo sapiens Lysine-specific histone demethylase 1A Proteins 0.000 claims description 6
- 102100040582 Lysine-specific demethylase 3B Human genes 0.000 claims description 6
- 102100040860 Lysine-specific demethylase 4B Human genes 0.000 claims description 6
- 102100033230 Lysine-specific demethylase 4C Human genes 0.000 claims description 6
- 102100033231 Lysine-specific demethylase 4D Human genes 0.000 claims description 6
- 102100037465 Lysine-specific demethylase 7A Human genes 0.000 claims description 6
- 102100024985 Lysine-specific histone demethylase 1A Human genes 0.000 claims description 6
- 102100021299 Methyl-CpG-binding domain protein 2 Human genes 0.000 claims description 6
- 230000006872 improvement Effects 0.000 claims description 6
- 101000615488 Homo sapiens Methyl-CpG-binding domain protein 2 Proteins 0.000 claims description 5
- 230000002068 genetic effect Effects 0.000 claims description 5
- 206010003594 Ataxia telangiectasia Diseases 0.000 claims description 4
- 208000005692 Bloom Syndrome Diseases 0.000 claims description 4
- 208000010200 Cockayne syndrome Diseases 0.000 claims description 4
- 206010010356 Congenital anomaly Diseases 0.000 claims description 4
- 102100032865 General transcription factor IIH subunit 5 Human genes 0.000 claims description 4
- 101000655402 Homo sapiens General transcription factor IIH subunit 5 Proteins 0.000 claims description 4
- 208000028982 Nestor-Guillermo progeria syndrome Diseases 0.000 claims description 4
- 206010044628 Trichothiodystrophy Diseases 0.000 claims description 4
- 208000003059 Trichothiodystrophy Syndromes Diseases 0.000 claims description 4
- 201000011032 Werner Syndrome Diseases 0.000 claims description 4
- 201000006083 Xeroderma Pigmentosum Diseases 0.000 claims description 4
- 210000001185 bone marrow Anatomy 0.000 claims description 4
- 210000004443 dendritic cell Anatomy 0.000 claims description 4
- 210000002950 fibroblast Anatomy 0.000 claims description 4
- 230000030279 gene silencing Effects 0.000 claims description 4
- 210000005260 human cell Anatomy 0.000 claims description 4
- 208000008813 mosaic variegated aneuploidy syndrome Diseases 0.000 claims description 4
- FMURUEPQXKJIPS-UHFFFAOYSA-N n-(1-benzylpiperidin-4-yl)-6,7-dimethoxy-2-(4-methyl-1,4-diazepan-1-yl)quinazolin-4-amine;trihydrochloride Chemical compound Cl.Cl.Cl.C=12C=C(OC)C(OC)=CC2=NC(N2CCN(C)CCC2)=NC=1NC(CC1)CCN1CC1=CC=CC=C1 FMURUEPQXKJIPS-UHFFFAOYSA-N 0.000 claims description 4
- OWNQZZTXPWICRQ-UHFFFAOYSA-N 1-[2-[4-[(4-methoxyphenyl)-oxomethoxy]phenyl]ethyl]-2-[[oxo-[4-(trifluoromethyl)phenyl]methyl]amino]-5-benzimidazolecarboxylic acid Chemical compound C1=CC(OC)=CC=C1C(=O)OC(C=C1)=CC=C1CCN1C2=CC=C(C(O)=O)C=C2N=C1NC(=O)C1=CC=C(C(F)(F)F)C=C1 OWNQZZTXPWICRQ-UHFFFAOYSA-N 0.000 claims description 3
- UCGWYCMPZXDHNR-UHFFFAOYSA-N 2-benzamido-1-(3-phenylpropyl)-5-benzimidazolecarboxylic acid methyl ester Chemical compound C=1C=CC=CC=1C(=O)NC1=NC2=CC(C(=O)OC)=CC=C2N1CCCC1=CC=CC=C1 UCGWYCMPZXDHNR-UHFFFAOYSA-N 0.000 claims description 3
- QOECJCJVIMVJGX-UHFFFAOYSA-N 2-cyclohexyl-6-methoxy-N-(1-propan-2-yl-4-piperidinyl)-7-[3-(1-pyrrolidinyl)propoxy]-4-quinazolinamine Chemical compound N1=C(C2CCCCC2)N=C2C=C(OCCCN3CCCC3)C(OC)=CC2=C1NC1CCN(C(C)C)CC1 QOECJCJVIMVJGX-UHFFFAOYSA-N 0.000 claims description 3
- 102100022361 CAAX prenyl protease 1 homolog Human genes 0.000 claims description 3
- 102100035864 Histone lysine demethylase PHF8 Human genes 0.000 claims description 3
- 108091016366 Histone-lysine N-methyltransferase EHMT1 Proteins 0.000 claims description 3
- 101000824531 Homo sapiens CAAX prenyl protease 1 homolog Proteins 0.000 claims description 3
- 101001000378 Homo sapiens Histone lysine demethylase PHF8 Proteins 0.000 claims description 3
- 101000877314 Homo sapiens Histone-lysine N-methyltransferase EHMT1 Proteins 0.000 claims description 3
- 101000614020 Homo sapiens Lysine-specific demethylase 3B Proteins 0.000 claims description 3
- 101001025945 Homo sapiens Lysine-specific demethylase 7A Proteins 0.000 claims description 3
- 101150051032 Kdm3b gene Proteins 0.000 claims description 3
- 101150048064 kdm7a gene Proteins 0.000 claims description 3
- 101710158114 Histone-lysine N-methyltransferase Su(var)3-9 Proteins 0.000 claims description 2
- 101710186208 Histone-lysine N-methyltransferase, H3 lysine-9 specific Proteins 0.000 claims description 2
- 238000010253 intravenous injection Methods 0.000 claims description 2
- 230000003941 amyloidogenesis Effects 0.000 abstract description 4
- 230000016273 neuron death Effects 0.000 abstract description 3
- 102100032938 Telomerase reverse transcriptase Human genes 0.000 description 145
- 210000001808 exosome Anatomy 0.000 description 82
- 239000002502 liposome Substances 0.000 description 66
- 230000014509 gene expression Effects 0.000 description 52
- 210000004027 cell Anatomy 0.000 description 47
- 235000018102 proteins Nutrition 0.000 description 38
- 235000001014 amino acid Nutrition 0.000 description 37
- 150000001413 amino acids Chemical class 0.000 description 37
- 229940024606 amino acid Drugs 0.000 description 32
- 239000000306 component Substances 0.000 description 32
- 150000002632 lipids Chemical class 0.000 description 30
- 108020004999 messenger RNA Proteins 0.000 description 29
- 239000013598 vector Substances 0.000 description 29
- 241000699670 Mus sp. Species 0.000 description 26
- 230000004913 activation Effects 0.000 description 26
- 238000011282 treatment Methods 0.000 description 23
- 239000003814 drug Substances 0.000 description 22
- 241000699666 Mus <mouse, genus> Species 0.000 description 21
- 210000004556 brain Anatomy 0.000 description 20
- 230000001537 neural effect Effects 0.000 description 20
- 238000011825 3xTg-AD mouse Methods 0.000 description 18
- 150000003904 phospholipids Chemical class 0.000 description 18
- 239000000523 sample Substances 0.000 description 18
- 238000011818 5xFAD mouse Methods 0.000 description 17
- 101000655352 Homo sapiens Telomerase reverse transcriptase Proteins 0.000 description 17
- 239000003795 chemical substances by application Substances 0.000 description 17
- 201000010099 disease Diseases 0.000 description 16
- 230000001225 therapeutic effect Effects 0.000 description 16
- 210000003618 cortical neuron Anatomy 0.000 description 15
- 229940124597 therapeutic agent Drugs 0.000 description 15
- 101150047500 TERT gene Proteins 0.000 description 14
- 210000004295 hippocampal neuron Anatomy 0.000 description 14
- 238000006467 substitution reaction Methods 0.000 description 14
- 241000701161 unidentified adenovirus Species 0.000 description 14
- 230000001054 cortical effect Effects 0.000 description 13
- 230000006698 induction Effects 0.000 description 12
- 241000700605 Viruses Species 0.000 description 11
- 230000007935 neutral effect Effects 0.000 description 11
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 10
- 239000003153 chemical reaction reagent Substances 0.000 description 10
- 238000001727 in vivo Methods 0.000 description 9
- 230000007170 pathology Effects 0.000 description 9
- 230000037361 pathway Effects 0.000 description 9
- 239000008188 pellet Substances 0.000 description 9
- 238000012546 transfer Methods 0.000 description 9
- 238000005199 ultracentrifugation Methods 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 8
- 230000015572 biosynthetic process Effects 0.000 description 8
- 230000003197 catalytic effect Effects 0.000 description 8
- 238000004520 electroporation Methods 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 230000004770 neurodegeneration Effects 0.000 description 8
- 230000008569 process Effects 0.000 description 8
- 238000010173 Alzheimer-disease mouse model Methods 0.000 description 7
- 238000003559 RNA-seq method Methods 0.000 description 7
- 241000700584 Simplexvirus Species 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 210000003520 dendritic spine Anatomy 0.000 description 7
- 238000010172 mouse model Methods 0.000 description 7
- 239000002904 solvent Substances 0.000 description 7
- 230000008625 synaptic signaling Effects 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- 230000002103 transcriptional effect Effects 0.000 description 7
- 239000013603 viral vector Substances 0.000 description 7
- 230000003612 virological effect Effects 0.000 description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- SNKAWJBJQDLSFF-NVKMUCNASA-N 1,2-dioleoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC SNKAWJBJQDLSFF-NVKMUCNASA-N 0.000 description 6
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 6
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 6
- 101000655351 Mus musculus Telomerase reverse transcriptase Proteins 0.000 description 6
- 101900083372 Rabies virus Glycoprotein Proteins 0.000 description 6
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 6
- DKGAVHZHDRPRBM-UHFFFAOYSA-N Tert-Butanol Chemical compound CC(C)(C)O DKGAVHZHDRPRBM-UHFFFAOYSA-N 0.000 description 6
- 102000013814 Wnt Human genes 0.000 description 6
- 108050003627 Wnt Proteins 0.000 description 6
- 230000036765 blood level Effects 0.000 description 6
- 239000000872 buffer Substances 0.000 description 6
- ADEBPBSSDYVVLD-UHFFFAOYSA-N donepezil Chemical compound O=C1C=2C=C(OC)C(OC)=CC=2CC1CC(CC1)CCN1CC1=CC=CC=C1 ADEBPBSSDYVVLD-UHFFFAOYSA-N 0.000 description 6
- ASUTZQLVASHGKV-JDFRZJQESA-N galanthamine Chemical compound O1C(=C23)C(OC)=CC=C2CN(C)CC[C@]23[C@@H]1C[C@@H](O)C=C2 ASUTZQLVASHGKV-JDFRZJQESA-N 0.000 description 6
- 230000000971 hippocampal effect Effects 0.000 description 6
- 210000001320 hippocampus Anatomy 0.000 description 6
- 238000002955 isolation Methods 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- 101000653540 Homo sapiens Transcription factor 7 Proteins 0.000 description 5
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 5
- 102100030627 Transcription factor 7 Human genes 0.000 description 5
- 230000033228 biological regulation Effects 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 238000010199 gene set enrichment analysis Methods 0.000 description 5
- 230000010354 integration Effects 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 230000002452 interceptive effect Effects 0.000 description 5
- 229960000310 isoleucine Drugs 0.000 description 5
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 5
- 238000002372 labelling Methods 0.000 description 5
- 230000011987 methylation Effects 0.000 description 5
- 238000007069 methylation reaction Methods 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 229960001603 tamoxifen Drugs 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 238000013518 transcription Methods 0.000 description 5
- 230000035897 transcription Effects 0.000 description 5
- 241001430294 unidentified retrovirus Species 0.000 description 5
- 108700028369 Alleles Proteins 0.000 description 4
- 108010039224 Amidophosphoribosyltransferase Proteins 0.000 description 4
- 239000004475 Arginine Substances 0.000 description 4
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 4
- 108010040163 CREB-Binding Protein Proteins 0.000 description 4
- 102100021975 CREB-binding protein Human genes 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- 206010014611 Encephalitis venezuelan equine Diseases 0.000 description 4
- 108010036115 Histone Methyltransferases Proteins 0.000 description 4
- 102100023676 Histone-lysine N-methyltransferase SETDB2 Human genes 0.000 description 4
- 101000684615 Homo sapiens Histone-lysine N-methyltransferase SETDB2 Proteins 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- 239000000232 Lipid Bilayer Substances 0.000 description 4
- 241001529936 Murinae Species 0.000 description 4
- PKFBJSDMCRJYDC-GEZSXCAASA-N N-acetyl-s-geranylgeranyl-l-cysteine Chemical compound CC(C)=CCC\C(C)=C\CC\C(C)=C\CC\C(C)=C\CSC[C@@H](C(O)=O)NC(C)=O PKFBJSDMCRJYDC-GEZSXCAASA-N 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 238000009825 accumulation Methods 0.000 description 4
- 239000012736 aqueous medium Substances 0.000 description 4
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 4
- 229960001230 asparagine Drugs 0.000 description 4
- 235000009582 asparagine Nutrition 0.000 description 4
- 230000027455 binding Effects 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 239000000975 dye Substances 0.000 description 4
- 230000002708 enhancing effect Effects 0.000 description 4
- 230000001973 epigenetic effect Effects 0.000 description 4
- 239000012530 fluid Substances 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 239000012634 fragment Substances 0.000 description 4
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 210000004263 induced pluripotent stem cell Anatomy 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 239000008194 pharmaceutical composition Substances 0.000 description 4
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 4
- 102000040430 polynucleotide Human genes 0.000 description 4
- 108091033319 polynucleotide Proteins 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- 230000023603 positive regulation of transcription initiation, DNA-dependent Effects 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 230000001718 repressive effect Effects 0.000 description 4
- 230000001177 retroviral effect Effects 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 230000011664 signaling Effects 0.000 description 4
- 230000000946 synaptic effect Effects 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 3
- 102000016362 Catenins Human genes 0.000 description 3
- 108010067316 Catenins Proteins 0.000 description 3
- 238000001353 Chip-sequencing Methods 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 102100021429 DNA-directed RNA polymerase II subunit RPB1 Human genes 0.000 description 3
- 206010012289 Dementia Diseases 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 108010074870 Histone Demethylases Proteins 0.000 description 3
- 102000011787 Histone Methyltransferases Human genes 0.000 description 3
- 101001106401 Homo sapiens DNA-directed RNA polymerase II subunit RPB1 Proteins 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 102000009572 RNA Polymerase II Human genes 0.000 description 3
- 108010009460 RNA Polymerase II Proteins 0.000 description 3
- XSVMFMHYUFZWBK-NSHDSACASA-N Rivastigmine Chemical compound CCN(C)C(=O)OC1=CC=CC([C@H](C)N(C)C)=C1 XSVMFMHYUFZWBK-NSHDSACASA-N 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- 208000002687 Venezuelan Equine Encephalomyelitis Diseases 0.000 description 3
- 201000009145 Venezuelan equine encephalitis Diseases 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 230000007792 alzheimer disease pathology Effects 0.000 description 3
- 239000007864 aqueous solution Substances 0.000 description 3
- 229940009098 aspartate Drugs 0.000 description 3
- 101150036080 at gene Proteins 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 239000000544 cholinesterase inhibitor Substances 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 230000002950 deficient Effects 0.000 description 3
- 238000001085 differential centrifugation Methods 0.000 description 3
- 229960003530 donepezil Drugs 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 229960003980 galantamine Drugs 0.000 description 3
- ASUTZQLVASHGKV-UHFFFAOYSA-N galanthamine hydrochloride Natural products O1C(=C23)C(OC)=CC=C2CN(C)CCC23C1CC(O)C=C2 ASUTZQLVASHGKV-UHFFFAOYSA-N 0.000 description 3
- 229930195712 glutamate Natural products 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 238000003119 immunoblot Methods 0.000 description 3
- 238000012744 immunostaining Methods 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- BUGYDGFZZOZRHP-UHFFFAOYSA-N memantine Chemical compound C1C(C2)CC3(C)CC1(C)CC2(N)C3 BUGYDGFZZOZRHP-UHFFFAOYSA-N 0.000 description 3
- 229960004640 memantine Drugs 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 239000002105 nanoparticle Substances 0.000 description 3
- 230000000324 neuroprotective effect Effects 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 230000002093 peripheral effect Effects 0.000 description 3
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000013615 primer Substances 0.000 description 3
- 239000002987 primer (paints) Substances 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 229960004136 rivastigmine Drugs 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 230000002123 temporal effect Effects 0.000 description 3
- 108010016851 thrombin receptor peptide (42-55) Proteins 0.000 description 3
- OXHYRVSBKWIFES-WWSDOYNLSA-N trap-14 peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)NC(=O)[C@@H](N)CO)C1=CC=CC=C1 OXHYRVSBKWIFES-WWSDOYNLSA-N 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 230000003827 upregulation Effects 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- FVXDQWZBHIXIEJ-LNDKUQBDSA-N 1,2-di-[(9Z,12Z)-octadecadienoyl]-sn-glycero-3-phosphocholine Chemical compound CCCCC\C=C/C\C=C/CCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCC\C=C/C\C=C/CCCCC FVXDQWZBHIXIEJ-LNDKUQBDSA-N 0.000 description 2
- KILNVBDSWZSGLL-KXQOOQHDSA-N 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCC KILNVBDSWZSGLL-KXQOOQHDSA-N 0.000 description 2
- PORPENFLTBBHSG-MGBGTMOVSA-N 1,2-dihexadecanoyl-sn-glycerol-3-phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(O)=O)OC(=O)CCCCCCCCCCCCCCC PORPENFLTBBHSG-MGBGTMOVSA-N 0.000 description 2
- NRJAVPSFFCBXDT-HUESYALOSA-N 1,2-distearoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCCCC NRJAVPSFFCBXDT-HUESYALOSA-N 0.000 description 2
- CFKMVGJGLGKFKI-UHFFFAOYSA-N 4-chloro-m-cresol Chemical compound CC1=CC(O)=CC=C1Cl CFKMVGJGLGKFKI-UHFFFAOYSA-N 0.000 description 2
- HLXHCNWEVQNNKA-UHFFFAOYSA-N 5-methoxy-2,3-dihydro-1h-inden-2-amine Chemical compound COC1=CC=C2CC(N)CC2=C1 HLXHCNWEVQNNKA-UHFFFAOYSA-N 0.000 description 2
- 208000022099 Alzheimer disease 2 Diseases 0.000 description 2
- 208000037259 Amyloid Plaque Diseases 0.000 description 2
- 102000013918 Apolipoproteins E Human genes 0.000 description 2
- 108010025628 Apolipoproteins E Proteins 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 208000005145 Cerebral amyloid angiopathy Diseases 0.000 description 2
- 101710163595 Chaperone protein DnaK Proteins 0.000 description 2
- 229940122041 Cholinesterase inhibitor Drugs 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- GZDFHIJNHHMENY-UHFFFAOYSA-N Dimethyl dicarbonate Chemical compound COC(=O)OC(=O)OC GZDFHIJNHHMENY-UHFFFAOYSA-N 0.000 description 2
- 201000011240 Frontotemporal dementia Diseases 0.000 description 2
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 101710178376 Heat shock 70 kDa protein Proteins 0.000 description 2
- 102100031628 Heat shock 70 kDa protein 12A Human genes 0.000 description 2
- 102100028761 Heat shock 70 kDa protein 6 Human genes 0.000 description 2
- 101710152018 Heat shock cognate 70 kDa protein Proteins 0.000 description 2
- 102000008157 Histone Demethylases Human genes 0.000 description 2
- 102100028998 Histone-lysine N-methyltransferase SUV39H1 Human genes 0.000 description 2
- 102100028988 Histone-lysine N-methyltransferase SUV39H2 Human genes 0.000 description 2
- 101000866485 Homo sapiens Heat shock 70 kDa protein 12A Proteins 0.000 description 2
- 101001078680 Homo sapiens Heat shock 70 kDa protein 6 Proteins 0.000 description 2
- 101000696705 Homo sapiens Histone-lysine N-methyltransferase SUV39H1 Proteins 0.000 description 2
- 101000696699 Homo sapiens Histone-lysine N-methyltransferase SUV39H2 Proteins 0.000 description 2
- 101000650119 Homo sapiens Protein Wnt-9b Proteins 0.000 description 2
- 101100313319 Homo sapiens TERT gene Proteins 0.000 description 2
- 101100484716 Homo sapiens VHLL gene Proteins 0.000 description 2
- 241001135569 Human adenovirus 5 Species 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 241000713666 Lentivirus Species 0.000 description 2
- 201000009342 Limb-girdle muscular dystrophy Diseases 0.000 description 2
- 102100040581 Lysine-specific demethylase 3A Human genes 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 108060004795 Methyltransferase Proteins 0.000 description 2
- 102000016397 Methyltransferase Human genes 0.000 description 2
- 108010006519 Molecular Chaperones Proteins 0.000 description 2
- 102000005431 Molecular Chaperones Human genes 0.000 description 2
- 102000007474 Multiprotein Complexes Human genes 0.000 description 2
- 101710195305 Nuclear transition protein 2 Proteins 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 241000009328 Perro Species 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 208000000609 Pick Disease of the Brain Diseases 0.000 description 2
- 101710124239 Poly(A) polymerase Proteins 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 102100027502 Protein Wnt-9b Human genes 0.000 description 2
- 108020004459 Small interfering RNA Proteins 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102300062281 Telomerase reverse transcriptase isoform 1 Human genes 0.000 description 2
- 102300062278 Telomerase reverse transcriptase isoform 2 Human genes 0.000 description 2
- 108700009124 Transcription Initiation Site Proteins 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 101100068491 Vicia faba AGPP gene Proteins 0.000 description 2
- 108010067390 Viral Proteins Proteins 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 239000004599 antimicrobial Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 238000013528 artificial neural network Methods 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 239000003012 bilayer membrane Substances 0.000 description 2
- 230000031018 biological processes and functions Effects 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- 210000001124 body fluid Anatomy 0.000 description 2
- 239000010839 body fluid Substances 0.000 description 2
- 210000005013 brain tissue Anatomy 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 239000006143 cell culture medium Substances 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 208000010877 cognitive disease Diseases 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 230000006735 deficit Effects 0.000 description 2
- 229940124447 delivery agent Drugs 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 230000004064 dysfunction Effects 0.000 description 2
- 208000025688 early-onset autosomal dominant Alzheimer disease Diseases 0.000 description 2
- 235000019441 ethanol Nutrition 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 238000001476 gene delivery Methods 0.000 description 2
- 238000010362 genome editing Methods 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 238000002513 implantation Methods 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 239000006193 liquid solution Substances 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 239000003697 methyltransferase inhibitor Substances 0.000 description 2
- 239000002991 molded plastic Substances 0.000 description 2
- 201000006938 muscular dystrophy Diseases 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 150000008105 phosphatidylcholines Chemical class 0.000 description 2
- 229940067605 phosphatidylethanolamines Drugs 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 210000002243 primary neuron Anatomy 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000000750 progressive effect Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000017155 regulation of synapse organization Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 210000003296 saliva Anatomy 0.000 description 2
- 238000003118 sandwich ELISA Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000007470 synaptic degeneration Effects 0.000 description 2
- 230000003956 synaptic plasticity Effects 0.000 description 2
- 210000001138 tear Anatomy 0.000 description 2
- 108091008023 transcriptional regulators Proteins 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- 210000002700 urine Anatomy 0.000 description 2
- 230000031836 visual learning Effects 0.000 description 2
- 102100032078 von Hippel-Lindau-like protein Human genes 0.000 description 2
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 1
- YKIOPDIXYAUOFN-YACUFSJGSA-N (2-{[(2r)-2,3-bis(icosanoyloxy)propyl phosphonato]oxy}ethyl)trimethylazanium Chemical compound CCCCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCCCCCC YKIOPDIXYAUOFN-YACUFSJGSA-N 0.000 description 1
- WKJDWDLHIOUPPL-JSOSNVBQSA-N (2s)-2-amino-3-({[(2r)-2,3-bis(tetradecanoyloxy)propoxy](hydroxy)phosphoryl}oxy)propanoic acid Chemical compound CCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCC WKJDWDLHIOUPPL-JSOSNVBQSA-N 0.000 description 1
- LVNGJLRDBYCPGB-LDLOPFEMSA-N (R)-1,2-distearoylphosphatidylethanolamine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[NH3+])OC(=O)CCCCCCCCCCCCCCCCC LVNGJLRDBYCPGB-LDLOPFEMSA-N 0.000 description 1
- QFMZQPDHXULLKC-UHFFFAOYSA-N 1,2-bis(diphenylphosphino)ethane Chemical compound C=1C=CC=CC=1P(C=1C=CC=CC=1)CCP(C=1C=CC=CC=1)C1=CC=CC=C1 QFMZQPDHXULLKC-UHFFFAOYSA-N 0.000 description 1
- LZLVZIFMYXDKCN-QJWFYWCHSA-N 1,2-di-O-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC LZLVZIFMYXDKCN-QJWFYWCHSA-N 0.000 description 1
- CITHEXJVPOWHKC-UUWRZZSWSA-N 1,2-di-O-myristoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCC CITHEXJVPOWHKC-UUWRZZSWSA-N 0.000 description 1
- 229940083937 1,2-diarachidoyl-sn-glycero-3-phosphocholine Drugs 0.000 description 1
- SLKDGVPOSSLUAI-PGUFJCEWSA-N 1,2-dihexadecanoyl-sn-glycero-3-phosphoethanolamine zwitterion Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OCCN)OC(=O)CCCCCCCCCCCCCCC SLKDGVPOSSLUAI-PGUFJCEWSA-N 0.000 description 1
- KLFKZIQAIPDJCW-GPOMZPHUSA-N 1,2-dihexadecanoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCC KLFKZIQAIPDJCW-GPOMZPHUSA-N 0.000 description 1
- DSNRWDQKZIEDDB-SQYFZQSCSA-N 1,2-dioleoyl-sn-glycero-3-phospho-(1'-sn-glycerol) Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@@H](O)CO)OC(=O)CCCCCCC\C=C/CCCCCCCC DSNRWDQKZIEDDB-SQYFZQSCSA-N 0.000 description 1
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 1
- OZSITQMWYBNPMW-GDLZYMKVSA-N 1,2-ditetradecanoyl-sn-glycerol-3-phosphate Chemical compound CCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(O)=O)OC(=O)CCCCCCCCCCCCC OZSITQMWYBNPMW-GDLZYMKVSA-N 0.000 description 1
- BIABMEZBCHDPBV-MPQUPPDSSA-N 1,2-palmitoyl-sn-glycero-3-phospho-(1'-sn-glycerol) Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@@H](O)CO)OC(=O)CCCCCCCCCCCCCCC BIABMEZBCHDPBV-MPQUPPDSSA-N 0.000 description 1
- RYCNUMLMNKHWPZ-SNVBAGLBSA-N 1-acetyl-sn-glycero-3-phosphocholine Chemical compound CC(=O)OC[C@@H](O)COP([O-])(=O)OCC[N+](C)(C)C RYCNUMLMNKHWPZ-SNVBAGLBSA-N 0.000 description 1
- PZNPLUBHRSSFHT-RRHRGVEJSA-N 1-hexadecanoyl-2-octadecanoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[C@@H](COP([O-])(=O)OCC[N+](C)(C)C)COC(=O)CCCCCCCCCCCCCCC PZNPLUBHRSSFHT-RRHRGVEJSA-N 0.000 description 1
- RFVFQQWKPSOBED-PSXMRANNSA-N 1-myristoyl-2-palmitoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)O[C@@H](COP([O-])(=O)OCC[N+](C)(C)C)COC(=O)CCCCCCCCCCCCC RFVFQQWKPSOBED-PSXMRANNSA-N 0.000 description 1
- JLVSRWOIZZXQAD-UHFFFAOYSA-N 2,3-disulfanylpropane-1-sulfonic acid Chemical compound OS(=O)(=O)CC(S)CS JLVSRWOIZZXQAD-UHFFFAOYSA-N 0.000 description 1
- JTTIOYHBNXDJOD-UHFFFAOYSA-N 2,4,6-triaminopyrimidine Chemical compound NC1=CC(N)=NC(N)=N1 JTTIOYHBNXDJOD-UHFFFAOYSA-N 0.000 description 1
- NEZDNQCXEZDCBI-UHFFFAOYSA-N 2-azaniumylethyl 2,3-di(tetradecanoyloxy)propyl phosphate Chemical compound CCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCCN)OC(=O)CCCCCCCCCCCCC NEZDNQCXEZDCBI-UHFFFAOYSA-N 0.000 description 1
- QTWJRLJHJPIABL-UHFFFAOYSA-N 2-methylphenol;3-methylphenol;4-methylphenol Chemical compound CC1=CC=C(O)C=C1.CC1=CC=CC(O)=C1.CC1=CC=CC=C1O QTWJRLJHJPIABL-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- OSDLLIBGSJNGJE-UHFFFAOYSA-N 4-chloro-3,5-dimethylphenol Chemical compound CC1=CC(O)=CC(C)=C1Cl OSDLLIBGSJNGJE-UHFFFAOYSA-N 0.000 description 1
- CNNSWSHYGANWBM-UHFFFAOYSA-N 6-chloro-2,3-dimethylquinoxaline Chemical compound C1=C(Cl)C=C2N=C(C)C(C)=NC2=C1 CNNSWSHYGANWBM-UHFFFAOYSA-N 0.000 description 1
- 208000018282 ACys amyloidosis Diseases 0.000 description 1
- 102100039819 Actin, alpha cardiac muscle 1 Human genes 0.000 description 1
- 206010001258 Adenoviral infections Diseases 0.000 description 1
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 1
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 1
- 206010059245 Angiopathy Diseases 0.000 description 1
- 102100029470 Apolipoprotein E Human genes 0.000 description 1
- 101710095339 Apolipoprotein E Proteins 0.000 description 1
- 101000651036 Arabidopsis thaliana Galactolipid galactosyltransferase SFR2, chloroplastic Proteins 0.000 description 1
- 230000007082 Aβ accumulation Effects 0.000 description 1
- 201000006935 Becker muscular dystrophy Diseases 0.000 description 1
- 206010004446 Benign prostatic hyperplasia Diseases 0.000 description 1
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 description 1
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 description 1
- LVDKZNITIUWNER-UHFFFAOYSA-N Bronopol Chemical compound OCC(Br)(CO)[N+]([O-])=O LVDKZNITIUWNER-UHFFFAOYSA-N 0.000 description 1
- NLZUEZXRPGMBCV-UHFFFAOYSA-N Butylhydroxytoluene Chemical compound CC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 NLZUEZXRPGMBCV-UHFFFAOYSA-N 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- 238000011740 C57BL/6 mouse Methods 0.000 description 1
- 108091033409 CRISPR Proteins 0.000 description 1
- 238000010354 CRISPR gene editing Methods 0.000 description 1
- 101710086875 Calcium/calmodulin-dependent protein kinase type II Proteins 0.000 description 1
- 101100507655 Canis lupus familiaris HSPA1 gene Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 1
- GHXZTYHSJHQHIJ-UHFFFAOYSA-N Chlorhexidine Chemical compound C=1C=C(Cl)C=CC=1NC(N)=NC(N)=NCCCCCCN=C(N)N=C(N)NC1=CC=C(Cl)C=C1 GHXZTYHSJHQHIJ-UHFFFAOYSA-N 0.000 description 1
- 108010009685 Cholinergic Receptors Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 229930028154 D-arginine Natural products 0.000 description 1
- 125000002038 D-arginyl group Chemical group N[C@@H](C(=O)*)CCCNC(=N)N 0.000 description 1
- 241000252212 Danio rerio Species 0.000 description 1
- 206010011878 Deafness Diseases 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- KLFKZIQAIPDJCW-HTIIIDOHSA-N Dipalmitoylphosphatidylserine Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCC KLFKZIQAIPDJCW-HTIIIDOHSA-N 0.000 description 1
- 108700019745 Disks Large Homolog 4 Proteins 0.000 description 1
- 102000047174 Disks Large Homolog 4 Human genes 0.000 description 1
- 201000010374 Down Syndrome Diseases 0.000 description 1
- 206010013801 Duchenne Muscular Dystrophy Diseases 0.000 description 1
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 108010067770 Endopeptidase K Proteins 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 108050001049 Extracellular proteins Proteins 0.000 description 1
- 229940124602 FDA-approved drug Drugs 0.000 description 1
- 208000007487 Familial Cerebral Amyloid Angiopathy Diseases 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 208000002705 Glucose Intolerance Diseases 0.000 description 1
- 102000018899 Glutamate Receptors Human genes 0.000 description 1
- 108010027915 Glutamate Receptors Proteins 0.000 description 1
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 206010019196 Head injury Diseases 0.000 description 1
- 102100032606 Heat shock factor protein 1 Human genes 0.000 description 1
- 208000032849 Hereditary cerebral hemorrhage with amyloidosis Diseases 0.000 description 1
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 1
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 1
- 102000006947 Histones Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000959247 Homo sapiens Actin, alpha cardiac muscle 1 Proteins 0.000 description 1
- 101000896557 Homo sapiens Eukaryotic translation initiation factor 3 subunit B Proteins 0.000 description 1
- 101000867525 Homo sapiens Heat shock factor protein 1 Proteins 0.000 description 1
- 101000877312 Homo sapiens Histone-lysine N-methyltransferase EHMT2 Proteins 0.000 description 1
- 101000988834 Homo sapiens Hypoxanthine-guanine phosphoribosyltransferase Proteins 0.000 description 1
- 101000614017 Homo sapiens Lysine-specific demethylase 3A Proteins 0.000 description 1
- 101001030211 Homo sapiens Myc proto-oncogene protein Proteins 0.000 description 1
- 101000724418 Homo sapiens Neutral amino acid transporter B(0) Proteins 0.000 description 1
- 101000588302 Homo sapiens Nuclear factor erythroid 2-related factor 2 Proteins 0.000 description 1
- 101000753178 Homo sapiens Sodium/potassium-transporting ATPase subunit alpha-3 Proteins 0.000 description 1
- 101000823778 Homo sapiens Y-box-binding protein 2 Proteins 0.000 description 1
- 241000598171 Human adenovirus sp. Species 0.000 description 1
- 208000023105 Huntington disease Diseases 0.000 description 1
- 102100029098 Hypoxanthine-guanine phosphoribosyltransferase Human genes 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- 102100034349 Integrase Human genes 0.000 description 1
- 101150018389 Kdm3a gene Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- 208000009829 Lewy Body Disease Diseases 0.000 description 1
- 201000002832 Lewy body dementia Diseases 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 206010025538 Malignant ascites Diseases 0.000 description 1
- 102000000490 Mediator Complex Human genes 0.000 description 1
- 108010080991 Mediator Complex Proteins 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 108010085220 Multiprotein Complexes Proteins 0.000 description 1
- 101100339694 Mus musculus Hspa1b gene Proteins 0.000 description 1
- 101100395818 Mus musculus Hspa2 gene Proteins 0.000 description 1
- 101100313320 Mus musculus Tert gene Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 102100031455 NAD-dependent protein deacetylase sirtuin-1 Human genes 0.000 description 1
- 229910002651 NO3 Inorganic materials 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 208000009668 Neurobehavioral Manifestations Diseases 0.000 description 1
- 102100028267 Neutral amino acid transporter B(0) Human genes 0.000 description 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 1
- 102100031701 Nuclear factor erythroid 2-related factor 2 Human genes 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 208000001132 Osteoporosis Diseases 0.000 description 1
- 108700005081 Overlapping Genes Proteins 0.000 description 1
- 238000010222 PCR analysis Methods 0.000 description 1
- FVJZSBGHRPJMMA-IOLBBIBUSA-N PG(18:0/18:0) Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@@H](O)CO)OC(=O)CCCCCCCCCCCCCCCCC FVJZSBGHRPJMMA-IOLBBIBUSA-N 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 208000024571 Pick disease Diseases 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 208000004403 Prostatic Hyperplasia Diseases 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101001000212 Rattus norvegicus Decorin Proteins 0.000 description 1
- 101100339690 Rattus norvegicus Hspa1a gene Proteins 0.000 description 1
- 101100339696 Rattus norvegicus Hspa1b gene Proteins 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 235000011449 Rosa Nutrition 0.000 description 1
- 108010032838 Sialoglycoproteins Proteins 0.000 description 1
- 102000007365 Sialoglycoproteins Human genes 0.000 description 1
- 108010041191 Sirtuin 1 Proteins 0.000 description 1
- 108091027967 Small hairpin RNA Proteins 0.000 description 1
- 102100021952 Sodium/potassium-transporting ATPase subunit alpha-3 Human genes 0.000 description 1
- 208000020339 Spinal injury Diseases 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 102300062279 Telomerase reverse transcriptase isoform 3 Human genes 0.000 description 1
- 241000255588 Tephritidae Species 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 208000030886 Traumatic Brain injury Diseases 0.000 description 1
- 206010044688 Trisomy 21 Diseases 0.000 description 1
- 102000004243 Tubulin Human genes 0.000 description 1
- 108090000704 Tubulin Proteins 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 241000710959 Venezuelan equine encephalitis virus Species 0.000 description 1
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 230000004156 Wnt signaling pathway Effects 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- DSNRWDQKZIEDDB-GCMPNPAFSA-N [(2r)-3-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxy-2-[(z)-octadec-9-enoyl]oxypropyl] (z)-octadec-9-enoate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCC\C=C/CCCCCCCC DSNRWDQKZIEDDB-GCMPNPAFSA-N 0.000 description 1
- CWRILEGKIAOYKP-SSDOTTSWSA-M [(2r)-3-acetyloxy-2-hydroxypropyl] 2-aminoethyl phosphate Chemical compound CC(=O)OC[C@@H](O)COP([O-])(=O)OCCN CWRILEGKIAOYKP-SSDOTTSWSA-M 0.000 description 1
- 102000034337 acetylcholine receptors Human genes 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000036982 action potential Effects 0.000 description 1
- 206010064930 age-related macular degeneration Diseases 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 210000004381 amniotic fluid Anatomy 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000003712 anti-aging effect Effects 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 239000000935 antidepressant agent Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 101150085125 apr gene Proteins 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 210000003567 ascitic fluid Anatomy 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 208000032908 autosomal dominant 2 dyskeratosis congenita Diseases 0.000 description 1
- 201000000123 autosomal dominant dyskeratosis congenita 2 Diseases 0.000 description 1
- 201000000152 autosomal recessive dyskeratosis congenita 4 Diseases 0.000 description 1
- 208000013404 behavioral symptom Diseases 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000013060 biological fluid Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000002459 blastocyst Anatomy 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 238000009640 blood culture Methods 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 238000009395 breeding Methods 0.000 description 1
- 230000001488 breeding effect Effects 0.000 description 1
- 229960003168 bronopol Drugs 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 235000011089 carbon dioxide Nutrition 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000007541 cellular toxicity Effects 0.000 description 1
- 210000003710 cerebral cortex Anatomy 0.000 description 1
- 229960001927 cetylpyridinium chloride Drugs 0.000 description 1
- YMKDRGPMQRFJGP-UHFFFAOYSA-M cetylpyridinium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCC[N+]1=CC=CC=C1 YMKDRGPMQRFJGP-UHFFFAOYSA-M 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 229960003260 chlorhexidine Drugs 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 229960002242 chlorocresol Drugs 0.000 description 1
- 229960005443 chloroxylenol Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 238000005352 clarification Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000000749 co-immunoprecipitation Methods 0.000 description 1
- 238000011490 co-immunoprecipitation assay Methods 0.000 description 1
- 230000007278 cognition impairment Effects 0.000 description 1
- 230000006999 cognitive decline Effects 0.000 description 1
- 230000003920 cognitive function Effects 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 238000010205 computational analysis Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000008358 core component Substances 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 229930003836 cresol Natural products 0.000 description 1
- 229940013361 cresol Drugs 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000009110 definitive therapy Methods 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000002716 delivery method Methods 0.000 description 1
- 210000001787 dendrite Anatomy 0.000 description 1
- 238000000151 deposition Methods 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 239000012470 diluted sample Substances 0.000 description 1
- BPHQZTVXXXJVHI-UHFFFAOYSA-N dimyristoyl phosphatidylglycerol Chemical compound CCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCCCCCCCC BPHQZTVXXXJVHI-UHFFFAOYSA-N 0.000 description 1
- 229960003724 dimyristoylphosphatidylcholine Drugs 0.000 description 1
- 229960005160 dimyristoylphosphatidylglycerol Drugs 0.000 description 1
- MWRBNPKJOOWZPW-CLFAGFIQSA-N dioleoyl phosphatidylethanolamine Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC(COP(O)(=O)OCCN)OC(=O)CCCCCCC\C=C/CCCCCCCC MWRBNPKJOOWZPW-CLFAGFIQSA-N 0.000 description 1
- BIABMEZBCHDPBV-UHFFFAOYSA-N dipalmitoyl phosphatidylglycerol Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCCCCCCCCCC BIABMEZBCHDPBV-UHFFFAOYSA-N 0.000 description 1
- FVJZSBGHRPJMMA-UHFFFAOYSA-N distearoyl phosphatidylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCCCCCCCCCCCC FVJZSBGHRPJMMA-UHFFFAOYSA-N 0.000 description 1
- BPHQZTVXXXJVHI-AJQTZOPKSA-N ditetradecanoyl phosphatidylglycerol Chemical compound CCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@@H](O)CO)OC(=O)CCCCCCCCCCCCC BPHQZTVXXXJVHI-AJQTZOPKSA-N 0.000 description 1
- 230000034431 double-strand break repair via homologous recombination Effects 0.000 description 1
- 238000011143 downstream manufacturing Methods 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 206010015037 epilepsy Diseases 0.000 description 1
- 229960004756 ethanol Drugs 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000012226 gene silencing method Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 231100000734 genotoxic potential Toxicity 0.000 description 1
- 238000003205 genotyping method Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 229960005150 glycerol Drugs 0.000 description 1
- 150000002327 glycerophospholipids Chemical class 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 230000010370 hearing loss Effects 0.000 description 1
- 231100000888 hearing loss Toxicity 0.000 description 1
- 208000016354 hearing loss disease Diseases 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 235000020256 human milk Nutrition 0.000 description 1
- 210000004251 human milk Anatomy 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- ZCTXEAQXZGPWFG-UHFFFAOYSA-N imidurea Chemical compound O=C1NC(=O)N(CO)C1NC(=O)NCNC(=O)NC1C(=O)NC(=O)N1CO ZCTXEAQXZGPWFG-UHFFFAOYSA-N 0.000 description 1
- 229940113174 imidurea Drugs 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 201000008319 inclusion body myositis Diseases 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000009533 lab test Methods 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N lactose group Chemical group OC1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@@H](O)[C@H](O2)CO)[C@H](O1)CO GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 150000002634 lipophilic molecules Chemical class 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 208000002780 macular degeneration Diseases 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- PSGAAPLEWMOORI-PEINSRQWSA-N medroxyprogesterone acetate Chemical compound C([C@@]12C)CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2CC[C@]2(C)[C@@](OC(C)=O)(C(C)=O)CC[C@H]21 PSGAAPLEWMOORI-PEINSRQWSA-N 0.000 description 1
- 230000028161 membrane depolarization Effects 0.000 description 1
- 210000004779 membrane envelope Anatomy 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 108091070501 miRNA Proteins 0.000 description 1
- 238000001471 micro-filtration Methods 0.000 description 1
- 239000002679 microRNA Substances 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 208000027061 mild cognitive impairment Diseases 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000009456 molecular mechanism Effects 0.000 description 1
- 238000011201 multiple comparisons test Methods 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000000626 neurodegenerative effect Effects 0.000 description 1
- 230000002232 neuromuscular Effects 0.000 description 1
- 208000018360 neuromuscular disease Diseases 0.000 description 1
- 230000007171 neuropathology Effects 0.000 description 1
- 239000002858 neurotransmitter agent Substances 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 230000000242 pagocytic effect Effects 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000007310 pathophysiology Effects 0.000 description 1
- 238000003068 pathway analysis Methods 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 210000004910 pleural fluid Anatomy 0.000 description 1
- 229920001308 poly(aminoacid) Polymers 0.000 description 1
- 229920002946 poly[2-(methacryloxy)ethyl phosphorylcholine] polymer Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000022426 positive regulation of synapse assembly Effects 0.000 description 1
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 229910000160 potassium phosphate Inorganic materials 0.000 description 1
- 235000011009 potassium phosphates Nutrition 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 201000009104 prediabetes syndrome Diseases 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 208000022256 primary systemic amyloidosis Diseases 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 208000037821 progressive disease Diseases 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 210000001176 projection neuron Anatomy 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000009993 protective function Effects 0.000 description 1
- 230000004952 protein activity Effects 0.000 description 1
- 230000006916 protein interaction Effects 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 239000013608 rAAV vector Substances 0.000 description 1
- 230000007420 reactivation Effects 0.000 description 1
- 239000000985 reactive dye Substances 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 230000022429 regulation of synapse assembly Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 239000003161 ribonuclease inhibitor Substances 0.000 description 1
- 238000013341 scale-up Methods 0.000 description 1
- 210000000582 semen Anatomy 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000000822 sequential centrifugation Methods 0.000 description 1
- 239000004017 serum-free culture medium Substances 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 208000017520 skin disease Diseases 0.000 description 1
- 239000004055 small Interfering RNA Substances 0.000 description 1
- 229940126586 small molecule drug Drugs 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 230000006886 spatial memory Effects 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 150000003408 sphingolipids Chemical class 0.000 description 1
- 208000020431 spinal cord injury Diseases 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 210000004243 sweat Anatomy 0.000 description 1
- 210000000225 synapse Anatomy 0.000 description 1
- 210000001179 synovial fluid Anatomy 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 108010057210 telomerase RNA Proteins 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 230000036962 time dependent Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000012549 training Methods 0.000 description 1
- 230000037426 transcriptional repression Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 230000009529 traumatic brain injury Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 230000010415 tropism Effects 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- 238000007492 two-way ANOVA Methods 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- A61K38/1716—Amyloid plaque core protein
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0275—Genetically modified vertebrates, e.g. transgenic
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/517—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with carbocyclic ring systems, e.g. quinazoline, perimidine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/54—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one sulfur as the ring hetero atoms, e.g. sulthiame
- A61K31/548—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one sulfur as the ring hetero atoms, e.g. sulthiame having two or more sulfur atoms in the same ring
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
- A61K31/551—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/28—Bone marrow; Haematopoietic stem cells; Mesenchymal stem cells of any origin, e.g. adipose-derived stem cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/33—Fibroblasts
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/10—Peptides having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/44—Oxidoreductases (1)
- A61K38/443—Oxidoreductases (1) acting on CH-OH groups as donors, e.g. glucose oxidase, lactate dehydrogenase (1.1)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/45—Transferases (2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/5005—Wall or coating material
- A61K9/5063—Compounds of unknown constitution, e.g. material from plants or animals
- A61K9/5068—Cell membranes or bacterial membranes enclosing drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/88—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation using microencapsulation, e.g. using amphiphile liposome vesicle
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1241—Nucleotidyltransferases (2.7.7)
- C12N9/1276—RNA-directed DNA polymerase (2.7.7.49), i.e. reverse transcriptase or telomerase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y114/00—Oxidoreductases acting on paired donors, with incorporation or reduction of molecular oxygen (1.14)
- C12Y114/11—Oxidoreductases acting on paired donors, with incorporation or reduction of molecular oxygen (1.14) with 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (1.14.11)
- C12Y114/11027—[Histone H3]-lysine-36 demethylase (1.14.11.27)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/07—Nucleotidyltransferases (2.7.7)
- C12Y207/07049—RNA-directed DNA polymerase (2.7.7.49), i.e. telomerase or reverse-transcriptase
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/072—Animals genetically altered by homologous recombination maintaining or altering function, i.e. knock in
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/15—Animals comprising multiple alterations of the genome, by transgenesis or homologous recombination, e.g. obtained by cross-breeding
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/105—Murine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/0306—Animal model for genetic diseases
- A01K2267/0312—Animal model for Alzheimer's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0008—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
- A61K48/0025—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid
- A61K48/0041—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid the non-active part being polymeric
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/20011—Rhabdoviridae
- C12N2760/20111—Lyssavirus, e.g. rabies virus
- C12N2760/20122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- This invention relates to the field of medicine. Specifically, this invention provides methods and compositions for treating Alzheimer’s disease.
- AD Alzheimer's disease
- cytokines pro-inflammatory cytokines
- build-up of toxic .beta.- amyloid depositions especially in the hippocampus, that gradually destroys memory and the ability to learn.
- FDA- approved drugs only temporarily slow the worsening of symptoms, and only in about half of the patients who take these medications. This translates into combined direct and indirect costs of AD and other dementias to Medicare, Medicaid, and businesses in excess of $148 billion each year.
- AD cognitive symptoms
- cholinesterase inhibitors include cholinesterase inhibitors
- antidepressant drugs both of these drug classes, in addition to increasing neurotransmitter availability, elicit unfavorable side effects and inhibit the production of tumor necrosis factor.
- the problems of high costs, unfavorable side effects, and limited efficacy need to be resolved in treatments of AD.
- therapies that address issues related to AD such as, high costs, high occurrence of unfavorable side effects, and existing limitations in efficacious treatment of AD.
- aspects of the disclosure relate to a method for treating a premature aging disorder in a subject in need thereof, comprising administering a TERT activating therapy to the subject. Further aspects relate to a method for treating a neurodegenerative disorder in a subject comprising administering a TERT activating therapy to the subject. Further aspects relate to a method for generating new neurons in a subject in need thereof, comprising administering a TERT activating therapy to the subject.
- a TERT activating therapy refers to a therapy that may do one or more of increase expression of the endogenous TERT protein, increase concentration of the TERT protein in a cell, increases the activity of the TERT protein (ether endogenously added TERT protein or exogenously added TERT protein), and stabilize the TERT protein and/or mRNA.
- the premature aging disorder comprises Hutchinson-Gilford progeria syndrome (HGPS), Nestor-Guillermo progeria syndrome, Werner syndrome, Cockayne syndrome, Bloom syndrome, Xeroderma pigmentosum, Ataxia telangiectasia, Trichothiodystrophy, Dyskeratosis congenital, or Mosaic variegated aneuploidy syndrome.
- the neurodegenerative disorder comprises Alzheimer’s disease.
- the premature aging disorder excludes Hutchinson-Gilford progeria syndrome (HGPS), Nestor-Guillermo progeria syndrome, Werner syndrome, Cockayne syndrome, Bloom syndrome, Xeroderma pigmentosum, Ataxia telangiectasia, Trichothiodystrophy, Dyskeratosis congenital, or Mosaic variegated aneuploidy syndrome.
- the neurodegenerative disorder excludes Alzheimer’s disease.
- Alzheimer’s disease comprises or is early onset Alzheimer’s disease.
- Alzheimer’s disease comprises or is late onset Alzheimer’s disease. In some embodiments, either early onset Alzheimer’s disease or late onset Alzheimer’s disease is excluded.
- the neurodegenerative disorder comprises a neurodegenerative disorder associated with amyloid deposition.
- neurodegenerative is defined as a disease comprising degeneration and/or death of nerve cells.
- the neurodegenerative disorder is one that causes neuronal cell death.
- treating comprises increasing dendritic spine formation.
- the increase of dendritic spine formation is in cortical neurons.
- treating comprises increasing or enhancing neural networks.
- treating comprises enhancing or increasing synaptic pathway activation, which promotes molecular chaperon expression and reduces the expression of AD risk genes.
- treating comprises reducing amyloid plaques.
- the subject has been diagnosed with the disorder.
- the subject has previously been treated for the disorder. In some embodiments, the subject has been determined to be non-responsive to the previous therapy. In some embodiments, the subject has not been previously treated for the disorder. In some embodiments, the subject is a human. In some embodiments, the subject is less than 50 years old. In some embodiments, the subject is less than or more than 30, 31, 32, 33, 34, 35, 36, 37,
- the method further comprises administration of an additional therapy.
- the additional therapy comprises a cholinesterase inhibitor such as donepezil, galantamine, or rivastigmine.
- the additional therapy comprises memantine.
- the methods and compositions of the disclosure exclude one or more of donepezil, galantamine, rivastigmine, or memantine.
- the TERT activating therapy comprises delivery of nucleic acids encoding a TERT polypeptide.
- the TERT nucleic acids comprise a nucleic acid of SEQ ID NO: l, 3, 5, 7, or 9, or fragments thereof, or a nucleic acid with at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to one of SEQ ID NO: 1, 3, 5, 7, or 9, or a fragment thereof.
- the TERT activating therapy comprises a DNA or RNA encoding for a TERT polypeptide to the subject.
- the TERT activating therapy comprises a TERT polypeptide.
- the TERT polypeptide comprises a polypeptide of SEQ ID NO:2, 4, 6, 8, or 10, or fragments thereof, or a nucleic acid with at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95,
- the TERT activating therapy comprises a catalytically inactive TERT polypeptide, such as a TERT polypeptide capable of transactivation of genes but lacking Telomerase Reverse Transcriptase activity.
- the TERT polypeptide comprises a D712A mutation.
- the TERT polypeptide does not have a D712A mutation.
- the TERT activating therapy comprises a nanovesicle comprising a TERT polypeptide or a nucleic acid encoding for a TERT polypeptide.
- the nanovesicle comprises an exosome.
- the nanovesicle is 10- lOOOnm in diameter. In some embodiments, the nanovesicle is at least or at most 10, 20,
- the nanovesicle comprises CD47. In some embodiments, the nanovesicle comprises expression of CD47 on the surface and/or within the membrane of the nanovesicle. In some embodiments, the nanovesicle comprises a rabies virus glycoprotein peptide. Exemplary rabies virus glycoprotein peptides useful in embodiments of the disclosure include the following:
- the rabies virus glycoprotein peptide may include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
- the rabies virus glycoprotein peptide may include 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,
- the rabies virus glycoprotein peptide comprises amino acids 1 to 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28,
- the rabies virus glycoprotein peptide may include at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29,
- compositions and methods exclude exosomes or nanovesicles as a delivery method for a TERT
- substitution may be at amino acid position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 1 ⁇ 6 ⁇ , 17, 18, 119, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,
- polypeptides described herein may be of a fixed length of at least, at most, or exactly 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, or 42 amino acids (or any derivable range therein).
- the TERT activating therapy comprises modulation of a histone H3K9 methyltransferases (HMTs).
- HMTs histone H3K9 methyltransferases
- the modulation comprises repression of the HMT gene or protein.
- the repression comprises genetic silencing of one or more HMT genes.
- Methods for genetic silencing are known in the art. For example methods such as homology directed repair and gene editing may be used to mutate one or more HMT genes in cells in the subject, such as in neuronal cells or support cells.
- gene editing techniques such as CRISPR, are used to decrease the expression of one or more HMTs in a subject.
- the one or more HMT genes comprise one or more of SUV 39H 1 /KMT 1 A, SUV 39H2/KMT 1 B , SETDB1/KMT1E, SETDB2/KMT1F, PRDM2, G9 A/KMT 1C, GLP/KMT1D, EHMTl, and RIZ1/KMT8.
- the TERT activating therapy comprises a HMT inhibitor.
- the HMT inhibitor comprises one or more of Chaetocin, BIX-01294, BIX-01338, UNC0638, and BRD4770.
- one or more of Chaetocin, BIX-01294, BIX-01338, UNC0638, and BRD4770 is excluded.
- the TERT activating therapy comprises Chaetocin.
- the TERT activating therapy comprises administration of a histone H3K9 demethylase (HDM) polypeptide or a nucleic acid encoding a HDM.
- HDM histone H3K9 demethylase
- the HDM polypeptide comprises a polypeptide with demethylase activity. In some embodiments, the HDM polypeptide comprises a polypeptide from one or more of KDM1A/LSD1, KDM3 A/JHDM2 A, KDM3B/JHDM2B, KDM4 A/JHDM3 A,
- KDM1 A/LSD 1 KDM3A/JHDM2A, KDM3B/JHDM2B, KDM4 A/JHDM3 A, KDM4B/JMJD2B, KDM4C/JMJD2C, KDM4D/JMJD2D,
- KDM7/JHDM1D, and PHF8 is excluded as a HDM embodiment.
- the nanovesicles are derived from fibroblasts or bone marrow dendritic cells. In some embodiments, the nanovesicles are derived from human cells. In some embodiments, the nanovesicles are derived from non-human cells.
- the TERT activating therapy is administered by intravenous injection. In some embodiments, the TERT activating therapy is administered systemically. In some embodiments, the TERT activating therapy is administered by a route of administration described herein.
- treating comprises one or more of a reduction in amyloid-b peptide, an improvement in learning, an improvement in memory, and the generation of neurons.
- the reduction or improvement may be at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, or 90%, or any range derivable therein.
- the TERT polypeptide comprises a polypeptide with telomerase activity.
- protein protein
- polypeptide and “peptide” are used interchangeably herein when referring to a gene product.
- the terms“subject,”“mammal,” and“patient” are used interchangeably.
- the subject is a mammal.
- the subject is a human.
- the subject is a mouse, rat, rabbit, dog, donkey, or a laboratory test animal such as fruit fly, zebrafish, etc.
- the subject has been previously treated for a disease or disorder. In some embodiments, the subject was resistant to the previous treatment. In some embodiments, the subject was determined to be a poor responder to the previous treatment.
- the terms“or” and“and/or” are utilized to describe multiple components in combination or exclusive of one another.
- “x, y, and/or z” can refer to“x” alone,“y” alone,“z” alone,“x, y, and z,”“(x and y) or z,”“x or (y and z),” or“x or y or z.” It is specifically contemplated that x, y, or z may be specifically excluded from an embodiment.
- compositions and methods for their use can“comprise,”“consist essentially of,” or“consist of’ any of the ingredients or steps disclosed throughout the specification.
- the phrase“consisting of’ excludes any element, step, or ingredient not specified.
- the phrase “consisting essentially of’ limits the scope of described subject matter to the specified materials or steps and those that do not materially affect its basic and novel characteristics. It is contemplated that embodiments described in the context of the term“comprising” may also be implemented in the context of the term“consisting of’ or“consisting essentially of.”
- any limitation discussed with respect to one embodiment of the invention may apply to any other embodiment of the invention.
- any composition of the invention may be used in any method of the invention, and any method of the invention may be used to produce or to utilize any composition of the invention.
- Aspects of an embodiment set forth in the Examples are also embodiments that may be implemented in the context of embodiments discussed elsewhere in a different Example or elsewhere in the application, such as in the Summary of Invention, Detailed Description of the Embodiments, Claims, and description of Figure Legends.
- FIG. 1A-I Tert is downregulated in two distinct mouse Alzheimer’s neurons.
- B Tert mRNA levels in the hippocampus of 5xFAD and wildtype littermate control mice ( n 4; 2 ⁇ 3-month-old).
- FIG. 2A-C Generation of Cre-inducible Tert knock-in mouse ( R26-CAG-LSL - mTert-IRES-eGFP-pA).
- A Scheme of the construct used to introduce the CAG-LSL-mTert- IRES-eGFP-pA into Rosa26 locus.
- B Genotyping results of the original ES targeted lines carrying the R26-CAG-LSL-mTert-IRES-eGFP-pA alleles.
- C Representative photographs of chimeric mice obtained from targeted ES cells.
- FIG. 3A-D Tert activation alleviates amyloid pathology in the novel inducible TERT-AD mouse model.
- A Breeding strategy of R26-CAG-LSL-mTert with 3xTg-AD or 5xFAD and Camk2a-CreERT2 mice.
- B Ab immunostaining in the CA1 hippocampal subfield of adult (8-month-old) control and / ⁇ / /-activated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a- CreERT2 mice.
- D Ab immunostaining in the hippocampus of adult (7-month-old) control and 7 f //-activated R26-CAG-LSL-mTert; 5xFAD; Camk2a- CreERT2 mice.
- FIG. 4A-F Tert activation in AD neurons enhances various synaptic pathways which promote molecular chaperon expression and reduce the expression of AD risk genes.
- GSEA Gene Set Enrichment Analysis
- FIG. 5A-C Tert activation enhances spine morphology and neural networks in AD mouse model.
- A Representative images of Golgi-stained cortical neurons from aged (18 months) control and 7 f //-activated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 mice.
- FIG. 6A-D Activation of human TERT gene by HMT inhibitor and gene silencing in human AD neurons.
- A Representative view of H3K9me3 repressive histone mark occupancy in TERT gene of neurons differentiated from APP DP patient- and non-demented control (NDC) individual-derived iPSCs.
- B,C TERT mRNA levels
- B TERT protein levels
- C TERT protein levels
- D Immunoblot of TERT protein levels in human AD neurons treated with siRNAs targeting histone methyltransferase genes, G9A or SETDB1.
- FIG. 7A-E TERT activation alleviates amyloid pathology in human AD neurons.
- A Cloning of Flag-tagged human TERT lentiviral expression construct.
- D Immunoblots for the indicated endogenous proteins in EGFP- or 77/777 transduced APP DP neurons. A tubulin was used as a loading control.
- FIG. 8A-C TERT’s transactivation function is independent of its catalytic activity.
- A Schematic of catalytically inactive (Cl) human TERT lentiviral expression construct. The white asterisk indicates the position of the single mutation D712A, which renders the protein catalytically inactive.
- B Immunoblots for the confirmation of Flag-tagged catalytically inactive TERT expression in HEK293 cells.
- C mRNA expression levels of each gene indicated. Transcript levels were normalized to HPRT1 mRNA.
- FIG. 9A-D Activation of neuronal TERT triggers the transactivation of specific genes associated with learning processes in AD neurons.
- (D) Escape latency of aged (22-26 months) control and 7 c/7- activated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 mice in the Barnes maze over training days (n 9 for each group).
- FIG. 10A-C Neuronal TERT physically interacts with b-catenin transcription factor and RNA polymerase II complex core component.
- A List of TERT-interacting proteins identified by mass spectrometry in human AD neurons.
- C Co- immunoprecipitation of endogenous b-Catenin (active), CREBBP, POLR2A, and TERT from human AD neurons.
- FIG. 11A-C A global enrichment of the association of TERT and b-Catenin/TCF? on the genomic level.
- A ChIP-Seq density heat maps of TERT, b-Catenin (active) and TCF7 across the gene promoters of human AD neurons.
- B Chromatin-state maps showing b-Catenin (active), TCF7 and TERT binding peaks for the WNT9B , ATP1A3 , HSPA12A , HSPA6 , and MYC locus, as determined by ChIP-Seq.
- C Model for TERT action in transcriptional activation in AD neurons. In neuronal cells, TERT levels decrease at the early pathological stage of AD. Activation of neuronal TERT triggers the transcriptional induction of specific genes associated with synaptic signaling and learning processes in AD neurons, enabling to alleviate cognitive deficits.
- telomerase reverse transcriptase a catalytic subunit of telomerase
- TERT a catalytic subunit of telomerase
- AD is a progressive and adult- onset neurodegenerative disease.
- TERT-AD inducible telomerase activation AD
- telomerase activation can alleviate AD pathology in mouse and human AD models via its direct regulation of critical neuronal transcription networks affected in AD. Enhancing TERT level and activity in the brain provides for a therapeutic strategy for the prevention and treatment of Alzheimer’s disease amyloid neuropathology.
- TERT also known as CMM9, DKCA2, DKCB4, EST2, PFBMFT1, TCS1, TP2, TRT, hEST2, and hTRT in humans and EST2, TCS1, TP2, TR, and TRT in mice, is known in the art and exemplified by the following mRNA and protein sequences described herein.
- the human TERT gene is exemplified by Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 2, mRNA (NCBI Reference Sequence: NM_001193376.1):
- NKLF AGIRRDGLLLRLVDDFLL VTPHLTHAKTFL S YARTSIRASLTFNRGFK AGRNM
- telomerase reverse transcriptase TERT
- transcript variant 1 mRNA
- Mus musculus telomerase reverse transcriptase isoform 2 NCBI Reference Sequence: NP_001349316.1 :
- Mus musculus telomerase reverse transcriptase (Tert), transcript variant 3, mRNA, NCBI Reference Sequence: NM_001362388.1 : GTTCCCAGCCTCATCTTTTTCGTCGTGGACTCTCAGTGGCCTGGGTCCTGGCTGTT
- ADPALSTDFQTILD (SEQ ID NO:8).
- GAGGAGT GC ACC C AGT GC AC AT GGGC AC T GGGAC AGT GGAC AGGT GT GAGATT C
- AAAAAAAAAAAA (SEQ ID NO:9).
- Mus musculus telomerase reverse transcriptase isoform 1 NCBI Reference Sequence: NP_033380.1 :
- the TERT polypeptide or nucleic acid comprises a human TERT polypeptide or human TERT nucleic acid. In some embodiments, the TERT polypeptide or TERT nucleic acid is non-human. In some embodiments, the TERT polypeptide or TERT nucleic acid is from mouse, horse, dog, rabbit, or goat.
- polypeptides or polynucleotides of the disclosure such as those comprising or encoding for a TERT polypeptide, may include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15,
- polypeptides or polynucleotides of the disclosure such as those comprising or encoding for a TERT polypeptide, may include 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
- the polypeptide comprises amino acids or nucleic acids 1 to
- 902 903, 904, 905, 906, 907, 908, 909, 910, 911, 912, 913, 914, 915, 916, 917, 918, 919, 920,
- the polypeptide comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
- the polypeptide comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
- polypeptides or polynucleotides of the disclosure may include at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25,
- substitution may be at amino acid position or nucleic acid position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81
- 504 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522,
- polypeptides described herein may be of a fixed length of at least, at most, or exactly 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29,
- Substitutional variants typically contain the exchange of one amino acid for another at one or more sites within the protein, and may be designed to modulate one or more properties of the polypeptide, with or without the loss of other functions or properties. Substitutions may be conservative, that is, one amino acid is replaced with one of similar shape and charge.
- Conservative substitutions are well known in the art and include, for example, the changes of: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine.
- substitutions may be non-conservative such that a function or activity of the polypeptide is affected.
- Non conservative changes typically involve substituting a residue with one that is chemically dissimilar, such as a polar or charged amino acid for a nonpolar or uncharged amino acid, and vice versa.
- Proteins may be recombinant, or synthesized in vitro. Alternatively, a non recombinant or recombinant protein may be isolated from bacteria. It is also contemplated that bacteria containing such a variant may be implemented in compositions and methods. Consequently, a protein need not be isolated.
- “functionally equivalent codon” is used herein to refer to codons that encode the same amino acid, such as the six codons for arginine or serine, and also refers to codons that encode biologically equivalent amino acids.
- amino acid and nucleic acid sequences may include additional residues, such as additional N- or C-terminal amino acids, or 5' or 3' sequences, respectively, and yet still be essentially as set forth in one of the sequences disclosed herein, so long as the sequence meets the criteria set forth above, including the maintenance of biological protein activity where protein expression is concerned.
- the addition of terminal sequences particularly applies to nucleic acid sequences that may, for example, include various non coding sequences flanking either of the 5' or 3' portions of the coding region.
- amino acids of a protein may be substituted for other amino acids in a protein structure without appreciable loss of interactive binding capacity.
- Structures such as, for example, an enzymatic catalytic domain or interaction components may have amino acid substituted to maintain such function. Since it is the interactive capacity and nature of a protein that defines that protein’s biological functional activity, certain amino acid substitutions can be made in a protein sequence, and in its underlying DNA coding sequence, and nevertheless produce a protein with like properties. It is thus contemplated by the inventors that various changes may be made in the DNA sequences of genes without appreciable loss of their biological utility or activity.
- alteration of the function of a polypeptide is intended by introducing one or more substitutions.
- certain amino acids may be substituted for other amino acids in a protein structure with the intent to modify the interactive binding capacity of interaction components. Structures such as, for example, protein interaction domains, nucleic acid interaction domains, and catalytic sites may have amino acids substituted to alter such function. Since it is the interactive capacity and nature of a protein that defines that protein’s biological functional activity, certain amino acid substitutions can be made in a protein sequence, and in its underlying DNA coding sequence, and nevertheless produce a protein with different properties. It is thus contemplated by the inventors that various changes may be made in the DNA sequences of genes with appreciable alteration of their biological utility or activity.
- the hydropathic index of amino acids may be considered.
- the importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
- amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- Exemplary substitutions that take into consideration the various foregoing characteristics are well known and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
- all or part of proteins described herein can also be synthesized in solution or on a solid support in accordance with conventional techniques.
- Various automatic synthesizers are commercially available and can be used in accordance with known protocols. See, for example, Stewart and Young, (1984); Tam et ah, (1983); Merrifield, (1986); and Barany and Merrifield (1979), each incorporated herein by reference.
- recombinant DNA technology may be employed wherein a nucleotide sequence that encodes a peptide or polypeptide is inserted into an expression vector, transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression.
- One embodiment includes the use of gene transfer to cells, including microorganisms, for the production and/or presentation of proteins.
- the gene for the protein of interest may be transferred into appropriate host cells followed by culture of cells under the appropriate conditions.
- a nucleic acid encoding virtually any polypeptide may be employed.
- the generation of recombinant expression vectors, and the elements included therein, are discussed herein.
- the protein to be produced may be an endogenous protein normally synthesized by the cell used for protein production.
- Certain aspects of the disclosure include administration of a TERT activating therapy to a subject.
- This may include administration of TERT nucleic acids and/or polypeptides to a subject.
- the TERT nucleic acids may include a TERT gene, protein, or mRNA encoded on a DNA or RNA.
- the methods include administration of DNA encoding for a TERT polypeptide to a subject.
- the methods include administration of an RNA encoding a TERT polypeptide to a subject.
- transfer of an expression construct into a cell is accomplished using a viral vector.
- viral vectors are well- known in the art.
- a viral vector is meant to include those constructs containing viral sequences sufficient to (a) support packaging of the expression cassette and (b) to ultimately express a recombinant gene construct that has been cloned therein.
- the viral vector is a lentivirus vector.
- Lentivirus vectors have been successfully used in infecting stem cells and providing long term expression.
- Adenovirus vectors are known to have a low capacity for integration into genomic DNA. Adenovirus vectors result in highly efficient gene transfer.
- Adenoviruses are currently the most commonly used vector for gene transfer in clinical settings. Among the advantages of these viruses is that they are efficient at gene delivery to both nondividing and dividing cells and can be produced in large quantities.
- the vector comprises a genetically engineered form of adenovirus (Grunhaus et al, 1992).
- retrovirus the adenoviral infection of host cells does not result in chromosomal integration because adenoviral DNA can replicate in an episomal manner without potential genotoxicity.
- adenoviruses are structurally stable, and no genome rearrangement has been detected after extensive amplification.
- Adenovirus is particularly suitable for use as a gene transfer vector because of its mid- sized genome, ease of manipulation, high titer, wide target-cell range and high infectivity. A person of ordinary skill in the art would be familiar with experimental methods using adenoviral vectors.
- the adenovirus vector may be replication defective, or at least conditionally defective, and the nature of the adenovirus vector is not believed to be crucial to the successful practice of the invention.
- the adenovirus may be of any of the 42 different known serotypes or subgroups A-F and other serotypes or subgroups are envisioned.
- Adenovirus type 5 of subgroup C is the starting material in order to obtain the conditional replication- defective adenovirus vector for use in the present invention. This is because Adenovirus type 5 is a human adenovirus about which a great deal of biochemical and genetic information is known, and it has historically been used for most constructions employing adenovirus as a vector.
- Adenovirus growth and manipulation is known to those of skill in the art, and exhibits broad host range in vitro and in vivo. Modified viruses, such as adenoviruses with alteration of the CAR domain, may also be used. Methods for enhancing delivery or evading an immune response, such as liposome encapsulation of the virus, are also envisioned.
- the retroviruses are a group of single-stranded RNA viruses characterized by an ability to convert their RNA to double-stranded DNA in infected cells by a process of reverse-transcription (Coffin, 1990). The resulting DNA then stably integrates into cellular chromosomes as a provirus and directs synthesis of viral proteins.
- the integration results in the retention of the viral gene sequences in the recipient cell and its descendants.
- the retroviral genome contains two long terminal repeat (LTR) sequences present at the 5' and 3' ends of the viral genome. These contain strong promoter and enhancer sequences and are also required for integration in the host cell genome (Coffin, 1990).
- LTR long terminal repeat
- Adeno-associated virus is an attractive vector system for use in the present invention as it has a high frequency of integration and it can infect nondividing cells, thus making it useful for delivery of genes into mammalian cells in tissue culture (Muzyczka, 1992).
- AAV has a broad host range for infectivity (Tratschin et ah, 1984; Laughlin et al, 1986; Lebkowski et al, 1988; McLaughlin et al, 1988), which means it is applicable for use with the present invention. Details concerning the generation and use of rAAV vectors are described in U.S. Patents 5, 139,941 and 4,797,368, each incorporated herein by reference.
- recombinant AAV (rAAV) virus is made by cotransfecting a plasmid containing the gene of interest flanked by the two AAV terminal repeats (McLaughlin et al, 1988; Samulski et al, 1989; each incorporated herein by reference) and an expression plasmid containing the wild-type AAV coding sequences without the terminal repeats, for example pIM45 (McCarty et al., 1991; incorporated herein by reference).
- pIM45 McCarty et al.
- HSV Herpes simplex virus
- Another factor that makes HSV an attractive vector is the size and organization of the genome. Because HSV is large, incorporation of multiple genes or expression cassettes is less problematic than in other smaller viral systems.
- the availability of different viral control sequences with varying performance makes it possible to control expression to a greater extent than in other systems. It also is an advantage that the virus has relatively few spliced messages, further easing genetic manipulations.
- HSV also is relatively easy to manipulate and can be grown to high titers. Thus, delivery is less of a problem, both in terms of volumes needed to attain sufficient MOI and in a lessened need for repeat dosings.
- HSV as a gene therapy vector, see Glorioso et al. (1995). A person of ordinary skill in the art would be familiar with well- known techniques for use of HSV as vectors.
- Vaccinia virus vectors have been used extensively because of the ease of their construction, relatively high levels of expression obtained, wide host range and large capacity for carrying DNA.
- Vaccinia contains a linear, double-stranded DNA genome of about 186 kb that exhibits a marked "A-T" preference. Inverted terminal repeats of about 10.5 kb flank the genome.
- viral vectors may be employed as constructs in the present invention.
- vectors derived from viruses such as poxvirus may be employed.
- a molecularly cloned strain of Venezuelan equine encephalitis (VEE) virus has been genetically refined as a replication competent vaccine vector for the expression of heterologous viral proteins (Davis et al., 1996). Studies have demonstrated that VEE infection stimulates potent CTL responses and it has been suggested that VEE may be an extremely useful vector for immunizations (Caley et al., 1997). It is contemplated in the present invention, that VEE virus may be useful in targeting dendritic cells.
- a polynucleotide may be housed within a viral vector that has been engineered to express a specific binding ligand.
- the virus particle will thus bind specifically to the cognate receptors of the target cell and deliver the contents to the cell.
- a novel approach designed to allow specific targeting of retrovirus vectors was developed based on the chemical modification of a retrovirus by the chemical addition of lactose residues to the viral envelope. This modification can permit the specific infection of hepatocytes via sialoglycoprotein receptors.
- the expression cassette may be entrapped in a liposome or lipid formulation.
- Liposomes are vesicular structures characterized by a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium.
- a gene construct complexed with Lipofectamine (Gibco BRL).
- a lipid-based nanovesicle such as a liposome, an exosome, lipid preparations, lipid-based vesicles (e.g., a DOTAPxholesterol vesicle) are employed in the methods of the disclosure.
- the nanovesicle comprising a TERT polypeptide or nucleic acid encoding a TERT polypeptide is administered to the subject.
- Lipid- based nanovesicles may be positively charged, negatively charged or neutral.
- a "liposome” is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes may be characterized as having vesicular structures with a bilayer membrane, generally comprising a phospholipid, and an inner medium that generally comprises an aqueous composition. Liposomes provided herein include unilamellar liposomes, multilamellar liposomes, and multivesicular liposomes. Liposomes provided herein may be positively charged, negatively charged, or neutrally charged. In certain embodiments, the liposomes are neutral in charge.
- a multilamellar liposome has multiple lipid layers separated by aqueous medium. Such liposomes form spontaneously when lipids comprising phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers. Lipophilic molecules or molecules with lipophilic regions may also dissolve in or associate with the lipid bilayer.
- a polypeptide, a nucleic acid, or a small molecule drug may be, for example, encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the polypeptide/nucleic acid, entrapped in a liposome, complexed with a liposome, or the like.
- a liposome used according to the present embodiments can be made by different methods, as would be known to one of ordinary skill in the art.
- a phospholipid such as for example the neutral phospholipid dioleoylphosphatidylcholine (DOPC)
- DOPC neutral phospholipid dioleoylphosphatidylcholine
- the lipid(s) is then mixed with a polypeptide, nucleic acid, and/or other component(s).
- Tween 20 is added to the lipid mixture such that Tween 20 is about 5% of the composition's weight.
- Excess tert-butanol is added to this mixture such that the volume of tert-butanol is at least 95%.
- the mixture is vortexed, frozen in a dry ice/acetone bath and lyophilized overnight.
- the lyophilized preparation is stored at -20° and can be used up to three months. When required the lyophilized liposomes are reconstituted in 0.9% saline.
- a liposome can be prepared by mixing lipids in a solvent in a container, e.g., a glass, pear-shaped flask.
- the container should have a volume ten-times greater than the volume of the expected suspension of liposomes.
- the solvent is removed at approximately 40°C under negative pressure.
- the solvent normally is removed within about 5 min to 2 h, depending on the desired volume of the liposomes.
- the composition can be dried further in a desiccator under vacuum. The dried lipids generally are discarded after about 1 week because of a tendency to deteriorate with time.
- Dried lipids can be hydrated at approximately 25-50 mM phospholipid in sterile, pyrogen-free water by shaking until all the lipid film is resuspended.
- the aqueous liposomes can be then separated into aliquots, each placed in a vial, lyophilized and sealed under vacuum.
- the dried lipids or lyophilized liposomes prepared as described above may be dehydrated and reconstituted in a solution of a protein or peptide and diluted to an appropriate concentration with a suitable solvent, e.g., DPBS.
- a suitable solvent e.g., DPBS.
- the washed liposomes are resuspended at an appropriate total phospholipid concentration, e.g., about 50-200 mM.
- the amount of additional material or active agent encapsulated can be determined in accordance with standard methods. After determination of the amount of additional material or active agent encapsulated in the liposome preparation, the liposomes may be diluted to appropriate concentrations and stored at 4°C until use.
- a pharmaceutical composition comprising the liposomes will usually include a sterile, pharmaceutically acceptable carrier or diluent, such as water or saline solution.
- Additional liposomes which may be useful with the embodiments of the disclosure include cationic liposomes, for example, as described in W002/100435A1, U.S. Pat. No. 5,962,016, U.S. Application 2004/0208921, W003/015757A1, WO04029213A2, U.S. Pat. No. 5,030,453, and U.S. Pat. No. 6,680,068, all of which are hereby incorporated by reference in their entirety without disclaimer. [00103] In preparing such liposomes, any protocol described herein, or as would be known to one of ordinary skill in the art may be used. Additional non-limiting examples of preparing liposomes are described in U.S. Pat. Nos.
- the lipid based nanovesicle is a neutral liposome (e.g., a DOPC liposome).
- neutral liposomes or “non-charged liposomes”, as used herein, are defined as liposomes having one or more lipid components that yield an essentially-neutral, net charge (substantially non-charged).
- neutral liposomes By “essentially neutral” or “essentially non-charged”, it is meant that few, if any, lipid components within a given population (e.g., a population of liposomes) include a charge that is not canceled by an opposite charge of another component (i.e., fewer than 10% of components include a non-canceled charge, more preferably fewer than 5%, and most preferably fewer than 1%).
- neutral liposomes may include mostly lipids and/or phospholipids that are themselves neutral under physiological conditions (i.e., at about pH 7).
- Liposomes and/or lipid-based nanovesicles of the present embodiments may comprise a phospholipid.
- a single kind of phospholipid may be used in the creation of liposomes (e.g., a neutral phospholipid, such as DOPC, may be used to generate neutral liposomes).
- a neutral phospholipid such as DOPC
- more than one kind of phospholipid may be used to create liposomes.
- Phospholipids may be from natural or synthetic sources.
- Phospholipids include, for example, phosphatidylcholines, phosphatidylglycerols, and phosphatidylethanolamines; because phosphatidylethanolamines and phosphatidylcholines are non-charged under physiological conditions (i.e., at about pH 7), these compounds may be particularly useful for generating neutral liposomes.
- the phospholipid DOPC is used to produce non-charged liposomes.
- a lipid that is not a phospholipid may be used.
- Phospholipids include glycerophospholipids and certain sphingolipids.
- Phospholipids include, but are not limited to, dioleoylphosphatidylycholine ("DOPC"), egg phosphatidylcholine (“EPC”), dilauryloylphosphatidylcholine (“DLPC”), dimyristoylphosphatidylcholine (“DMPC”), dipalmitoylphosphatidylcholine (“DPPC”), distearoylphosphatidylcholine (“DSPC”), l-myristoyl-2-palmitoyl phosphatidylcholine (“MPPC”), l-palmitoyl-2-myristoyl phosphatidylcholine (“PMPC”), l-palmitoyl-2-stearoyl phosphatidylcholine (“PSPC”), l-stearoyl-2-palmitoyl phosphatidylcholine (“SPPC”), dil
- nanovesicle and "exosomes,” as used herein, refer to a membranous particle having a diameter (or largest dimension where the particles is not spheroid) of between about 10 nm to about 1000 nm, more typically between 30 nm and 1000 nm, and most typically between about 50 nm and 750 nm, wherein at least part of the membrane of the exosomes is directly obtained from a cell. Most commonly, exosomes will have a size (average diameter) that is up to 5% of the size of the donor cell. Therefore, especially contemplated exosomes include those that are shed from a cell.
- Exosomes may be detected in or isolated from any suitable sample type, such as, for example, body fluids.
- sample refers to any sample suitable for the methods provided by the present invention.
- the sample may be any sample that includes exosomes suitable for detection or isolation.
- Sources of samples include blood, bone marrow, pleural fluid, peritoneal fluid, cerebrospinal fluid, urine, saliva, amniotic fluid, malignant ascites, broncho-alveolar lavage fluid, synovial fluid, breast milk, sweat, tears, joint fluid, and bronchial washes.
- the sample is a blood sample, including, for example, whole blood or any fraction or component thereof.
- a blood sample suitable for use with the present invention may be extracted from any source known that includes blood cells or components thereof, such as venous, arterial, peripheral, tissue, cord, and the like.
- a sample may be obtained and processed using well-known and routine clinical methods (e.g., procedures for drawing and processing whole blood).
- an exemplary sample may be peripheral blood drawn from a subject with a disease.
- Exosomes may be isolated from freshly collected samples or from samples that have been stored frozen or refrigerated. In some embodiments, exosomes may be isolated from cell culture medium. Although not necessary, higher purity exosomes may be obtained if fluid samples are clarified before precipitation with a volume-excluding polymer, to remove any debris from the sample. Methods of clarification include centrifugation, ultracentrifugation, filtration, or ultrafiltration. Most typically, exosomes can be isolated by numerous methods well-known in the art. One preferred method is differential centrifugation from body fluids or cell culture supernatants.
- exosomes Exemplary methods for isolation of exosomes are described in (Losche et al., 2004; Mesri and Altieri, 1998; Morel et al., 2004). Alternatively, exosomes may also be isolated via flow cytometry as described in (Combes et al., 1997).
- One accepted protocol for isolation of exosomes includes ultracentrifugation, often in combination with sucrose density gradients or sucrose cushions to float the relatively low- density exosomes. Isolation of exosomes by sequential differential centrifugations is complicated by the possibility of overlapping size distributions with other microvesicles or macromolecular complexes. Furthermore, centrifugation may provide insufficient means to separate vesicles based on their sizes. However, sequential centrifugations, when combined with sucrose gradient ultracentrifugation, can provide high enrichment of exosomes.
- HPLC-based protocols could potentially allow one to obtain highly pure exosomes, though these processes require dedicated equipment and are difficult to scale up.
- a significant problem is that both blood and cell culture media contain large numbers of nanoparticles (some non-vesicular) in the same size range as exosomes.
- some miRNAs may be contained within extracellular protein complexes rather than exosomes; however, treatment with protease (e.g., proteinase K) can be performed to eliminate any possible contamination with "extraexosomal" protein.
- protease e.g., proteinase K
- [00116] Mix 1 x 10 8 exosomes (measured by NanoSight analysis) or 100 nm liposomes (e.g., purchased from Encapsula Nano Sciences) and 1 pg of siRNA (Qiagen) or shRNA in 400 pL of electroporation buffer (1.15 mM potassium phosphate, pH 7.2, 25 mM potassium chloride, 21% Optiprep). Electroporate the exosomes or liposomes using a 4 mm cuvette (see, e.g., Alvarez-Erviti et al., 2011; El-Andaloussi et al., 2012).
- exosomes that express or comprise a therapeutic agent, such as a TERT polypeptide or nucleic acid.
- a therapeutic agent such as a TERT polypeptide or nucleic acid.
- exosomes are known to comprise the machinery necessary to complete mRNA transcription and protein translation (see PCT/US2014/068630, which is incorporated herein by reference in its entirety)
- mRNA or DNA nucleic acids encoding a therapeutic protein may be transfected into exosomes.
- the therapeutic protein itself may be electroporated into the exosomes or incorporated directly into a liposome.
- the exosome further comprises an additional therapeutic agent, such as a therapeutic agent described herein.
- compositions that comprise a lipid-based nanovesicle comprising CD47 on its surface and wherein the lipid-based nanovesicle comprises a TERT polypeptide or a nucleic acid encoding for a TERT polypeptide.
- the lipid-based nanoparticle is a liposome or an exosome.
- the exosomes are isolated from cells over-expressing CD47.
- the exosomes are isolated from a patient in need of treatment.
- the exosomes are isolated from fibroblasts.
- the liposome is a single lamellar liposome.
- the liposome is a multilamellar liposome.
- the composition is formulated for parenteral administration, such as, for example, intravenous, intramuscular, sub-cutaneous, or intraperitoneal injection.
- the composition comprises an antimicrobial agent.
- the antimicrobial agent may be benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, centrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, exetidine, imidurea, phenol, phenoxyethanol, phenylethl alcohol, phenlymercuric nitrate, propylene glycol, or thimerosal.
- a single lipid-based nanovesicle comprises more than one agent, such as a TERT polypeptide or nucleic acid and one or more additional therapeutic agents described herein.
- methods are provided for administering a TERT activating therapy to a patient, wherein the TERT activating therapy therapeutic comprises exosomes.
- the disclosure relates to transfecting exosomes with a nucleic acid (e.g., a DNA or an RNA) encoding a TERT polypeptide, incubating the transfected exosomes under conditions to allow for expression of TERT within the exosomes, and providing the incubated exosomes to the patient, thereby administering TERT activating therapy to the patient.
- a nucleic acid e.g., a DNA or an RNA
- the therapy provided herein may comprise administration of a combination of therapeutic agents, such as a first TERT activating therapy and a second therapy.
- the therapies may be administered in any suitable manner known in the art.
- the first and second treatment may be administered sequentially (at different times) or concurrently (at the same time).
- the first and second therapies are administered in a separate composition.
- the first and second therapies are in the same composition.
- methods and compositions of the disclosure comprise administration of an additional therapy.
- the additional therapy comprises a cholinesterase inhibitor such as donepezil, galantamine, or rivastigmine.
- the additional therapy comprises memantine.
- Embodiments of the disclosure relate to compositions and methods comprising therapeutic compositions.
- the different therapies may be administered in one composition or in more than one composition, such as 2 compositions, 3 compositions, or 4 compositions.
- Various combinations of the agents may be employed, for example, a first treatment is“A” and a second treatment is“B”:
- the therapeutic agents of the disclosure may be administered by the same route of administration or by different routes of administration.
- the therapy is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
- the antibiotic is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
- the appropriate dosage may be determined based on the type of disease to be treated, severity and course of the disease, the clinical condition of the individual, the individual's clinical history and response to the treatment, and the discretion of the attending physician.
- the treatments may include various“unit doses.”
- Unit dose is defined as containing a predetermined-quantity of the therapeutic composition.
- the quantity to be administered, and the particular route and formulation, is within the skill of determination of those in the clinical arts.
- a unit dose need not be administered as a single injection but may comprise continuous infusion over a set period of time.
- a unit dose comprises a single administrable dose.
- doses include doses of about 0.1, 0.5, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, and 200, 300, 400,
- Such doses can be administered at multiple times during a day, and/or on multiple days, weeks, or months.
- the effective dose of the pharmaceutical composition is one which can provide a blood level of about 1 mM to 150 mM
- the effective dose provides a blood level of about 4 mM to 100 mM ; or about 1 mM to 100 mM; or about 1 mM to 50 mM; or about 1 mM to 40 mM; or about 1 mM to 30 mM; or about 1 mM to 20 mM; or about 1 mM to 10 mM; or about 10 mM to 150 mM; or about 10 mM to 100 mM; or about 10 mM to 50 mM; or about 25 mM to 150 mM; or about 25 mM to 100 mM; or about 25 mM to 50 mM; or about 50 mM ⁇ o 150 mM; or about 50 mM ⁇ o 100 mM (or any range derivable therein).
- the dose can provide the following blood level
- the therapeutic agent that is administered to a subject is metabolized in the body to a metabolized therapeutic agent, in which case the blood levels may refer to the amount of that agent.
- the blood levels discussed herein may refer to the unmetabolized therapeutic agent.
- Precise amounts of the therapeutic composition also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting dose include physical and clinical state of the patient, the route of administration, the intended goal of treatment (alleviation of symptoms versus cure) and the potency, stability and toxicity of the particular therapeutic substance or other therapies a subject may be undergoing.
- dosage units of pg/kg or mg/kg of body weight can be converted and expressed in comparable concentration units of pg/ml or mM (blood levels), such as 4 mM to 100 pM. It is also understood that uptake is species and organ/tissue dependent. The applicable conversion factors and physiological assumptions to be made concerning uptake and concentration measurement are well-known and would permit those of skill in the art to convert one concentration measurement to another and make reasonable comparisons and conclusions regarding the doses, efficacies and results described herein.
- the methods of the disclosure may be used to treat or prevent certain age-related diseases, conditions, or disorders.
- age-related diseases, conditions, or disorders include insulin resistance (i.e., impaired glucose tolerance), benign prostatic hyperplasia, hearing loss, osteoporosis, age-related macular degeneration, neurodegenerative diseases, a skin disease, aging skin, or cancer.
- Non-limiting examples of neurodegenerative diseases include Alzheimer disease; epilepsy; Huntington's Disease; Parkinson's Disease; stroke; spinal cord injury; traumatic brain injury; Lewy body dementia; Pick's disease; Niewmann-Pick disease; amyloid angiopathy; cerebral amyloid angiopathy; systemic amyloidosis; hereditary cerebral hemorrhage with amyloidosis of the Dutch type; inclusion body myositis; mild cognitive impairment; Down's syndrome; and neuromuscular disorders including amyotrophic lateral sclerosis (ALS), multiple sclerosis, and muscular dystrophies including Duchenne dystrophy, Becker muscular dystrophy, Facioscapulohumeral (Landouzy- Dejerine) muscular dystrophy, and limb-girdle muscular dystrophy (LGMD). Also included is neurodegenerative disease due to stroke, head trauma, spinal injury, or other injuries to the brain, peripheral nervous, central nervous, or neuromuscular system.
- ALS amyotrophic lateral sclerosis
- Certain embodiments of the methods set forth herein pertain to methods of preventing a disease or health-related condition in a subject. Preventive strategies are of key importance in medicine today.
- the treatment is for the premature aging or a disease associated with premature aging.
- premature aging disorders include Hutchinson- Gilford progeria syndrome (HGPS), Nestor-Guillermo progeria syndrome, Werner syndrome, Cockayne syndrome, Bloom syndrome, xeroderma pigmentosum, ataxia telangiectasia, trichothiodystrophy, dyskeratosis congenital, and mosaic variegated aneuploidy syndrome.
- HGPS Hutchinson- Gilford progeria syndrome
- Nestor-Guillermo progeria syndrome Werner syndrome, Cockayne syndrome, Bloom syndrome
- xeroderma pigmentosum ataxia telangiectasia
- trichothiodystrophy dyskeratosis congenital
- mosaic variegated aneuploidy syndrome one or more of premature aging disease, disease associated with premature aging, age-related disease, neurodegenerative disease, or disorders described herein is excluded from the methods of the disclosure.
- kits containing compositions described herein or compositions to implement methods described herein are provided.
- kits are envisioned containing therapeutic agents and/or other therapeutic and delivery agents.
- a kit for preparing and/or administering a therapy described herein may be provided.
- the kit may comprise one or more sealed vials containing any of the pharmaceutical compositions, therapeutic agents and/or other therapeutic and delivery agents.
- the lipid is in one vial, and the therapeutic agent is in a separate vial.
- the kit may include, for example, at least one TERT activating therapy, one or more lipid component, as well as reagents to prepare, formulate, and/or administer the components described herein or perform one or more steps of the methods.
- the kit may also comprise a suitable container means, which is a container that will not react with components of the kit, such as an eppendorf tube, an assay plate, a syringe, a bottle, or a tube.
- the container may be made from sterilizable materials such as plastic or glass.
- the kit may further include an instruction sheet that outlines the procedural steps of the methods set forth herein, and will follow substantially the same procedures as described herein or are known to those of ordinary skill.
- the instruction information may be in a computer readable media containing machine-readable instructions that, when executed using a computer, cause the display of a real or virtual procedure of delivering a pharmaceutically effective amount of a therapeutic agent.
- kits may be provided to evaluate the expression of TERT or related molecules.
- kits can be prepared from readily available materials and reagents.
- such kits can comprise any one or more of the following materials: enzymes, reaction tubes, buffers, detergent, primers and probes, nucleic acid amplification, and/or hybridization agents.
- these kits allow a practitioner to obtain samples in blood, tears, semen, saliva, urine, tissue, serum, stool, colon, rectum, sputum, cerebrospinal fluid and supernatant from cell lysate.
- these kits include the needed apparatus for performing RNA extraction, RT-PCR, and gel electrophoresis. Instructions for performing the assays can also be included in the kits.
- Kits may comprise components, which may be individually packaged or placed in a container, such as a tube, bottle, vial, syringe, or other suitable container means.
- the components may include probes, primers, antibodies, arrays, negative and/or positive controls.
- Individual components may also be provided in a kit in concentrated amounts; in some embodiments, a component is provided individually in the same concentration as it would be in a solution with other components. Concentrations of components may be provided as lx, 2x, 5x, lOx, or 20x or more.
- the kit can further comprise reagents for labeling TERT in the sample.
- the kit may also include labeling reagents, including at least one of amine-modified nucleotide, poly(A) polymerase, and poly(A) polymerase buffer.
- Labeling reagents can include an amine-reactive dye or any dye known in the art.
- kits may be packaged either in aqueous media or in lyophilized form.
- the container means of the kits will generally include at least one vial, test tube, flask, bottle, syringe or other container means, into which a component may be placed, and preferably, suitably aliquotted. Where there is more than one component in the kit (labeling reagent and label may be packaged together), the kit also will generally contain a second, third or other additional container into which the additional components may be separately placed. However, various combinations of components may be comprised in a vial.
- the kits may also include a means for containing the nucleic acids, antibodies or any other reagent containers in close confinement for commercial sale. Such containers may include injection or blow molded plastic containers into which the desired vials are retained.
- the liquid solution is an aqueous solution, with a sterile aqueous solution being particularly preferred.
- the components of the kit may be provided as dried powder(s).
- the powder can be reconstituted by the addition of a suitable solvent.
- the solvent may also be provided in another container means.
- labeling dyes are provided as a dried power. It is contemplated that 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 120, 130, 140, 150, 160, 170, 180, 190, 200, 300, 400, 500, 600, 700, 800, 900, 1000 pg or at least or at most those amounts of dried dye are provided in kits in certain aspects.
- the dye may then be resuspended in any suitable solvent, such as DMSO.
- the container means will generally include at least one vial, test tube, flask, bottle, syringe and/or other container means, into which the nucleic acid formulations are placed, preferably, suitably allocated.
- the kits may also comprise a second container means for containing a sterile, pharmaceutically acceptable buffer and/or other diluent.
- kits may include a means for containing the vials in close confinement for commercial sale, such as, e.g., injection and/or blow-molded plastic containers into which the desired vials are retained.
- kits may also include instructions for employing the kit components as well the use of any other reagent not included in the kit. Instructions may include variations that can be implemented.
- Example 1 Identification of telomerase activation as a therapeutic strategy for alleviating Alzheimer’s pathology using novel inducible TERT-AD mouse model.
- DIV Days in vitro
- telomere activity was also lower in freshly isolated hippocampal neurons from 5xFAD brain relative to wildtype controls (Fig. IE). More interestingly, the inventors observed the high occupancy of repressive epigenetic mark, H3K9me3, which has been known to be mainly accumulated at gene bodies and critical for gene repression in neuronal genes, in the Tert gene body and promoter region in 5xFAD mouse neurons (Fig. IF).
- Histone methylation is reversible and histone demethylases mediate the removal of methyl groups from lysine residues on histones (Greer and Shi, Nat Rev Genet , 2012).
- the inventors examined the levels of histone methyltransferases and demethylases and revealed that H3K9 demethylases Kdmla , Kdm4b and Kdm4c were significantly downregulated in the cortical and hippocampal neurons of the mouse AD brains relative to wildtype controls (Fig.
- the inventors tested whether increased Tert gene expression in AD neurons could ameliorate or prevent amyloid pathophysiology.
- the inventors generated Cre-inducible Tert knock-in allele that consists of the ubiquitously expressed CAG promoter, followed by the ZorP-flanked stop cassette and mouse Tert open reading frame ( R26- CAG-LSL-mTerf).
- the linearized construct was targeted into the Rosa 26 locus of C57BL/6- derived JM8F6 embryonic stem (ES) cells by electroporation (Fig. 2A).
- the inventors identified positive clones by Long Range PCR (New England Biolabs) using the following primers: left arm 5'-GGT CGT GTG GTT CGG TGT CTC TTT-3' and 5'-ATG GGC TAT GAA CTA ATG ACC CCG-3' right arm 5'- CAC TAC CAG CAG AAC ACC CCC ATC-3' and 5'-GTG CCA CTA GTA CCA AC A GCC TCT-3' (Fig. 2B). The inventors confirmed the correct recombination by sequencing and karyotyping. Eventually, the inventors identified two independent clones and injected into C57BL/6 albino blastocysts to generate chimeric mice, and the chimeric mice from each clone was able to produce germline transmission (Fig. 2C).
- telomerase activation in AD mouse model, the inventors first crossed this new Cre-inducible Tert knock-in allele with 3xTg-AD or 5xFAD. Subsequently, to selectively drive Tert expression in neuronal populations of the AD mouse models, the inventors incorporated a neuron-specific Cre allele which is under the control of the calcium/calmodulin-dependent protein kinase type II alpha promoter (Camk2a- CreERT2 ) (Madisen et al, Nat Neurosci, 2010).
- Camk2a- CreERT2 calcium/calmodulin-dependent protein kinase type II alpha promoter
- the inventors successfully established both R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 and R26-CAG-LSL-mTert; 5xFAD; Camk2a-CreERT2 strains which result in deletion of the floxed stopper sequences following tamoxifen administration, leading to turning on of mTert gene expression in the neurons of each AD mouse strain (Fig. 3A).
- These models enabled spatial (neuron-specific) and temporal (tamoxifen-inducible) control of Tert gene expression in two independent and widely studied AD (3xTg-AD and 5xFAD) mouse models.
- telomerase activation on AD pathology in vivo
- the inventors treated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 with tamoxifen at 2 ⁇ 3 months of age, at which time intracellular and cytotoxic Ab oligomers begin to accumulate in the brain, and evaluated the effect of enhanced Tert expression on amyloid pathology.
- the inventors revealed a striking decline in Ab deposition in the hippocampus of Zb/V-activated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 mouse model (Fig. 3B,C). Similar amyloid load reduction was observed in the R26-CAG-LSL-mTert; 5xFAD; Camk2a-CreERT2 model (Fig. 3D).
- RNA-Seq genome-wide RNA sequencing
- the inventors identified that Tert induction in neurons can impact the expression of a large group of genes in postmitotic neurons in vivo that are strongly linked to AD pathobiology and central to synapse formation and neuronal activity.
- iPSCs induced pluripotent stem cells
- APP dp genomic duplication of APR gene
- Fig. 6A human AD neurons derived from APP DP patient also had high occupancy of the repressive epigenetic mark H3K9me3 in TERT gene body relative to non-demented control
- H3K9 methyltransferases were investigated for human AD neurons. Consistent with the murine in vivo findings (Fig. II), inhibiting H3K9 methylation also restored both TERT mRNA and protein expression in human AD neurons (Fig. 6B,C,D).
- TERT activation can also impact Ab pathology in human contexts
- the inventors generated lentiviral human TERT construct under EFla promoter, and measured the impact of TERT induction on Ab accumulation in differentiated human AD neurons infected with lentiviral vectors expressing TERT or EGFP (Fig. 7A). Similar to the murine studies, the inventors found that TERT induction resulted a significant dose- and time- dependent reduction in intracellular Ab accumulation in human AD neurons as measured by sandwich ELISA (enzyme-linked immunosorbent assay) (Fig. 7B,C). To further understand the underlying mechanisms of TERT -mediated attenuation of amyloid load in neurons, the inventors sought to identify possible molecular targets.
- TERT induction not only decreased APP protein levels, but also triggered activation of the anti-aging gene ( SIRT1 ), molecular chaperone and stress sensor genes ( HSP70 and HSF1 ), synaptic plasticity-related genes ( BDNF and PSD-95 ), and antioxidant genes ( NRF2 and HOT) (Fig.
- RNA-seq transcriptional profiles and pathway analysis of mouse AD cortical neurons, mouse AD hippocampal neurons, and human AD neurons were intersected.
- Fig. 9A the most significantly enriched pathway (all p ⁇ 0.001) followed by membrane depolarization, glutamate receptor signaling, action potential, and synaptic signaling as the downstream consequences of TERT activation (Fig. 9B).
- Fig. 9C the enrichment profiles from three groups displayed a high level of concordant regulation of genes sets involved in learning processes in mouse and human AD neurons (Fig. 9C), suggesting that TERT regulates critical disease-associated pathways in the AD brain.
- the inventors further investigated the mechanistic details underlying TERT’s role in terminally differentiated postmitotic neurons.
- TERT mechanistic basis of TERT activation and gene regulation
- the inventors conducted proteome-wide analysis of potential interaction partners of TERT in neurons. Characterization of TERT-containing protein complexes by mass spectrometry identified transcriptional regulators CREB-binding protein (CREBBP) and RELA, RNA polymerase II largest and catalytic subunit POLR2A, and multiple Mediator complex subunits (MEDl, 4, 12, 15, 16, 23, 24) which link transcriptional regulators to RNA polymerase II in human neurons (Fig. 10A).
- CREBBP transcriptional regulators CREB-binding protein
- RELA RNA polymerase II largest and catalytic subunit POLR2A
- MEDl multiple Mediator complex subunits
- RNA-Seq analysis RNA-Seq analysis
- Fig. 10B RNA-Seq analysis
- the inventors assessed whether endogenous TERT in postmitotic neurons physically interacts with transcriptional regulatory complexes containing b-Catenin, a pivotal player in the transduction of WNT signaling.
- Co-immunoprecipitation assay indeed confirmed that neuronal TERT protein physically interacts with the activated nuclear form of b-Catenin as well as CREBBP and POLR2A at endogenous levels in fully differentiated human neurons (Fig. IOC)
- the inventors further assessed a possible global enrichment of the association of TERT and b-Oh ⁇ eh ⁇ h/TOE7 on the genomic level.
- the inventors determined the genome-wide distribution of TERT and b-Oh ⁇ eh ⁇ h/TOE7 in human neurons by ChIP-Seq using specific antibodies, and discovered that both TERT and b-Catenin as well as TCF7, which is transcription complex partner, predominantly occupied the transcription start sites (TSS) of gene promoters in human neurons (Fig. 11A).
- the inventors also defined that TERT -binding sites were occupied by both b-Catenin and TCF7 at the promoter regions of highly relevant genes including a WNT family member WNT9B , a Na + /K + -ATPase catalytic subunit ATP IAS (one of 5 overlapping genes upregulated in both TERT- activated human and mouse neurons in our study), HSP70 family members HSPA12A and HSPA6 , and a positive feed-forward regulator of TERT, MYC (Fig. 11B).
- the inventors findings of the physical association of TERT and the b-Catenin/TCF transcription complex and the TERT enhancement of b- Catenin/TCF transcriptional activity in AD neurons (Fig. 11C) point to important roles for TERT and WNT signaling in the progression of AD disease.
- the inventors identified that murine and human neurons from amyloid-based AD models exhibit epigenetic repression of neuronal TERT expression, prompting exploration of the relationship between amyloid accumulation and TERT gene expression and whether restoration of TERT expression could impact the disease trajectory.
- the inventors observed that TERT activation results in a marked reduction of Ab levels in hippocampal and cortical neurons in the brains of two AD mouse models and in cultured human iPSC-derived AD neurons harboring genomic APP duplication.
- TERT induced gene expression and physically interacted with core transcriptional and b- Catenin/TCF7 complex components at the transcriptional start sites of key neuronal genes governing synaptic signaling and learning pathways and protecting neuron health in both mouse and human neurons.
- Neuronal TERT expression improved dendritic spine formation and cognitive function in aged AD mouse models.
- Example 2 Exosome-mediated delivery of TERT mRNA in Alzheimer’s disease brain
- Exosomes are extracellular small vesicles (40 - 100 nM) that are released from cells and found in most biological fluids, and provide a useful means of transmission of macromolecules, such as nucleic acids and proteins, into target cells.
- Exosome therapies have been explored in anti-cancer clinical trials and can be also used to treat neurodegenerative diseases due to their ability to cross the blood-brain barrier easily, while liposomes are preferentially degraded by enzymes, mechanical strain and/or phagocytic attacks before they are delivered to the target sites.
- the display of CD47 and RVG brain-targeting peptide on the surface of exosomes may not only increase the biological stability by protecting themselves from degradation, but also improve the overall delivery efficiency of bioactive exosomal nucleic acids to target cells in the brain, when compared to liposomes.
- Targeted exosomes exhibiting a superior ability to deliver TERT mRNA to the brains can serve as effective therapeutic strategies for AD treatment.
- BMDCs bone marrow dendritic cells
- BMDCs bone marrow dendritic cells
- the cells can be transfected with plasmids encoding CD47 and RVG (rabies virus glycoprotein)-derived peptide using X-tremeGENE transfection reagents (Roche) or Lipofectamine 2000 reagents (Invitrogen).
- CD47 ligand protein may interact with signal- regulatory protein a (SIRPa), then initiating a‘don’t eat me’ signal that may protect the exosomes from phagocytosis.
- RVG-derived peptide on the exosome surface target may guide exosomes to bind to neuronal cells expressing acetylcholine receptors and allow transvascular delivery of targeted exosomes to the central nervous system.
- Targeted exosomes can be purified by differential centrifugation steps.
- the supernatant supplemented with exosome-depleted FBS can be collected from cells, filtered using 0.2-mih filters, ultra-centrifuged at 120,000xg ⁇ for 70 min at 4°C.
- the exosome pellets can then be re-suspended in PBS and subsequently ultra-centrifuged at 120,000 for another 70 min at 4°C.
- the exosome pellets can be re-suspended in electroporation buffer.
- Isolated exosomes can be mixed with TERT mRNA in the electroporation buffer, and electroporated at 400 mV and 125 pF capacitance. All exosomes can then be re-suspended in PBS, and ultracentrifuged at 120, 000 for another 70 min at 4°C.
- the loaded exosomes can be re-suspended in PBS and then injected intravenously into Alzheimer’s disease subjects.
- AD subjects treated with targeted exosomes loaded with control nucleic acids or TERT mRNA can be periodically assessed for learning and memory tasks. It is contemplated that administration of the therapeutic exosomes will improve the learning and memory of the treated subjects and/or increase clearance of amyloid beta in the subjects’ brains.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Psychiatry (AREA)
- Hospice & Palliative Care (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Environmental Sciences (AREA)
- Botany (AREA)
- Marine Sciences & Fisheries (AREA)
- Hematology (AREA)
Abstract
The disclosure provides for methods and compositions for treating a premature aging disorder or neurodegenerative disorder, particularly neurodegenerative disorders associated with amyloid deposition and neuronal death, such as Alzheimer's disease. Accordingly, aspects of the disclosure relate to a method for treating a premature aging disorder in a subject in need thereof, comprising administering a TERT activating therapy to the subject. Further aspects relate to a method for treating a neurodegenerative disorder in a subject comprising administering a TERT activating therapy to the subject.
Description
DESCRIPTION
METHODS AND COMPOSITIONS INVOLVING TERT ACTIVATING THERAPIES
BACKGROUND OF THE INVENTION
[0001] This application claims priority to U.S. Provisional Application No. 62/842,323, filed on May 2, 2019, the entirety of which is incorporated herein by reference.
[0002] This invention was made with government support under grant number CA084628 awarded by the National Institutes of Health. The government has certain rights in the invention.
I. Field of the Invention
[0003] This invention relates to the field of medicine. Specifically, this invention provides methods and compositions for treating Alzheimer’s disease.
II. Background
[0004] Alzheimer's disease (AD) is a progressive and degenerative disease. It is characterized by increased levels of pro-inflammatory cytokines and build-up of toxic .beta.- amyloid depositions, especially in the hippocampus, that gradually destroys memory and the ability to learn. Despite medical advances, there are no definitive therapies for AD. FDA- approved drugs only temporarily slow the worsening of symptoms, and only in about half of the patients who take these medications. This translates into combined direct and indirect costs of AD and other dementias to Medicare, Medicaid, and businesses in excess of $148 billion each year.
[0005] Current approved drug treatments for cognitive symptoms of AD include cholinesterase inhibitors, while 'off-label' treatment of behavioral symptoms of AD include antidepressant drugs; both of these drug classes, in addition to increasing neurotransmitter availability, elicit unfavorable side effects and inhibit the production of tumor necrosis factor. The problems of high costs, unfavorable side effects, and limited efficacy need to be resolved in treatments of AD. The need exists for therapies that address issues related to AD, such as, high costs, high occurrence of unfavorable side effects, and existing limitations in efficacious treatment of AD.
SUMMARY OF THE INVENTION
[0006] The disclosure provides for methods and compositions for treating a premature aging disorder or neurodegenerative disorder, particularly those associated with amyloid deposition
and neuronal death, such as Alzheimer’s disease. Accordingly, aspects of the disclosure relate to a method for treating a premature aging disorder in a subject in need thereof, comprising administering a TERT activating therapy to the subject. Further aspects relate to a method for treating a neurodegenerative disorder in a subject comprising administering a TERT activating therapy to the subject. Further aspects relate to a method for generating new neurons in a subject in need thereof, comprising administering a TERT activating therapy to the subject. Further aspects relate to a method for reducing amyloid-b peptide in a subject in need thereof, comprising administering a TERT activating therapy to the subject. Yet further aspects relate to a composition comprising a nanovesicle comprising a TERT polypeptide and/or a nucleic acid encoding a TERT polypeptide. A TERT activating therapy refers to a therapy that may do one or more of increase expression of the endogenous TERT protein, increase concentration of the TERT protein in a cell, increases the activity of the TERT protein (ether endogenously added TERT protein or exogenously added TERT protein), and stabilize the TERT protein and/or mRNA.
[0007] In some embodiments, the premature aging disorder comprises Hutchinson-Gilford progeria syndrome (HGPS), Nestor-Guillermo progeria syndrome, Werner syndrome, Cockayne syndrome, Bloom syndrome, Xeroderma pigmentosum, Ataxia telangiectasia, Trichothiodystrophy, Dyskeratosis congenital, or Mosaic variegated aneuploidy syndrome. In some embodiments, the neurodegenerative disorder comprises Alzheimer’s disease. In some embodiments, the premature aging disorder excludes Hutchinson-Gilford progeria syndrome (HGPS), Nestor-Guillermo progeria syndrome, Werner syndrome, Cockayne syndrome, Bloom syndrome, Xeroderma pigmentosum, Ataxia telangiectasia, Trichothiodystrophy, Dyskeratosis congenital, or Mosaic variegated aneuploidy syndrome. In some embodiments, the neurodegenerative disorder excludes Alzheimer’s disease. In some embodiments, Alzheimer’s disease comprises or is early onset Alzheimer’s disease. In some embodiments, Alzheimer’s disease comprises or is late onset Alzheimer’s disease. In some embodiments, either early onset Alzheimer’s disease or late onset Alzheimer’s disease is excluded. In some embodiments, the neurodegenerative disorder comprises a neurodegenerative disorder associated with amyloid deposition. In some embodiments, neurodegenerative is defined as a disease comprising degeneration and/or death of nerve cells. In some embodiments, the neurodegenerative disorder is one that causes neuronal cell death. In some embodiments, treating comprises increasing dendritic spine formation. In some embodiments, the increase of dendritic spine formation is in cortical neurons. In some embodiments, treating comprises increasing or enhancing neural networks. In some embodiments, treating comprises enhancing
or increasing synaptic pathway activation, which promotes molecular chaperon expression and reduces the expression of AD risk genes. In some embodiments, treating comprises reducing amyloid plaques. In some embodiments, the subject has been diagnosed with the disorder. In some embodiments, the subject has previously been treated for the disorder. In some embodiments, the subject has been determined to be non-responsive to the previous therapy. In some embodiments, the subject has not been previously treated for the disorder. In some embodiments, the subject is a human. In some embodiments, the subject is less than 50 years old. In some embodiments, the subject is less than or more than 30, 31, 32, 33, 34, 35, 36, 37,
38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62
63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, or 85 years old (or any range derivable therein).
[0008] In some embodiments, the method further comprises administration of an additional therapy. In some embodiments, the additional therapy comprises a cholinesterase inhibitor such as donepezil, galantamine, or rivastigmine. In some embodiments, the additional therapy comprises memantine. In some embodiments, the methods and compositions of the disclosure exclude one or more of donepezil, galantamine, rivastigmine, or memantine.
[0009] In some embodiments, the TERT activating therapy comprises delivery of nucleic acids encoding a TERT polypeptide. In some embodiments, the TERT nucleic acids comprise a nucleic acid of SEQ ID NO: l, 3, 5, 7, or 9, or fragments thereof, or a nucleic acid with at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to one of SEQ ID NO: 1, 3, 5, 7, or 9, or a fragment thereof. In some embodiments, the TERT activating therapy comprises a DNA or RNA encoding for a TERT polypeptide to the subject. In some embodiments, the TERT activating therapy comprises a TERT polypeptide. In some embodiments, the TERT polypeptide comprises a polypeptide of SEQ ID NO:2, 4, 6, 8, or 10, or fragments thereof, or a nucleic acid with at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95,
96, 97, 98, 99, or 100% identity to one of SEQ ID NO: 2, 4, 6, 8, or 10, or fragments thereof. In some embodiments, the TERT activating therapy comprises a catalytically inactive TERT polypeptide, such as a TERT polypeptide capable of transactivation of genes but lacking Telomerase Reverse Transcriptase activity. In some embodiments the TERT polypeptide comprises a D712A mutation. In some embodiments, the TERT polypeptide does not have a D712A mutation.
[0010] In some embodiments, the TERT activating therapy comprises a nanovesicle comprising a TERT polypeptide or a nucleic acid encoding for a TERT polypeptide. In some embodiments, the nanovesicle comprises an exosome. In some embodiments, the nanovesicle is 10- lOOOnm in diameter. In some embodiments, the nanovesicle is at least or at most 10, 20,
30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420,
430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610,
620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800,
810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, 990 or lOOOnm in diameter (or any derivable range therein). In some embodiments, the nanovesicle comprises CD47. In some embodiments, the nanovesicle comprises expression of CD47 on the surface and/or within the membrane of the nanovesicle. In some embodiments, the nanovesicle comprises a rabies virus glycoprotein peptide. Exemplary rabies virus glycoprotein peptides useful in embodiments of the disclosure include the following:
dR = D-arginine
[0011] The rabies virus glycoprotein peptide may include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37,
38, 39, 40, 41, or 42 (or any derivable range therein) or more variant amino acids or be at least 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%,
76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% similar, identical, or homologous with at least, or at most 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, or 42 or more contiguous amino acids, or any range derivable therein, of SEQ ID Nos: 11-14.
[0012] The rabies virus glycoprotein peptide may include 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,
39, 40, 41, or 42 or more contiguous amino acids, or any range derivable therein, of SEQ ID NOS: l l-14.
[0013] In some embodiments, the rabies virus glycoprotein peptide comprises amino acids 1 to 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28,
29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, or 42 (or any derivable range therein) of SEQ ID NOs: 11-14.
[0014] The rabies virus glycoprotein peptide may include at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29,
30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, or 42 substitutions.
[0015] In some embodiments, the compositions and methods exclude exosomes or nanovesicles as a delivery method for a TERT
[0016] The substitution may be at amino acid position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 1 ^6 ^, 17, 18, 119, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,
39, 40, 41, or 42.
[0017] The polypeptides described herein may be of a fixed length of at least, at most, or exactly 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, or 42 amino acids (or any derivable range therein).
[0018] In some embodiments, the TERT activating therapy comprises modulation of a histone H3K9 methyltransferases (HMTs). In some embodiments, the modulation comprises repression of the HMT gene or protein. In some embodiments, the repression comprises genetic silencing of one or more HMT genes. Methods for genetic silencing are known in the art. For example methods such as homology directed repair and gene editing may be used to mutate one or more HMT genes in cells in the subject, such as in neuronal cells or support cells. In some embodiments, gene editing techniques such as CRISPR, are used to decrease the expression of one or more HMTs in a subject. In some embodiments, the one or more HMT genes comprise one or more of SUV 39H 1 /KMT 1 A, SUV 39H2/KMT 1 B , SETDB1/KMT1E, SETDB2/KMT1F, PRDM2, G9 A/KMT 1C, GLP/KMT1D, EHMTl, and RIZ1/KMT8. In some embodiments, one or more of SUV39H1/KMT1A, SUV39H2/KMT1B, SETDB1/KMT1E, SETDB2/KMT1F, PRDM2, G9 A/KMT 1C, GLP/KMT1D, EHMTl, and
RIZ1/KMT8 is excluded as an HMT embodiment. In some embodiments, the TERT activating therapy comprises a HMT inhibitor. In some embodiments, the HMT inhibitor comprises one or more of Chaetocin, BIX-01294, BIX-01338, UNC0638, and BRD4770. In some embodiments, one or more of Chaetocin, BIX-01294, BIX-01338, UNC0638, and BRD4770 is excluded. In some embodiments, the TERT activating therapy comprises Chaetocin. In some embodiments, the TERT activating therapy comprises administration of a histone H3K9 demethylase (HDM) polypeptide or a nucleic acid encoding a HDM. In some embodiments,
the HDM polypeptide comprises a polypeptide with demethylase activity. In some embodiments, the HDM polypeptide comprises a polypeptide from one or more of KDM1A/LSD1, KDM3 A/JHDM2 A, KDM3B/JHDM2B, KDM4 A/JHDM3 A,
KDM4B/JMJD2B, KDM4C/JMJD2C, KDM4D/JMJD2D, KDM7/JHDM1D, and PHF8. In some embodiments, one or more of KDM1 A/LSD 1, KDM3A/JHDM2A, KDM3B/JHDM2B, KDM4 A/JHDM3 A, KDM4B/JMJD2B, KDM4C/JMJD2C, KDM4D/JMJD2D,
KDM7/JHDM1D, and PHF8 is excluded as a HDM embodiment.
[0019] Other embodiments of the rabies virus glycoprotein are further described in Oswald et al., Mol. Pharmaceutics, 2017, 14 (7), pp 2177-2196, which is herein incorporated by reference.
[0020] In some embodiments, the nanovesicles are derived from fibroblasts or bone marrow dendritic cells. In some embodiments, the nanovesicles are derived from human cells. In some embodiments, the nanovesicles are derived from non-human cells.
[0021] In some embodiments, the TERT activating therapy is administered by intravenous injection. In some embodiments, the TERT activating therapy is administered systemically. In some embodiments, the TERT activating therapy is administered by a route of administration described herein.
[0022] In some embodiments, treating comprises one or more of a reduction in amyloid-b peptide, an improvement in learning, an improvement in memory, and the generation of neurons. The reduction or improvement may be at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, or 90%, or any range derivable therein.
[0023] In some embodiments, the TERT polypeptide comprises a polypeptide with telomerase activity. The terms “protein”, “polypeptide” and “peptide” are used interchangeably herein when referring to a gene product.
[0024] The terms“subject,”“mammal,” and“patient” are used interchangeably. In some embodiments, the subject is a mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a mouse, rat, rabbit, dog, donkey, or a laboratory test animal such as fruit fly, zebrafish, etc.
[0025] In some embodiments, the subject has been previously treated for a disease or disorder. In some embodiments, the subject was resistant to the previous treatment. In some embodiments, the subject was determined to be a poor responder to the previous treatment.
[0026] It is contemplated that the methods and compositions include exclusion of any of the embodiments described herein.
[0027] Throughout this application, the term“about” is used according to its plain and ordinary meaning in the area of cell and molecular biology to indicate that a value includes the standard deviation of error for the device or method being employed to determine the value.
[0028] The use of the word “a” or “an” when used in conjunction with the term “comprising” may mean“one,” but it is also consistent with the meaning of“one or more,”“at least one,” and“one or more than one.”
[0029] As used herein, the terms“or” and“and/or” are utilized to describe multiple components in combination or exclusive of one another. For example,“x, y, and/or z” can refer to“x” alone,“y” alone,“z” alone,“x, y, and z,”“(x and y) or z,”“x or (y and z),” or“x or y or z.” It is specifically contemplated that x, y, or z may be specifically excluded from an embodiment.
[0030] The words“comprising” (and any form of comprising, such as“comprise” and “comprises”),“having” (and any form of having, such as“have” and“has”),“including” (and any form of including, such as“includes” and“include”),“characterized by” (and any form of including, such as“characterized as”), or“containing” (and any form of containing, such as “contains” and“contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps.
[0031] The compositions and methods for their use can“comprise,”“consist essentially of,” or“consist of’ any of the ingredients or steps disclosed throughout the specification. The phrase“consisting of’ excludes any element, step, or ingredient not specified. The phrase “consisting essentially of’ limits the scope of described subject matter to the specified materials or steps and those that do not materially affect its basic and novel characteristics. It is contemplated that embodiments described in the context of the term“comprising” may also be implemented in the context of the term“consisting of’ or“consisting essentially of.”
[0032] It is specifically contemplated that any limitation discussed with respect to one embodiment of the invention may apply to any other embodiment of the invention. Furthermore, any composition of the invention may be used in any method of the invention, and any method of the invention may be used to produce or to utilize any composition of the invention. Aspects of an embodiment set forth in the Examples are also embodiments that may be implemented in the context of embodiments discussed elsewhere in a different Example or elsewhere in the application, such as in the Summary of Invention, Detailed Description of the Embodiments, Claims, and description of Figure Legends.
[0033] Other obj ects, features and advantages of the present invention will become apparent from the following detailed description. It should be understood, however, that the detailed
description and the specific examples, while indicating specific embodiments of the invention, are given by way of illustration only, since various changes and modifications within the spirit and scope of the invention will become apparent to those skilled in the art from this detailed description.
BRIEF DESCRIPTION OF THE DRAWINGS
[0034] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0035] FIG. 1A-I. Tert is downregulated in two distinct mouse Alzheimer’s neurons. (A) Tert mRNA levels in the cortex of 3xTg-AD and wildtype control (B6129SF2/J) mice (// = 4; 3-month-old). (B) Tert mRNA levels in the hippocampus of 5xFAD and wildtype littermate control mice ( n 4; 2~3-month-old). (C) Tert mRNA levels in primary cortical and hippocampal neurons isolated from 3xTg-AD and control mice at DIV 14 (// = 3). (D) Tert mRNA levels in primary cortical and hippocampal neurons isolated from 5xFAD and control mice at DIV 14 {n = 3). (E) Telomerase activity in hippocampal neurons isolated from 5xFAD and control mice {n = 4; 2~3-month-old). (F) Representative view of H3K9me3 repressive histone mark occupancy in Tert gene of 5xFAD and control mouse primary neurons at DIV 14.
(G) mRNA levels of histone demethylase Kdmla , Kdm4b , and Kdm4c genes in cortical and hippocampal neurons of 5xFAD and wildtype littermate control mice (// = 4; 2~3 -month-old).
(H) KDM1A immunostaining in the CA1 hippocampal subfield of 5xFAD and wildtype littermate control mice (2~3-month-old). (I) Tert mRNA levels in the cortex and hippocampus of 5xFAD mice treated with chaetocin or BIX-01294.
[0036] FIG. 2A-C. Generation of Cre-inducible Tert knock-in mouse ( R26-CAG-LSL - mTert-IRES-eGFP-pA). (A) Scheme of the construct used to introduce the CAG-LSL-mTert- IRES-eGFP-pA into Rosa26 locus. (B) Genotyping results of the original ES targeted lines carrying the R26-CAG-LSL-mTert-IRES-eGFP-pA alleles. (C) Representative photographs of chimeric mice obtained from targeted ES cells.
[0037] FIG. 3A-D. Tert activation alleviates amyloid pathology in the novel inducible TERT-AD mouse model. (A) Breeding strategy of R26-CAG-LSL-mTert with 3xTg-AD or 5xFAD and Camk2a-CreERT2 mice. (B) Ab immunostaining in the CA1 hippocampal subfield of adult (8-month-old) control and /^/ /-activated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a- CreERT2 mice. (C) Quantitative comparison of Ab-immunoreactive pyramidal neurons in the
CA1 regions (n = 6 per group; 8-month-old). (D) Ab immunostaining in the hippocampus of adult (7-month-old) control and 7 f //-activated R26-CAG-LSL-mTert; 5xFAD; Camk2a- CreERT2 mice.
[0038] FIG. 4A-F. Tert activation in AD neurons enhances various synaptic pathways which promote molecular chaperon expression and reduce the expression of AD risk genes.
(A) mRNA levels of Tert and Terc in /^/ /-activated neurons of R26-CAG-LSL-mTert; 3xTg- AD; Camk2a-CreERT2 mouse brains. (B) Venn diagram showing intersections of upregulated biological processes based on the RNA-Seq results from Tert- activated cortical and hippocampal neurons of R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 mice compared with control groups. (C) Top 5 overlapping pathways upregulated in both Tert- activated cortical and hippocampal neurons. (D) Gene Set Enrichment Analysis (GSEA) plots showing relative upregulation of synaptic signaling genes in Tert- activated cortical and hippocampal neurons by comparison with control neurons. (E,F) mRNA levels of App, ApoE, Hsp70-1 and Hsp70-2 genes with or without Tert induction.
[0039] FIG. 5A-C. Tert activation enhances spine morphology and neural networks in AD mouse model. (A) Representative images of Golgi-stained cortical neurons from aged (18 months) control and 7 f //-activated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 mice.
(B) High magnification of dendritic spines in impregnated pyramidal cortical neurons of aged control and 7 c/7- activated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 mice. (C) Quantification of dendritic spine density ( n = 20 dendrites per group from n = 4 mice per group; 18-month-old). Student's /-test for two-group comparisons. ****p < 0.0001; mean ± s.e.m.
[0040] FIG. 6A-D. Activation of human TERT gene by HMT inhibitor and gene silencing in human AD neurons. (A) Representative view of H3K9me3 repressive histone mark occupancy in TERT gene of neurons differentiated from APPDP patient- and non-demented control (NDC) individual-derived iPSCs. (B,C) TERT mRNA levels (B) and TERT protein levels (C) in chaetocin-treated human AD neurons. (D) Immunoblot of TERT protein levels in human AD neurons treated with siRNAs targeting histone methyltransferase genes, G9A or SETDB1.
[0041] FIG. 7A-E. TERT activation alleviates amyloid pathology in human AD neurons. (A) Cloning of Flag-tagged human TERT lentiviral expression construct. (B,C) Abi-40 levels measured by sandwich ELISA in EGFP- or 77/777 '-transduced neurons differentiated from APPDP patient-derived iPSCs (// = 3). (D) Immunoblots for the indicated endogenous proteins in EGFP- or 77/777 transduced APPDP neurons. A tubulin was used as a loading control. (E)
Relative gene expression by quantitative RT-PCR in EGFP- or TERT- transduced APPDP neurons ( n = 4).
[0042] FIG. 8A-C. TERT’s transactivation function is independent of its catalytic activity. (A) Schematic of catalytically inactive (Cl) human TERT lentiviral expression construct. The white asterisk indicates the position of the single mutation D712A, which renders the protein catalytically inactive. (B) Immunoblots for the confirmation of Flag-tagged catalytically inactive TERT expression in HEK293 cells. (C) mRNA expression levels of each gene indicated. Transcript levels were normalized to HPRT1 mRNA.
[0043] FIG. 9A-D. Activation of neuronal TERT triggers the transactivation of specific genes associated with learning processes in AD neurons. (A) Venn diagram showing intersections of upregulated biological processes based on three independent RNA-Seq results from /^/ /-activated mouse cortical and hippocampal neurons of R26-CAG-LSL-mTert; 3xTg- AD; Camk2a-CreERT2 mice (n = 4 for each group) and 77/77 /'-activated human APPDP neurons (n = 3) compared with each control group (all p < 0.05). (B) List of 13 overlapping pathways upregulated in all Tert- activated mouse cortical and hippocampal AD neurons and TERT- activated human AD neurons. (C) GSEA plots showing relative upregulation of learning- related genes in Tert- activated cortical and hippocampal AD neurons and 77/777 '-activated human AD neurons by comparison with each control group. (D) Escape latency of aged (22-26 months) control and 7 c/7- activated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 mice in the Barnes maze over training days (n = 9 for each group). Two-way ANOVA with Sidak's multiple comparisons test; Student's t-test for two-group comparisons; One, two, three, or four symbols denote P < 0.05, 0.01, 0.0005, 0.0001, respectively; mean ± s.e.m.
[0044] FIG. 10A-C. Neuronal TERT physically interacts with b-catenin transcription factor and RNA polymerase II complex core component. (A) List of TERT-interacting proteins identified by mass spectrometry in human AD neurons. (B) RNA-Seq heat map of WNT signaling pathway genes in EGFP- and 77/777 '-transduced human AD neurons (// = 3) (C) Co- immunoprecipitation of endogenous b-Catenin (active), CREBBP, POLR2A, and TERT from human AD neurons.
[0045] FIG. 11A-C. A global enrichment of the association of TERT and b-Catenin/TCF? on the genomic level. (A) ChIP-Seq density heat maps of TERT, b-Catenin (active) and TCF7 across the gene promoters of human AD neurons. (B) Chromatin-state maps showing b-Catenin (active), TCF7 and TERT binding peaks for the WNT9B , ATP1A3 , HSPA12A , HSPA6 , and MYC locus, as determined by ChIP-Seq. (C) Model for TERT action in transcriptional
activation in AD neurons. In neuronal cells, TERT levels decrease at the early pathological stage of AD. Activation of neuronal TERT triggers the transcriptional induction of specific genes associated with synaptic signaling and learning processes in AD neurons, enabling to alleviate cognitive deficits.
PET ATT, ED DESCRIPTION OF THE INVENTION
[0046] The telomerase reverse transcriptase (TERT), a catalytic subunit of telomerase, has been reported to have a variety of beneficial and protective functions in multiple tissues of both rodent and human. However, the relationship between telomerase and amyloid pathology, a major hallmark of AD pathology, has not been investigated. AD is a progressive and adult- onset neurodegenerative disease. To test the impact of TERT reactivation in the brain, the inventors established an inducible telomerase activation AD (TERT-AD) mouse model to control temporal regulation of TERT gene expression. As shown in Example 1, telomerase activation can alleviate AD pathology in mouse and human AD models via its direct regulation of critical neuronal transcription networks affected in AD. Enhancing TERT level and activity in the brain provides for a therapeutic strategy for the prevention and treatment of Alzheimer’s disease amyloid neuropathology.
I. TERT Polypeptides
[0047] TERT, also known as CMM9, DKCA2, DKCB4, EST2, PFBMFT1, TCS1, TP2, TRT, hEST2, and hTRT in humans and EST2, TCS1, TP2, TR, and TRT in mice, is known in the art and exemplified by the following mRNA and protein sequences described herein.
[0048] For example, the human TERT gene is exemplified by Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 2, mRNA (NCBI Reference Sequence: NM_001193376.1):
CAGGCAGCGCTGCGTCCTGCTGCGCACGTGGGAAGCCCTGGCCCCGGCCACCCC
CGCGATGCCGCGCGCTCCCCGCTGCCGAGCCGTGCGCTCCCTGCTGCGCAGCCAC
TACCGCGAGGTGCTGCCGCTGGCCACGTTCGTGCGGCGCCTGGGGCCCCAGGGC
TGGCGGCTGGTGCAGCGCGGGGACCCGGCGGCTTTCCGCGCGCTGGTGGCCCAG
TGCCTGGTGTGCGTGCCCTGGGACGCACGGCCGCCCCCCGCCGCCCCCTCCTTCC
GCCAGGTGTCCTGCCTGAAGGAGCTGGTGGCCCGAGTGCTGCAGAGGCTGTGCG
AGCGCGGCGCGAAGAACGTGCTGGCCTTCGGCTTCGCGCTGCTGGACGGGGCCC
GCGGGGGCCCCCCCGAGGCCTTCACCACCAGCGTGCGCAGCTACCTGCCCAACA
CGGTGACCGACGCACTGCGGGGGAGCGGGGCGTGGGGGCTGCTGCTGCGCCGCG
TGGGCGACGACGTGCTGGTTCACCTGCTGGCACGCTGCGCGCTCTTTGTGCTGGT
GGCTCCCAGCTGCGCCTACCAGGTGTGCGGGCCGCCGCTGTACCAGCTCGGCGCT
GCCACTCAGGCCCGGCCCCCGCCACACGCTAGTGGACCCCGAAGGCGTCTGGGA
TGCGAACGGGCCTGGAACCATAGCGTCAGGGAGGCCGGGGTCCCCCTGGGCCTG
CCAGCCCCGGGTGCGAGGAGGCGCGGGGGCAGTGCCAGCCGAAGTCTGCCGTTG
CCCAAGAGGCCCAGGCGTGGCGCTGCCCCTGAGCCGGAGCGGACGCCCGTTGGG
CAGGGGTCCTGGGCCCACCCGGGCAGGACGCGTGGACCGAGTGACCGTGGTTTC
TGTGTGGTGTCACCTGCCAGACCCGCCGAAGAAGCCACCTCTTTGGAGGGTGCGC
TCTCTGGCACGCGCCACTCCCACCCATCCGTGGGCCGCCAGCACCACGCGGGCCC
CCCATCCACATCGCGGCCACCACGTCCCTGGGACACGCCTTGTCCCCCGGTGTAC
GCCGAGACCAAGCACTTCCTCTACTCCTCAGGCGACAAGGAGCAGCTGCGGCCC
TCCTTCCTACTCAGCTCTCTGAGGCCCAGCCTGACTGGCGCTCGGAGGCTCGTGG
AGACCATCTTTCTGGGTTCCAGGCCCTGGATGCCAGGGACTCCCCGCAGGTTGCC
CCGCCTGCCCCAGCGCTACTGGCAAATGCGGCCCCTGTTTCTGGAGCTGCTTGGG
AACCACGCGCAGTGCCCCTACGGGGTGCTCCTCAAGACGCACTGCCCGCTGCGA
GCTGCGGTCACCCCAGCAGCCGGTGTCTGTGCCCGGGAGAAGCCCCAGGGCTCT
GTGGCGGCCCCCGAGGAGGAGGACACAGACCCCCGTCGCCTGGTGCAGCTGCTC
CGCCAGCACAGCAGCCCCTGGCAGGTGTACGGCTTCGTGCGGGCCTGCCTGCGC
CGGCTGGTGCCCCCAGGCCTCTGGGGCTCCAGGCACAACGAACGCCGCTTCCTCA
GGAACACCAAGAAGTTCATCTCCCTGGGGAAGCATGCCAAGCTCTCGCTGCAGG
AGCTGACGTGGAAGATGAGCGTGCGGGACTGCGCTTGGCTGCGCAGGAGCCCAG
GGGTTGGCTGTGTTCCGGCCGCAGAGCACCGTCTGCGTGAGGAGATCCTGGCCA
AGTTCCTGCACTGGCTGATGAGTGTGTACGTCGTCGAGCTGCTCAGGTCTTTCTTT
TATGTCACGGAGACCACGTTTCAAAAGAACAGGCTCTTTTTCTACCGGAAGAGTG
TCTGGAGCAAGTTGCAAAGCATTGGAATCAGACAGCACTTGAAGAGGGTGCAGC
TGCGGGAGCTGTCGGAAGCAGAGGTCAGGCAGCATCGGGAAGCCAGGCCCGCCC
TGCTGACGTCCAGACTCCGCTTCATCCCCAAGCCTGACGGGCTGCGGCCGATTGT
G A AC AT GG AC T AC GT C GT GGG AGC C AG A AC GT TC C GC AG AG A A A AG AGGGC C G
AGCGTCTCACCTCGAGGGTGAAGGCACTGTTCAGCGTGCTCAACTACGAGCGGG
CGCGGCGCCCCGGCCTCCTGGGCGCCTCTGTGCTGGGCCTGGACGATATCCACAG
GGCCTGGCGCACCTTCGTGCTGCGTGTGCGGGCCCAGGACCCGCCGCCTGAGCTG
TACTTTGTCAAGGTGGATGTGACGGGCGCGTACGACACCATCCCCCAGGACAGG
CTCACGGAGGTCATCGCCAGCATCATCAAACCCCAGAACACGTACTGCGTGCGT
CGGTATGCCGTGGTCCAGAAGGCCGCCCATGGGCACGTCCGCAAGGCCTTCAAG
AGCCACGTCTCTACCTTGACAGACCTCCAGCCGTACATGCGACAGTTCGTGGCTC
ACCTGCAGGAGACCAGCCCGCTGAGGGATGCCGTCGTCATCGAGCAGAGCTCCT
CCCTGAATGAGGCCAGCAGTGGCCTCTTCGACGTCTTCCTACGCTTCATGTGCCA
CCACGCCGTGCGCATCAGGGGCAAGTCCTACGTCCAGTGCCAGGGGATCCCGCA
GGGCTCCATCCTCTCCACGCTGCTCTGCAGCCTGTGCTACGGCGACATGGAGAAC
AAGCTGTTTGCGGGGATTCGGCGGGACGGGCTGCTCCTGCGTTTGGTGGATGATT
TCTTGTTGGTGACACCTCACCTCACCCACGCGAAAACCTTCCTCAGCTATGCCCG
GACCTCCATCAGAGCCAGTCTCACCTTCAACCGCGGCTTCAAGGCTGGGAGGAA
CATGCGTCGCAAACTCTTTGGGGTCTTGCGGCTGAAGTGTCACAGCCTGTTTCTG
GATTTGCAGGTGAACAGCCTCCAGACGGTGTGCACCAACATCTACAAGATCCTCC
TGCTGCAGGCGTACAGGTTTCACGCATGTGTGCTGCAGCTCCCATTTCATCAGCA
AGTTTGGAAGAACCCCACATTTTTCCTGCGCGTCATCTCTGACACGGCCTCCCTCT
GCTACTCCATCCTGAAAGCCAAGAACGCAGGGATGTCGCTGGGGGCCAAGGGCG
CCGCCGGCCCTCTGCCCTCCGAGGCCGTGCAGTGGCTGTGCCACCAAGCATTCCT
GCTCAAGCTGACTCGACACCGTGTCACCTACGTGCCACTCCTGGGGTCACTCAGG
ACAGCCCAGACGCAGCTGAGTCGGAAGCTCCCGGGGACGACGCTGACTGCCCTG
GAGGCCGCAGCCAACCCGGCACTGCCCTCAGACTTCAAGACCATCCTGGACTGA
TGGCCACCCGCCCACAGCCAGGCCGAGAGCAGACACCAGCAGCCCTGTCACGCC
GGGCTCTACGTCCCAGGGAGGGAGGGGCGGCCCACACCCAGGCCCGCACCGCTG
GGAGTCTGAGGCCTGAGTGAGTGTTTGGCCGAGGCCTGCATGTCCGGCTGAAGG
CTGAGTGTCCGGCTGAGGCCTGAGCGAGTGTCCAGCCAAGGGCTGAGTGTCCAG
CACACCTGCCGTCTTCACTTCCCCACAGGCTGGCGCTCGGCTCCACCCCAGGGCC
AGCTTTTCCTCACCAGGAGCCCGGCTTCCACTCCCCACATAGGAATAGTCCATCC
CCAGATTCGCCATTGTTCACCCCTCGCCCTGCCCTCCTTTGCCTTCCACCCCCACC
ATCCAGGTGGAGACCCTGAGAAGGACCCTGGGAGCTCTGGGAATTTGGAGTGAC
CAAAGGTGTGCCCTGTACACAGGCGAGGACCCTGCACCTGGATGGGGGTCCCTG
TGGGT C AAATTGGGGGGAGGT GCTGTGGGAGT AAAAT ACTGAAT AT AT GAGTTT
TT C AGTTTT GAAAAAAA (SEQ ID NO: 1).
[0049] Human Telomerase reverse transcriptase isoform 2, NCBI Reference Sequence: NP_001 180305.1 :
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLV C VPWD ARPPP AAP SFRQ V SCLKEL VARVLQRLCERGAKNVL AF GF ALLDGARGGPP E AF TT S VRS YLPNT VTD ALRGS GAW GLLLRRV GDD VL VHLL ARC ALF VL V AP S CAY QVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRR GGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEE
AT SLEGAL S GTRHSHP S VGRQHH AGPP S T SRPPRP WDTPCPP V Y AETKHFL Y S S GDK
EQLRP SFLL S SLRP SLT GARRLVETIFLGSRPWMPGTPRRLPRLPQRYW QMRPLFLEL
LGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLL
RQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELT
WKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVT
ETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLR
FIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGAS
VLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQN
TYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVI
EQS S SLNEAS SGLFDVFLRFMCHHAVRIRGKS YVQCQGIPQGSILSTLLC SLC YGDME
NKLF AGIRRDGLLLRLVDDFLL VTPHLTHAKTFL S YARTSIRASLTFNRGFK AGRNM
RRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWK
NPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTR
HRVT YVPLLGSLRT AQTQLSRKLPGTTLT ALE AAANP ALPSDFKTILD (SEQ ID NO:2).
[0050] Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 1 , mRNA,
NCBI Reference Sequence: NM_198253.2:
CAGGCAGCGCTGCGTCCTGCTGCGCACGTGGGAAGCCCTGGCCCCGGCCACCCC
CGCGATGCCGCGCGCTCCCCGCTGCCGAGCCGTGCGCTCCCTGCTGCGCAGCCAC
TACCGCGAGGTGCTGCCGCTGGCCACGTTCGTGCGGCGCCTGGGGCCCCAGGGC
TGGCGGCTGGTGCAGCGCGGGGACCCGGCGGCTTTCCGCGCGCTGGTGGCCCAG
TGCCTGGTGTGCGTGCCCTGGGACGCACGGCCGCCCCCCGCCGCCCCCTCCTTCC
GCCAGGTGTCCTGCCTGAAGGAGCTGGTGGCCCGAGTGCTGCAGAGGCTGTGCG
AGCGCGGCGCGAAGAACGTGCTGGCCTTCGGCTTCGCGCTGCTGGACGGGGCCC
GCGGGGGCCCCCCCGAGGCCTTCACCACCAGCGTGCGCAGCTACCTGCCCAACA
CGGTGACCGACGCACTGCGGGGGAGCGGGGCGTGGGGGCTGCTGCTGCGCCGCG
TGGGCGACGACGTGCTGGTTCACCTGCTGGCACGCTGCGCGCTCTTTGTGCTGGT
GGCTCCCAGCTGCGCCTACCAGGTGTGCGGGCCGCCGCTGTACCAGCTCGGCGCT
GCCACTCAGGCCCGGCCCCCGCCACACGCTAGTGGACCCCGAAGGCGTCTGGGA
TGCGAACGGGCCTGGAACCATAGCGTCAGGGAGGCCGGGGTCCCCCTGGGCCTG
CCAGCCCCGGGTGCGAGGAGGCGCGGGGGCAGTGCCAGCCGAAGTCTGCCGTTG
CCCAAGAGGCCCAGGCGTGGCGCTGCCCCTGAGCCGGAGCGGACGCCCGTTGGG
CAGGGGTCCTGGGCCCACCCGGGCAGGACGCGTGGACCGAGTGACCGTGGTTTC
TGTGTGGTGTCACCTGCCAGACCCGCCGAAGAAGCCACCTCTTTGGAGGGTGCGC
TCTCTGGCACGCGCCACTCCCACCCATCCGTGGGCCGCCAGCACCACGCGGGCCC
CCCATCCACATCGCGGCCACCACGTCCCTGGGACACGCCTTGTCCCCCGGTGTAC
GCCGAGACCAAGCACTTCCTCTACTCCTCAGGCGACAAGGAGCAGCTGCGGCCC
TCCTTCCTACTCAGCTCTCTGAGGCCCAGCCTGACTGGCGCTCGGAGGCTCGTGG
AGACCATCTTTCTGGGTTCCAGGCCCTGGATGCCAGGGACTCCCCGCAGGTTGCC
CCGCCTGCCCCAGCGCTACTGGCAAATGCGGCCCCTGTTTCTGGAGCTGCTTGGG
AACCACGCGCAGTGCCCCTACGGGGTGCTCCTCAAGACGCACTGCCCGCTGCGA
GCTGCGGTCACCCCAGCAGCCGGTGTCTGTGCCCGGGAGAAGCCCCAGGGCTCT
GTGGCGGCCCCCGAGGAGGAGGACACAGACCCCCGTCGCCTGGTGCAGCTGCTC
CGCCAGCACAGCAGCCCCTGGCAGGTGTACGGCTTCGTGCGGGCCTGCCTGCGC
CGGCTGGTGCCCCCAGGCCTCTGGGGCTCCAGGCACAACGAACGCCGCTTCCTCA
GGAACACCAAGAAGTTCATCTCCCTGGGGAAGCATGCCAAGCTCTCGCTGCAGG
AGCTGACGTGGAAGATGAGCGTGCGGGACTGCGCTTGGCTGCGCAGGAGCCCAG
GGGTTGGCTGTGTTCCGGCCGCAGAGCACCGTCTGCGTGAGGAGATCCTGGCCA
AGTTCCTGCACTGGCTGATGAGTGTGTACGTCGTCGAGCTGCTCAGGTCTTTCTTT
TATGTCACGGAGACCACGTTTCAAAAGAACAGGCTCTTTTTCTACCGGAAGAGTG
TCTGGAGCAAGTTGCAAAGCATTGGAATCAGACAGCACTTGAAGAGGGTGCAGC
TGCGGGAGCTGTCGGAAGCAGAGGTCAGGCAGCATCGGGAAGCCAGGCCCGCCC
TGCTGACGTCCAGACTCCGCTTCATCCCCAAGCCTGACGGGCTGCGGCCGATTGT
G A AC AT GG AC T AC GT C GT GGG AGC C AG A AC GT TC C GC AG AG A A A AG AGGGC C G
AGCGTCTCACCTCGAGGGTGAAGGCACTGTTCAGCGTGCTCAACTACGAGCGGG
CGCGGCGCCCCGGCCTCCTGGGCGCCTCTGTGCTGGGCCTGGACGATATCCACAG
GGCCTGGCGCACCTTCGTGCTGCGTGTGCGGGCCCAGGACCCGCCGCCTGAGCTG
TACTTTGTCAAGGTGGATGTGACGGGCGCGTACGACACCATCCCCCAGGACAGG
CTCACGGAGGTCATCGCCAGCATCATCAAACCCCAGAACACGTACTGCGTGCGT
CGGTATGCCGTGGTCCAGAAGGCCGCCCATGGGCACGTCCGCAAGGCCTTCAAG
AGCCACGTCTCTACCTTGACAGACCTCCAGCCGTACATGCGACAGTTCGTGGCTC
ACCTGCAGGAGACCAGCCCGCTGAGGGATGCCGTCGTCATCGAGCAGAGCTCCT
CCCTGAATGAGGCCAGCAGTGGCCTCTTCGACGTCTTCCTACGCTTCATGTGCCA
CCACGCCGTGCGCATCAGGGGCAAGTCCTACGTCCAGTGCCAGGGGATCCCGCA
GGGCTCCATCCTCTCCACGCTGCTCTGCAGCCTGTGCTACGGCGACATGGAGAAC
AAGCTGTTTGCGGGGATTCGGCGGGACGGGCTGCTCCTGCGTTTGGTGGATGATT
TCTTGTTGGTGACACCTCACCTCACCCACGCGAAAACCTTCCTCAGGACCCTGGT
CCGAGGTGTCCCTGAGTATGGCTGCGTGGTGAACTTGCGGAAGACAGTGGTGAA
CTTCCCTGTAGAAGACGAGGCCCTGGGTGGCACGGCTTTTGTTCAGATGCCGGCC
CACGGCCTATTCCCCTGGTGCGGCCTGCTGCTGGATACCCGGACCCTGGAGGTGC
AGAGCGACTACTCCAGCTATGCCCGGACCTCCATCAGAGCCAGTCTCACCTTCAA
CCGCGGCTTCAAGGCTGGGAGGAACATGCGTCGCAAACTCTTTGGGGTCTTGCGG
CTGAAGTGTCACAGCCTGTTTCTGGATTTGCAGGTGAACAGCCTCCAGACGGTGT
GCACCAACATCTACAAGATCCTCCTGCTGCAGGCGTACAGGTTTCACGCATGTGT
GCTGCAGCTCCCATTTCATCAGCAAGTTTGGAAGAACCCCACATTTTTCCTGCGC
GTCATCTCTGACACGGCCTCCCTCTGCTACTCCATCCTGAAAGCCAAGAACGCAG
GGATGTCGCTGGGGGCCAAGGGCGCCGCCGGCCCTCTGCCCTCCGAGGCCGTGC
AGTGGCTGTGCCACCAAGCATTCCTGCTCAAGCTGACTCGACACCGTGTCACCTA
CGTGCCACTCCTGGGGTCACTCAGGACAGCCCAGACGCAGCTGAGTCGGAAGCT
CCCGGGGACGACGCTGACTGCCCTGGAGGCCGCAGCCAACCCGGCACTGCCCTC
AGACTTCAAGACCATCCTGGACTGATGGCCACCCGCCCACAGCCAGGCCGAGAG
CAGACACCAGCAGCCCTGTCACGCCGGGCTCTACGTCCCAGGGAGGGAGGGGCG
GCCCACACCCAGGCCCGCACCGCTGGGAGTCTGAGGCCTGAGTGAGTGTTTGGC
CGAGGCCTGCATGTCCGGCTGAAGGCTGAGTGTCCGGCTGAGGCCTGAGCGAGT
GTCCAGCCAAGGGCTGAGTGTCCAGCACACCTGCCGTCTTCACTTCCCCACAGGC
TGGCGCTCGGCTCCACCCCAGGGCCAGCTTTTCCTCACCAGGAGCCCGGCTTCCA
CTCCCCACATAGGAATAGTCCATCCCCAGATTCGCCATTGTTCACCCCTCGCCCT
GCCCTCCTTTGCCTTCCACCCCCACCATCCAGGTGGAGACCCTGAGAAGGACCCT
GGGAGCTCTGGGAATTTGGAGTGACCAAAGGTGTGCCCTGTACACAGGCGAGGA
CCCTGCACCTGGATGGGGGTCCCTGTGGGTCAAATTGGGGGGAGGTGCTGTGGG
AGT A A A AT AC T GA AT AT AT GAGTTTTT C AGTTTT GA A A A A A A (SEQ ID NO:3).
[0051] Human telomerase reverse transcriptase isoform 1, NCBI reference sequence:
NP_937983.2:
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLV C VPWD ARPPP AAP SFRQ V SCLKEL VARVLQRLCERGAKNVL AF GF ALLDGARGGPP E AF TT S VRS YLPNT VTD ALRGS GAW GLLLRRV GDD VL VHLL ARC ALF VL V AP S CAY QVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRR GGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEE AT SLEGAL S GTRHSHP S VGRQHH AGPP S T SRPPRP WDTPCPP V Y AETKHFL Y S S GDK EQLRP SFLL S SLRP SLT GARRLVETIFLGSRPWMPGTPRRLPRLPQRYW QMRPLFLEL LGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLL RQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELT WKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVT
ETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLR FIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGAS VLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQN TYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVI EQS S SLNEAS SGLFDVFLRFMCHHAVRIRGKS YVQCQGIPQGSILSTLLC SLC YGDME NKLF AGIRRDGLLLRLVDDFLL VTPHLTHAKTFLRTL VRGVPEY GC VVNLRKT VVNF P VEDEALGGTAF VQMP AHGLFPWCGLLLDTRTLE V Q SD Y S S YART SIRASLTFNRGF KAGRNMRRKLF GVLRLKCHSLFLDLQVN SLQTVCTNIYKILLLQ AYRFHACVLQLPF HQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQA FLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
(SEQ ID NO:4).
[0052] Mus musculus telomerase reverse transcriptase (Tert), transcript variant 2, mRNA,
NCBI Reference Sequence: NM_001362387.1 :
GTTCCCAGCCTCATCTTTTTCGTCGTGGACTCTCAGTGGCCTGGGTCCTGGCTGTT
TTCTAAGCACACCCTTGCATCTTGGTTCCCGCACGTGGGAGGCCCATCCCGGCCT
TGAGCACAATGACCCGCGCTCCTCGTTGCCCCGCGGTGCGCTCTCTGCTGCGCAG
CCGATACCGGGAGGTGTGGCCGCTGGCAACCTTTGTGCGGCGCCTGGGGCCCGA
GGGCAGGCGGCTTGTGCAACCCGGGGACCCGAAGATCTACCGCACTTTGGTTGC
CCAATGCCTAGTGTGCATGCACTGGGGCTCACAGCCTCCACCTGCCGACCTTTCC
TTCCACCAGGTGTCATCCCTGAAAGAGCTGGTGGCCAGGGTTGTGCAGAGACTCT
GCGAGCGCAACGAGAGAAACGTGCTGGCTTTTGGCTTTGAGCTGCTTAACGAGG
CCAGAGGCGGGCCTCCCATGGCCTTCACTAGTAGCGTGCGTAGCTACTTGCCCAA
CACTGTTATTGAGACCCTGCGTGTCAGTGGTGCATGGATGCTACTGTTGAGCCGA
GTGGGCGACGACCTGCTGGTCTACCTGCTGGCACACTGTGCTCTTTATCTTCTGGT
GCCCCCCAGCTGTGCCTACCAGGGGAGATGGCCAAGAGCGTCTAAACCCCTCAT
TCCTACTCAGCAACCTCCAGCCTAACTTGACTGGGGCCAGGAGACTGGTGGAGAT
CATCTTTCTGGGCTCAAGGCCTAGGACATCAGGACCACTCTGCAGGACACACCGT
CTATCGCGTCGATACTGGCAGATGCGGCCCCTGTTCCAACAGCTGCTGGTGAACC
ATGCAGAGTGCCAATATGTCAGACTCCTCAGGTCACATTGCAGGTTTCGAACAGC
AAACCAACAGGTGACAGATGCCTTGAACACCAGCCCACCGCACCTCATGGATTT
GCTCCGCCTGCACAGCAGTCCCTGGCAGGTATATGGTTTTCTTCGGGCCTGTCTCT
GCAAGGTGGTGTCTGCTAGTCTCTGGGGTACCAGGCACAATGAGCGCCGCTTCTT
TAAGAACTTAAAGAAGTTCATCTCGTTGGGGAAATACGGCAAGCTATCACTGCA
GGAACTGAT GT GGAAGAT GAAAGT AGAGGATT GCC ACTGGCTCCGC AGC AGCCC
GGGGAAGGACCGTGTCCCCGCTGCAGAGCACCGTCTGAGGGAGAGGATCCTGGC
TACGTTCCTGTTCTGGCTGATGGACACATACGTGGTACAGCTGCTTAGGTCATTCT
TTTACATCACAGAGAGCACATTCCAGAAGAACAGGCTCTTCTTCTACCGTAAGAG
TGTGTGGAGCAAGCTGCAGAGCATTGGAGTCAGGCAACACCTTGAGAGAGTGCG
GCT ACGGGAGCTGT C AC AAGAGGAGGTC AGGC AT C ACC AGGAC ACCTGGCT AGC
CATGCCCATCTGCAGACTGCGCTTCATCCCCAAGCCCAACGGCCTGCGGCCCATT
GT G A AC AT G AGTT AT AGC AT GGGT AC C AG AGC TT T GGGC AG A AGG A AGC AGGC C
CAGCATTTCACCCAGCGTCTCAAGACTCTCTTCAGCATGCTCAACTATGAGCGGA
CAAAACATCCTCACCTTATGGGGTCTTCTGTACTGGGTATGAATGACATCTACAG
GACCTGGCGGGCCTTTGTGCTGCGTGTGCGTGCTCTGGACCAGACACCCAGGATG
TACTTTGTTAAGGCAGATGTGACCGGGGCCTATGATGCCATCCCCCAGGGTAAGC
TGGTGGAGGTTGTTGCCAATATGATCAGGCACTCGGAGAGCACGTACTGTATCCG
CCAGTATGCAGTGGTCCGGAGAGATAGCCAAGGCCAAGTCCACAAGTCCTTTAG
GAGACAGGTCACCACCCTCTCTGACCTCCAGCCATACATGGGCCAGTTCCTTAAG
CATCTGCAGGATTCAGATGCCAGTGCACTGAGGAACTCCGTTGTCATCGAGCAGA
GCATCTCTATGAATGAGAGCAGCAGCAGCCTGTTTGACTTCTTCCTGCACTTCCT
GCGTCACAGTGTCGTAAAGATTGGTGACAGGTGCTATACGCAGTGCCAGGGCAT
CCCCCAGGGCTCCAGCCTATCCACCCTGCTCTGCAGTCTGTGTTTCGGAGACATG
GAGAACAAGCTGTTTGCTGAGGTGCAGCGGGATGGGTTGCTTTTACGTTTTGTTG
ATGACTTTCTGTTGGTGACGCCTCACTTGGACCAAGCAAAAACCTTCCTCAGCAC
CCTGGTCCATGGCGTTCCTGAGTATGGGTGCATGATAAACTTGCAGAAGACAGTG
GTGAACTTCCCTGTGGAGCCTGGTACCCTGGGTGGTGCAGCTCCATACCAGCTGC
CTGCTCACTGCCTGTTTCCCTGGTGTGGCTTGCTGCTGGACACTCAGACTTTGGAG
GTGTTCTGTGACTACTCAGGTTATGCCCAGACCTCAATTAAGACGAGCCTCACCT
TCCAGAGTGTCTTCAAAGCTGGGAAGACCATGCGGAACAAGCTCCTGTCGGTCTT
GCGGTTGAAGTGTCACGGTCTATTTCTAGACTTGCAGGTGAACAGCCTCCAGACA
GTCTGCATCAATATATACAAGATCTTCCTGCTTCAGGCCTACAGGTTCCATGCAT
GTGTGATTCAGCTTCCCTTTGACCAGCGTGTTAGGAAGAACCTCACATTCTTTCTG
GGCATCATCTCCAGCCAAGCATCCTGCTGCTATGCTATCCTGAAGGTCAAGAATC
CAGGAATGACACTAAAGGCCTCTGGCTCCTTTCCTCCTGAAGCCGCACATTGGCT
CTGCTACCAGGCCTTCCTGCTCAAGCTGGCTGCTCATTCTGTCATCTACAAATGTC
TCCTGGGACCTCTGAGGACAGCCCAAAAACTGCTGTGCCGGAAGCTCCCAGAGG
CGACAATGACCATCCTTAAAGCTGCAGCTGACCCAGCCCTAAGCACAGACTTTCA
GACCATTTTGGACTAACCCTGTCTCCTTCCGCTAGATGAACATGGGCATTGTAGC
CTCAGCACTCCTGGATCCACGTCACAAGAGGGACTGGTCAGTTGTGAGGCTAGGT
CATCCTCCAAACCTCTGTGTCATGGGTGGTATGGGAGATTGTCCCAGTGCCTTGT
TTCCTGTAACAGGCTTGATTTCTTTCCTGATGCCCTCAGGGAGGCAGATCCTATCC
CTTTTAGTGGCAGGGATCCACTAGCACCAGCACATGAGGAGTGCACCCAGTGCA
CATGGGCACTGGGACAGTGGACAGGTGTGAGATTCCTGGGCCCTGGAGTCTTTTC
AC ACCT AACC AT GGAGCCTGTCCC AGT AC AT C AGAGT GCCTCGGAGAT GAA AAA
GGACATCGAGCCAGTGACCTAAATTACAGCCTGAATATACTCTGAATTCATGTGA
CTGCCTTAGCTACTTCTCTACTGCTGTGTAGTAAAACACCAAGCCAACTTATAAA
AGCAGGATTTTCCTACTGGAGCAGCAGCTGAGAGTTTACATCTTGATCCATAAGC
ACAAAAGCACAAGACAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGA
GAG AG AG AG AGAGAG AG AG AG AGT C AGT C AGTC AGTCT AAC AAAT AACT AAGA
AAGGTGAAGGGTGATGAAGTCCACAGGGATCACGCTAGGGATGTTCCATGCCTT
CTCTGAAGCTAAGATTCCTTGGCAGCGTTTGACAGTAACCATAGTGGGTACCTAC
T GAG AT C AC T AT A A AG AT A A A AT AGGGGG A AGC GT ATT T GT ACT G A AC T GG A A A
A AC AT AC A A AT A A AGAGT AAAT CAT GGA A A A A A A A A A A A A A A A A A A (SEQ ID
NO:5).
[0053] Mus musculus telomerase reverse transcriptase isoform 2, NCBI Reference Sequence: NP_001349316.1 :
MRPLFQQLLVNHAECQYVRLLRSHCRFRTANQQVTDALNTSPPHLMDLLRLHSSPW Q VY GFLRACLCK VV S ASLW GTRHNERRFFKNLKKFISLGK Y GKL SLQELMWKMK V EDCHWLRSSPGKDRVPAAEHRLRERILATFLFWLMDTYVVQLLRSFFYITESTFQKN RLFFYRKSVWSKLQSIGVRQHLERVRLRELSQEEVRHHQDTWLAMPICRLRFIPKPN GLRPI VNM S Y SMGTR ALGRRKQ AQHF T QRLKTLF SMLNYERTKHPHLMGS SVLGM NDIYRTWRAFVLRVRALDQTPRMYFVKADVTGAYDAIPQGKLVEVVANMIRHSEST YCIRQYAVVRRDSQGQVHKSFRRQVTTLSDLQPYMGQFLKHLQDSDASALRNSVVI EQ SISMNES S S SLFDFFLHFLRHS VVKIGDRC YTQCQGIPQGS SL STLLC SLCF GDMEN KLF AE V QRDGLLLRF VDDFLL VTPHLDQ AKTFL STL VHGVPE Y GCMINLQKT VVNFP VEPGTLGGAAPYQLPAHCLFPWCGLLLDTQTLEVFCDYSGYAQTSIKTSLTFQSVFK AGKTMRNKLLSVLRLKCHGLFLDLQVNSLQTVCINIYKIFLLQAYRFHACVIQLPFDQ RVRKNLTFFLGIISSQASCCYAILKVKNPGMTLKASGSFPPEAAHWLCYQAFLLKLA AHSVIYKCLLGPLRTAQKLLCRKLPEATMTILKAAADPALSTDFQTILD (SEQ ID NO:6).
[0054] Mus musculus telomerase reverse transcriptase (Tert), transcript variant 3, mRNA, NCBI Reference Sequence: NM_001362388.1 :
GTTCCCAGCCTCATCTTTTTCGTCGTGGACTCTCAGTGGCCTGGGTCCTGGCTGTT
TTCTAAGCACACCCTTGCATCTTGGTTCCCGCACGTGGGAGGCCCATCCCGGCCT
TGAGCACAATGACCCGCGCTCCTCGTTGCCCCGCGGTGCGCTCTCTGCTGCGCAG
CCGATACCGGGAGGTGTGGCCGCTGGCAACCTTTGTGCGGCGCCTGGGGCCCGA
GGGCAGGCGGCTTGTGCAACCCGGGGACCCGAAGATCTACCGCACTTTGGTTGC
CCAATGCCTAGTGTGCATGCACTGGGGCTCACAGCCTCCACCTGCCGACCTTTCC
TTCCACCAGGTGTCATCCCTGAAAGAGCTGGTGGCCAGGGTTGTGCAGAGACTCT
GCGAGCGCAACGAGAGAAACGTGCTGGCTTTTGGCTTTGAGCTGCTTAACGAGG
CCAGAGGCGGGCCTCCCATGGCCTTCACTAGTAGCGTGCGTAGCTACTTGCCCAA
CACTGTTATTGAGACCCTGCGTGTCAGTGGTGCATGGATGCTACTGTTGAGCCGA
GTGGGCGACGACCTGCTGGTCTACCTGCTGGCACACTGTGCTCTTTATCTTCTGGT
GCCCCCCAGCTGTGCCTACCAGGGGAGATGGCCAAGAGCGTCTAAACCCCTCAT
TCCTACTCAGCAACCTCCAGCCTAACTTGACTGGGGCCAGGAGACTGGTGGAGAT
CATCTTTCTGGGCTCAAGGCCTAGGACATCAGGACCACTCTGCAGGACACACCGT
CTATCGCGTCGATACTGGCAGATGCGGCCCCTGTTCCAACAGCTGCTGGTGAACC
ATGCAGAGTGCCAATATGTCAGACTCCTCAGGTCACATTGCAGGTTTCGAACAGC
AAACCAACAGGTGACAGATGCCTTGAACACCAGCCCACCGCACCTCATGGATTT
GCTCCGCCTGCACAGCAGTCCCTGGCAGGGAAGGACCGTGTCCCCGCTGCAGAG
CACCGTCTGAGGGAGAGGATCCTGGCTACGTTCCTGTTCTGGCTGATGGACACAT
ACGTGGTACAGCTGCTTAGGTCATTCTTTTACATCACAGAGAGCACATTCCAGAA
GAACAGGCTCTTCTTCTACCGTAAGAGTGTGTGGAGCAAGCTGCAGAGCATTGG
AGTCAGGCAACACCTTGAGAGAGTGCGGCTACGGGAGCTGTCACAAGAGGAGGT
CAGGCATCACCAGGACACCTGGCTAGCCATGCCCATCTGCAGACTGCGCTTCATC
CCCAAGCCCAACGGCCTGCGGCCCATTGTGAACATGAGTTATAGCATGGGTACC
AGAGCTTTGGGCAGAAGGAAGCAGGCCCAGCATTTCACCCAGCGTCTCAAGACT
CTCTTCAGCATGCTCAACTATGAGCGGACAAAACATCCTCACCTTATGGGGTCTT
CTGTACTGGGTATGAATGACATCTACAGGACCTGGCGGGCCTTTGTGCTGCGTGT
GCGTGCTCTGGACCAGACACCCAGGATGTACTTTGTTAAGGCAGATGTGACCGG
GGCCTATGATGCCATCCCCCAGGGTAAGCTGGTGGAGGTTGTTGCCAATATGATC
AGGC AC TCGGAGAGC AC GT AC T GT ATCC GC C AGT AT GC AGT GGTCC GGAGAGAT
AGCCAAGGCCAAGTCCACAAGTCCTTTAGGAGACAGGTCACCACCCTCTCTGAC
CTCCAGCCATACATGGGCCAGTTCCTTAAGCATCTGCAGGATTCAGATGCCAGTG
CACTGAGGAACTCCGTTGTCATCGAGCAGAGCATCTCTATGAATGAGAGCAGCA
GCAGCCTGTTTGACTTCTTCCTGCACTTCCTGCGTCACAGTGTCGTAAAGATTGGT
GACAGGTGCTATACGCAGTGCCAGGGCATCCCCCAGGGCTCCAGCCTATCCACC
CTGCTCTGCAGTCTGTGTTTCGGAGACATGGAGAACAAGCTGTTTGCTGAGGTGC
AGCGGGATGGGTTGCTTTTACGTTTTGTTGATGACTTTCTGTTGGTGACGCCTCAC
TTGGACCAAGCAAAAACCTTCCTCAGCACCCTGGTCCATGGCGTTCCTGAGTATG
GGTGCATGATAAACTTGCAGAAGACAGTGGTGAACTTCCCTGTGGAGCCTGGTA
CCCTGGGTGGTGCAGCTCCATACCAGCTGCCTGCTCACTGCCTGTTTCCCTGGTGT
GGCTTGCTGCTGGACACTCAGACTTTGGAGGTGTTCTGTGACTACTCAGGTTATG
CCCAGACCTCAATTAAGACGAGCCTCACCTTCCAGAGTGTCTTCAAAGCTGGGAA
GACCATGCGGAACAAGCTCCTGTCGGTCTTGCGGTTGAAGTGTCACGGTCTATTT
CTAGACTTGCAGGTGAACAGCCTCCAGACAGTCTGCATCAATATATACAAGATCT
TCCTGCTTCAGGCCTACAGGTTCCATGCATGTGTGATTCAGCTTCCCTTTGACCAG
CGTGTTAGGAAGAACCTCACATTCTTTCTGGGCATCATCTCCAGCCAAGCATCCT
GCTGCTATGCTATCCTGAAGGTCAAGAATCCAGGAATGACACTAAAGGCCTCTG
GCTCCTTTCCTCCTGAAGCCGCACATTGGCTCTGCTACCAGGCCTTCCTGCTCAAG
CTGGCTGCTCATTCTGTCATCTACAAATGTCTCCTGGGACCTCTGAGGACAGCCC
AAAAACTGCTGTGCCGGAAGCTCCCAGAGGCGACAATGACCATCCTTAAAGCTG
CAGCTGACCCAGCCCTAAGCACAGACTTTCAGACCATTTTGGACTAACCCTGTCT
CCTTCCGCTAGATGAACATGGGCATTGTAGCCTCAGCACTCCTGGATCCACGTCA
CAAGAGGGACTGGTCAGTTGTGAGGCTAGGTCATCCTCCAAACCTCTGTGTCATG
GGTGGTATGGGAGATTGTCCCAGTGCCTTGTTTCCTGTAACAGGCTTGATTTCTTT
CCTGATGCCCTCAGGGAGGCAGATCCTATCCCTTTTAGTGGCAGGGATCCACTAG
CACCAGCACATGAGGAGTGCACCCAGTGCACATGGGCACTGGGACAGTGGACAG
GTGTGAGATTCCTGGGCCCTGGAGTCTTTTCACACCTAACCATGGAGCCTGTCCC
AGT AC AT C AGAGT GCC T C GGAGAT GA A A A AGGAC ATCGAGC C AGT GAC CT A A AT
TACAGCCTGAATATACTCTGAATTCATGTGACTGCCTTAGCTACTTCTCTACTGCT
GTGTAGTAAAACACCAAGCCAACTTATAAAAGCAGGATTTTCCTACTGGAGCAG
CAGCTGAGAGTTTACATCTTGATCCATAAGCACAAAAGCACAAGACAGAGAGAG
AGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAG
T C AGT C AGT C AGT C T A AC A A AT A AC T A AG A A AGGT G A AGGGT GAT G A AGT C C AC
AGGGATCACGCTAGGGATGTTCCATGCCTTCTCTGAAGCTAAGATTCCTTGGCAG
CGTTTGACAGTAACCATAGTGGGTACCTACTGAGATCACTATAAAGATAAAATA
GGGGGAAGCGTATTTGTACTGAACTGGAAAAACATACAAATAAAGAGTAAATCA
T GG A A A A A A A A A A A A A A A A A A A (SEQ ID NO:7).
[0055] Mus musculus telomerase reverse transcriptase isoform 3, NCBI Reference
Sequence: NP 001349317.1 :
MDTYVVQLLRSFFYITESTFQKNRLFFYRKSVWSKLQSIGVRQHLERVRLRELSQEE
VRHHQDTWLAMPICRLRFIPKPNGLRPIVNMSYSMGTRALGRRKQAQHFTQRLKTL
FSMLNYERTKHPHLMGSSVLGMNDIYRTWRAFVLRVRALDQTPRMYFVKADVTGA
YDAIPQGKLVEVVANMIRHSESTYCIRQYAVVRRDSQGQVHKSFRRQVTTLSDLQPY
MGQFLKHLQD SD AS ALRN S VVIEQ SISMNES S S SLFDFFLHFLRHS VVKIGDRC YTQC
QGIPQGS SL STLLC SLCF GDMENKLF AEVQRDGLLLRF VDDFLL VTPHLDQ AKTFL ST
LVHGVPEYGCMINLQKTVVNFPVEPGTLGGAAPYQLPAHCLFPWCGLLLDTQTLEV
FCDYSGYAQTSIKTSLTFQSVFKAGKTMRNKLLSVLRLKCHGLFLDLQVNSLQTVCI
NIYKIFLLQAYRFHACVIQLPFDQRVRKNLTFFLGIISSQASCCYAILKVKNPGMTLKA
SGSFPPEAAHWLCYQAFLLKLAAHSVIYKCLLGPLRTAQKLLCRKLPEATMTILKAA
ADPALSTDFQTILD (SEQ ID NO:8).
[0056] Mus musculus telomerase reverse transcriptase (Tert), transcript variant 1, mRNA,
NCBI Reference Sequence: NM_009354.2:
GTTCCCAGCCTCATCTTTTTCGTCGTGGACTCTCAGTGGCCTGGGTCCTGGCTGTT
TTCTAAGCACACCCTTGCATCTTGGTTCCCGCACGTGGGAGGCCCATCCCGGCCT
TGAGCACAATGACCCGCGCTCCTCGTTGCCCCGCGGTGCGCTCTCTGCTGCGCAG
CCGATACCGGGAGGTGTGGCCGCTGGCAACCTTTGTGCGGCGCCTGGGGCCCGA
GGGCAGGCGGCTTGTGCAACCCGGGGACCCGAAGATCTACCGCACTTTGGTTGC
CCAATGCCTAGTGTGCATGCACTGGGGCTCACAGCCTCCACCTGCCGACCTTTCC
TTCCACCAGGTGTCATCCCTGAAAGAGCTGGTGGCCAGGGTTGTGCAGAGACTCT
GCGAGCGCAACGAGAGAAACGTGCTGGCTTTTGGCTTTGAGCTGCTTAACGAGG
CCAGAGGCGGGCCTCCCATGGCCTTCACTAGTAGCGTGCGTAGCTACTTGCCCAA
CACTGTTATTGAGACCCTGCGTGTCAGTGGTGCATGGATGCTACTGTTGAGCCGA
GTGGGCGACGACCTGCTGGTCTACCTGCTGGCACACTGTGCTCTTTATCTTCTGGT
GCCCCCCAGCTGTGCCTACCAGGTGTGTGGGTCTCCCCTGTACCAAATTTGTGCC
ACCACGGATATCTGGCCCTCTGTGTCCGCTAGTTACAGGCCCACCCGACCCGTGG
GCAGGAATTTCACTAACCTTAGGTTCTTACAACAGATCAAGAGCAGTAGTCGCCA
GGAAGCACCGAAACCCCTGGCCTTGCCATCTCGAGGTACAAAGAGGCATCTGAG
TCTCACCAGTACAAGTGTGCCTTCAGCTAAGAAGGCCAGATGCTATCCTGTCCCG
AGAGTGGAGGAGGGACCCCACAGGCAGGTGCTACCAACCCCATCAGGCAAATCA
TGGGTGCCAAGTCCTGCTCGGTCCCCCGAGGTGCCTACTGCAGAGAAAGATTTGT
CTTCT AAAGGAAAGGT GTCTGACCTGAGTCTCTCTGGGTCGGTGT GCTGT A AAC A
CAAGCCCAGCTCCACATCTCTGCTGTCACCACCCCGCCAAAATGCCTTTCAGCTC
AGGCCATTTATTGAGACCAGACATTTCCTTTACTCCAGGGGAGATGGCCAAGAGC
GTCTAAACCCCTCATTCCTACTCAGCAACCTCCAGCCTAACTTGACTGGGGCCAG
GAGACTGGT GGAGAT C ATCTTTCTGGGCTC AAGGCCT AGGAC AT C AGGACC ACTC
TGCAGGACACACCGTCTATCGCGTCGATACTGGCAGATGCGGCCCCTGTTCCAAC
AGCTGCTGGTGAACCATGCAGAGTGCCAATATGTCAGACTCCTCAGGTCACATTG
CAGGTTTCGAACAGCAAACCAACAGGTGACAGATGCCTTGAACACCAGCCCACC
GCACCTCATGGATTTGCTCCGCCTGCACAGCAGTCCCTGGCAGGTATATGGTTTT
CTTCGGGCCTGTCTCTGCAAGGTGGTGTCTGCTAGTCTCTGGGGTACCAGGCACA
ATGAGCGCCGCTTCTTTAAGAACTTAAAGAAGTTCATCTCGTTGGGGAAATACGG
C A AGC T AT C AC T GC AGG A AC T GAT GT GG A AG AT G A A AGT AG AGG AT T GC C AC TG
GCTCCGCAGCAGCCCGGGGAAGGACCGTGTCCCCGCTGCAGAGCACCGTCTGAG
GGAGAGGATCCTGGCTACGTTCCTGTTCTGGCTGATGGACACATACGTGGTACAG
CTGCTT AGGT C ATTCTTTT AC AT C AC AGAGAGC AC ATTCC AGAAGAAC AGGCTCT
TCTTCT ACCGT AAGAGT GTGT GGAGC AAGCTGC AGAGC ATT GGAGT C AGGC AAC
ACCTTGAGAGAGTGCGGCTACGGGAGCTGTCACAAGAGGAGGTCAGGCATCACC
AGGACACCTGGCTAGCCATGCCCATCTGCAGACTGCGCTTCATCCCCAAGCCCAA
CGGCCTGCGGCCCATTGTGAACATGAGTTATAGCATGGGTACCAGAGCTTTGGGC
AGAAGGAAGCAGGCCCAGCATTTCACCCAGCGTCTCAAGACTCTCTTCAGCATG
CTCAACTATGAGCGGACAAAACATCCTCACCTTATGGGGTCTTCTGTACTGGGTA
TGAATGACATCTACAGGACCTGGCGGGCCTTTGTGCTGCGTGTGCGTGCTCTGGA
CCAGACACCCAGGATGTACTTTGTTAAGGCAGATGTGACCGGGGCCTATGATGCC
ATCCCCCAGGGTAAGCTGGTGGAGGTTGTTGCCAATATGATCAGGCACTCGGAG
AGCACGTACTGTATCCGCCAGTATGCAGTGGTCCGGAGAGATAGCCAAGGCCAA
GTCCACAAGTCCTTTAGGAGACAGGTCACCACCCTCTCTGACCTCCAGCCATACA
TGGGCCAGTTCCTTAAGCATCTGCAGGATTCAGATGCCAGTGCACTGAGGAACTC
CGTTGTCATCGAGCAGAGCATCTCTATGAATGAGAGCAGCAGCAGCCTGTTTGAC
TTCTTCCTGCACTTCCTGCGTCACAGTGTCGTAAAGATTGGTGACAGGTGCTATA
CGCAGTGCCAGGGCATCCCCCAGGGCTCCAGCCTATCCACCCTGCTCTGCAGTCT
GTGTTTCGGAGAC AT GGAGAAC A AGCTGTTT GCTGAGGTGC AGCGGGAT GGGTT
GCTTTTACGTTTTGTTGATGACTTTCTGTTGGTGACGCCTCACTTGGACCAAGCAA
AAACCTTCCTCAGCACCCTGGTCCATGGCGTTCCTGAGTATGGGTGCATGATAAA
CTTGCAGAAGACAGTGGTGAACTTCCCTGTGGAGCCTGGTACCCTGGGTGGTGCA
GCTCCATACCAGCTGCCTGCTCACTGCCTGTTTCCCTGGTGTGGCTTGCTGCTGGA
CACTCAGACTTTGGAGGTGTTCTGTGACTACTCAGGTTATGCCCAGACCTCAATT
AAGACGAGCCTCACCTTCCAGAGTGTCTTCAAAGCTGGGAAGACCATGCGGAAC
AAGCTCCTGTCGGTCTTGCGGTTGAAGTGTCACGGTCTATTTCTAGACTTGCAGG
TGAACAGCCTCCAGACAGTCTGCATCAATATATACAAGATCTTCCTGCTTCAGGC
CTACAGGTTCCATGCATGTGTGATTCAGCTTCCCTTTGACCAGCGTGTTAGGAAG
AACCTCACATTCTTTCTGGGCATCATCTCCAGCCAAGCATCCTGCTGCTATGCTAT
CCTGAAGGTCAAGAATCCAGGAATGACACTAAAGGCCTCTGGCTCCTTTCCTCCT
GAAGCCGCACATTGGCTCTGCTACCAGGCCTTCCTGCTCAAGCTGGCTGCTCATT
CTGTCATCTACAAATGTCTCCTGGGACCTCTGAGGACAGCCCAAAAACTGCTGTG
CCGGAAGCTCCCAGAGGCGACAATGACCATCCTTAAAGCTGCAGCTGACCCAGC
CCTAAGCACAGACTTTCAGACCATTTTGGACTAACCCTGTCTCCTTCCGCTAGAT
GAACATGGGCATTGTAGCCTCAGCACTCCTGGATCCACGTCACAAGAGGGACTG
GTCAGTTGTGAGGCTAGGTCATCCTCCAAACCTCTGTGTCATGGGTGGTATGGGA
GATTGTCCCAGTGCCTTGTTTCCTGTAACAGGCTTGATTTCTTTCCTGATGCCCTC
AGGGAGGCAGATCCTATCCCTTTTAGTGGCAGGGATCCACTAGCACCAGCACAT
GAGGAGT GC ACC C AGT GC AC AT GGGC AC T GGGAC AGT GGAC AGGT GT GAGATT C
CTGGGCCCTGGAGTCTTTTCACACCTAACCATGGAGCCTGTCCCAGTACATCAGA
GTGCCTCGGAGAT GAAAAAGGAC ATCGAGCC AGT GACCT AAATT AC AGCCTGAA
TATACTCTGAATTCATGTGACTGCCTTAGCTACTTCTCTACTGCTGTGTAGTAAAA
CACCAAGCCAACTTATAAAAGCAGGATTTTCCTACTGGAGCAGCAGCTGAGAGT
TTACATCTTGATCCATAAGCACAAAAGCACAAGACAGAGAGAGAGAGAGAGAG
AGAGAGAGAGAG AGAGAGAGAGAG AGAGAGAGAGAGAGAGAGT C AGT C AGT C
AGT C T A AC A A AT A AC T A AG A A AGGT G A AGGGT GAT G A AGT C C AC AGGG AT C AC G
CTAGGGATGTTCCATGCCTTCTCTGAAGCTAAGATTCCTTGGCAGCGTTTGACAG
T A AC CAT AGT GGGT AC C T AC T GAG AT C AC T AT A A AG AT A A A AT AGGGGG A AGC G
TATTTGTACTGAACTGGAAAAACATACAAATAAAGAGTAAATCATGGAAAAAAA
AAAAAAAAAAAA (SEQ ID NO:9).
[0057] Mus musculus telomerase reverse transcriptase isoform 1, NCBI Reference Sequence: NP_033380.1 :
MTRAPRCPAVRSLLRSRYREVWPLATFVRRLGPEGRRLVQPGDPKIYRTLVAQCLVC MHWGSQPPPADLSFHQ V S SLKELVARVVQRLCERNERNVL AF GFELLNEARGGPPM AF T S S VRS YLPNT VIETLR V S GAWMLLL SRV GDDLL VYLL AHC AL YLL VPP S CAY Q V CGSPL Y QIC ATTDIWP S V S AS YRPTRP VGRNFTNLRFLQQIK S S SRQEAPKPL ALP SRG TKRHLSLTSTSVPSAKKARCYPVPRVEEGPHRQVLPTPSGKSWVPSPARSPEVPTAEK
DL S SKGK V SDL SL S GS VC CKHKP S S T SLL SPPRQNAF QLRPFIETRHFL Y SRGDGQERL
NP SFLL SNLQPNLTGARRL VEIIFLGSRPRT S GPLCRTHRL SRRYW QMRPLF QQLL VN
HAECQYVRLLRSHCRFRTANQQVTDALNTSPPHLMDLLRLHSSPWQVYGFLRACLC
K VV S ASLW GTRHNERRFFKNLKKFISLGK Y GKL SLQELMWKMKVEDCHWLRS SPG
KDRVPAAEHRLRERILATFLFWLMDTYVVQLLRSFFYITESTFQKNRLFFYRKSVWS
KLQ SIGVRQHLERVRLREL S QEEVRHHQDT WL AMPICRLRFIPKPN GLRPI VNM S Y S
MGTRALGRRKQ AQHFTQRLKTLF SMLNYERTKHPHLMGS S VLGMNDIYRTWRAF V
LRVRALDQTPRMYFVKADVTGAYDAIPQGKLVEVVANMIRHSESTYCIRQYAVVRR
DSQGQVHKSFRRQVTTLSDLQPYMGQFLKHLQDSDASALRNSVVIEQSISMNESSSS
LFDFFLHFLRHSVVKIGDRCYTQCQGIPQGSSLSTLLCSLCFGDMENKLFAEVQRDGL
LLRFVDDFLLVTPHLDQAKTFLSTLVHGVPEYGCMINLQKTVVNFPVEPGTLGGAAP
Y QLP AHCLFPWCGLLLDTQTLEVF CD YSGY AQT SECT SLTF Q S VFK AGKTMRNKLLS
VLRLKCHGLFLDLQVNSLQTVCINIYKIFLLQAYRFHACVIQLPFDQRVRKNLTFFLGI
ISSQASCCYAILKVKNPGMTLKASGSFPPEAAHWLCYQAFLLKLAAHSVIYKCLLGP
LRTAQKLLCRKLPEATMTILKAAADPALSTDFQTILD (SEQ ID NO: 10).
[0058] In some embodiments, the TERT polypeptide or nucleic acid comprises a human TERT polypeptide or human TERT nucleic acid. In some embodiments, the TERT polypeptide or TERT nucleic acid is non-human. In some embodiments, the TERT polypeptide or TERT nucleic acid is from mouse, horse, dog, rabbit, or goat.
[0059] The polypeptides or polynucleotides of the disclosure such as those comprising or encoding for a TERT polypeptide, may include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15,
16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40,
41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65,
66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 1 10, 1 1 1, 1 12, 1 13, 1 14, 1 15, 1 16, 1 17, 1 18, 1 19, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130,
131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149,
150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168,
169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187,
188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206,
207, 208, 209, 210, 21 1, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225,
226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244,
245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263,
264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282,
283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540, 541, 542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578, 579, 580, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 594, 595, 596, 597, 598, 599, 600, 601, 602, 603, 604, 605, 606, 607, 608, 609, 610, 611, 612, 613, 614, 615, 616, 617, 618, 619, 620, 621, 622, 623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633, 634, 635, 636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647, 648, 649, 650, 651, 652, 653, 654, 655, 656, 657, 658, 659, 660, 661, 662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672, 673, 674, 675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686, 687, 688, 689, 690, 691, 692, 693, 694, 695, 696, 697, 698, 699, 700, 701, 702, 703, 704, 705, 706, 707, 708, 709, 710, 711, 712, 713, 714, 715, 716, 717, 718, 719, 720, 721, 722, 723, 724, 725, 726, 727, 728, 729, 730, 731, 732, 733, 734, 735, 736, 737, 738, 739, 740, 741, 742, 743, 744, 745, 746, 747, 748, 749, 750, 751, 752, 753, 754, 755, 756, 757, 758, 759, 760, 761, 762, 763, 764, 765, 766, 767, 768, 769, 770, 771, 772, 773, 774, 775, 776, 777, 778, 779, 780, 781, 782, 783, 784, 785, 786, 787, 788, 789, 790, 791, 792, 793, 794, 795, 796, 797, 798, 799, 800, 801, 802, 803, 804, 805, 806, 807, 808, 809, 810, 811, 812, 813, 814, 815, 816, 817, 818, 819, 820, 821, 822, 823, 824, 825, 826, 827, 828, 829, 830, 831, 832, 833, 834, 835, 836, 837, 838, 839, 840, 841, 842, 843, 844, 845, 846, 847, 848, 849, 850, 851, 852, 853, 854, 855, 856, 857, 858, 859, 860, 861, 862, 863, 864, 865, 866, 867, 868, 869, 870, 871, 872, 873, 874, 875, 876, 877, 878, 879, 880, 881, 882, 883, 884, 885, 886, 887, 888, 889, 890, 891, 892, 893, 894, 895, 896, 897, 898, 899, 900, 901, 902, 903, 904, 905, 906, 907, 908, 909, 910, 911, 912, 913, 914, 915, 916, 917, 918, 919, 920, 921, 922, 923, 924, 925, 926, 927, 928,
929, 930, 931, 932, 933, 934, 935, 936, 937, 938, 939, 940, 941, 942, 943, 944, 945, 946, 947,
948, 949, 950, 951, 952, 953, 954, 955, 956, 957, 958, 959, 960, 961, 962, 963, 964, 965, 966,
967, 968, 969, 970, 971, 972, 973, 974, 975, 976, 977, 978, 979, 980, 981, 982, 983, 984, 985,
986, 987, 988, 989, 990, 991, 992, 993, 994, 995, 996, 997, 998, 999, or 1000 (or any derivable range therein) or more variant amino acids or nucleic acid substitutions or be at least 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%. 78%. 79%. 80%. 81%. 82%. 83%. 84%. 85%. 86%. 87%. 88%. 89%. 90%. 91%. 92%.
93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% similar, identical, or homologous with at least, or at most 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518,
519, 520, 521, 522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537,
538, 539, 540, 541, 542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556,
557, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575,
576, 577, 578, 579, 580, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 594,
595, 596, 597, 598, 599, 600, 601, 602, 603, 604, 605, 606, 607, 608, 609, 610, 611, 612, 613,
614, 615, 616, 617, 618, 619, 620, 621, 622, 623, 624, 625, 626, 627, 628, 629, 630, 631, 632,
633, 634, 635, 636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647, 648, 649, 650, 651,
652, 653, 654, 655, 656, 657, 658, 659, 660, 661, 662, 663, 664, 665, 666, 667, 668, 669, 670,
671, 672, 673, 674, 675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686, 687, 688, 689,
690, 691, 692, 693, 694, 695, 696, 697, 698, 699, 700, 701, 702, 703, 704, 705, 706, 707, 708,
709, 710, 711, 712, 713, 714, 715, 716, 717, 718, 719, 720, 721, 722, 723, 724, 725, 726, 727,
728, 729, 730, 731, 732, 733, 734, 735, 736, 737, 738, 739, 740, 741, 742, 743, 744, 745, 746,
747, 748, 749, 750, 751, 752, 753, 754, 755, 756, 757, 758, 759, 760, 761, 762, 763, 764, 765,
766, 767, 768, 769, 770, 771, 772, 773, 774, 775, 776, 777, 778, 779, 780, 781, 782, 783, 784,
785, 786, 787, 788, 789, 790, 791, 792, 793, 794, 795, 796, 797, 798, 799, 800, 801, 802, 803,
804, 805, 806, 807, 808, 809, 810, 811, 812, 813, 814, 815, 816, 817, 818, 819, 820, 821, 822,
823, 824, 825, 826, 827, 828, 829, 830, 831, 832, 833, 834, 835, 836, 837, 838, 839, 840, 841,
842, 843, 844, 845, 846, 847, 848, 849, 850, 851, 852, 853, 854, 855, 856, 857, 858, 859, 860,
861, 862, 863, 864, 865, 866, 867, 868, 869, 870, 871, 872, 873, 874, 875, 876, 877, 878, 879,
880, 881, 882, 883, 884, 885, 886, 887, 888, 889, 890, 891, 892, 893, 894, 895, 896, 897, 898,
899, 900, 901, 902, 903, 904, 905, 906, 907, 908, 909, 910, 911, 912, 913, 914, 915, 916, 917,
918, 919, 920, 921, 922, 923, 924, 925, 926, 927, 928, 929, 930, 931, 932, 933, 934, 935, 936,
937, 938, 939, 940, 941, 942, 943, 944, 945, 946, 947, 948, 949, 950, 951, 952, 953, 954, 955,
956, 957, 958, 959, 960, 961, 962, 963, 964, 965, 966, 967, 968, 969, 970, 971, 972, 973, 974,
975, 976, 977, 978, 979, 980, 981, 982, 983, 984, 985, 986, 987, 988, 989, 990, 991, 992, 993,
994, 995, 996, 997, 998, 999, or 1000 or more contiguous amino acids or nucleic acids, or any range derivable therein, of SEQ ID Nos: 1-10.
[0060] The polypeptides or polynucleotides of the disclosure such as those comprising or encoding for a TERT polypeptide, may include 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42
43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67
68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92
93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132,
133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540, 541, 542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578, 579, 580, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 594, 595, 596, 597, 598, 599, 600, 601, 602, 603, 604, 605, 606, 607, 608, 609, 610, 611, 612, 613, 614, 615, 616, 617, 618, 619, 620, 621, 622, 623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633, 634, 635, 636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647, 648, 649, 650, 651, 652, 653, 654, 655, 656, 657, 658, 659, 660, 661, 662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672, 673, 674, 675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686, 687, 688, 689, 690, 691, 692, 693, 694, 695, 696, 697, 698, 699, 700, 701, 702, 703, 704, 705, 706, 707, 708, 709, 710, 711, 712, 713, 714, 715, 716, 717, 718, 719, 720, 721, 722, 723, 724, 725, 726, 727, 728, 729, 730, 731, 732, 733, 734, 735, 736, 737, 738, 739, 740, 741, 742, 743, 744, 745, 746, 747, 748, 749, 750, 751, 752, 753, 754, 755, 756, 757, 758, 759, 760, 761, 762, 763, 764, 765, 766, 767, 768, 769, 770, 771, 772, 773, 774, 775, 776, 777, 778,
779, 780, 781, 782, 783, 784, 785, 786, 787, 788, 789, 790, 791, 792, 793, 794, 795, 796, 797,
798, 799, 800, 801, 802, 803, 804, 805, 806, 807, 808, 809, 810, 811, 812, 813, 814, 815, 816,
817, 818, 819, 820, 821, 822, 823, 824, 825, 826, 827, 828, 829, 830, 831, 832, 833, 834, 835,
836, 837, 838, 839, 840, 841, 842, 843, 844, 845, 846, 847, 848, 849, 850, 851, 852, 853, 854,
855, 856, 857, 858, 859, 860, 861, 862, 863, 864, 865, 866, 867, 868, 869, 870, 871, 872, 873,
874, 875, 876, 877, 878, 879, 880, 881, 882, 883, 884, 885, 886, 887, 888, 889, 890, 891, 892,
893, 894, 895, 896, 897, 898, 899, 900, 901, 902, 903, 904, 905, 906, 907, 908, 909, 910, 911,
912, 913, 914, 915, 916, 917, 918, 919, 920, 921, 922, 923, 924, 925, 926, 927, 928, 929, 930,
931, 932, 933, 934, 935, 936, 937, 938, 939, 940, 941, 942, 943, 944, 945, 946, 947, 948, 949,
950, 951, 952, 953, 954, 955, 956, 957, 958, 959, 960, 961, 962, 963, 964, 965, 966, 967, 968,
969, 970, 971, 972, 973, 974, 975, 976, 977, 978, 979, 980, 981, 982, 983, 984, 985, 986, 987,
988, 989, 990, 991, 992, 993, 994, 995, 996, 997, 998, 999, 1000, 1001, 1002, 1003, 1004, 1005, 1006, 1007, 1008, 1009, 1010, 1011, 1012, 1013, 1014, 1015, 1016, 1017, 1018, 1019,
1020, 1021, 1022, 1023, 1024, 1025, 1026, 1027, 1028, 1029, 1030, 1031, 1032, 1033, 1034,
1035, 1036, 1037, 1038, 1039, 1040, 1041, 1042, 1043, 1044, 1045, 1046, 1047, 1048, 1049,
1050, 1051, 1052, 1053, 1054, 1055, 1056, 1057, 1058, 1059, 1060, 1061, 1062, 1063, 1064,
1065, 1066, 1067, 1068, 1069, 1070, 1071, 1072, 1073, 1074, 1075, 1076, 1077, 1078, 1079,
1080, 1081, 1082, 1083, 1084, 1085, 1086, 1087, 1088, 1089, 1090, 1091, 1092, 1093, 1094,
1095, 1096, 1097, 1098, 1099, 1100, 1101, 1102, 1103, 1104, 1105, 1106, 1107, 1108, 1109,
1110, 1111, 1112, 1113, 1114, 1115, 1116, 1117, 1118, 1119, 1120, 1121, 1122, 1123, 1124,
1125, 1126, 1127, 1128, 1129, 1130, 1131, 1132, 1133, 1134, 1135, 1136, 1137, 1138, 1139,
1140, 1141, 1142, 1143, 1144, 1145, 1146, 1147, 1148, 1149, 1150, 1151, 1152, 1153, 1154,
1155, 1156, 1157, 1158, 1159, 1160, 1161, 1162, 1163, 1164, 1165, 1166, 1167, 1168, 1169,
1170, 1171, 1172, 1173, 1174, 1175, 1176, 1177, 1178, 1179, 1180, 1181, 1182, 1183, 1184,
1185, 1186, 1187, 1188, 1189, 1190, 1191, 1192, 1193, 1194, 1195, 1196, 1197, 1198, 1199,
1200, 1201, 1202, 1203, 1204, 1205, 1206, 1207, 1208, 1209, 1210, 1211, 1212, 1213, 1214,
1215, 1216, 1217, 1218, 1219, 1220, 1221, 1222, 1223, 1224, 1225, 1226, 1227, 1228, 1229,
1230, 1231, 1232, 1233, 1234, 1235, 1236, 1237, 1238, 1239, 1240, 1241, 1242, 1243, 1244,
1245, 1246, 1247, 1248, 1249, 1250, 1251, 1252, 1253, 1254, 1255, 1256, 1257, 1258, 1259,
1260, 1261, 1262, 1263, 1264, 1265, 1266, 1267, 1268, 1269, 1270, 1271, 1272, 1273, 1274,
1275, 1276, 1277, 1278, 1279, 1280, 1281, 1282, 1283, 1284, 1285, 1286, 1287, 1288, 1289,
1290, 1291, 1292, 1293, 1294, 1295, 1296, 1297, 1298, 1299, 1300, 1301, 1302, 1303, 1304,
1305, 1306, 1307, 1308, 1309, 1310, 1311, 1312, 1313, 1314, 1315, 1316, 1317, 1318, 1319,
1320, 1321, 1322, 1323, 1324, 1325, 1326, 1327, 1328, 1329, 1330, 1331, 1332, 1333, 1334,
1335, 1336, 1337, 1338, 1339, 1340, 1341, 1342, 1343, 1344, 1345, 1346, 1347, 1348, 1349, 1350, 1351, 1352, 1353, 1354, 1355, 1356, 1357, 1358, 1359, 1360, 1361, 1362, 1363, 1364, 1365, 1366, 1367, 1368, 1369, 1370, 1371, 1372, 1373, 1374, 1375, 1376, 1377, 1378, 1379, 1380, 1381, 1382, 1383, 1384, 1385, 1386, 1387, 1388, 1389, 1390, 1391, 1392, 1393, 1394, 1395, 1396, 1397, 1398, 1399, 1400, 1401, 1402, 1403, 1404, 1405, 1406, 1407, 1408, 1409, 1410, 1411, 1412, 1413, 1414, 1415, 1416, 1417, 1418, 1419, 1420, 1421, 1422, 1423, 1424, 1425, 1426, 1427, 1428, 1429, 1430, 1431, 1432, 1433, 1434, 1435, 1436, 1437, 1438, 1439, 1440, 1441, 1442, 1443, 1444, 1445, 1446, 1447, 1448, 1449, 1450, 1451, 1452, 1453, 1454, 1455, 1456, 1457, 1458, 1459, 1460, 1461, 1462, 1463, 1464, 1465, 1466, 1467, 1468, 1469, 1470, 1471, 1472, 1473, 1474, 1475, 1476, 1477, 1478, 1479, 1480, 1481, 1482, 1483, 1484, 1485, 1486, 1487, 1488, 1489, 1490, 1491, 1492, 1493, 1494, 1495, 1496, 1497, 1498, 1499, 1500, 1501, 1502, 1503, 1504, 1505, 1506, 1507, 1508, 1509, 1510, 1511, 1512, 1513, 1514, 1515, 1516, 1517, 1518, 1519, 1520, 1521, 1522, 1523, 1524, 1525, 1526, 1527, 1528, 1529, 1530, 1531, 1532, 1533, 1534, 1535, 1536, 1537, 1538, 1539, 1540, 1541, 1542, 1543, 1544, 1545, 1546, 1547, 1548, 1549, 1550, 1551, 1552, 1553, 1554, 1555, 1556, 1557, 1558, 1559, 1560, 1561, 1562, 1563, 1564, 1565, 1566, 1567, 1568, 1569, 1570, 1571, 1572, 1573, 1574, 1575, 1576, 1577, 1578, 1579, 1580, 1581, 1582, 1583, 1584, 1585, 1586, 1587, 1588, 1589, 1590, 1591, 1592, 1593, 1594, 1595, 1596, 1597, 1598, 1599, 1600, 1601, 1602, 1603, 1604, 1605, 1606, 1607, 1608, 1609, 1610, 1611, 1612, 1613, 1614, 1615, 1616, 1617, 1618, 1619, 1620, 1621, 1622, 1623, 1624, 1625, 1626, 1627, 1628, 1629, 1630, 1631, 1632, 1633, 1634, 1635, 1636, 1637, 1638, 1639, 1640, 1641, 1642, 1643, 1644, 1645, 1646, 1647, 1648, 1649, 1650, 1651, 1652, 1653, 1654, 1655, 1656, 1657, 1658, 1659, 1660, 1661, 1662, 1663, 1664, 1665, 1666, 1667, 1668, 1669, 1670, 1671, 1672, 1673, 1674, 1675, 1676, 1677, 1678, 1679, 1680, 1681, 1682, 1683, 1684, 1685, 1686, 1687, 1688, 1689, 1690, 1691, 1692, 1693, 1694, 1695, 1696, 1697, 1698, 1699, 1700, 1701, 1702, 1703, 1704, 1705, 1706, 1707, 1708, 1709, 1710, 1711, 1712, 1713, 1714, 1715, 1716, 1717, 1718, 1719, 1720, 1721, 1722, 1723, 1724, 1725, 1726, 1727, 1728, 1729, 1730, 1731, 1732, 1733, 1734, 1735, 1736, 1737, 1738, 1739, 1740, 1741, 1742, 1743, 1744, 1745, 1746, 1747, 1748, 1749, 1750, 1751, 1752, 1753, 1754, 1755, 1756, 1757, 1758, 1759, 1760, 1761, 1762, 1763, 1764, 1765, 1766, 1767, 1768, 1769, 1770, 1771, 1772, 1773, 1774, 1775, 1776, 1777, 1778, 1779, 1780, 1781, 1782, 1783, 1784, 1785, 1786, 1787, 1788, 1789, 1790, 1791, 1792, 1793, 1794, 1795, 1796, 1797, 1798, 1799, 1800, 1801, 1802, 1803, 1804, 1805, 1806, 1807, 1808, 1809, 1810, 1811, 1812, 1813, 1814, 1815, 1816, 1817, 1818, 1819, 1820, 1821, 1822, 1823, 1824, 1825, 1826, 1827, 1828, 1829, 1830, 1831, 1832, 1833, 1834, 1835, 1836, 1837, 1838, 1839, 1840, 1841, 1842, 1843, 1844,
1845, 1846, 1847, 1848, 1849, 1850, 1851, 1852, 1853, 1854, 1855, 1856, 1857, 1858, 1859,
1860, 1861, 1862, 1863, 1864, 1865, 1866, 1867, 1868, 1869, 1870, 1871, 1872, 1873, 1874,
1875, 1876, 1877, 1878, 1879, 1880, 1881, 1882, 1883, 1884, 1885, 1886, 1887, 1888, 1889,
1890, 1891, 1892, 1893, 1894, 1895, 1896, 1897, 1898, 1899, 1900, 1901, 1902, 1903, 1904,
1905, 1906, 1907, 1908, 1909, 1910, 1911, 1912, 1913, 1914, 1915, 1916, 1917, 1918, 1919,
1920, 1921, 1922, 1923, 1924, 1925, 1926, 1927, 1928, 1929, 1930, 1931, 1932, 1933, 1934,
1935, 1936, 1937, 1938, 1939, 1940, 1941, 1942, 1943, 1944, 1945, 1946, 1947, 1948, 1949,
1950, 1951, 1952, 1953, 1954, 1955, 1956, 1957, 1958, 1959, 1960, 1961, 1962, 1963, 1964,
1965, 1966, 1967, 1968, 1969, 1970, 1971, 1972, 1973, 1974, 1975, 1976, 1977, 1978, 1979,
1980, 1981, 1982, 1983, 1984, 1985, 1986, 1987, 1988, 1989, 1990, 1991, 1992, 1993, 1994,
1995, 1996, 1997, 1998, 1999, or 2000 or more contiguous amino acids or nucleic acids, or any range derivable therein, of SEQ ID NOS: 1-10.
[0061] In some embodiments, the polypeptide comprises amino acids or nucleic acids 1 to
2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79,
80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, S '3, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426,
427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445,
446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464,
465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483,
484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502,
503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521,
522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540,
541, 542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559,
560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578,
579, 580, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 594, 595, 596, 597,
598, 599, 600, 601, 602, 603, 604, 605, 606, 607, 608, 609, 610, 611, 612, 613, 614, 615, 616,
617, 618, 619, 620, 621, 622, 623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633, 634, 635,
636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647, 648, 649, 650, 651, 652, 653, 654,
655, 656, 657, 658, 659, 660, 661, 662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672, 673,
674, 675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686, 687, 688, 689, 690, 691, 692,
693, 694, 695, 696, 697, 698, 699, 700, 701, 702, 703, 704, 705, 706, 707, 708, 709, 710, 711,
712, 713, 714, 715, 716, 717, 718, 719, 720, 721, 722, 723, 724, 725, 726, 727, 728, 729, 730,
731, 732, 733, 734, 735, 736, 737, 738, 739, 740, 741, 742, 743, 744, 745, 746, 747, 748, 749,
750, 751, 752, 753, 754, 755, 756, 757, 758, 759, 760, 761, 762, 763, 764, 765, 766, 767, 768,
769, 770, 771, 772, 773, 774, 775, 776, 777, 778, 779, 780, 781, 782, 783, 784, 785, 786, 787,
788, 789, 790, 791, 792, 793, 794, 795, 796, 797, 798, 799, 800, 801, 802, 803, 804, 805, 806,
807, 808, 809, 810, 811, 812, 813, 814, 815, 816, 817, 818, 819, 820, 821, 822, 823, 824, 825,
826, 827, 828, 829, 830, 831, 832, 833, 834, 835, 836, 837, 838, 839, 840, 841, 842, 843, 844,
845, 846, 847, 848, 849, 850, 851, 852, 853, 854, 855, 856, 857, 858, 859, 860, 861, 862, 863,
864, 865, 866, 867, 868, 869, 870, 871, 872, 873, 874, 875, 876, 877, 878, 879, 880, 881, 882,
883, 884, 885, 886, 887, 888, 889, 890, 891, 892, 893, 894, 895, 896, 897, 898, 899, 900, 901,
902, 903, 904, 905, 906, 907, 908, 909, 910, 911, 912, 913, 914, 915, 916, 917, 918, 919, 920,
921, 922, 923, 924, 925, 926, 927, 928, 929, 930, 931, 932, 933, 934, 935, 936, 937, 938, 939,
940, 941, 942, 943, 944, 945, 946, 947, 948, 949, 950, 951, 952, 953, 954, 955, 956, 957, 958,
959, 960, 961, 962, 963, 964, 965, 966, 967, 968, 969, 970, 971, 972, 973, 974, 975, 976, 977,
978, 979, 980, 981, 982, 983, 984, 985, 986, 987, 988, 989, 990, 991, 992, 993, 994, 995, 996,
997, 998, 999, 1000, 1001, 1002, 1003, 1004, 1005, 1006, 1007, 1008, 1009, 1010, 1011, 1012,
1013, 1014, 1015, 1016, 1017, 1018, 1019, 1020, 1021, 1022, 1023, 1024, 1025, 1026, 1027,
1028, 1029, 1030, 1031, 1032, 1033, 1034, 1035, 1036, 1037, 1038, 1039, 1040, 1041, 1042,
1043, 1044, 1045, 1046, 1047, 1048, 1049, 1050, 1051, 1052, 1053, 1054, 1055, 1056, 1057,
1058, 1059, 1060, 1061, 1062, 1063, 1064, 1065, 1066, 1067, 1068, 1069, 1070, 1071, 1072, 1073, 1074, 1075, 1076, 1077, 1078, 1079, 1080, 1081, 1082, 1083, 1084, 1085, 1086, 1087, 1088, 1089, 1090, 1091, 1092, 1093, 1094, 1095, 1096, 1097, 1098, 1099, 1100, 1101, 1102, 1103, 1104, 1105, 1106, 1107, 1108, 1109, 1110, 1111, 1112, 1113, 1114, 1115, 1116, 1117, 1118, 1119, 1120, 1121, 1122, 1123, 1124, 1125, 1126, 1127, 1128, 1129, 1130, 1131, 1132, 1133, 1134, 1135, 1136, 1137, 1138, 1139, 1140, 1141, 1142, 1143, 1144, 1145, 1146, 1147, 1148, 1149, 1150, 1151, 1152, 1153, 1154, 1155, 1156, 1157, 1158, 1159, 1160, 1161, 1162, 1163, 1164, 1165, 1166, 1167, 1168, 1169, 1170, 1171, 1172, 1173, 1174, 1175, 1176, 1177, 1178, 1179, 1180, 1181, 1182, 1183, 1184, 1185, 1186, 1187, 1188, 1189, 1190, 1191, 1192, 1193, 1194, 1195, 1196, 1197, 1198, 1199, 1200, 1201, 1202, 1203, 1204, 1205, 1206, 1207, 1208, 1209, 1210, 1211, 1212, 1213, 1214, 1215, 1216, 1217, 1218, 1219, 1220, 1221, 1222, 1223, 1224, 1225, 1226, 1227, 1228, 1229, 1230, 1231, 1232, 1233, 1234, 1235, 1236, 1237, 1238, 1239, 1240, 1241, 1242, 1243, 1244, 1245, 1246, 1247, 1248, 1249, 1250, 1251, 1252, 1253, 1254, 1255, 1256, 1257, 1258, 1259, 1260, 1261, 1262, 1263, 1264, 1265, 1266, 1267, 1268, 1269, 1270, 1271, 1272, 1273, 1274, 1275, 1276, 1277, 1278, 1279, 1280, 1281, 1282, 1283, 1284, 1285, 1286, 1287, 1288, 1289, 1290, 1291, 1292, 1293, 1294, 1295, 1296, 1297, 1298, 1299, 1300, 1301, 1302, 1303, 1304, 1305, 1306, 1307, 1308, 1309, 1310, 1311, 1312, 1313, 1314, 1315, 1316, 1317, 1318, 1319, 1320, 1321, 1322, 1323, 1324, 1325, 1326, 1327, 1328, 1329, 1330, 1331, 1332, 1333, 1334, 1335, 1336, 1337, 1338, 1339, 1340, 1341, 1342, 1343, 1344, 1345, 1346, 1347, 1348, 1349, 1350, 1351, 1352, 1353, 1354, 1355, 1356, 1357, 1358, 1359, 1360, 1361, 1362, 1363, 1364, 1365, 1366, 1367, 1368, 1369, 1370, 1371, 1372, 1373, 1374, 1375, 1376, 1377, 1378, 1379, 1380, 1381, 1382, 1383, 1384, 1385, 1386, 1387, 1388, 1389, 1390, 1391, 1392, 1393, 1394, 1395, 1396, 1397, 1398, 1399, 1400, 1401, 1402, 1403, 1404, 1405, 1406, 1407, 1408, 1409, 1410, 1411, 1412, 1413, 1414, 1415, 1416, 1417, 1418, 1419, 1420, 1421, 1422, 1423, 1424, 1425, 1426, 1427, 1428, 1429, 1430, 1431, 1432, 1433, 1434, 1435, 1436, 1437, 1438, 1439, 1440, 1441, 1442, 1443, 1444, 1445, 1446, 1447, 1448, 1449, 1450, 1451, 1452, 1453, 1454, 1455, 1456, 1457, 1458, 1459, 1460, 1461, 1462, 1463, 1464, 1465, 1466, 1467, 1468, 1469, 1470, 1471, 1472, 1473, 1474, 1475, 1476, 1477, 1478, 1479, 1480, 1481, 1482, 1483, 1484, 1485, 1486, 1487, 1488, 1489, 1490, 1491, 1492, 1493, 1494, 1495, 1496, 1497, 1498, 1499, 1500, 1501, 1502, 1503, 1504, 1505, 1506, 1507, 1508, 1509, 1510, 1511, 1512, 1513, 1514, 1515, 1516, 1517, 1518, 1519, 1520, 1521, 1522, 1523, 1524, 1525, 1526, 1527, 1528, 1529, 1530, 1531, 1532, 1533, 1534, 1535, 1536, 1537, 1538, 1539, 1540, 1541, 1542, 1543, 1544, 1545, 1546, 1547, 1548, 1549, 1550, 1551, 1552, 1553, 1554, 1555, 1556, 1557, 1558, 1559, 1560, 1561, 1562, 1563, 1564, 1565, 1566, 1567,
1568, 1569, 1570, 1571, 1572, 1573, 1574, 1575, 1576, 1577, 1578, 1579, 1580, 1581, 1582,
1583, 1584, 1585, 1586, 1587, 1588, 1589, 1590, 1591, 1592, 1593, 1594, 1595, 1596, 1597,
1598, 1599, 1600, 1601, 1602, 1603, 1604, 1605, 1606, 1607, 1608, 1609, 1610, 1611, 1612,
1613, 1614, 1615, 1616, 1617, 1618, 1619, 1620, 1621, 1622, 1623, 1624, 1625, 1626, 1627,
1628, 1629, 1630, 1631, 1632, 1633, 1634, 1635, 1636, 1637, 1638, 1639, 1640, 1641, 1642,
1643, 1644, 1645, 1646, 1647, 1648, 1649, 1650, 1651, 1652, 1653, 1654, 1655, 1656, 1657,
1658, 1659, 1660, 1661, 1662, 1663, 1664, 1665, 1666, 1667, 1668, 1669, 1670, 1671, 1672,
1673, 1674, 1675, 1676, 1677, 1678, 1679, 1680, 1681, 1682, 1683, 1684, 1685, 1686, 1687,
1688, 1689, 1690, 1691, 1692, 1693, 1694, 1695, 1696, 1697, 1698, 1699, 1700, 1701, 1702,
1703, 1704, 1705, 1706, 1707, 1708, 1709, 1710, 1711, 1712, 1713, 1714, 1715, 1716, 1717,
1718, 1719, 1720, 1721, 1722, 1723, 1724, 1725, 1726, 1727, 1728, 1729, 1730, 1731, 1732,
1733, 1734, 1735, 1736, 1737, 1738, 1739, 1740, 1741, 1742, 1743, 1744, 1745, 1746, 1747,
1748, 1749, 1750, 1751, 1752, 1753, 1754, 1755, 1756, 1757, 1758, 1759, 1760, 1761, 1762,
1763, 1764, 1765, 1766, 1767, 1768, 1769, 1770, 1771, 1772, 1773, 1774, 1775, 1776, 1777,
1778, 1779, 1780, 1781, 1782, 1783, 1784, 1785, 1786, 1787, 1788, 1789, 1790, 1791, 1792,
1793, 1794, 1795, 1796, 1797, 1798, 1799, 1800, 1801, 1802, 1803, 1804, 1805, 1806, 1807,
1808, 1809, 1810, 1811, 1812, 1813, 1814, 1815, 1816, 1817, 1818, 1819, 1820, 1821, 1822,
1823, 1824, 1825, 1826, 1827, 1828, 1829, 1830, 1831, 1832, 1833, 1834, 1835, 1836, 1837,
1838, 1839, 1840, 1841, 1842, 1843, 1844, 1845, 1846, 1847, 1848, 1849, 1850, 1851, 1852,
1853, 1854, 1855, 1856, 1857, 1858, 1859, 1860, 1861, 1862, 1863, 1864, 1865, 1866, 1867,
1868, 1869, 1870, 1871, 1872, 1873, 1874, 1875, 1876, 1877, 1878, 1879, 1880, 1881, 1882,
1883, 1884, 1885, 1886, 1887, 1888, 1889, 1890, 1891, 1892, 1893, 1894, 1895, 1896, 1897,
1898, 1899, 1900, 1901, 1902, 1903, 1904, 1905, 1906, 1907, 1908, 1909, 1910, 1911, 1912,
1913, 1914, 1915, 1916, 1917, 1918, 1919, 1920, 1921, 1922, 1923, 1924, 1925, 1926, 1927,
1928, 1929, 1930, 1931, 1932, 1933, 1934, 1935, 1936, 1937, 1938, 1939, 1940, 1941, 1942,
1943, 1944, 1945, 1946, 1947, 1948, 1949, 1950, 1951, 1952, 1953, 1954, 1955, 1956, 1957,
1958, 1959, 1960, 1961, 1962, 1963, 1964, 1965, 1966, 1967, 1968, 1969, 1970, 1971, 1972,
1973, 1974, 1975, 1976, 1977, 1978, 1979, 1980, 1981, 1982, 1983, 1984, 1985, 1986, 1987,
1988, 1989, 1990, 1991, 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, or 2000 (or any derivable range therein) of SEQ ID NOs: 1-10.
[0062] In some embodiments, the polypeptide comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37,
38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62,
63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87,
88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540, 541, 542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578, 579, 580, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 594, 595, 596, 597, 598, 599, 600, 601, 602, 603,
604, 605, 606, 607, 608, 609, 610, 611, 612, 613, 614, or 615 (or any derivable range therein) contiguous amino acids of SEQ ID NOs: 1-10.
[0063] In some embodiments, the polypeptide comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37,
38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62,
63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87,
88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109,
110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540, 541, 542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578, 579, 580, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 594, 595, 596, 597, 598, 599, 600, 601, 602, 603, 604, 605, 606, 607, 608, 609, 610, 611, 612, 613, 614, 615, 616, 617, 618, 619, 620, 621, 622, 623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633, 634, 635, 636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647, 648, 649, 650, 651, 652, 653, 654, 655, 656, 657, 658, 659, 660, 661, 662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672, 673, 674, 675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686, 687, 688, 689, 690, 691, 692, 693, 694, 695, 696, 697, 698, 699, 700, 701, 702, 703, 704, 705, 706, 707, 708, 709, 710, 711, 712, 713, 714, 715, 716, 717, 718, 719, 720, 721, 722, 723, 724, 725, 726, 727, 728, 729, 730, 731, 732, 733, 734, 735, 736, 737, 738, 739, 740, 741, 742, 743, 744, 745, 746, 747, 748, 749, 750, 751, 752, 753, 754, 755,
756, 757, 758, 759, 760, 761, 762, 763, 764, 765, 766, 767, 768, 769, 770, 771, 772, 773, 774,
775, 776, 777, 778, 779, 780, 781, 782, 783, 784, 785, 786, 787, 788, 789, 790, 791, 792, 793,
794, 795, 796, 797, 798, 799, 800, 801, 802, 803, 804, 805, 806, 807, 808, 809, 810, 811, 812,
813, 814, 815, 816, 817, 818, 819, 820, 821, 822, 823, 824, 825, 826, 827, 828, 829, 830, 831,
832, 833, 834, 835, 836, 837, 838, 839, 840, 841, 842, 843, 844, 845, 846, 847, 848, 849, 850,
851, 852, 853, 854, 855, 856, 857, 858, 859, 860, 861, 862, 863, 864, 865, 866, 867, 868, 869,
870, 871, 872, 873, 874, 875, 876, 877, 878, 879, 880, 881, 882, 883, 884, 885, 886, 887, 888,
889, 890, 891, 892, 893, 894, 895, 896, 897, 898, 899, 900, 901, 902, 903, 904, 905, 906, 907,
908, 909, 910, 911, 912, 913, 914, 915, 916, 917, 918, 919, 920, 921, 922, 923, 924, 925, 926,
927, 928, 929, 930, 931, 932, 933, 934, 935, 936, 937, 938, 939, 940, 941, 942, 943, 944, 945,
946, 947, 948, 949, 950, 951, 952, 953, 954, 955, 956, 957, 958, 959, 960, 961, 962, 963, 964,
965, 966, 967, 968, 969, 970, 971, 972, 973, 974, 975, 976, 977, 978, 979, 980, 981, 982, 983,
984, 985, 986, 987, 988, 989, 990, 991, 992, 993, 994, 995, 996, 997, 998, 999, or 1000 (or any derivable range therein) contiguous amino acids of SEQ ID NOs: 1-10 that are at least, at most, or exactly 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%,
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% similar, identical, or homologous with one of SEQ ID NOS: 1-10.
[0064] The polypeptides or polynucleotides of the disclosure may include at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25,
26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50,
51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75
76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119,
120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138,
139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157,
158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176,
177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195,
196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214,
215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233,
234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252,
253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271,
272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290,
291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309,
310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540, 541, 542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578, 579, 580, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 594, 595, 596, 597, 598, 599, or 600 substitutions.
[0065] The substitution may be at amino acid position or nucleic acid position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81
82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123,
124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142,
143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161,
162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180,
181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199,
200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218,
219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237,
238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256,
257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275,
276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294,
295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313,
314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332,
333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351,
352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370,
371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389,
390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408,
409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427,
428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446,
447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465,
466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484,
485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503,
504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522,
523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540, 541,
542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 560,
561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578, 579,
580, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 594, 595, 596, 597, 598,
599, 600, 601, 602, 603, 604, 605, 606, 607, 608, 609, 610, 611, 612, 613, 614, 615, 616, 617,
618, 619, 620, 621, 622, 623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633, 634, 635, 636,
637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647, 648, 649, 650, 651, 652, 653, 654, 655,
656, 657, 658, 659, 660, 661, 662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672, 673, 674,
675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686, 687, 688, 689, 690, 691, 692, 693,
694, 695, 696, 697, 698, 699, 700, 701, 702, 703, 704, 705, 706, 707, 708, 709, 710, 711, 712,
713, 714, 715, 716, 717, 718, 719, 720, 721, 722, 723, 724, 725, 726, 727, 728, 729, 730, 731,
732, 733, 734, 735, 736, 737, 738, 739, 740, 741, 742, 743, 744, 745, 746, 747, 748, 749, 750,
751, 752, 753, 754, 755, 756, 757, 758, 759, 760, 761, 762, 763, 764, 765, 766, 767, 768, 769,
770, 771, 772, 773, 774, 775, 776, 777, 778, 779, 780, 781, 782, 783, 784, 785, 786, 787, 788,
789, 790, 791, 792, 793, 794, 795, 796, 797, 798, 799, 800, 801, 802, 803, 804, 805, 806, 807,
808, 809, 810, 811, 812, 813, 814, 815, 816, 817, 818, 819, 820, 821, 822, 823, 824, 825, 826,
827, 828, 829, 830, 831, 832, 833, 834, 835, 836, 837, 838, 839, 840, 841, 842, 843, 844, 845,
846, 847, 848, 849, 850, 851, 852, 853, 854, 855, 856, 857, 858, 859, 860, 861, 862, 863, 864,
865, 866, 867, 868, 869, 870, 871, 872, 873, 874, 875, 876, 877, 878, 879, 880, 881, 882, 883,
884, 885, 886, 887, 888, 889, 890, 891, 892, 893, 894, 895, 896, 897, 898, 899, 900, 901, 902,
903, 904, 905, 906, 907, 908, 909, 910, 911, 912, 913, 914, 915, 916, 917, 918, 919, 920, 921,
922, 923, 924, 925, 926, 927, 928, 929, 930, 931, 932, 933, 934, 935, 936, 937, 938, 939, 940,
941, 942, 943, 944, 945, 946, 947, 948, 949, 950, 951, 952, 953, 954, 955, 956, 957, 958, 959,
960, 961, 962, 963, 964, 965, 966, 967, 968, 969, 970, 971, 972, 973, 974, 975, 976, 977, 978,
979, 980, 981, 982, 983, 984, 985, 986, 987, 988, 989, 990, 991, 992, 993, 994, 995, 996, 997, 998, 999, or 1000 of one of SEQ ID NOS: 1-10.
[0066] The polypeptides described herein may be of a fixed length of at least, at most, or exactly 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29,
30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66 , 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, or 500 or more amino acids (or any derivable range therein).
[0067] Substitutional variants typically contain the exchange of one amino acid for another at one or more sites within the protein, and may be designed to modulate one or more properties of the polypeptide, with or without the loss of other functions or properties. Substitutions may be conservative, that is, one amino acid is replaced with one of similar shape and charge. Conservative substitutions are well known in the art and include, for example, the changes of:
alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine. Alternatively, substitutions may be non-conservative such that a function or activity of the polypeptide is affected. Non conservative changes typically involve substituting a residue with one that is chemically dissimilar, such as a polar or charged amino acid for a nonpolar or uncharged amino acid, and vice versa.
[0068] Proteins may be recombinant, or synthesized in vitro. Alternatively, a non recombinant or recombinant protein may be isolated from bacteria. It is also contemplated that bacteria containing such a variant may be implemented in compositions and methods. Consequently, a protein need not be isolated.
[0069] The term“functionally equivalent codon” is used herein to refer to codons that encode the same amino acid, such as the six codons for arginine or serine, and also refers to codons that encode biologically equivalent amino acids.
[0070] It also will be understood that amino acid and nucleic acid sequences may include additional residues, such as additional N- or C-terminal amino acids, or 5' or 3' sequences, respectively, and yet still be essentially as set forth in one of the sequences disclosed herein, so long as the sequence meets the criteria set forth above, including the maintenance of biological protein activity where protein expression is concerned. The addition of terminal sequences particularly applies to nucleic acid sequences that may, for example, include various non coding sequences flanking either of the 5' or 3' portions of the coding region.
[0071] The following is a discussion based upon changing of the amino acids of a protein to create an equivalent, or even an improved, second-generation molecule. For example, certain amino acids may be substituted for other amino acids in a protein structure without appreciable loss of interactive binding capacity. Structures such as, for example, an enzymatic catalytic domain or interaction components may have amino acid substituted to maintain such function. Since it is the interactive capacity and nature of a protein that defines that protein’s biological functional activity, certain amino acid substitutions can be made in a protein sequence, and in its underlying DNA coding sequence, and nevertheless produce a protein with like properties. It is thus contemplated by the inventors that various changes may be made in the DNA sequences of genes without appreciable loss of their biological utility or activity.
[0072] In other embodiments, alteration of the function of a polypeptide is intended by introducing one or more substitutions. For example, certain amino acids may be substituted for other amino acids in a protein structure with the intent to modify the interactive binding capacity of interaction components. Structures such as, for example, protein interaction domains, nucleic acid interaction domains, and catalytic sites may have amino acids substituted to alter such function. Since it is the interactive capacity and nature of a protein that defines that protein’s biological functional activity, certain amino acid substitutions can be made in a protein sequence, and in its underlying DNA coding sequence, and nevertheless produce a protein with different properties. It is thus contemplated by the inventors that various changes may be made in the DNA sequences of genes with appreciable alteration of their biological utility or activity.
[0073] In making such changes, the hydropathic index of amino acids may be considered. The importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
[0074] It also is understood in the art that the substitution of like amino acids can be made effectively on the basis of hydrophilicity. U.S. Patent 4,554, 101, incorporated herein by reference, states that the greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with a biological property of the protein. It is understood that an amino acid can be substituted for another having a similar hydrophilicity value and still produce a biologically equivalent and immunologically equivalent protein.
[0075] As outlined above, amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary substitutions that take into consideration the various foregoing characteristics are well known and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
[0076] In specific embodiments, all or part of proteins described herein can also be synthesized in solution or on a solid support in accordance with conventional techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols. See, for example, Stewart and Young, (1984); Tam et ah, (1983); Merrifield, (1986); and Barany and Merrifield (1979), each incorporated herein by reference.
Alternatively, recombinant DNA technology may be employed wherein a nucleotide sequence that encodes a peptide or polypeptide is inserted into an expression vector, transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression. One embodiment includes the use of gene transfer to cells, including microorganisms, for the production and/or presentation of proteins. The gene for the protein of interest may be transferred into appropriate host cells followed by culture of cells under the appropriate conditions. A nucleic acid encoding virtually any polypeptide may be employed. The generation of recombinant expression vectors, and the elements included therein, are discussed herein. Alternatively, the protein to be produced may be an endogenous protein normally synthesized by the cell used for protein production.
II. Gene Delivery
[0077] Certain aspects of the disclosure include administration of a TERT activating therapy to a subject. This may include administration of TERT nucleic acids and/or polypeptides to a subject. The TERT nucleic acids may include a TERT gene, protein, or mRNA encoded on a DNA or RNA. In some embodiments, the methods include administration of DNA encoding for a TERT polypeptide to a subject. In some embodiments, the methods include administration of an RNA encoding a TERT polypeptide to a subject. Techniques pertaining to the transfer of nucleic acids into cells are well-known to those of ordinary skill in the art. Exemplary techniques are discussed below.
A. Viral Vectors
[0078] In certain embodiments, transfer of an expression construct into a cell is accomplished using a viral vector. Techniques using "viral vectors" are well- known in the art. A viral vector is meant to include those constructs containing viral sequences sufficient to (a) support packaging of the expression cassette and (b) to ultimately express a recombinant gene construct that has been cloned therein.
[0079] In particular embodiments, the viral vector is a lentivirus vector. Lentivirus vectors have been successfully used in infecting stem cells and providing long term expression.
[0080] Another method for delivery of a nucleic acid involves the use of an adenovirus vector. Adenovirus vectors are known to have a low capacity for integration into genomic DNA. Adenovirus vectors result in highly efficient gene transfer.
[0081] Adenoviruses are currently the most commonly used vector for gene transfer in clinical settings. Among the advantages of these viruses is that they are efficient at gene delivery to both nondividing and dividing cells and can be produced in large quantities. The
vector comprises a genetically engineered form of adenovirus (Grunhaus et al, 1992). In contrast to retrovirus, the adenoviral infection of host cells does not result in chromosomal integration because adenoviral DNA can replicate in an episomal manner without potential genotoxicity. Also, adenoviruses are structurally stable, and no genome rearrangement has been detected after extensive amplification.
[0082] Adenovirus is particularly suitable for use as a gene transfer vector because of its mid- sized genome, ease of manipulation, high titer, wide target-cell range and high infectivity. A person of ordinary skill in the art would be familiar with experimental methods using adenoviral vectors.
[0083] The adenovirus vector may be replication defective, or at least conditionally defective, and the nature of the adenovirus vector is not believed to be crucial to the successful practice of the invention. The adenovirus may be of any of the 42 different known serotypes or subgroups A-F and other serotypes or subgroups are envisioned. Adenovirus type 5 of subgroup C is the starting material in order to obtain the conditional replication- defective adenovirus vector for use in the present invention. This is because Adenovirus type 5 is a human adenovirus about which a great deal of biochemical and genetic information is known, and it has historically been used for most constructions employing adenovirus as a vector. Adenovirus growth and manipulation is known to those of skill in the art, and exhibits broad host range in vitro and in vivo. Modified viruses, such as adenoviruses with alteration of the CAR domain, may also be used. Methods for enhancing delivery or evading an immune response, such as liposome encapsulation of the virus, are also envisioned. The retroviruses are a group of single-stranded RNA viruses characterized by an ability to convert their RNA to double-stranded DNA in infected cells by a process of reverse-transcription (Coffin, 1990). The resulting DNA then stably integrates into cellular chromosomes as a provirus and directs synthesis of viral proteins. The integration results in the retention of the viral gene sequences in the recipient cell and its descendants. The retroviral genome contains two long terminal repeat (LTR) sequences present at the 5' and 3' ends of the viral genome. These contain strong promoter and enhancer sequences and are also required for integration in the host cell genome (Coffin, 1990).
[0084] In order to construct a retroviral vector, a nucleic acid encoding a nucleic acid or gene of interest is inserted into the viral genome in the place of certain viral sequences to produce a virus that is replication-defective. A person of ordinary skill in the art would be familiar with well-known techniques that are available to construct a retroviral vector.
[0085] Adeno-associated virus (AAV) is an attractive vector system for use in the present invention as it has a high frequency of integration and it can infect nondividing cells, thus making it useful for delivery of genes into mammalian cells in tissue culture (Muzyczka, 1992). AAV has a broad host range for infectivity (Tratschin et ah, 1984; Laughlin et al, 1986; Lebkowski et al, 1988; McLaughlin et al, 1988), which means it is applicable for use with the present invention. Details concerning the generation and use of rAAV vectors are described in U.S. Patents 5, 139,941 and 4,797,368, each incorporated herein by reference.
[0086] Typically, recombinant AAV (rAAV) virus is made by cotransfecting a plasmid containing the gene of interest flanked by the two AAV terminal repeats (McLaughlin et al, 1988; Samulski et al, 1989; each incorporated herein by reference) and an expression plasmid containing the wild-type AAV coding sequences without the terminal repeats, for example pIM45 (McCarty et al., 1991; incorporated herein by reference). A person of ordinary skill in the art would be familiar with techniques available to generate vectors using AAV virus.
[0087] Herpes simplex virus (HSV) has generated considerable interest in treating nervous system disorders due to its tropism for neuronal cells, but this vector also can be exploited for other tissues given its wide host range. Another factor that makes HSV an attractive vector is the size and organization of the genome. Because HSV is large, incorporation of multiple genes or expression cassettes is less problematic than in other smaller viral systems. In addition, the availability of different viral control sequences with varying performance (temporal, strength, etc) makes it possible to control expression to a greater extent than in other systems. It also is an advantage that the virus has relatively few spliced messages, further easing genetic manipulations.
[0088] HSV also is relatively easy to manipulate and can be grown to high titers. Thus, delivery is less of a problem, both in terms of volumes needed to attain sufficient MOI and in a lessened need for repeat dosings. For a review of HSV as a gene therapy vector, see Glorioso et al. (1995). A person of ordinary skill in the art would be familiar with well- known techniques for use of HSV as vectors.
[0089] Vaccinia virus vectors have been used extensively because of the ease of their construction, relatively high levels of expression obtained, wide host range and large capacity for carrying DNA. Vaccinia contains a linear, double-stranded DNA genome of about 186 kb that exhibits a marked "A-T" preference. Inverted terminal repeats of about 10.5 kb flank the genome.
[0090] Other viral vectors may be employed as constructs in the present invention. For example, vectors derived from viruses such as poxvirus may be employed. A molecularly
cloned strain of Venezuelan equine encephalitis (VEE) virus has been genetically refined as a replication competent vaccine vector for the expression of heterologous viral proteins (Davis et al., 1996). Studies have demonstrated that VEE infection stimulates potent CTL responses and it has been suggested that VEE may be an extremely useful vector for immunizations (Caley et al., 1997). It is contemplated in the present invention, that VEE virus may be useful in targeting dendritic cells.
[0091] A polynucleotide may be housed within a viral vector that has been engineered to express a specific binding ligand. The virus particle will thus bind specifically to the cognate receptors of the target cell and deliver the contents to the cell. A novel approach designed to allow specific targeting of retrovirus vectors was developed based on the chemical modification of a retrovirus by the chemical addition of lactose residues to the viral envelope. This modification can permit the specific infection of hepatocytes via sialoglycoprotein receptors.
[0092] Another approach to targeting of recombinant retroviruses was designed in which biotinylated antibodies against a retroviral envelope protein and against a specific cell receptor were used. The antibodies were coupled via the biotin components by using streptavidin (Roux et al., 1989). Using antibodies against major histocompatibility complex class I and class II antigens, they demonstrated the infection of a variety of human cells that bore those surface antigens with an ecotropic virus in vitro (Roux et al., 1989).
B. Nonviral Gene Transfer
[0093] Several non-viral methods for the transfer of nucleic acids into cells also are contemplated by certain aspects of the present invention. These include calcium phosphate precipitation (Graham and Van Der Eb, 1973; Chen and Okayama, 1987; Rippe et al, 1990) DEAE- dextran (Gopal, 1985), electroporation (Tur-Kaspa et al, 1986; Potter et al, 1984), nucleofection (Trompeter et al, 2003), direct microinjection (Harland and Weintraub, 1985), DNA- loaded liposomes (Nicolau and Sene, 1982; Fraley et al, 1979) and lipofectamine- DNA complexes, polyamino acids, cell sonication (Fechheimer et al, 1987), gene bombardment using high velocity microprojectiles (Yang et al, 1990), polycations (Boussif et al, 1995) and receptor-mediated transfection (Wu and Wu, 1987; Wu and Wu, 1988). Some of these techniques may be successfully adapted for in vivo or ex vivo use. A person of ordinary skill in the art would be familiar with the techniques pertaining to use of nonviral vectors, and would understand that other types of nonviral vectors than those disclosed herein are contemplated by the present invention. In a further embodiment of the invention, the expression cassette may be
entrapped in a liposome or lipid formulation. Liposomes are vesicular structures characterized by a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. Also contemplated is a gene construct complexed with Lipofectamine (Gibco BRL). One of ordinary skill in the art would be familiar with techniques utilizing liposomes and lipid formulations.
C. Lipid-based Nanovesicles
[0094] In some embodiments, a lipid-based nanovesicle, such as a liposome, an exosome, lipid preparations, lipid-based vesicles (e.g., a DOTAPxholesterol vesicle) are employed in the methods of the disclosure. In some embodiments, the nanovesicle comprising a TERT polypeptide or nucleic acid encoding a TERT polypeptide is administered to the subject. Lipid- based nanovesicles may be positively charged, negatively charged or neutral.
1. Liposomes
[0095] A "liposome" is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes may be characterized as having vesicular structures with a bilayer membrane, generally comprising a phospholipid, and an inner medium that generally comprises an aqueous composition. Liposomes provided herein include unilamellar liposomes, multilamellar liposomes, and multivesicular liposomes. Liposomes provided herein may be positively charged, negatively charged, or neutrally charged. In certain embodiments, the liposomes are neutral in charge.
[0096] A multilamellar liposome has multiple lipid layers separated by aqueous medium. Such liposomes form spontaneously when lipids comprising phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers. Lipophilic molecules or molecules with lipophilic regions may also dissolve in or associate with the lipid bilayer.
[0097] In some embodiments, a polypeptide, a nucleic acid, or a small molecule drug may be, for example, encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the polypeptide/nucleic acid, entrapped in a liposome, complexed with a liposome, or the like.
[0098] A liposome used according to the present embodiments can be made by different methods, as would be known to one of ordinary skill in the art. For example, a phospholipid,
such as for example the neutral phospholipid dioleoylphosphatidylcholine (DOPC), is dissolved in tert-butanol. The lipid(s) is then mixed with a polypeptide, nucleic acid, and/or other component(s). Tween 20 is added to the lipid mixture such that Tween 20 is about 5% of the composition's weight. Excess tert-butanol is added to this mixture such that the volume of tert-butanol is at least 95%. The mixture is vortexed, frozen in a dry ice/acetone bath and lyophilized overnight. The lyophilized preparation is stored at -20° and can be used up to three months. When required the lyophilized liposomes are reconstituted in 0.9% saline.
[0099] Alternatively, a liposome can be prepared by mixing lipids in a solvent in a container, e.g., a glass, pear-shaped flask. The container should have a volume ten-times greater than the volume of the expected suspension of liposomes. Using a rotary evaporator, the solvent is removed at approximately 40°C under negative pressure. The solvent normally is removed within about 5 min to 2 h, depending on the desired volume of the liposomes. The composition can be dried further in a desiccator under vacuum. The dried lipids generally are discarded after about 1 week because of a tendency to deteriorate with time.
[00100] Dried lipids can be hydrated at approximately 25-50 mM phospholipid in sterile, pyrogen-free water by shaking until all the lipid film is resuspended. The aqueous liposomes can be then separated into aliquots, each placed in a vial, lyophilized and sealed under vacuum.
[00101] The dried lipids or lyophilized liposomes prepared as described above may be dehydrated and reconstituted in a solution of a protein or peptide and diluted to an appropriate concentration with a suitable solvent, e.g., DPBS. The mixture is then vigorously shaken in a vortex mixer. Unencapsulated additional materials, such as agents including but not limited to hormones, drugs, nucleic acid constructs and the like, are removed by centrifugation at 29,000 xg and the liposomal pellets washed. The washed liposomes are resuspended at an appropriate total phospholipid concentration, e.g., about 50-200 mM. The amount of additional material or active agent encapsulated can be determined in accordance with standard methods. After determination of the amount of additional material or active agent encapsulated in the liposome preparation, the liposomes may be diluted to appropriate concentrations and stored at 4°C until use. A pharmaceutical composition comprising the liposomes will usually include a sterile, pharmaceutically acceptable carrier or diluent, such as water or saline solution.
[00102] Additional liposomes which may be useful with the embodiments of the disclosure include cationic liposomes, for example, as described in W002/100435A1, U.S. Pat. No. 5,962,016, U.S. Application 2004/0208921, W003/015757A1, WO04029213A2, U.S. Pat. No. 5,030,453, and U.S. Pat. No. 6,680,068, all of which are hereby incorporated by reference in their entirety without disclaimer.
[00103] In preparing such liposomes, any protocol described herein, or as would be known to one of ordinary skill in the art may be used. Additional non-limiting examples of preparing liposomes are described in U.S. Pat. Nos. 4,728,578, 4,728,575, 4,737,323, 4,533,254, 4,162,282, 4,310,505, and 4,921,706; International Applications PCT/US85/01161 and PCT/US89/05040, each incorporated herein by reference.
[00104] In certain embodiments, the lipid based nanovesicle is a neutral liposome (e.g., a DOPC liposome). "Neutral liposomes" or "non-charged liposomes", as used herein, are defined as liposomes having one or more lipid components that yield an essentially-neutral, net charge (substantially non-charged). By "essentially neutral" or "essentially non-charged", it is meant that few, if any, lipid components within a given population (e.g., a population of liposomes) include a charge that is not canceled by an opposite charge of another component (i.e., fewer than 10% of components include a non-canceled charge, more preferably fewer than 5%, and most preferably fewer than 1%). In certain embodiments, neutral liposomes may include mostly lipids and/or phospholipids that are themselves neutral under physiological conditions (i.e., at about pH 7).
[00105] Liposomes and/or lipid-based nanovesicles of the present embodiments may comprise a phospholipid. In certain embodiments, a single kind of phospholipid may be used in the creation of liposomes (e.g., a neutral phospholipid, such as DOPC, may be used to generate neutral liposomes). In other embodiments, more than one kind of phospholipid may be used to create liposomes. Phospholipids may be from natural or synthetic sources. Phospholipids include, for example, phosphatidylcholines, phosphatidylglycerols, and phosphatidylethanolamines; because phosphatidylethanolamines and phosphatidylcholines are non-charged under physiological conditions (i.e., at about pH 7), these compounds may be particularly useful for generating neutral liposomes. In certain embodiments, the phospholipid DOPC is used to produce non-charged liposomes. In certain embodiments, a lipid that is not a phospholipid (e.g., a cholesterol) may be used.
[00106] Phospholipids include glycerophospholipids and certain sphingolipids. Phospholipids include, but are not limited to, dioleoylphosphatidylycholine ("DOPC"), egg phosphatidylcholine ("EPC"), dilauryloylphosphatidylcholine ("DLPC"), dimyristoylphosphatidylcholine ("DMPC"), dipalmitoylphosphatidylcholine ("DPPC"), distearoylphosphatidylcholine ("DSPC"), l-myristoyl-2-palmitoyl phosphatidylcholine ("MPPC"), l-palmitoyl-2-myristoyl phosphatidylcholine ("PMPC"), l-palmitoyl-2-stearoyl phosphatidylcholine ("PSPC"), l-stearoyl-2-palmitoyl phosphatidylcholine ("SPPC"), dilauryloylphosphatidylglycerol ("DLPG"), dimyristoylphosphatidylglycerol ("DMPG"),
dipalmitoylphosphatidylglycerol ("DPPG"), distearoylphosphatidylglycerol ("DSPG"), distearoyl sphingomyelin ("DSSP"), distearoylphophatidylethanolamine ("DSPE"), dioleoylphosphatidylglycerol ("DOPG"), dimyristoyl phosphatidic acid ("DMPA"), dipalmitoyl phosphatidic acid ("DPP A"), dimyristoyl phosphatidylethanolamine ("DMPE"), dipalmitoyl phosphatidylethanolamine ("DPPE"), dimyristoyl phosphatidylserine ("DMPS"), dipalmitoyl phosphatidylserine ("DPPS"), brain phosphatidylserine ("BPS"), brain sphingomyelin ("BSP"), dipalmitoyl sphingomyelin ("DPSP"), dimyristyl phosphatidylcholine ("DMPC"), l,2-distearoyl-sn-glycero-3-phosphocholine ("DAPC"), 1,2-diarachidoyl-sn- glycero-3-phosphocholine ("DBPC"), l,2-dieicosenoyl-sn-glycero-3-phosphocholine ("DEPC"), dioleoylphosphatidylethanolamine ("DOPE"), palmitoyloeoyl phosphatidylcholine ("POPC"), palmitoyloeoyl phosphatidylethanolamine ("POPE"), lysophosphatidylcholine, lysophosphatidylethanolamine, and dilinoleoylphosphatidylcholine.
2. Exosomes
[00107] The terms "nanovesicle" and "exosomes," as used herein, refer to a membranous particle having a diameter (or largest dimension where the particles is not spheroid) of between about 10 nm to about 1000 nm, more typically between 30 nm and 1000 nm, and most typically between about 50 nm and 750 nm, wherein at least part of the membrane of the exosomes is directly obtained from a cell. Most commonly, exosomes will have a size (average diameter) that is up to 5% of the size of the donor cell. Therefore, especially contemplated exosomes include those that are shed from a cell.
[00108] Exosomes may be detected in or isolated from any suitable sample type, such as, for example, body fluids. As used herein, the term "isolated" refers to separation out of its natural environment and is meant to include at least partial purification and may include substantial purification. As used herein, the term "sample" refers to any sample suitable for the methods provided by the present invention. The sample may be any sample that includes exosomes suitable for detection or isolation. Sources of samples include blood, bone marrow, pleural fluid, peritoneal fluid, cerebrospinal fluid, urine, saliva, amniotic fluid, malignant ascites, broncho-alveolar lavage fluid, synovial fluid, breast milk, sweat, tears, joint fluid, and bronchial washes. In one aspect, the sample is a blood sample, including, for example, whole blood or any fraction or component thereof. A blood sample suitable for use with the present invention may be extracted from any source known that includes blood cells or components thereof, such as venous, arterial, peripheral, tissue, cord, and the like. For example, a sample may be obtained and processed using well-known and routine clinical methods (e.g.,
procedures for drawing and processing whole blood). In one aspect, an exemplary sample may be peripheral blood drawn from a subject with a disease.
[00109] Exosomes may be isolated from freshly collected samples or from samples that have been stored frozen or refrigerated. In some embodiments, exosomes may be isolated from cell culture medium. Although not necessary, higher purity exosomes may be obtained if fluid samples are clarified before precipitation with a volume-excluding polymer, to remove any debris from the sample. Methods of clarification include centrifugation, ultracentrifugation, filtration, or ultrafiltration. Most typically, exosomes can be isolated by numerous methods well-known in the art. One preferred method is differential centrifugation from body fluids or cell culture supernatants. Exemplary methods for isolation of exosomes are described in (Losche et al., 2004; Mesri and Altieri, 1998; Morel et al., 2004). Alternatively, exosomes may also be isolated via flow cytometry as described in (Combes et al., 1997).
[00110] One accepted protocol for isolation of exosomes includes ultracentrifugation, often in combination with sucrose density gradients or sucrose cushions to float the relatively low- density exosomes. Isolation of exosomes by sequential differential centrifugations is complicated by the possibility of overlapping size distributions with other microvesicles or macromolecular complexes. Furthermore, centrifugation may provide insufficient means to separate vesicles based on their sizes. However, sequential centrifugations, when combined with sucrose gradient ultracentrifugation, can provide high enrichment of exosomes.
[00111] Isolation of exosomes based on size, using alternatives to the ultracentrifugation routes, is another option. Successful purification of exosomes using ultrafiltration procedures that are less time consuming than ultracentrifugation, and do not require use of special equipment have been reported. Similarly, a commercial kit is available (EXOMIR™ Bioo Scientific) which allows removal of cells, platelets, and cellular debris on one microfilter and capturing of vesicles bigger than 30 nm on a second microfilter using positive pressure to drive the fluid. However, for this process, the exosomes are not recovered, their RNA content is directly extracted from the material caught on the second microfilter, which can then be used for PCR analysis. HPLC-based protocols could potentially allow one to obtain highly pure exosomes, though these processes require dedicated equipment and are difficult to scale up. A significant problem is that both blood and cell culture media contain large numbers of nanoparticles (some non-vesicular) in the same size range as exosomes. For example, some miRNAs may be contained within extracellular protein complexes rather than exosomes; however, treatment with protease (e.g., proteinase K) can be performed to eliminate any possible contamination with "extraexosomal" protein.
a. Exemplary Protocol for Collecting Exosomes from Cell Culture
[00112] On Day 1, seed enough cells (e.g., about five million cells) in T225 flasks in media containing 10% FBS so that the next day the cells will be about 70% confluent. On Day 2, aspirate the media on the cells, wash the cells twice with PBS, and then add 25-30 mL base media (i.e., no PenStrep or FBS) to the cells. Incubate the cells for 24-48 hours. A 48 hour incubation is preferred, but some cells lines are more sensitive to serum-free media and so the incubation time should be reduced to 24 hours. Note that FBS contains exosomes that will heavily skew NanoSight results.
[00113] On Day 3/4, collect the media and centrifuge at room temperature for five minutes at 800xg to pellet dead cells and large debris. Transfer the supernatant to new conical tubes and centrifuge the media again for 10 minutes at 2,000xg to remove other large debris and large vesicles. Pass the media through a 0.2 pm filter and then aliquot into ultracentrifuge tubes (e.g., 25x89 mm Beckman Ultra-Clear) using 35 mL per tube. If the volume of media per tube is less than 35 mL, fill the remainder of the tube with PBS to reach 35 mL. Ultracentrifuge the media for 2-4 hours at 28,000 rpm at 4°C using a SW 32 Ti rotor (k-factor 266.7, RCF max 133,907). Carefully aspirate the supernatant until there is roughly 1-inch of liquid remaining. Tilt the tube and allow remaining media to slowly enter aspirator pipette. If desired, the exosomes pellet can be resuspended in PBS and the ultracentrifugation at 28,000 rpm repeated for 1-2 hours to further purify the population of exosomes.
[00114] Finally, resuspend the exosomes pellet in 210 pL PBS. If there are multiple ultracentrifuge tubes for each sample, use the same 210 pL PBS to serially resuspend each exosomes pellet. For each sample, take 10 pL and add to 990 pL FLO to use for nanoparticle tracking analysis. Use the remaining 200 pL exosomes-containing suspension for downstream processes or immediately store at -80°C.
b. Exemplary Protocol for Extracting Exosomes from Serum
Samples
[00115] First, allow serum samples to thaw on ice. Then, dilute 250 pL of cell-free serum samples in 11 mL PBS; filter through a 0.2 pm pore filter. Ultracentrifuge the diluted sample at 150,000xg overnight at 4° C. The following day, carefully discard the supernatant and wash the exosomes pellet in 11 mL PBS. Perform a second round of ultracentrifugation at 150,000xg at 4° C for 2 hours. Finally, carefully discard the supernatant and resuspend the exosomes pellet in 100 pL PBS for analysis.
c. Exemplary Protocol for Electroporation of Exosomes and Liposomes
[00116] Mix 1 x 108 exosomes (measured by NanoSight analysis) or 100 nm liposomes (e.g., purchased from Encapsula Nano Sciences) and 1 pg of siRNA (Qiagen) or shRNA in 400 pL of electroporation buffer (1.15 mM potassium phosphate, pH 7.2, 25 mM potassium chloride, 21% Optiprep). Electroporate the exosomes or liposomes using a 4 mm cuvette (see, e.g., Alvarez-Erviti et al., 2011; El-Andaloussi et al., 2012). After electroporation, treat the exosomes or liposomes with protease-free RNase followed by addition of 10 concentrated RNase inhibitor. Finally, wash the exosomes or liposomes with PBS under ultracentrifugation methods, as described above.
d. Administration of therapeutic exosomes
[00117] Certain aspects of the disclosure provide for treating a patient with exosomes that express or comprise a therapeutic agent, such as a TERT polypeptide or nucleic acid. As exosomes are known to comprise the machinery necessary to complete mRNA transcription and protein translation (see PCT/US2014/068630, which is incorporated herein by reference in its entirety), mRNA or DNA nucleic acids encoding a therapeutic protein may be transfected into exosomes. Alternatively, the therapeutic protein itself may be electroporated into the exosomes or incorporated directly into a liposome. In some embodiments, the exosome further comprises an additional therapeutic agent, such as a therapeutic agent described herein.
Provided herein are methods and drugs that use engineered liposomes and exosomes as delivery systems for treatment of disease.
3. CD47-expressing nanovesicles
[00118] In some embodiments, pharmaceutical compositions are provided that comprise a lipid-based nanovesicle comprising CD47 on its surface and wherein the lipid-based nanovesicle comprises a TERT polypeptide or a nucleic acid encoding for a TERT polypeptide.
[00119] In some aspects, the lipid-based nanoparticle is a liposome or an exosome. In certain aspects, the exosomes are isolated from cells over-expressing CD47. In some aspects, the exosomes are isolated from a patient in need of treatment. In some aspects, the exosomes are isolated from fibroblasts. In some aspects, the liposome is a single lamellar liposome. In some aspects, the liposome is a multilamellar liposome.
[00120] In some aspects, the composition is formulated for parenteral administration, such as, for example, intravenous, intramuscular, sub-cutaneous, or intraperitoneal injection.
[00121] In some aspects, the composition comprises an antimicrobial agent. The antimicrobial agent may be benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, centrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, exetidine, imidurea, phenol, phenoxyethanol, phenylethl alcohol, phenlymercuric nitrate, propylene glycol, or thimerosal.
[00122] In some aspects, a single lipid-based nanovesicle comprises more than one agent, such as a TERT polypeptide or nucleic acid and one or more additional therapeutic agents described herein.
[00123] In one embodiment, methods are provided for administering a TERT activating therapy to a patient, wherein the TERT activating therapy therapeutic comprises exosomes. In some aspects, the disclosure relates to transfecting exosomes with a nucleic acid (e.g., a DNA or an RNA) encoding a TERT polypeptide, incubating the transfected exosomes under conditions to allow for expression of TERT within the exosomes, and providing the incubated exosomes to the patient, thereby administering TERT activating therapy to the patient.
III. Administration of Therapeutic Compositions
[00124] The therapy provided herein may comprise administration of a combination of therapeutic agents, such as a first TERT activating therapy and a second therapy. The therapies may be administered in any suitable manner known in the art. For example, the first and second treatment may be administered sequentially (at different times) or concurrently (at the same time). In some embodiments, the first and second therapies are administered in a separate composition. In some embodiments, the first and second therapies are in the same composition. In some embodiments, methods and compositions of the disclosure comprise administration of an additional therapy. In some embodiments, the additional therapy comprises a cholinesterase inhibitor such as donepezil, galantamine, or rivastigmine. In some embodiments, the additional therapy comprises memantine.
[00125] Embodiments of the disclosure relate to compositions and methods comprising therapeutic compositions. The different therapies may be administered in one composition or in more than one composition, such as 2 compositions, 3 compositions, or 4 compositions. Various combinations of the agents may be employed, for example, a first treatment is“A” and a second treatment is“B”:
A/B/A B/A/B B/B/A A/A/B A/B/B B/A/A A/B/B/B B/A/B/B
B/B/B/A B/B/A/B A/A/B/B A/B/A/B A/B/B/A B/B/A/A
B/A/B/A B/A/A/B A/A/A/B B/A/A/A A/B/A/A A/A/B/A
[00126] The therapeutic agents of the disclosure may be administered by the same route of administration or by different routes of administration. In some embodiments, the therapy is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally. In some embodiments, the antibiotic is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally. The appropriate dosage may be determined based on the type of disease to be treated, severity and course of the disease, the clinical condition of the individual, the individual's clinical history and response to the treatment, and the discretion of the attending physician.
[00127] The treatments may include various“unit doses.” Unit dose is defined as containing a predetermined-quantity of the therapeutic composition. The quantity to be administered, and the particular route and formulation, is within the skill of determination of those in the clinical arts. A unit dose need not be administered as a single injection but may comprise continuous infusion over a set period of time. In some embodiments, a unit dose comprises a single administrable dose.
[00128] The quantity to be administered, both according to number of treatments and unit dose, depends on the treatment effect desired. An effective dose is understood to refer to an amount necessary to achieve a particular effect. In the practice in certain embodiments, it is contemplated that doses in the range from 10 mg/kg to 200 mg/kg can affect the protective capability of these agents. Thus, it is contemplated that doses include doses of about 0.1, 0.5, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, and 200, 300, 400,
500, 1000 pg/kg, mg/kg, gg/day, or mg/day or any range derivable therein. Furthermore, such doses can be administered at multiple times during a day, and/or on multiple days, weeks, or months.
[00129] In certain embodiments, the effective dose of the pharmaceutical composition is one which can provide a blood level of about 1 mM to 150 mM In another embodiment, the effective dose provides a blood level of about 4 mM to 100 mM ; or about 1 mM to 100 mM; or about 1 mM to 50 mM; or about 1 mM to 40 mM; or about 1 mM to 30 mM; or about 1 mM to 20 mM; or about 1 mM to 10 mM; or about 10 mM to 150 mM; or about 10 mM to 100 mM; or about 10 mM to 50 mM; or about 25 mM to 150 mM; or about 25 mM to 100 mM; or about 25 mM to 50 mM; or about 50 mM ΐo 150 mM; or about 50 mM ΐo 100 mM (or any range derivable therein).
In other embodiments, the dose can provide the following blood level of the agent that results from a therapeutic agent being administered to a subject: about, at least about, or at most about
1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28,
29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53,
54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78,
79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 mM or any range derivable therein. In certain embodiments, the therapeutic agent that is administered to a subject is metabolized in the body to a metabolized therapeutic agent, in which case the blood levels may refer to the amount of that agent. Alternatively, to the extent the therapeutic agent is not metabolized by a subject, the blood levels discussed herein may refer to the unmetabolized therapeutic agent.
[00130] Precise amounts of the therapeutic composition also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting dose include physical and clinical state of the patient, the route of administration, the intended goal of treatment (alleviation of symptoms versus cure) and the potency, stability and toxicity of the particular therapeutic substance or other therapies a subject may be undergoing.
[00131] It will be understood by those skilled in the art and made aware that dosage units of pg/kg or mg/kg of body weight can be converted and expressed in comparable concentration units of pg/ml or mM (blood levels), such as 4 mM to 100 pM. It is also understood that uptake is species and organ/tissue dependent. The applicable conversion factors and physiological assumptions to be made concerning uptake and concentration measurement are well-known and would permit those of skill in the art to convert one concentration measurement to another and make reasonable comparisons and conclusions regarding the doses, efficacies and results described herein.
IV. Treatment of Disease
[00132] The methods of the disclosure may be used to treat or prevent certain age-related diseases, conditions, or disorders. Non-limiting examples of age-related diseases, conditions, or disorders include insulin resistance (i.e., impaired glucose tolerance), benign prostatic hyperplasia, hearing loss, osteoporosis, age-related macular degeneration, neurodegenerative diseases, a skin disease, aging skin, or cancer. Non-limiting examples of neurodegenerative diseases include Alzheimer disease; epilepsy; Huntington's Disease; Parkinson's Disease; stroke; spinal cord injury; traumatic brain injury; Lewy body dementia; Pick's disease; Niewmann-Pick disease; amyloid angiopathy; cerebral amyloid angiopathy; systemic
amyloidosis; hereditary cerebral hemorrhage with amyloidosis of the Dutch type; inclusion body myositis; mild cognitive impairment; Down's syndrome; and neuromuscular disorders including amyotrophic lateral sclerosis (ALS), multiple sclerosis, and muscular dystrophies including Duchenne dystrophy, Becker muscular dystrophy, Facioscapulohumeral (Landouzy- Dejerine) muscular dystrophy, and limb-girdle muscular dystrophy (LGMD). Also included is neurodegenerative disease due to stroke, head trauma, spinal injury, or other injuries to the brain, peripheral nervous, central nervous, or neuromuscular system.
[00133] Certain embodiments of the methods set forth herein pertain to methods of preventing a disease or health-related condition in a subject. Preventive strategies are of key importance in medicine today.
[00134] In some embodiments, the treatment is for the premature aging or a disease associated with premature aging. Examples of premature aging disorders include Hutchinson- Gilford progeria syndrome (HGPS), Nestor-Guillermo progeria syndrome, Werner syndrome, Cockayne syndrome, Bloom syndrome, xeroderma pigmentosum, ataxia telangiectasia, trichothiodystrophy, dyskeratosis congenital, and mosaic variegated aneuploidy syndrome. In some embodiments, one or more of premature aging disease, disease associated with premature aging, age-related disease, neurodegenerative disease, or disorders described herein is excluded from the methods of the disclosure.
V. Kits
[00135] Certain aspects concern kits containing compositions described herein or compositions to implement methods described herein.
[00136] In various aspects, a kit is envisioned containing therapeutic agents and/or other therapeutic and delivery agents. In some embodiments, a kit for preparing and/or administering a therapy described herein may be provided. The kit may comprise one or more sealed vials containing any of the pharmaceutical compositions, therapeutic agents and/or other therapeutic and delivery agents. In some embodiments, the lipid is in one vial, and the therapeutic agent is in a separate vial. The kit may include, for example, at least one TERT activating therapy, one or more lipid component, as well as reagents to prepare, formulate, and/or administer the components described herein or perform one or more steps of the methods. In some embodiments, the kit may also comprise a suitable container means, which is a container that will not react with components of the kit, such as an eppendorf tube, an assay plate, a syringe, a bottle, or a tube. The container may be made from sterilizable materials such as plastic or glass.
[00137] The kit may further include an instruction sheet that outlines the procedural steps of the methods set forth herein, and will follow substantially the same procedures as described herein or are known to those of ordinary skill. The instruction information may be in a computer readable media containing machine-readable instructions that, when executed using a computer, cause the display of a real or virtual procedure of delivering a pharmaceutically effective amount of a therapeutic agent.
[00138] In some embodiments, kits may be provided to evaluate the expression of TERT or related molecules. Such kits can be prepared from readily available materials and reagents. For example, such kits can comprise any one or more of the following materials: enzymes, reaction tubes, buffers, detergent, primers and probes, nucleic acid amplification, and/or hybridization agents. In a particular embodiment, these kits allow a practitioner to obtain samples in blood, tears, semen, saliva, urine, tissue, serum, stool, colon, rectum, sputum, cerebrospinal fluid and supernatant from cell lysate. In another embodiment, these kits include the needed apparatus for performing RNA extraction, RT-PCR, and gel electrophoresis. Instructions for performing the assays can also be included in the kits.
[00139] Kits may comprise components, which may be individually packaged or placed in a container, such as a tube, bottle, vial, syringe, or other suitable container means. The components may include probes, primers, antibodies, arrays, negative and/or positive controls. Individual components may also be provided in a kit in concentrated amounts; in some embodiments, a component is provided individually in the same concentration as it would be in a solution with other components. Concentrations of components may be provided as lx, 2x, 5x, lOx, or 20x or more.
[00140] The kit can further comprise reagents for labeling TERT in the sample. The kit may also include labeling reagents, including at least one of amine-modified nucleotide, poly(A) polymerase, and poly(A) polymerase buffer. Labeling reagents can include an amine-reactive dye or any dye known in the art.
[00141] The components of the kits may be packaged either in aqueous media or in lyophilized form. The container means of the kits will generally include at least one vial, test tube, flask, bottle, syringe or other container means, into which a component may be placed, and preferably, suitably aliquotted. Where there is more than one component in the kit (labeling reagent and label may be packaged together), the kit also will generally contain a second, third or other additional container into which the additional components may be separately placed. However, various combinations of components may be comprised in a vial. The kits may also include a means for containing the nucleic acids, antibodies or any other
reagent containers in close confinement for commercial sale. Such containers may include injection or blow molded plastic containers into which the desired vials are retained.
[00142] When the components of the kit are provided in one and/or more liquid solutions, the liquid solution is an aqueous solution, with a sterile aqueous solution being particularly preferred.
[00143] Alternatively, the components of the kit may be provided as dried powder(s). When reagents and/or components are provided as a dry powder, the powder can be reconstituted by the addition of a suitable solvent. It is envisioned that the solvent may also be provided in another container means. In some embodiments, labeling dyes are provided as a dried power. It is contemplated that 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 120, 130, 140, 150, 160, 170, 180, 190, 200, 300, 400, 500, 600, 700, 800, 900, 1000 pg or at least or at most those amounts of dried dye are provided in kits in certain aspects. The dye may then be resuspended in any suitable solvent, such as DMSO.
[00144] The container means will generally include at least one vial, test tube, flask, bottle, syringe and/or other container means, into which the nucleic acid formulations are placed, preferably, suitably allocated. The kits may also comprise a second container means for containing a sterile, pharmaceutically acceptable buffer and/or other diluent.
[00145] The kits may include a means for containing the vials in close confinement for commercial sale, such as, e.g., injection and/or blow-molded plastic containers into which the desired vials are retained.
[00146] A kit may also include instructions for employing the kit components as well the use of any other reagent not included in the kit. Instructions may include variations that can be implemented.
VI. Examples
[00147] The following examples are included to demonstrate preferred embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.
Example 1 - Identification of telomerase activation as a therapeutic strategy for alleviating Alzheimer’s pathology using novel inducible TERT-AD mouse model.
[00148] The inventors observed that Tert gene expression was significantly downregulated in brain tissues of two distinct and well-established mouse models of AD, 3xTg-AD developing both amyloid and tau pathologies (Oddo et al, Neuron, 2003), 5xFAD only developing amyloid pathology (Oakley et al, J Neurosci, 2006) in 3-month-old mice, which exhibit elevated levels of Ab yet minimal signs of neurodegeneration (Fig. 1A,B). Focusing in particular on the neuronal population, the inventors isolated and cultured primary cortical and hippocampal neurons from E18.5 - E19.5 AD mouse brains, and Tert mRNA levels were examined at 14 Days in vitro (DIV), by which time the synaptic network is mature. Consistent with previous results from in vivo mouse brain tissues, Tert expression was downregulated in both 3xTg-AD and 5xFAD primary neurons relative to wildtype controls (Fig. 1C,D). Correspondingly, telomerase activity was also lower in freshly isolated hippocampal neurons from 5xFAD brain relative to wildtype controls (Fig. IE). More interestingly, the inventors observed the high occupancy of repressive epigenetic mark, H3K9me3, which has been known to be mainly accumulated at gene bodies and critical for gene repression in neuronal genes, in the Tert gene body and promoter region in 5xFAD mouse neurons (Fig. IF). Histone methylation is reversible and histone demethylases mediate the removal of methyl groups from lysine residues on histones (Greer and Shi, Nat Rev Genet , 2012). Interestingly, the inventors examined the levels of histone methyltransferases and demethylases and revealed that H3K9 demethylases Kdmla , Kdm4b and Kdm4c were significantly downregulated in the cortical and hippocampal neurons of the mouse AD brains relative to wildtype controls (Fig. 1G,H)· To investigate whether reversible H3K9 methylation is involved in the repression of Tert , the inventors assessed the impact of histone methyltransferase inhibitors chaetocin and BIX- 01294, the non-selective cofactor-competitive inhibitor and the selective substrate-competitive inhibitor, respectively, in the AD mouse model (Greiner et al, Nat Chem Biol , 2005; Kubicek et al, Mol Cell , 2007; Yuan et al, ACS Chem Biol , 2012). The peripheral administration of these compounds has been documented to reduce H3K9 methylation marks in the central nervous system (Dixit et al, Cell Death Dis, 2014; Chase et al, PLoS One, 2019). Both small- molecule histone methyltransferase inhibitors resulted in de-repression of Tert gene expression in the cortex and hippocampus of AD mice (Fig. II). Together with previous work showing that this epigenetic mark accumulates at gene bodies and is critical for transcriptional repression of neuronal genes (Liu et al, J Neurosci, 2015), the inventors confirmed the
possibility that soluble Ab may negatively regulate Tert gene expression via altered expression of H3K9 demethylases or methyltransferases in AD mouse neurons.
[00149] Given the repression of Tert gene expression early in the accumulation of amyloid in the AD mouse models, the inventors tested whether increased Tert gene expression in AD neurons could ameliorate or prevent amyloid pathophysiology. To that end, the inventors generated Cre-inducible Tert knock-in allele that consists of the ubiquitously expressed CAG promoter, followed by the ZorP-flanked stop cassette and mouse Tert open reading frame ( R26- CAG-LSL-mTerf). The linearized construct was targeted into the Rosa 26 locus of C57BL/6- derived JM8F6 embryonic stem (ES) cells by electroporation (Fig. 2A). The inventors identified positive clones by Long Range PCR (New England Biolabs) using the following primers: left arm 5'-GGT CGT GTG GTT CGG TGT CTC TTT-3' and 5'-ATG GGC TAT GAA CTA ATG ACC CCG-3' right arm 5'- CAC TAC CAG CAG AAC ACC CCC ATC-3' and 5'-GTG CCA CTA GTA CCA AC A GCC TCT-3' (Fig. 2B). The inventors confirmed the correct recombination by sequencing and karyotyping. Eventually, the inventors identified two independent clones and injected into C57BL/6 albino blastocysts to generate chimeric mice, and the chimeric mice from each clone was able to produce germline transmission (Fig. 2C).
[00150] In order to further investigate the role of telomerase activation in AD mouse model, the inventors first crossed this new Cre-inducible Tert knock-in allele with 3xTg-AD or 5xFAD. Subsequently, to selectively drive Tert expression in neuronal populations of the AD mouse models, the inventors incorporated a neuron-specific Cre allele which is under the control of the calcium/calmodulin-dependent protein kinase type II alpha promoter (Camk2a- CreERT2 ) (Madisen et al, Nat Neurosci, 2010). The inventors successfully established both R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 and R26-CAG-LSL-mTert; 5xFAD; Camk2a-CreERT2 strains which result in deletion of the floxed stopper sequences following tamoxifen administration, leading to turning on of mTert gene expression in the neurons of each AD mouse strain (Fig. 3A). These models enabled spatial (neuron-specific) and temporal (tamoxifen-inducible) control of Tert gene expression in two independent and widely studied AD (3xTg-AD and 5xFAD) mouse models.
[00151] To examine the potential impact of telomerase activation on AD pathology in vivo , the inventors treated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 with tamoxifen at 2 ~ 3 months of age, at which time intracellular and cytotoxic Ab oligomers begin to accumulate in the brain, and evaluated the effect of enhanced Tert expression on amyloid pathology. The inventors revealed a striking decline in Ab deposition in the hippocampus of Zb/V-activated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 mouse model (Fig. 3B,C). Similar
amyloid load reduction was observed in the R26-CAG-LSL-mTert; 5xFAD; Camk2a-CreERT2 model (Fig. 3D).
[00152] The inventors next investigated the molecular mechanism driving a reduction in amyloid plaque burden. To achieve a comprehensive understanding of Tert’s role in neuronal populations, the inventors performed genome-wide RNA sequencing (RNA-Seq) analysis. The inventors examined R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 mice with tamoxifen to induce Tert expression in AD neurons in vivo , and cortical and hippocampal neurons were separately isolated from adult mouse brain after tamoxifen treatment to probe early transcriptional responses of telomerase activation. This profile confirmed increased Tert gene expression in isolated neurons of our model upon tamoxifen treatment, and no changes in expression of Terc gene which encodes the telomerase RNA component (Fig. 4A). Computational analysis revealed that Tert induction in cortical and hippocampal AD neurons correlated with activation of multiple signaling pathways associated with synaptic signaling, regulation of synapse structure or activity, regulation of synapse assembly, positive regulation of synapse assembly, and regulation of synapse organization (Fig. 4B,C). Gene set enrichment analysis (GSEA) also showed that genes involved in synaptic signaling were globally upregulated in both neuronal populations after Tert induction (Fig. 4D). The inventors also examined the expression of genes integral to AD biology. Strikingly, the inventors found that the expression of App (amyloid-b precursor protein) and ApoE (apolipoprotein E, a strong genetic risk factor for AD) genes were significantly reduced in Tert- activated AD neurons (Fig. 4E). Simultaneously, the gene expression of Hsp70 , a molecular chaperone which can reduce the Ab-induced cellular toxicity and has been shown to effectively protect neurons in various AD animal models, was notably induced under Tert induction (Fig. 4F). By utilizing these unbiased transcriptomic analyses, the inventors identified that Tert induction in neurons can impact the expression of a large group of genes in postmitotic neurons in vivo that are strongly linked to AD pathobiology and central to synapse formation and neuronal activity.
[00153] Synapse loss and dysfunction are major correlates of cognitive decline in AD (Pal op and Mucke, Nat Neurosci, 2010; Hong et al, Science, 2016; Selkoe and Hardy, EMBO Mol Med, 2016). To test whether induction of neuronal Tert could lead to protection against synaptic and network dysfunction in the AD brain, the inventors examined neuronal morphology in vivo using Golgi-Cox staining. The inventors observed that Tert induction was associated with increased neuronal complexity and density of dendritic spines in the aged cerebral cortex of /b/V-activated R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 mice relative to controls (Fig. 5A,B?C). The inventors conclude that elevated Tert expression in
neurons activates synaptic signaling cascades and reduces spine shrinkage and synaptic loss in neurons of the mouse AD brain.
[00154] Together with these murine observations, the inventors also sought to assess the biological impact of TERT induction in the context of human AD. The inventors employed well-established induced pluripotent stem cells (iPSCs) which were derived from familial AD patient harboring genomic duplication of APR gene (APPdp) (Israel et al, Nature, 2012). Consistent with inventors’ findings from the murine models, the inventors found that human AD neurons derived from APPDP patient also had high occupancy of the repressive epigenetic mark H3K9me3 in TERT gene body relative to non-demented control (Fig. 6A). To further probe the requirement of H3K9 methylation for human TERT expression, the inventors next investigated the effect of inhibition of H3K9 methyltransferases in human AD neurons. Consistent with the murine in vivo findings (Fig. II), inhibiting H3K9 methylation also restored both TERT mRNA and protein expression in human AD neurons (Fig. 6B,C,D).
[00155] To examine whether TERT activation can also impact Ab pathology in human contexts, the inventors generated lentiviral human TERT construct under EFla promoter, and measured the impact of TERT induction on Ab accumulation in differentiated human AD neurons infected with lentiviral vectors expressing TERT or EGFP (Fig. 7A). Similar to the murine studies, the inventors found that TERT induction resulted a significant dose- and time- dependent reduction in intracellular Ab accumulation in human AD neurons as measured by sandwich ELISA (enzyme-linked immunosorbent assay) (Fig. 7B,C). To further understand the underlying mechanisms of TERT -mediated attenuation of amyloid load in neurons, the inventors sought to identify possible molecular targets. In addition to lessening Ab accumulation, TERT induction not only decreased APP protein levels, but also triggered activation of the anti-aging gene ( SIRT1 ), molecular chaperone and stress sensor genes ( HSP70 and HSF1 ), synaptic plasticity-related genes ( BDNF and PSD-95 ), and antioxidant genes ( NRF2 and HOT) (Fig. 7D,E), which are known to be crucial in reducing Ab processing and cytotoxicity as well as improving synaptic plasticity and memory formation in the adult brain (Evans et al, J Biol (Them, 2006; Qin et al, J Biol (Them, 2006; Herskovits and Guarente, Neuron , 2014; Lackie etal, Front Neurosci-Switz, 2017). The inventors’ findings suggest that TERT activation can not only diminish Ab production, but exert neuroprotective actions in AD neurons through the production of neuroprotective mediators.
[00156] To further ascertain whether catalytic activity is required for TERT-dependent gene regulation at the transcription level, the inventors generated catalytically inactive (Cl) TERT expression construct by substituting the aspartic acid at position 712 residue (Weinrich et al,
Nat Genet , 1997) with the alanine using site-directed mutagenesis (Fig. 8A,B). The inventors unveiled that the catalytically inactive TERT mutant also led to the upregulation of these genes (Fig. 8C), indicating that TERT’s transactivation function is independent of its catalytic activity.
[00157] To gain insight into the functional significance of neuronal TERT activation in AD, the inventors intersected RNA-seq transcriptional profiles and pathway analysis of mouse AD cortical neurons, mouse AD hippocampal neurons, and human AD neurons. Using this integrative cross-species analysis of the neuronal TERT activation network, the inventors identified overlap of multiple neuron-specific pathways (Fig. 9A) with learning process as the most significantly enriched pathway (all p < 0.001) followed by membrane depolarization, glutamate receptor signaling, action potential, and synaptic signaling as the downstream consequences of TERT activation (Fig. 9B). The inventors also found that all the enrichment profiles from three groups displayed a high level of concordant regulation of genes sets involved in learning processes in mouse and human AD neurons (Fig. 9C), suggesting that TERT regulates critical disease-associated pathways in the AD brain.
[00158] As TERT induces dendritic spine formation on the cellular and tissue levels as well as activates learning process genes on the molecular level, the inventors next investigated whether TERT activation could ameliorate the learning deficits of AD models in vivo. To that end, spatial learning and memory were assessed in the R26-CAG-LSL-mTert; 3xTg-AD; Camk2a-CreERT2 model versus AD controls. While AD controls showed impaired acquisition of spatial learning at old age on the Barnes maze, age- and gender-matched Tert- activated AD mice achieved significant improvement in learning ability and memory retention, as indicated by a reduction in latencies to enter the escape hole (Fig. 9D). Aligning with above cellular and molecular data, the inventors’ findings indicate that Tert activation attenuates age-associated learning impairment of AD mice.
[00159] The inventors further investigated the mechanistic details underlying TERT’s role in terminally differentiated postmitotic neurons. To identify the mechanistic basis of TERT activation and gene regulation, the inventors conducted proteome-wide analysis of potential interaction partners of TERT in neurons. Characterization of TERT-containing protein complexes by mass spectrometry identified transcriptional regulators CREB-binding protein (CREBBP) and RELA, RNA polymerase II largest and catalytic subunit POLR2A, and multiple Mediator complex subunits (MEDl, 4, 12, 15, 16, 23, 24) which link transcriptional regulators to RNA polymerase II in human neurons (Fig. 10A). The inventors also revealed that various WNTs and WNT pathway components were elevated in TERT-activated AD
neurons by RNA-Seq analysis (Fig. 10B) which gains added significance in light of the known neuroprotective action of WNT signaling in neurodegenerative disease. Based on these observations, the inventors assessed whether endogenous TERT in postmitotic neurons physically interacts with transcriptional regulatory complexes containing b-Catenin, a pivotal player in the transduction of WNT signaling. Co-immunoprecipitation assay indeed confirmed that neuronal TERT protein physically interacts with the activated nuclear form of b-Catenin as well as CREBBP and POLR2A at endogenous levels in fully differentiated human neurons (Fig. IOC)
[00160] The inventors further assessed a possible global enrichment of the association of TERT and b-Ohΐehίh/TOE7 on the genomic level. The inventors determined the genome-wide distribution of TERT and b-Ohΐehίh/TOE7 in human neurons by ChIP-Seq using specific antibodies, and discovered that both TERT and b-Catenin as well as TCF7, which is transcription complex partner, predominantly occupied the transcription start sites (TSS) of gene promoters in human neurons (Fig. 11A). The inventors also defined that TERT -binding sites were occupied by both b-Catenin and TCF7 at the promoter regions of highly relevant genes including a WNT family member WNT9B , a Na+/K+-ATPase catalytic subunit ATP IAS (one of 5 overlapping genes upregulated in both TERT- activated human and mouse neurons in our study), HSP70 family members HSPA12A and HSPA6 , and a positive feed-forward regulator of TERT, MYC (Fig. 11B). The inventors’ findings of the physical association of TERT and the b-Catenin/TCF transcription complex and the TERT enhancement of b- Catenin/TCF transcriptional activity in AD neurons (Fig. 11C) point to important roles for TERT and WNT signaling in the progression of AD disease.
[00161] In this invention, the inventors identified that murine and human neurons from amyloid-based AD models exhibit epigenetic repression of neuronal TERT expression, prompting exploration of the relationship between amyloid accumulation and TERT gene expression and whether restoration of TERT expression could impact the disease trajectory. The inventors observed that TERT activation results in a marked reduction of Ab levels in hippocampal and cortical neurons in the brains of two AD mouse models and in cultured human iPSC-derived AD neurons harboring genomic APP duplication. Mechanistically, TERT induced gene expression and physically interacted with core transcriptional and b- Catenin/TCF7 complex components at the transcriptional start sites of key neuronal genes governing synaptic signaling and learning pathways and protecting neuron health in both mouse and human neurons. Neuronal TERT expression improved dendritic spine formation and cognitive function in aged AD mouse models. Together, these findings support the
development of somatic TERT activation therapy as a potential disease modification strategy for AD.
Example 2 - Exosome-mediated delivery of TERT mRNA in Alzheimer’s disease brain
[00162] Exosomes are extracellular small vesicles (40 - 100 nM) that are released from cells and found in most biological fluids, and provide a useful means of transmission of macromolecules, such as nucleic acids and proteins, into target cells. Exosome therapies have been explored in anti-cancer clinical trials and can be also used to treat neurodegenerative diseases due to their ability to cross the blood-brain barrier easily, while liposomes are preferentially degraded by enzymes, mechanical strain and/or phagocytic attacks before they are delivered to the target sites. The display of CD47 and RVG brain-targeting peptide on the surface of exosomes may not only increase the biological stability by protecting themselves from degradation, but also improve the overall delivery efficiency of bioactive exosomal nucleic acids to target cells in the brain, when compared to liposomes. Targeted exosomes exhibiting a superior ability to deliver TERT mRNA to the brains can serve as effective therapeutic strategies for AD treatment.
A. Procedures
1. Cell preparation for exosome generation
[00163] Human fibroblasts and/or bone marrow dendritic cells (BMDCs) can be used as a source of exosomes. These cells can be cultured in DMEM supplemented with 10% exosome- depleted FBS and 1% penicillin-streptomycin.
2. Generation of targeted exosomes by display of RVG brain-targeting peptide and CD47‘don’t eat me’ signal
[00164] The cells can be transfected with plasmids encoding CD47 and RVG (rabies virus glycoprotein)-derived peptide using X-tremeGENE transfection reagents (Roche) or Lipofectamine 2000 reagents (Invitrogen). CD47 ligand protein may interact with signal- regulatory protein a (SIRPa), then initiating a‘don’t eat me’ signal that may protect the exosomes from phagocytosis. RVG-derived peptide on the exosome surface target may guide exosomes to bind to neuronal cells expressing acetylcholine receptors and allow transvascular delivery of targeted exosomes to the central nervous system.
3. Isolation of targeted exosomes by microfiltration and ultracentrifugation
[00165] Targeted exosomes can be purified by differential centrifugation steps. The supernatant supplemented with exosome-depleted FBS can be collected from cells, filtered
using 0.2-mih filters, ultra-centrifuged at 120,000xg· for 70 min at 4°C. The exosome pellets can then be re-suspended in PBS and subsequently ultra-centrifuged at 120,000 for another 70 min at 4°C. The exosome pellets can be re-suspended in electroporation buffer.
4. Loading of exosomes with TERT mRNA by electroporation
[00166] Isolated exosomes can be mixed with TERT mRNA in the electroporation buffer, and electroporated at 400 mV and 125 pF capacitance. All exosomes can then be re-suspended in PBS, and ultracentrifuged at 120, 000 for another 70 min at 4°C.
5. Systemic (i.v.) administration of exosomes into Alzheimer’s disease subjects
[00167] The loaded exosomes can be re-suspended in PBS and then injected intravenously into Alzheimer’s disease subjects.
6. Characterization of exosome-mediated therapeutic effects of TERT mRNA delivery on Alzheimer pathologies
[00168] The AD subjects treated with targeted exosomes loaded with control nucleic acids or TERT mRNA can be periodically assessed for learning and memory tasks. It is contemplated that administration of the therapeutic exosomes will improve the learning and memory of the treated subjects and/or increase clearance of amyloid beta in the subjects’ brains.
* * *
[00169] All of the methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
[00170] The references disclosed herein, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference.
Claims
1. A method for generating new neurons in a subject in need thereof, comprising administering a TERT activating therapy to the subject.
2. A method for treating a neurodegenerative disorder in a subject comprising administering a TERT activating therapy to the subject.
3. The method of claim 2, wherein the neurodegenerative disorder comprises Alzheimer’ s disease.
4. A method for reducing amyloid-b peptide in a subject in need thereof, comprising administering a TERT activating therapy to the subject.
5. A method for treating a premature aging disorder in a subject in need thereof, comprising administering a TERT activating therapy to the subject.
6. The method of claim 5, wherein the premature aging disorder comprises Hutchinson- Gilford progeria syndrome (HGPS), Nestor-Guillermo progeria syndrome, Werner syndrome, Cockayne syndrome, Bloom syndrome, Xeroderma pigmentosum, Ataxia telangiectasia, Trichothiodystrophy, Dyskeratosis congenital, or Mosaic variegated aneuploidy syndrome.
7. The method of any one of claims 1-6, wherein the subject has been diagnosed with the disorder.
8. The method of any one of claims 1-7, wherein the subject has previously been treated for the disorder.
9. The method of claim 8, wherein the subject has been determined to be non-responsive to the previous therapy.
10. The method of any one of claims 1-9, wherein the subject is a human.
11. The method of claim 10, wherein the subject is less than 50 years old.
12. The method of any one of claims 1-11, wherein the method further comprises administration of an additional therapy.
13. The method of any one of claims 1-12, wherein the TERT activating therapy comprises one or more nucleic acids encoding a TERT polypeptide.
14. The method of claim 13, wherein the TERT activating therapy comprises a DNA or RNA encoding a TERT polypeptide to the subject.
15. The method of any one of claims 1-12, wherein the TERT activating therapy comprises a TERT polypeptide.
16. The method of any one of claims 1-15, wherein the TERT activating therapy comprises a nanovesicle comprising a TERT polypeptide or a nucleic acid encoding for a TERT polypeptide.
17. The method of claim 16, wherein the nanovesicle comprises CD47.
18. The method of claim 16 or 17, wherein the nanovesicle comprises a rabies virus glycoprotein peptide.
19. The method of any one of claims 16-18, wherein the nanovesicles are derived from fibroblasts or bone marrow dendritic cells.
20. The method of any one of claims 16-19, wherein the nanovesicles are derived from human cells.
21. The method of any one of claims 1-20, wherein the TERT activating therapy comprises modulation of histone H3K9 methyltransferases (HMTs).
22. The method of claim 21, wherein the modulation comprises repression of the HMT gene or protein.
23. The method of claim 22, wherein the repression comprises genetic silencing of one or more HMT genes.
24. The method of claim 23, wherein the one or more HMT genes comprise one or more of SUV 39H 1 /KMT 1 A, SUV 39H2/KMT 1 B , SETDB1/KMT1E, SETDB 2/KMT IF, PRDM2, G9 A/KMT 1C, GLP/KMT1D, EHMTl, and RIZ1/KMT8.
25. The method of claim 22, wherein the TERT activating therapy comprises a HMT inhibitor.
26. The method of claim 25, wherein the HMT inhibitor comprises one or more of Chaetocin, BIX-01294, BIX-01338, UNC0638, and BRD4770.
27. The method of any one of claims 1-20, wherein the TERT activating therapy comprises administration of a histone H3K9 demethylase (HDM) polypeptide or a nucleic acid encoding a HDM.
28. The method of claim 27, wherein the HDM polypeptide comprises a polypeptide from one or more of KDM1A/LSD1, KDM3 A/JHDM2 A, KDM3B/JHDM2B, KDM4 A/JHDM3 A, KDM4B/JMJD2B, KDM4C/JMJD2C, KDM4D/JMJD2D, KDM7/JHDM1D, and PHF8.
29. The method of any one of claims 1-28, wherein the TERT activating therapy is administered by intravenous injection.
30. The method of any one of claims 1-29, wherein treating comprises one or more of a reduction in amyloid-b peptide, an improvement in learning, an improvement in memory, and the generation of neurons.
31. The method of any one of claims 15-30, wherein the TERT polypeptide comprises a polypeptide with telomerase activity.
Priority Applications (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/608,025 US20220313782A1 (en) | 2019-05-02 | 2020-04-30 | Methods and compositions involving tert activating therapies |
KR1020217039489A KR20220022126A (en) | 2019-05-02 | 2020-04-30 | Methods and compositions comprising TERT activation therapy |
JP2021564716A JP2022531296A (en) | 2019-05-02 | 2020-04-30 | Methods and compositions with TERRT activation therapy |
EP20799278.5A EP3962514A4 (en) | 2019-05-02 | 2020-04-30 | Methods and compositions involving tert activating therapies |
CN202080048942.0A CN114364392A (en) | 2019-05-02 | 2020-04-30 | Methods and compositions relating to TERT activation therapy |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201962842323P | 2019-05-02 | 2019-05-02 | |
US62/842,323 | 2019-05-02 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2020223475A1 true WO2020223475A1 (en) | 2020-11-05 |
Family
ID=73028701
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2020/030699 WO2020223475A1 (en) | 2019-05-02 | 2020-04-30 | Methods and compositions involving tert activating therapies |
Country Status (6)
Country | Link |
---|---|
US (1) | US20220313782A1 (en) |
EP (1) | EP3962514A4 (en) |
JP (1) | JP2022531296A (en) |
KR (1) | KR20220022126A (en) |
CN (1) | CN114364392A (en) |
WO (1) | WO2020223475A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20220401583A1 (en) * | 2021-06-16 | 2022-12-22 | BioViva USA, Inc. | Treatment of age-related cognitive decline using genetically modified viral vectors |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20060052324A1 (en) * | 2004-08-05 | 2006-03-09 | Artandi Steven E | Methods and compositions for cell activation |
US20160324986A1 (en) * | 2013-12-27 | 2016-11-10 | Teloregen, Inc. | Compositions and methods for providing active telomerase to cells in vivo |
US20180318383A1 (en) * | 2015-11-03 | 2018-11-08 | Gemvax & Kael Co., Ltd. | Peptide having neuronal loss prevention and regeneration effects, and composition containing same |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2009126537A1 (en) * | 2008-04-07 | 2009-10-15 | Syndax Pharmaceuticals, Inc. | Administration of an inhibitor of hdac and an hmt inhibitor |
IL296870A (en) * | 2013-02-22 | 2022-11-01 | Univ Leland Stanford Junior | Telomerase reverse transcriptase encoding nucleic acids, compositions comprising same and uses thereof |
WO2017176087A1 (en) * | 2016-04-07 | 2017-10-12 | 주식회사 젬백스앤카엘 | Peptide having effects of increasing telomerase activity and extending telomere, and composition containing same |
ES2848720T3 (en) * | 2016-11-25 | 2021-08-11 | Genuv Inc | Composition to promote the differentiation and protection of neural stem cells and method to induce neural regeneration using the same |
-
2020
- 2020-04-30 JP JP2021564716A patent/JP2022531296A/en active Pending
- 2020-04-30 WO PCT/US2020/030699 patent/WO2020223475A1/en unknown
- 2020-04-30 CN CN202080048942.0A patent/CN114364392A/en active Pending
- 2020-04-30 KR KR1020217039489A patent/KR20220022126A/en unknown
- 2020-04-30 EP EP20799278.5A patent/EP3962514A4/en active Pending
- 2020-04-30 US US17/608,025 patent/US20220313782A1/en active Pending
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20060052324A1 (en) * | 2004-08-05 | 2006-03-09 | Artandi Steven E | Methods and compositions for cell activation |
US20160324986A1 (en) * | 2013-12-27 | 2016-11-10 | Teloregen, Inc. | Compositions and methods for providing active telomerase to cells in vivo |
US20180318383A1 (en) * | 2015-11-03 | 2018-11-08 | Gemvax & Kael Co., Ltd. | Peptide having neuronal loss prevention and regeneration effects, and composition containing same |
Non-Patent Citations (3)
Title |
---|
PARK HYUN-HEE; LEE KYU-YONG; KIM SANGJAE; LEE JESSICA WOOJIN; CHOI NA-YOUNG; LEE EUN-HYE; LEE YOUNG JOO; LEE SANG-HUN; KOH SEONG-H: "The novel vaccine peptide GV1001 effectively blocks beta-amytoid toxicity by mimicking the extra-telomeric functions of human telomerase reverse transcriptase", NEUROBIOLOGY OF AGING, vol. 35, no. 6, 26 December 2013 (2013-12-26) - June 2014 (2014-06-01), pages 1255 - 1274, XP028631606 * |
See also references of EP3962514A4 * |
SPILSBURY A; MIWA S; ATTEMS J; SARETZKI G: "The Role of Telomerase Protein TERT in Alzheimer's Disease and in Tau-Related Pathology In Vitro", THE JOURNAL OF NEUROSCIENCE, vol. 35, no. Iss. 4, 28 January 2015 (2015-01-28), pages 1659 - 1674, XP055596586, DOI: 10.1523/JNEUROSCI.2925-14.2015 * |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20220401583A1 (en) * | 2021-06-16 | 2022-12-22 | BioViva USA, Inc. | Treatment of age-related cognitive decline using genetically modified viral vectors |
WO2022266347A1 (en) * | 2021-06-16 | 2022-12-22 | BioViva USA, Inc. | Treatment of age-related cognitive decline using genetically modified viral vectors |
Also Published As
Publication number | Publication date |
---|---|
JP2022531296A (en) | 2022-07-06 |
EP3962514A1 (en) | 2022-03-09 |
CN114364392A (en) | 2022-04-15 |
US20220313782A1 (en) | 2022-10-06 |
EP3962514A4 (en) | 2023-04-19 |
KR20220022126A (en) | 2022-02-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11596609B2 (en) | Combinations of mRNAs encoding immune modulating polypeptides and uses thereof | |
US11827886B2 (en) | Compositions and methods for modulating dysferlin expression | |
EP3240577B1 (en) | Therapeutic agent that activates mtorc1 function for use in treating huntington's disease | |
JP7332474B2 (en) | Compositions and methods related to myomixer-facilitated muscle cell fusion | |
EP3362564B1 (en) | Nucleic acid based tia-1 inhibitors | |
KR20220146501A (en) | Compositions and methods for inducible alternative splicing modulation of gene expression | |
US20220313782A1 (en) | Methods and compositions involving tert activating therapies | |
US10537591B2 (en) | Method for promoting muscle regeneration | |
EP3574091B1 (en) | Expression vector for cholesterol 24-hydrolase in therapy of polyglutamine repeat spinocerebellar ataxias | |
US20210246443A1 (en) | Antisense oligonucleotides to restore dysferlin protein expression in dysferlinopathy patient cells | |
US20070219150A1 (en) | Nerve Cell Differentiation Inducer | |
TW202124719A (en) | Vestibular supporting cell promoters and uses thereof | |
JP2023513188A (en) | MIRNA-485 inhibitors for increased gene expression | |
JP2024517377A (en) | Isolated or artificial nucleotides for use in treating neurodegenerative diseases | |
NZ733014A (en) | Methods and compositions for treating brain diseases | |
WO2008070858A1 (en) | Inhibiting translation of abrerrant dnmt3b transcripts in cancer cells using inhibitory nucleic acids |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20799278 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2021564716 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2020799278 Country of ref document: EP Effective date: 20211202 |