WO2020219682A2 - Gene knock-outs to improve t cell function - Google Patents
Gene knock-outs to improve t cell function Download PDFInfo
- Publication number
- WO2020219682A2 WO2020219682A2 PCT/US2020/029533 US2020029533W WO2020219682A2 WO 2020219682 A2 WO2020219682 A2 WO 2020219682A2 US 2020029533 W US2020029533 W US 2020029533W WO 2020219682 A2 WO2020219682 A2 WO 2020219682A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cell
- cells
- regnase
- gene
- modified
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/465—Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4271—Melanoma antigens
- A61K40/4273—Glycoprotein 100 [Gp100]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4705—Regulators; Modulating activity stimulating, promoting or activating activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4747—Apoptosis related proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1085—Transferases (2.) transferring alkyl or aryl groups other than methyl groups (2.5)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y205/00—Transferases transferring alkyl or aryl groups, other than methyl groups (2.5)
- C12Y205/01—Transferases transferring alkyl or aryl groups, other than methyl groups (2.5) transferring alkyl or aryl groups, other than methyl groups (2.5.1)
- C12Y205/01026—Alkylglycerone-phosphate synthase (2.5.1.26)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/03—Phosphoric monoester hydrolases (3.1.3)
- C12Y301/03048—Protein-tyrosine-phosphatase (3.1.3.48)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
- G01N33/5047—Cells of the immune system
- G01N33/505—Cells of the immune system involving T-cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/57—Skin; melanoma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1137—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/50—Physical structure
- C12N2310/53—Physical structure partially self-complementary or closed
- C12N2310/531—Stem-loop; Hairpin
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/13011—Gammaretrovirus, e.g. murine leukeamia virus
- C12N2740/13041—Use of virus, viral particle or viral elements as a vector
- C12N2740/13043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15041—Use of virus, viral particle or viral elements as a vector
- C12N2740/15043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/80—Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B40/00—Libraries per se, e.g. arrays, mixtures
- C40B40/02—Libraries contained in or displayed by microorganisms, e.g. bacteria or animal cells; Libraries contained in or displayed by vectors, e.g. plasmids; Libraries containing only microorganisms or vectors
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B40/00—Libraries per se, e.g. arrays, mixtures
- C40B40/04—Libraries containing only organic compounds
- C40B40/06—Libraries containing nucleotides or polynucleotides, or derivatives thereof
Definitions
- the application relates to methods of enhancing T cell function, particularly by genetic modification of the Regnase-1, Batf, and additional genes (alone or in combination).
- the application further relates to the modified T cells and related pharmaceutical compositions.
- the application further relates to the therapeutic use of the modified T cells for treating diseases.
- Adoptive cell therapy (ACT) using engineered T cells has produced unprecedented results in the clinic and represents a new paradigm in cancer immunotherapy.
- the therapeutic efficacy, especially in solid tumors is often limited by poor in vivo expansion, persistence and function of adoptively transferred T cells 1 ⁇ 2 .
- T cell fate decisions in the tumor microenvironment (TME) and the underlying processes remain elusive.
- CD8 + T cells play a pivotal role in the control of cancer.
- the efficacy of ACT including the use of T cells engineered to express chimeric antigen receptors (CARs), depends upon T cell longevity and their differentiation state 1 ⁇ 2 .
- CARs chimeric antigen receptors
- Paradoxically, fully differentiated effector CD8 + T cells have been shown to have reduced antitumor efficacy and exhibit poor in vivo persistence 2 ⁇ 3 , while the long-term persistence of 7e/2-mutated T cells, despite the impaired effector function, is associated with tumor remission in a clinical case 4 .
- Another major challenge of ACT against solid tumors is that antitumor T cell responses can be blunted in the highly immunosuppressive TME 1 ⁇ 2 ⁇ 5 , as evidenced by the poor accumulation of adoptively transferred T cells and limited therapeutic efficacy in human solid tumors and mouse ACT models.
- a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell comprising modifying a Regnase- 1 (REGNASE-1, Zc3h12a, MCPIPl ) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated.
- a Regnase- 1 REGNASE-1, Zc3h12a, MCPIPl
- the T cell is selected from a CD8 + ab T cell receptor (TCR) T cell, a CD4 + ab TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a gd T cell.
- TCR CD8 + ab T cell receptor
- CD4 + ab TCR T cell a CD4 + ab TCR T cell
- a regulatory T cell a regulatory T cell
- a natural killer T (NKT) cell a gd T cell.
- the T cell is a CD8 + ab TCR T cell.
- the T cell is a CD4 + ab TCR T cell.
- the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR).
- CAR chimeric antigen receptor
- the CAR targets a tumor antigen or an infectious antigen.
- the modifying step comprises disrupting the Regnase-1 gene with a site-specific nuclease.
- the site-specific nuclease comprises a Cas protein and a guide RNA.
- the Cas protein is a Cas9 protein.
- the guide RNA is a single guide RNA (sgRNA).
- the sgRNA targets Regnase-1.
- the sgRNA comprises TTCACACCATCACGACGCGTNGG (SEQ ID NO: 29),
- the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
- the modifying step comprises silencing a Regnase-1 mRNA with an RNA interference (RNAi) molecule or an antisense oligonucleotide.
- RNAi RNA interference
- the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
- the modifying step comprises inhibiting a Regnase-1 protein with one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
- in vivo accumulation of the T cell is improved more than 100- fold as compared an unmodified T cell at day 7 after the Regnase-1 modification.
- the method further comprises modifying one or more additional genes or gene products alone or in combination with Regnase-1 in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
- modifying of one or more additional genes comprises disrupting the gene(s) with a site-specific nuclease.
- the site-specific nuclease comprises a Cas protein and a guide RNA.
- the Cas protein is a Cas9 protein.
- the guide RNA is a single guide RNA (sgRNA).
- the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
- modifying of one or more additional gene products comprises administering an RNA interference (RNAi) molecule or an antisense oligonucleotide.
- RNAi RNA interference
- the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
- modifying of one or more additional gene products comprises administering one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
- the T cell is a CD8 + T cell.
- the T cell is derived from a blood, marrow, tissue, or tumor sample.
- the T cell is an allogeneic T cell.
- the T cell is an autologous T cell.
- the T cell has been activated and/or expanded ex vivo.
- composition comprising the modified T cell described above and a pharmaceutically acceptable carrier and/or excipient.
- the modified T cells are autologous cells.
- the modified T cells are allogeneic cells.
- the disease is a cancer or an infectious disease.
- the cancer is a solid tumor.
- the cancer is melanoma, colon cancer, breast cancer, or brain cancer.
- the cancer is a blood cancer.
- the cancer is a lymphoma, leukemia, or multiple myeloma.
- the method comprises: a) isolating a T cell from the subject or a donor; b) modifying a Regnase-1 gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated; c) optionally, activating and/or expanding the T cell before or after step b); and d) administering an effective amount of the modified T cells to the subject.
- the subject is a human.
- a method of enhancing expansion and/or persistence and/or an anti -tumor or an anti-infection function of aT cell comprising increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
- the T cell is selected from a CD8 + ab T cell receptor (TCR) T cell, a CD4 + ab TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a gd T cell.
- TCR CD8 + ab T cell receptor
- CD4 + ab TCR T cell a CD4 + ab TCR T cell
- a regulatory T cell a regulatory T cell
- a natural killer T (NKT) cell a gd T cell.
- the T cell is a CD8 + ab TCR T cell.
- the T cell is a CD4 + ab TCR T cell.
- the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR).
- CAR chimeric antigen receptor
- the CAR targets a tumor antigen or an infectious antigen.
- the method comprises introducing into the T cell a polynucleotide encoding a BATF protein, or functional fragment or derivative thereof.
- the polynucleotide encoding a BATF protein comprises the nucleotide sequence of SEQ ID NO: 27, or a nucleotide sequence having at least 80% identity therof.
- the BATF protein encoded by the polynucleotide comprises the amino acid sequence of SEQ ID NO: 25, or an amino acid sequence having at least 80% identity therof.
- the polynucleotide encoding a BATF protein, or functional fragment or derivative thereof is introduced into the T cell in a recombinant vector.
- the recombinant vector is a viral vector.
- the viral vector is a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated virus vector, an alphaviral vector, a herpes virus vector, or a vaccinia virus vector.
- the viral vector is a retroviral vector.
- the recombinant vector is a non- viral RNA and/or DNA vector.
- the method further comprises modifying one or more additional genes or gene products, alone or in combination, in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl), Ptpn2, Socsl, Agps, Pc3hl, and Rcorl.
- the additional gene(s) or gene product(s) is Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl).
- modifying of one or more additional genes comprises disrupting the gene(s) with a site-specific nuclease.
- the site-specific nuclease comprises a Cas protein and a guide RNA.
- the Cas protein is a Cas9 protein.
- the guide RNA is a single guide RNA (sgRNA).
- the sgRNA comprises TTCACACCATCACGACGCGTNGG (SEQ ID NO: 29), CAGCTCCCTCTAGTCCCGCGNGG (SEQ ID NO: 34),
- the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
- modifying of one or more additional gene products comprises administering an RNA interference (RNAi) molecule or an antisense oligonucleotide.
- RNAi RNA interference
- the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
- modifying of one or more additional gene products comprises administering one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
- a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell comprising modifying a Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
- a Regnase-1 REGNASE-1, Zc3hl2a, MCPIPl
- the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
- the site-specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, small molecule inhibitor, antibody or antibody fragment, or aptamer is introduced into the T cell via a physical means.
- the physical means is electroporation, microinjection, magnetofection, ultrasound, a ballistic or hydrodynamic method, or a combination thereof. In some embodiments, the physical means is electroporation.
- the site-specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, antibody or antibody fragment, or aptamer is introduced into the T cell in a recombinant vector.
- the recombinant vector is a viral vector.
- the viral vector is a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated virus vector, an alphaviral vector, a herpes virus vector, or a vaccinia virus vector.
- the recombinant vector is a non-viral RNA and/or DNA vector.
- the T cell is a CD8 + T cell.
- the T cell is derived from a blood, marrow, tissue, or tumor sample.
- the T cell is an allogeneic T cell.
- the T cell is an autologous T cell.
- the T cell has been activated and/or expanded ex vivo.
- composition comprising the modified T cell described above and a pharmaceutically acceptable carrier and/or excipient.
- the modified T cells are autologous cells.
- the modified T cells are allogeneic cells.
- the disease is a cancer or an infectious disease.
- the cancer is a solid tumor.
- the cancer is melanoma, colon cancer, breast cancer, or brain cancer.
- the cancer is a blood cancer.
- the cancer is a lymphoma, leukemia, or multiple myeloma.
- the method comprises a) isolating a T cell from the subject or a donor; b) increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell; c) optionally, activating and/or expanding the T cell before or after step b); and d) administering an effective amount of the modified T cells to the subject.
- the subject is a human.
- a method of improving mitochondrial biogenesis and/or function in a T cell comprising modifying a Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and/or increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
- a Regnase-1 REGNASE-1, Zc3hl2a, MCPIPl
- the method further comprises modifying one or more additional genes or gene products alone or together with Regnase-1 in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
- an isolated polynucleotide comprising the nucleotide sequence of any one of SEQ ID NOs: 1-9, 29-34 and 36-42, or a nucleotide sequence having at least 80% identity thereof.
- the isolated polynucleotide comprises the nucleotide sequence of SEQ ID NO: 1 or 2.
- the isolated polynucleotide comprises the nucleotide sequence of SEQ ID NO: 29, 34, 36 or 41.
- the polynucleotide is a guide RNA.
- the guide RNA is a single guide RNA (sgRNA).
- the cell is a T cell.
- the T cell is selected from a CD8 + ab T cell receptor (TCR) T cell, a CD4 + ab TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a gd T cell.
- TCR CD8 + ab T cell receptor
- NKT natural killer T
- the T cell is a CD8 + ab TCR T cell.
- the T cell is a CD4 + ab TCR T cell.
- the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR).
- the cell is a human cell.
- the site-specific nuclease comprises a Cas protein and one or more guide RNAs.
- the Cas protein is a Cas9 protein.
- the one or more guide RNAs are one or more single guide RNAs (sgRNAs).
- the sgRNA comprises TTCACACCATCACGACGCGTNGG (SEQ ID NO: 29), CAGCTCCCTCTAGTCCCGCGNGG (SEQ ID NO: 34),
- the Cas protein and the guide RNA are mixed to form a ribonucleoprotein (RNP) complex.
- RNP ribonucleoprotein
- the site-specific nuclease is introduced into the cell via a physical means.
- the physical means is electroporation, microinjection, magnetofection, ultrasound, a ballistic or hydrodynamic method, or a combination thereof.
- the physical means is electroporation.
- a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell comprising modifying one or more genes or gene products thereof in the T cell such that the expression and/or function of gene or gene product in the T cell is reduced or eliminated, wherein the one or more genes are selected from Ptpn2, Socsl, Agps, Rc3hl ( Roquin-1 ) and Rear I .
- the T cell is selected from a CD8 + ab T cell receptor (TCR) T cell, a CD4 + ab TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a gd T cell.
- TCR CD8 + ab T cell receptor
- CD4 + ab TCR T cell a CD4 + ab TCR T cell
- a regulatory T cell a regulatory T cell
- a natural killer T (NKT) cell a gd T cell.
- the T cell is a CD8 + ab TCR T cell.
- the T cell is a CD4 + ab TCR T cell.
- the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR).
- CAR chimeric antigen receptor
- the CAR targets a tumor antigen or an infectious antigen.
- the modifying step comprises disrupting said one or more genes with a site-specific nuclease.
- the site-specific nuclease comprises a Cas protein and a guide RNA.
- the Cas protein is a Cas9 protein.
- the guide RNA is a single guide RNA (sgRNA).
- the sgRNA targets said one or more genes.
- the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
- the modifying step comprises silencing an mRNA produced from said one or more genes with an RNA interference (RNAi) molecule or an antisense oligonucleotide.
- RNAi RNA interference
- the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
- the modifying step comprises inhibiting a protein produced from said one or more genes with one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
- the site-specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, small molecule inhibitor, antibody or antibody fragment, or aptamer is introduced into the T cell via a physical means.
- the physical means is electroporation, microinjection, magnetofection, ultrasound, a ballistic or hydrodynamic method, or a combination thereof. In some embodiments, the physical means is electroporation.
- the site-specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, antibody or antibody fragment, or aptamer is introduced into the T cell in a recombinant vector.
- the recombinant vector is a viral vector.
- the viral vector is a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated virus vector, an alphaviral vector, a herpes virus vector, or a vaccinia virus vector.
- the recombinant vector is a non-viral RNA and/or DNA vector.
- a modified T cell produced by the method described above that involves modifying one or more genes selected from one or more genes are selected from Ptpn2, Socsl, Agps, Rc3hl ( Roquin-1 ) and Rcorl, or gene products threof.
- the T cell is a CD8 + T cell.
- the T cell is derived from a blood, marrow, tissue, or tumor sample.
- the T cell is an allogeneic T cell.
- the T cell is an autologous T cell.
- the T cell has been activated and/or expanded ex vivo.
- composition comprising the modified T cell described above and a pharmaceutically acceptable carrier and/or excipient.
- the modified T cells are autologous cells.
- the modified T cells are allogeneic cells.
- the disease is a cancer or an infectious disease.
- the cancer is a solid tumor.
- the cancer is melanoma, colon cancer, breast cancer, or brain cancer.
- the cancer is a blood cancer.
- the cancer is a lymphoma, leukemia, or multiple myeloma.
- the method comprises:
- the one or more genes are selected from Ptpn2, Socs 1 , Agps , Rc3hl ( Roquin-1 ) and Rcor I
- step b optionally, activating and/or expanding the T cell before or after step b); and d) administering an effective amount of the modified T cells to the subject.
- the subject is a human.
- Figures 1A-1G illustrate the identification of Regnase-1 as a major negative regulator of CD8 + T cell antitumor responses using in vivo CRISPR-Cas9 mutagenesis screening.
- Figure 1A Diagram of the screening system. Naive Cas9-expressing OT-I cells were transduced with lentiviral sgRNA metabolic library and expanded in vitro before adoptive transfer into B 16-Ova melanoma-bearing mice. OT-I cells were purified from tumor- infiltrating lymphocytes (TILs) at 7 days after transfer, and library representation in TILs and pre-transfer (input) OT-I cells was examined by deep sequencing of sgRNA cassette.
- TILs tumor- infiltrating lymphocytes
- FIG. IB Scatterplot of the enrichment of each gene versus its adjusted P values. Gene enrichment was calculated by averaging the enrichment of their 6 sgRNAs in tumor-infiltrating OT-I cells relative to input (log2 ratio (TIL/input)), with the most extensively enriched (black solid circle) and selective depleted (stripe-filled circle) genes (adjustedP ⁇ 0.05), as well as‘dummy’ genes (empty circle; generated by random combinations of 6 out of 1,000 non-targeting control sgRNAs per‘dummy’ gene) highlighted.
- Figure 1C Diagram of in vivo dual transfer system.
- OT-I cells transduced with sgRNA viral vectors expressing distinct fluorescent proteins were mixed and transferred into the same tumor-bearing hosts where further analyses were performed.
- OT- I cells transduced with non-targeting control sgRNA- referred to as “control sgRNA” hereafter
- control sgRNA mCherry + ; red
- sg Regnase-1 Ametrine + ; green
- FIG. IE Immunoblot analysis of Regnase-1 expression in control sgRNA- and sg/ri3 ⁇ 4v ⁇ .ve-/-transduced OT-I cells isolated from TILs at 7 days after adoptive transfer.
- Cell number in the tumor is shown as cell number per gram tissue. Numbers in plots indicate frequencies of OT-I cells in gates ( Figure IF). Numbers above bar graphs indicate fold change of sg Regnase-1- versus control sgRNA-transduced OT-I cells ( Figure 1G). Mean ⁇ s.e.m. in Figures ID and 1G. *P ⁇ 0.05; **P ⁇ 0.01; ***P ⁇ 0.001; two-tailed unpaired Student’s /-test in Figures ID and 1G. Data are representative of one ( Figure IB) or two ( Figures 1D-1F) independent experiments, or pooled from two ( Figure 1G) independent experiments.
- Figures 2A-2F show the enhanced therapeutic efficacy of Regnase-1 -deficient engineered CD8 + T cells against solid and blood cancers.
- Figures 3A-3M demonstrate that deletion of Regnase-1 reprograms tumor- infiltrating effector CD8 + T cells to acquire better persistence capacity while retaining robust effector function.
- Figure 3A GSEA enrichment plots of sg Regnase-1- transduced OT-I cells isolated from TILs, using gene sets of antigen-specific CXCR5 + and CXCR5 exhausted CD8 + T cells from chronic infection and hematopoietic stem cells.
- Figures 3L, 3M scRNA-Seq analysis of control sgRNA- and sg//eq/i ve- /-transduced OT-I cells isolated from TILs.
- control sgRNA- and sg//eq/i ve- /-transduced OT-I cells were mixed and transferred into tumor-bearing mice, and tumor-infiltrating OT-I cells were isolated at day 7 for transcriptional profiling by scRNA-Seq.
- tSNE visualization of control sgRNA- and sg//eq/i ve- /-transduced cells indicating genotypes ( Figure 3L, left), Tcf7 u and Tcf7 l ° cells ( Figure 3L, right; numbers in parentheses indicate cell numbers of each subset), and Tcf7 (Figure 3M, left) and Slamf6 (Figure 3M, right) gene expression in individual cells.
- Figures 4A-4U illustrate the identification of BATF as a key Regnase-1 functional target as well as PTPN2 and SOCS1 as additional modifiers using genome-scale CRISPR-Cas9 screening.
- Figure 4A Diagram of genome-scale screening system. Naive Cas9-expressing OT-I cells were co-transduced with lentiviral sg Regnase-1 and genome-scale sgRNA library and expanded in vitro before transfer into tumor-bearing mice. OT-I cells were purified from TILs at 7 days after adoptive transfer, and library representation in TILs and pre-transfer (input) OT-I cells was examined by deep sequencing of sgRNA cassette.
- FIG. 4C Oxygen consumption rate (OCR) bioenergetics profiling of control sgRNA- and sg/ri3 ⁇ 4v ⁇ .ve- / -transduced OT-I cells cultured in vitro for basal (left) and maximal OCR (right).
- mice were analyzed at 7 days after adoptive transfer for quantification of relative OT-I cell percentage in CD8a + cells normalized to spike in the spleen (left) and TILs (right).
- FIG. 4L Principal component analysis (PCA) of transcriptomes.
- OT-I cells were isolated from TILs at day 7 for transcriptional profiling by microarray.
- Tumor-infiltrating OT-I cells were analyzed at day 7 for quantification of relative MFI of TMRM (left) and Mitotracker (right) normalized to spike.
- Figures 40-4S OT-I cells transduced with control sgRNA (mCherry + ; spike) were mixed at a 1: 1 ratio with cells transduced with control
- Figures 5A-5E illustrate the validation of the effect of Regnase-1 in CD8 + T cell accumulation in tumor immunity using the in vivo dual transfer system.
- Figure 5A Gating strategy for sgRNA-transduced OT-I cells.
- mice were analyzed at 7 days after adoptive transfer for analysis of the proportion of OT-I cells in CD8a + cells ( Figures 5B-5C, left), and quantification of relative OT-I cell percentage in CD8a + cells normalized to input in the spleen and TILs ( Figures 5B-5C, right). Numbers in plots indicate frequencies of OT-I cells.
- Figure 6 shows the antitumor efficacy of Regnase-1 -deficient CD8 + CAR-T cells.
- Xenogen images of bioluminescent intensities of mice received CD8 + CAR-T cell therapy are presented.
- Data are representative of two independent experiments.
- Figures 7A-7H demonstrate that tumor-infiltrating and peripheral Regnase-l-null CD8 + T cells show distinct immune signatures.
- Figures 7A-7B GSEA enrichment plots of antigen-specific CXCR5 + and CXCR5 exhausted CD8 + T cells from chronic infection using gene targets repressed by Regnase-1 (i.e. top 100 upregulated genes in TIL sg Regnase-1- compared to control sgRNA-transduced OT-I cells as identified by bulk RNA-Seq).
- control sgRNA- and sgRegna.se- 1 -t rans cuted OT-I cells were mixed and transferred into tumor-bearing mice, and OT-I cells were isolated at day 7 for transcriptional profiling by RNA-Seq.
- Figures 7D-7E List of the top 10 significantly (FDR ⁇ 0.05) upregulated and downregulated pathways in TIL sg Regnase-1 - versus control sgRNA-transduced OT-I cells ( Figure 7D) and PLN sg Regnase-1- versus control sgRNA-transduced OT-I cells ( Figure 7E), as revealed by performing GSEA using “immunologic signatures” gene sets.
- FIG. 7F-7G GSEA enrichment plots of TIL sg Regnase-1- versus control sgRNA-transduced OT-I cells ( Figure 7F) and PLN sg Regnase- 1- versus control sgRNA-transduced OT-I cells ( Figure 7G) using gene sets of four different tumor-infiltrating CD8 T cell activation states. Specifically, control sgRNA- and sg Regnase- 7 -transduced OT-I cells were mixed and transferred into tumor-bearing mice, and PLN OT-I cells were isolated at day 7 for transcriptional profiling by RNA-Seq.
- Figures 8A-8F show the altered transcriptional programs and chromatin accessibility of TIL Regnase-l-null CD8 + T cells.
- Figure 8A Gene expression heat maps normalized by row (z-score) for the naive or memory T cell-associated transcription factors in control sgRNA- and sg//c3 ⁇ 4VM.ve- /-transduced OT-I cells isolated from TILs.
- Figure 8C Gene expression heat maps normalized by row (z-score) for the effector or exhausted T cell-associated transcription factors in control sgRNA- and sg//eq/ ⁇ .ve- /-transduced OT-I cells isolated from TILs.
- control sgRNA- and sgRegnase-1 -transduced OT-I cells were mixed and transferred into tumor bearing mice, and tumor-infiltrating OT-I cells were isolated at day 7 for transcriptional profiling by RNA-Seq.
- Figures 9A-9N show the proliferation and survival analyses of Regnase-l-null CD8 + T cells in tumor immunity.
- Figure 9A List of the top 10 significantly (FDR ⁇ 0.05) upregulated and downregulated pathways in TIL sgPeq/M.ve- / -transduced OT-I cells, as revealed by performing GSEA using“Hallmark” gene sets. Specifically, control sgRNA- and sgRegnase-1-transduced OT-I cells were mixed and transferred into tumor-bearing mice, and tumor-infiltrating OT-I cells were isolated at day 7 for transcriptional profiling by RNA-Seq.
- Figure 9B GSEA enrichment plots of TIL sgRegnct.se- 1 -transduced OT-I cells using cell cycling-associated gene sets, including E2F targets (left), G2M checkpoint (middle) and mitotic spindle (right).
- FIG. 9G Gene expression heat maps normalized by row (z-score) for anti-apoptotic Bcl2ll (encodes Bcl-xL) and pro-apoptotic Bcl2l 11 (encodes Bim) in control sgRNA- and sgRegnase-1-transduced OT- I cells isolated from TILs.
- Figure 9K List of the top 15 significantly (FDR ⁇ 0.05) upregulated and top 4 significantly downregulated pathways in PLN sgRegna.se- 1 -transduced OT-I cells, as revealed by performing GSEA using“Hallmark” gene sets.
- Figures 10A-10G show the effector molecular expression of tumor-infiltrating Regnase-1 -null CD8 + T cells.
- Numbers in plots indicate frequencies of TNF-a + cells ( Figure 10D, upper), or IL-2 + cells ( Figure 10D, lower).
- NS not significant; *P ⁇ 0.05; **P ⁇ 0.01; ***P ⁇ 0.001; two-tailed unpaired Student’s /-test in Figures 10A-10B, and two-tailed paired Student’s /-test in Figures IOC and 10E- 10G.
- Data are representative of two ( Figures 10A, 10B, and 10D) independent experiments, or pooled from two ( Figures IOC and 10E-10G) independent experiments.
- Figures 11A-11D illustrate the identification of immune regulators and OXPHOS metabolic pathway using genome-scale CRISPR-Cas9 screening.
- Figure 11A Scatterplot of the enrichment of each gene versus its adjusted P values in genome-scale CRISPR-Cas9 screening.
- Gene enrichment was calculated by averaging the enrichment of their 4 sgRNAs in tumor-infiltrating OT-I cells relative to input (log2 ratio (TIL/input)), with the most extensively enriched (dark solid circle) and selective depleted (stripe-filled circle) genes (adjusted P ⁇ 0.05), as well as‘dummy’ genes (empty circle; generated by random combinations of 4 out of 1,000 non-targeting control sgRNAs per‘dummy’ gene) highlighted.
- FIG. 11B Functional enrichment plots of the top 10 significantly (FDR ⁇ 0.05) enriched pathways in top-ranking depleted genes identified in the genome-scale CRISPR-Cas9 screening (by less than -3.5 log2 (TIL/input) fold change; adjusted P ⁇ 0.05).
- Figure 11C GSEA enrichment plots of TIL sgPeq/ ve- /-transduced OT-I cells using OXPHOS gene set.
- Figures 12A-12L demonstrates that BATF is a key Regnase-1 target in tumor immunity and regulates mitochondrial function.
- Figure 12A Venn diagram showing the overlap of genes between top depleted genes in genome-scale CRISPR-Cas9 screening (by less than -3.5 log2 (TIL/input) fold change; adjusted P ⁇ 0.05) and top upregulated genes in TIL sgRegnase-1- versus control sgRNA-transduced OT-I cells as identified by bulk RNA-Seq (by greater than 1.5 log2 fold change; P ⁇ 0.05).
- FIG. 12B Tn5 insert sites from ATAC-Seq analysis were aligned to motifs for transcription factors from the TRANSFAC database, and the binding profiles of BATF are shown.
- FIG. 12D In vivo accumulation of double sgRNA-transduced OT-I cells in tumor-bearing mice, similar as Figure 4G, for the use of the second sgRNA targeting Batf (see Figure 4G legend for details).
- Figure 12E Flow cytometry analysis of BATF expression in control sgRNA, sgRegnase-1, sg Batf and sg Batf and sgRegnase-1 co-transduced OT-I cells cultured in vitro and stimulated with anti-CD3 and anti- CD28 for indicated time. Numbers in graphs indicate MFI of BATF and are listed in the same order as the legend.
- FIG. 12H Gene expression heat maps normalized by row (z-score) for Ifng, Gzmb and Gzma expression in sgRegnase-1-transduced and sg Batf and sgRegnase-1 co-transduced OT-I cells isolated from TILs.
- Figure 12K GSEA enrichment plots of TIL sg Batf and sgRegnase-1 co-transduced OT-I cells using OXPHOS gene set.
- Figures 13A-13E illustrate the identification of additional targets for ACT in cancer immunotherapy using genome-scale CRISPR-Cas9 screening.
- Figure 13A In vivo accumulation of double sgRNA-transduced OT-I cells in tumor-bearing mice, similar as Figure 4G, except for the use of the sgRNAs targeting Ptpn2, Socsl and Agps (see Figure 4G legend for details).
- mice were analyzed at 7 days after adoptive transfer for analysis of the proportion of OT-I cells in CD8a + cells ( Figures 13B and 13C, left), and quantification of relative OT-I cell percentage in CD8a + cells normalized to input in the spleen and TILs ( Figure 13B and 13C, right). Numbers in plots indicate frequencies of OT-I cells.
- Data are representative of one ( Figures 13A, 13C, 13D, and 13E) or pooled from two ( Figures 13B) independent experiments.
- FIG 14 depicts a schematic of deletion of Regnase-1 reprograms CD8 + T cells for improved cancer immunotherapy.
- Regnase-1 is a major negative regulator of CD8 + T cell antitumor responses, and TCR and IL-2 inhibit its expression and activity.
- Deletion of Regnase- 1 unleashes potent therapeutic efficacy of engineered tumor-specific CD8 + T cells against cancers by coordinating transcriptional and metabolic programs to achieve greatly improved cell accumulation and function.
- As a key functional target of Regnase-1 excessive BATF drives robust cell accumulation and effector function, in part through enhancing mitochondrial metabolism, in Regnase-1 -null CD8 + T cells.
- Regnase-1 deletion also reprograms cells to acquire increased naive/memory cell-associated gene signatures and gain survival advantage, which contribute to the improved persistence of Regnase-1 -null effector CD8 + T cells.
- Targeting PTPN2 and SOCS1 acts in coordination with Regnase-1 inhibition to promote CD8 + T cell antitumor responses.
- Figures 15A-15G demonstrate that upstream signals regulate Regnase-1 expression and Regnase-1 -null cell phenotypes.
- Figure 15B GSEA enrichment plots of PLN and TIL control sgRNA- OT-I cells used in ( Figure 15A) by using gene targets repressed by Regnase-1 (i.e.
- OT-I cells were stimulated with aCD3 and aCD28 for overnight before viral transduction, and then cultured in IL-2, IL-7 and IL-15- containing medium for another 3 days in vitro.
- Pre-activated OT-I cells were then continuously cultured in normoxia (21% O2) or hypoxia (1% O2) condition for 48 h for immunoblot analysis of expression of HIFla, Regnase-1 and BATF (Figure 15F), and for flow cytometry analysis of expression of BATF, CD69, GzmB, CD25 and TCF-1 ( Figure 15G). Numbers in graphs indicate MFI and appear in the same order as the legend ( Figure 15G). Mean ⁇ s.e.m.
- Figures 16A-16G show scRNA-Seq and flow cytometry analyses of tumor- infiltrating Regnase-1 -null OT-I cells.
- Figures 16A-16F scRNA-Seq analysis of control sgRNA- and sgRegnase-1-transduced OT-I cells isolated from TILs. Specifically, control sgRNA- and sgRegnase-1-transduced OT-I cells were mixed and transferred into tumor bearing mice, and tumor-infiltrating OT-I cells were isolated at day 7 for transcriptional profiling by scRNA-Seq.
- Figures 17A-17H demonstrate that genome-scale CRISPR-Cas9 screening identifies BATF as an important Regnase-1 functional target in tumor immunity.
- Figure 17A Enrichment of BATF-binding motifs in the genomic regions with upregulated accessibility in Regnase-l-null cells. First, common regions were analyzed in the Regnase-l-null ATAC-Seq data and published BATF ChIP-Seq peaks (GSE5419 9 ).
- mice were analyzed at 5 days after adoptive transfer for quantification of relative OT-I cell percentage in CD8a + cells normalized to spike in the spleen ( Figure 17B, left) and TILs (Figure 17B, right), and quantification of relative MFI of BATF normalized to spike in the tumor-infiltrating OT-I cells ( Figure 17C).
- Figure 17D Immunoblot analysis of Regnase-1 and BATF expression in in vitro cultured OT-I cells 3 days after transduction with control sgRNA or sg Batf/Regnase-1.
- Figures 17E-17G The same transfer system as in ( Figure 17F) was used.
- Data are representative of one (Figure 17A) or three ( Figure 17D) independent experiments, or pooled from two ( Figures 17B, 17C, 17E- 17H) independent experiments.
- Figures 18A-18H show BATF overexpression markedly enhances CD8 + T cell antitumor responses.
- Figure 18A OT-I cells were stimulated with aCD3 and aCD28 for overnight before viral transduction, and then cultured in IL-7 and IL- 15 -containing medium for another 3 days in vitro.
- Control sgRNA- and sgRegnase-1 ransduced OT-I cells were then stimulated with aCD3, IL-2 or IL-21 for overnight for flow cytometry analysis of BATF expression (upper), and quantification of the MFI of BATF (lower) (n 6 samples each group). Numbers in graphs indicate MFI (upper) and fold change between comparisons (lower).
- TIL OT-I cells GzmB + , TNF-a + and IL-2 + cells (Figure 18G, right), and TCF-1 + cells (Figure 18H, lower) in TIL OT-I cells, and analysis of the proportion of donor-derived OT-I cells in total CD8a + cells in TILs and spleen ( Figure 18C), and quantification of relative OT-I cell percentage in CD8a + cells normalized to input in the spleen ( Figure 18D), and the dilution of CellTrace Violet (CTV) in TIL OT-I cells ( Figure 18E, left), and quantification of MFI of CTV in TIL OT-I cells ( Figure 18E, right).
- CTV CellTrace Violet
- Figures 19A-19D show ATAC-Seq and WCGNA analyses of wild-type, Regnase-1- null, BATF -null and BATF/Regnase-l-null cells.
- OT-I cells transduced with control sgRNA (mCherry + ), sgRegnase-1 (Ametrine + ), sg Batf (GFP + ) or sgBatf/Regnase-1 (GFP + and Ametrine + ) ( n 2-4 samples each group) were transferred into tumor-bearing hosts individually.
- OT-I cells were isolated from TILs at day 7 for ATAC-Seq analysis ( Figure 19A) or transcriptional profiling by microarrays ( Figures 19B, 19C).
- Figure 19A Venn diagram depicting genes with differential chromatin accessibility (by
- the differential accessibility (DA) regions were annotated in ATAC-Seq for the nearest genes. The numbers indicate the shared and independent genes in each category.
- FIG. 19B Weighted gene correlation network analysis (WGCNA) of control gRNA-, sgRegnase-1-, sg Batf-, and sgfkiifl Regnase- 1 -Uansduced tumor-infiltrating OT-I cells. The number of genes in each cluster is indicated. Red dashed lines represent the relative gene expression level in control gRNA-transduced cells. Mitochondrial genes that were upregulated in the absence of Regnase- 1 were shown in the corresponding clusters. (Figure 19C) Functional enrichment of the clusters from WGCNA (Figure 19B) using four tumor-infiltrating CD8 + T cell activation states 10 .
- WGCNA Weighted gene correlation network analysis
- FIG. 19D Venn diagram depicting mitochondrial genes with differential chromatin accessibility (by
- the differential accessibility (DA) regions in ATAC-Seq were annotated for the nearest genes, and these genes were superimposed with 1,158 mitochondrial genes defined in MitoCarta 2.0 database 11 12 .
- the numbers indicate the shared and independent genes in each category. Data are representative of one ( Figures 19A-19D) experiment.
- Figures 20A-20B demonstrate PTPN2 and SOCS 1 deletion efficiency and expression in Regnase-1 -null cells.
- Figure 20A Immunoblot analysis of Regnase-1, PTPN2 and SOCS1 expression in in vitro cultured OT-I cells 3 days after transduction with control sgRNA, sgPtpn2/Regnase-l (left), or sg Socsl! Regnase-1 (right).
- Figure 20B Immunoblot analysis of Regnase-1, BATF, SOCS1 and PTPN2 expression in control sgRNA- and sgRegnase-1 - transduced OT-I cells cultured in vitro for 3 days after viral transduction. Data are representative of three ( Figures 20A, 20B) independent experiments.
- Figure 21 shows a schematic of the six guide RNAs (gRNAl-gRNA6) selected in silico for knocking out Regnase-1 in human CAR-T cells.
- Figures 22A-22B show Regnase-1 knockout confirmation in human T cells.
- Figure 22A shows deep sequence results for three selected guide RNAs (gRNAl, gRNA2, and gRNA6).
- Figure 22B is a Western blot showing the knock-down effect of three selected guide RNAs (gRNAl, gRNA2, and gRNA6) on Regnase-1 protein levels. From these data, two guide RNAs, gRNAl and gRNA6, were selected for further testing.
- Figures 23A-23B show that human CAR-T Regnase-1 -null cells have improved survival ex vivo.
- Figure 23A shows survival of human CD4 CAR-T Regnase-1 -null cells with the two selected guide RNAs gRNAl and gRNA6.
- Figure 23B shows survival of human CD8 CAR-T Regnase-1 -null cells with the two selected guide RNAs gRNAl and gRNA6.
- Figures 24A-24B show that human CAR-T Regnase-1 -null cells have improved proliferation ( Figure 24A) and reduced apoptosis ( Figure 24B) ex vivo.
- Figures 25A-25B show that human CD4 Regnase-1 -null ( Figure 25 A) and CD8 Regnase-1 -null ( Figure 25B) CAR-T cells have more memory subsets upon antigen activation ex vivo.
- Figures 26A-26D show that human CD8 CAR-T Regnase-l-null cells secrete more cytokines ex vivo, specifically IL-2 (Figure 26A), TNFa (Figure 26B), IFN-gamma (Figure 26C), and GrzB (Figure 26D).
- Figures 27A-27D show that human CD4 CAR-T Regnase-l-null cells secrete more cytokines ex vivo, specifically IL-2 (Figure 27A), TNFa (Figure 27B), IFN-gamma (Figure 27C), and GrzB (Figure 27D).
- Figure 28 shows that CD8 Regnase-l-null CAR-T cells can hyperproliferate ex vivo.
- Figures 29A-29B show that CD8 Regnase-l-null CAR-T naive (top panel) and bulk (bottom panel) cells have upregulated mitochondrial activity ex vivo as measured by TMRM ( Figure 29A) and mitotracker (Figure 29B).
- Figure 30 shows upregulation of genes related to T cell proliferation and mitochondrial activity in Regnase-l-null CAR-T cells ex vivo upon antigen stimulation by GSEA analysis.
- Figures 31A-31B show that mice treated with Regnase-l-null CAR-T cells in vivo have lower tumor burden as indicated by the luciferase activity of each treatment group ( Figure 31A) and individual recipient ( Figure 31B).
- Figures 32A-32B show that human Regnase-l-null CAR-T cells have improved cytotoxicity ( Figure 32A) and improved survival ( Figure 32B) ex vivo.
- Figures 33A-33B show hyperactivation of CD8 Regnase-l-null (Figure 33A) and CD4 Regnase-l-null ( Figure 33B) CAR-T cells ex vivo.
- the present invention generally provides methods for enhancing expansion and/or persistence and/or effector function (e.g., an anti-tumor or an anti-infection function) of T cells.
- the present invention also provides modified T cells with enhanced expansion and/or persistence and/or effector function (e.g., an anti-tumor or an anti-infection function), as well as pharmaceutical compositions comprising such modified T cells.
- the present invention further provides methods of using such modified T cells to treat a disease (e.g., cancer or infectious disease) in a subject.
- T cells undergo extensive metabolic programing during differentiation and in adaptation to different contexts. T cell longevity and function in cancer immunotherapy have been proposed to be closely correlated with cell metabolic fitness 13 14 , although the underlying molecular mechanisms are unclear.
- the present invention is based on an unexpected discovery that Regnase-1 (also known as Zc3hl2a or MCPIPl) is a major negative regulator of antitumor responses, whose deficiency results in drastically increased CD8 + T cell accumulation in tumors. Data in support of these findings is presented in the Examples section, below. For instance, it was demonstrated that Regnase-1 deficient CD8 + T cells are long-lived effector cells with extensive accumulation, better persistence and robust effector function in tumors.
- Regnase-1 -deficient CD8 + T cells show profoundly improved therapeutic efficacy in mouse melanoma and leukemia tumor models.
- Regnase-1 -deficient CD8 + T cells are reprogrammed specifically in tumor microenvironment (TME) to acquire naive/memory cell-associated gene signatures for better persistence and survival advantage, but also retain high-level expression of effector molecules such as IFN-g and granzyme B.
- TEE tumor microenvironment
- the present invention is also based on another unexpected discovery that BATF is a key functional target of Regnase-1 in reprogramming antitumor responses of CD8 + T cells.
- BATF was identified as the key target of Regnase-1 and a rheostat in shaping antitumor responses. Loss of BATF suppresses the elevated accumulation and mitochondrial fitness of Regnase-1 -deficient CD8 + T cells.
- genome-scale CRISPR-Cas9 screening also identifies additional genes, such as Ptpn2, Socsl and Rc3hl, that could be targeted alone or in combination with Regnase-1 and/or Batf to further improve T-cell based therapy.
- T cell includes thymocytes, naive T lymphocytes, immature T lymphocytes, mature T lymphocytes, resting T lymphocytes, or activated T lymphocytes.
- a T cell can be a T helper (Th) cell, for example a T helper 1 (Thl), a T helper 2 (Th2) cell, a T helper 17 (Thl7) or regulatory T (Treg) cell.
- the T cell can be a T helper cell (Th; CD4 + T cell) CD4 + T cell, a cytotoxic T cell (CTL; CD8 + T cell), a tumor infiltrating cytotoxic T cell (TIL; CD8 + T cell), CD4 + CD8 + T cell, or any other subset of T cells.
- T helper cell Th; CD4 + T cell
- CTL cytotoxic T cell
- TIL tumor infiltrating cytotoxic T cell
- CD4 + CD8 + T cell CD4 + CD8 + T cell
- Other illustrative populations of T cells suitable for use in particular embodiments include naive T cells and memory T cells.
- “NKT cells” refer to a specialized population of T cells that express a semi-invariant ab T-cell receptor, but also express a variety of molecular markers that are typically associated with NK cells, such as NK1.1.
- NKT cells include NK1.1 + and NKT 1 , as well as CD4 + , CD4 , CD8 + and CD8 cells.
- the TCR on NKT cells is unique in that it recognizes glycolipid antigens presented by the MHC I-like molecule CD Id. NKT cells can have either protective or deleterious effects due to their abilities to produce cytokines that promote either inflammation or immune tolerance.
- gd T cells gamma-delta T cells
- gd T cells gamma-delta T cells
- the TCR in gd T cells is made up of a g-chain and a d-chain.
- gd T cells can play a role in immunosurveillance and immunoregulation, and were found to be an important source of IL-17 and to induce robust CD8 + cytotoxic T cell response.
- “regulatory T cells” or“Tregs” refers to T cells that suppress an abnormal or excessive immune response and play a role in immune tolerance.
- Tregs cells are typically transcription factor Foxp3-positive CD4 + T cells and can also include transcription factor Foxp3 -negative regulatory T cells that are IL-10-producing CD4 + T cells.
- NK cell refers to a differentiated lymphocyte with a CD 16 + CD56 + and/or CD57 + TCR- phenotype. NKs are characterized by their ability to bind to and kill cells that fail to express“self’ MHC/HLA antigens by the activation of specific cytolytic enzymes, the ability to kill tumor cells or other diseased cells that express a ligand for NK activating receptors, and the ability to release protein molecules called cytokines that stimulate or inhibit the immune response.
- chimeric antigen receptor or“CAR” as used herein is defined as a cell- surface receptor comprising an extracellular target-binding domain, a transmembrane domain and a cytoplasmic domain, comprisilng a lymphocyte activation domain and optionally at least one co-stimulatory signaling domain, all in a combination that is not naturally found together on a single protein. This particularly includes receptors wherein the extracellular domain and the cytoplasmic domain are not naturally found together on a single receptor protein.
- the chimeric antigen receptors of the present invention are intended primarily for use with lymphocyte such as T cells and natural killer (NK) cells.
- the term“antigen” refers to any agent (e.g., protein, peptide, polysaccharide, glycoprotein, glycolipid, nucleic acid, portions thereof, or combinations thereof) molecule capable of being bound by a T-cell receptor.
- An antigen is also able to provoke an immune response.
- An example of an immune response may involve, without limitation, antibody production, or the activation of specific immunologically competent cells, or both.
- an antigen need not be encoded by a“gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample, or might be macromolecule besides a polypeptide.
- a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components, organisms, subunits of proteins/antigens, killed or inactivated whole cells or lysates.
- antigen-binding moiety refers to a target-specific binding element that may be any ligand that binds to the antigen of interest or a polypeptide or fragment thereof, wherein the ligand is either naturally derived or synthetic.
- antigen-binding moieties include, but are not limited to, antibodies; polypeptides derived from antibodies, such as, for example, single chain variable fragments (scFv), Fab, Fab', F(ab')2, and Fv fragments; polypeptides derived from T Cell receptors, such as, for example, TCR variable domains; secreted factors (e.g., cytokines, growth factors) that can be artificially fused to signaling domains; and any ligand or receptor fragment (e.g., CD27, NKG2D) that binds to the antigen of interest.
- Combinatorial libraries could also be used to identify peptides binding with high affinity to the therapeutic target.
- Terms“antibody” and“antibodies” refer to monoclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, chimeric antibodies, single-chain Fvs (scFv), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), intrabodies, minibodies, diabodies and anti-idiotypic (anti-id) antibodies (including, e.g., anti- id antibodies to antigen-specific TCR), and epitope-binding fragments of any of the above.
- the terms“antibody” and“antibodies” also refer to covalent diabodies such as those disclosed in U.S. Pat. Appl. Pub.
- Antibodies useful as a TCR-binding molecule include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an antigen-binding site.
- Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgMl, IgM2, IgAl and IgA2) or subclass.
- activation means to induce a change in their biologic state by which the cells (e.g., T cells and NK cells) express activation markers, produce cytokines, proliferate and/or become cytotoxic to target cells. All these changes can be produced by primary stimulatory signals. Co-stimulatory signals can amplify the magnitude of the primary signals and suppress cell death following initial stimulation resulting in a more durable activation state and thus a higher cytotoxic capacity.
- A“co-stimulatory signal” refers to a signal, which in combination with a primary signal, such as TCR/CD3 ligation, leads to T cell and/or NK cell proliferation and/or upregulation or downregulation of key molecules.
- the term“proliferation” refers to an increase in cell division, either symmetric or asymmetric division of cells.
- the term“expansion” refers to the outcome of cell division and cell death.
- the term “differentiation” refers to a method of decreasing the potency or proliferation of a cell or moving the cell to a more developmentally restricted state.
- the terms“express” and“expression” mean allowing or causing the information in a gene or DNA sequence to become produced, for example producing a protein by activating the cellular functions involved in transcription and translation of a corresponding gene or DNA sequence.
- a DNA sequence is expressed in or by a cell to form an“expression product” such as a protein.
- the expression product itself e.g., the resulting protein, may also be said to be “expressed” by the cell.
- An expression product can be characterized as intracellular, extracellular or transmembrane.
- the term“transfection” means the introduction of a“foreign” (i.e., extrinsic or extracellular) nucleic acid into a cell using recombinant DNA technology.
- the term“genetic modification” means the introduction of a“foreign” (i.e., extrinsic or extracellular) gene, DNA or RNA sequence to a host cell, so that the host cell will express the introduced gene or sequence to produce a desired substance, typically a protein or enzyme coded by the introduced gene or sequence.
- the introduced gene or sequence may also be called a“cloned” or“foreign” gene or sequence, may include regulatory or control sequences operably linked to polynucleotide encoding the chimeric antigen receptor, such as start, stop, promoter, signal, secretion, or other sequences used by a cell's genetic machinery.
- the gene or sequence may include nonfunctional sequences or sequences with no known function.
- a host cell that receives and expresses introduced DNA or RNA has been“genetically engineered.”
- the DNA or RNA introduced to a host cell can come from any source, including cells of the same genus or species as the host cell, or from a different genus or species.
- transduction means the introduction of a foreign nucleic acid into a cell using a viral vector.
- the terms“genetically modified” or“genetically engineered” refers to the addition of extra genetic material in the form of DNA or RNA into a cell.
- the term“derivative” in the context of proteins or polypeptides refer to: (a) a polypeptide that has at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 99.5% sequence identity to the polypeptide it is a derivative of; (b) a polypeptide encoded by a nucleotide sequence that has at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 99.5% sequence identity to a nucleotide sequence encoding the polypeptide it is a derivative of; (c) a polypeptide that contains 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acid mutations (i.e., additions, deletions and/or substitutions)
- “functional fragment” or“functional derivative” as used herein refers to a fragment or derivative of the polypeptide or protein, or a polynucleotide encoding the polypeptide or protein, that retains at least one function of the full-length polypeptide or protein, or the polypeptide or protein it is a derivative of.
- a functional fragment may comprise an amino acid sequence of at least 5 contiguous amino acid residues, at least 6 contiguous amino acid residues, at least 7 contiguous amino acid residues, at least 8 contiguous amino acid residues, at least 9 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 11 contiguous amino acid residues, at least 12 contiguous amino acid residues, at least 13 contiguous amino acid residues, at least 14 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least contiguous 80 amino acid residues, at least contiguous 90 amino acid residues, at least contiguous 100 amino acid residues, at least contiguous 125 amino acid residues, at least 150 contiguous amino acid residues, at least
- Percent sequence identity can be determined using any method known to one of skill in the art. In a specific embodiment, the percent identity is determined using the“Best Fit” or “Gap” program of the Sequence Analysis Software Package (Version 10; Genetics Computer Group, Inc., University of Wisconsin Biotechnology Center, Madison, Wisconsin). Information regarding hybridization conditions (e.g., high, moderate, and typical stringency conditions) have been described, see, e.g. , U.S. Patent Application Publication No. US 2005/0048549 (e.g., paragraphs 72-73).
- the terms“vector”,“cloning vector” and“expression vector” mean the vehicle by which a DNA or RNA sequence (e.g., a foreign gene) can be introduced into a host cell, so as to genetically modify the host and promote expression (e.g., transcription and translation) of the introduced sequence.
- Vectors include plasmids, synthesized RNA and DNA molecules, phages, viruses, etc.
- the vector is a viral vector such as, but not limited to, viral vector is an adenoviral, adeno-associated, alphaviral, herpes, lentiviral, retroviral, or vaccinia vector.
- the term“regulatory element” refers to any cis-acting genetic element that controls some aspect of the expression of nucleic acid sequences.
- the term “promoter” comprises essentially the minimal sequences required to initiate transcription.
- the term“promoter” includes the sequences to start transcription, and in addition, also include sequences that can upregulate or downregulate transcription, commonly termed“enhancer elements” and“repressor elements”, respectively.
- operatively linked when used in reference to nucleic acids or amino acids, refer to the operational linkage of nucleic acid sequences or amino acid sequence, respectively, placed in functional relationships with each other.
- an operatively linked promoter, enhancer elements, open reading frame, 5' and 3' UTR, and terminator sequences result in the accurate production of a nucleic acid molecule (e.g., RNA).
- operatively linked nucleic acid elements result in the transcription of an open reading frame and ultimately the production of a polypeptide (i.e., expression of the open reading frame).
- an operatively linked peptide is one in which the functional domains are placed with appropriate distance from each other to impart the intended function of each domain.
- the terms“enhance” or“promote” or“increase” or“expand” or“improve” refer generally to the ability of a composition contemplated herein to produce, elicit, or cause a greater physiological response (i.e., downstream effects) compared to the response caused by either vehicle or a control molecule/composition.
- a measurable physiological response may include an increase in T cell expansion, activation, effector function, persistence, and/or an increase in cancer cell death killing ability, among others apparent from the understanding in the art and the description herein.
- an“increased” or“enhanced” amount can be a“statistically significant” amount, and may include an increase that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response produced by vehicle or a control composition.
- a“decrease” or“lower,” or“lessen,” or“reduce,” or“abate” refer generally to the ability of composition contemplated herein to produce, elicit, or cause a lesser physiological response (i.e., downstream effects) compared to the response caused by either vehicle or a control molecule/composition.
- a“decrease” or“reduced” amount can be a“statistically significant” amount, and may include a decrease that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response (reference response) produced by vehicle, a control composition, or the response in a particular cell lineage.
- the terms “treat” or“treatment” of a state, disorder or condition include: (1) preventing, delaying, or reducing the incidence and/or likelihood of the appearance of at least one clinical or sub-clinical symptom of the state, disorder or condition developing in a subject that may be afflicted with or predisposed to the state, disorder or condition, but does not yet experience or display clinical or subclinical symptoms of the state, disorder or condition; or (2) inhibiting the state, disorder or condition, i.e., arresting, reducing or delaying the development of the disease or a relapse thereof or at least one clinical or sub-clinical symptom thereof; or (3) relieving the disease, i.e., causing regression of the state, disorder or condition or at least one of its clinical or sub-clinical symptoms.
- the benefit to a subject to be treated is either statistically significant or at least perceptible to the patient or to the physician.
- the term“effective” applied to dose or amount refers to that quantity of a compound or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a subject in need thereof. Note that when a combination of active ingredients is administered, the effective amount of the combination may or may not include amounts of each ingredient that would have been effective if administered individually. The exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the condition being treated, the particular drug or drugs employed, the mode of administration, and the like.
- compositions described herein refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to a mammal (e.g., a human).
- a mammal e.g., a human
- pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans.
- protein encompasses all kinds of naturally occurring and synthetic proteins, including protein fragments of all lengths, fusion proteins and modified proteins, including without limitation, glycoproteins, as well as all other types of modified proteins (e.g., proteins resulting from phosphorylation, acetylation, myristoylation, palmitoylation, glycosylation, oxidation, formylation, amidation, polyglutamylation, ADP- ribosylation, pegylation, biotinylation, etc.).
- modified proteins e.g., proteins resulting from phosphorylation, acetylation, myristoylation, palmitoylation, glycosylation, oxidation, formylation, amidation, polyglutamylation, ADP- ribosylation, pegylation, biotinylation, etc.
- nucleic acid encompass both DNA and RNA unless specified otherwise.
- a“nucleic acid sequence” or“nucleotide sequence” is meant the nucleic acid sequence encoding an amino acid, the term may also refer to the nucleic acid sequence including the portion coding for any amino acids added as an artifact of cloning, including any amino acids coded for by linkers
- the terms“patient”,“individual”,“subject”, and“animal” are used interchangeably herein and refer to mammals, including, without limitation, human and veterinary animals (e.g., cats, dogs, cows, horses, sheep, pigs, etc.) and experimental animal models.
- the subject is a human.
- carrier refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered.
- Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions.
- the carrier can be a solid dosage form carrier, including but not limited to one or more of a binder (for compressed pills), a glidant, an encapsulating agent, a flavorant, and a colorant. Suitable pharmaceutical carriers are described in “Remington’s Pharmaceutical Sciences” by E.W. Martin.
- Singular forms“a”,“an”, and“the” include plural references unless the context clearly dictates otherwise.
- a reference to“a method” includes one or more methods, and/or steps of the type described herein and/or which will become apparent to those persons skilled in the art upon reading this disclosure.
- the term“about” or“approximately” includes being within a statistically meaningful range of a value. Such a range can be within an order of magnitude, preferably within 50%, more preferably within 20%, still more preferably within 10%, and even more preferably within 5% of a given value or range.
- the allowable variation encompassed by the term“about” or “approximately” depends on the particular system under study, and can be readily appreciated by one of ordinary skill in the art.
- John Wiley and Sons, Inc. Hoboken, NJ; Coligan et al. eds. (2005) Current Protocols in Immunology, John Wiley and Sons, Inc.: Hoboken, NJ; Coico et al. eds. (2005) Current Protocols in Microbiology, John Wiley and Sons, Inc.: Hoboken, NJ; Coligan et al. eds. (2005) Current Protocols in Protein Science, John Wiley and Sons, Inc.: Hoboken, NJ; and Enna et al. eds. (2005) Current Protocols in Pharmacology, John Wiley and Sons, Inc.: Hoboken, NJ. Additional techniques are explained, e.g., in U.S. Patent No. 7,912,698 and U.S. Patent Appl. Pub. Nos. 2011/0202322 and 2011/0307437.
- the present disclosure provides a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell.
- the method includes modifying a Regnase-1 gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated.
- expand or“expansion” when used in relation to a T cell refer to the ability of the T cell to undergo cellular proliferation (i.e., to increase the number of cells).
- the terms used herein encompass both in vivo and in vitro T cell expansion.
- the terms“persist” or“persistence” when used in relation to a T cell refer to the ability of the T cell (and/or its progenies) to be maintained in a recipient (e.g., a subject) for a period of time.
- the terms used herein encompass both in vivo and in vitro T cell persistence.
- anti-tumor function refers to the ability of a T cell to inhibit tumor growth and/or to kill the tumor cells (cancer cells).
- anti-infection function refers to the ability of a T cell to inhibit the growth of a pathogen or a population of pathogens and/or kill a pathogen or a population of pathogens.
- a pathogen may be a virus, a bacterium, a fungus, a parasite, or a prion, or the like.
- Regnase-1 also known as Zc3hl2a or MCPIPl, is an RNase that destabilizes a set of mRNAs, through cleavage of their 3’ untranslated regions (UTRs).
- the Regnase-1 gene has NCBI gene IDs of 80149 (human) and 230738 (mouse).
- Regnase-1 was identified as a major regulator of T cell effector responses, whose deficiency can cause reprogramming of T cells (specifically in the TME), resulting in markedly improved therapeutic efficacy. While not wishing to be bound by theory, Regnase-1 may function after initial T cell activation 15 16 to enable precise temporal and spatial control of effector T cell responses. Further, Regnase-1 may restrain mitochondrial oxidative metabolism to limit effector T cell responses in tumor immunity, and function through a gene target BATF ( Figure 14).
- T cells that may be used in the present disclosure include, but are not limited to, thymocytes, naive T lymphocytes, immature T lymphocytes, mature T lymphocytes, resting T lymphocytes, or activated T lymphocytes.
- a T cell can be a T helper (Th) cell, for example a T helper 1 (Thl) or a T helper 2 (Th2) cell.
- the T cell can be a helper T cell (HTL; CD4 + T cell) CD4 + T cell, a cytotoxic T cell (CTL; CD8 + T cell), a tumor infiltrating cytotoxic T cell (TIL; CD8 + T cell), CD4 + CD8 + T cell, or any other subset of T cells.
- TIL tumor infiltrating cytotoxic T cell
- CD8 + T cell CD4 + CD8 + T cell
- Other illustrative populations of T cells suitable for use in particular embodiments include naive T cells memory T cells, and NKT cells.
- the T cell a CD8 + ab T cell receptor (TCR) T cell, a CD4 + ab TCR T cell, a regulatory T cell (Treg), a natural killer T (NKT) cell, or a gd T cell.
- TCR CD8 + ab T cell receptor
- Treg regulatory T cell
- NKT natural killer T
- gd T cell a gd T cell.
- the T cell is a CD8 + ab TCR T cell.
- the T cell is a CD4 + ab TCR T cell.
- the T cell is a regulatory T cell (Treg).
- the T cell may have the ability to target a tumor antigen or an infectious antigen.
- T cells may be further engineered to express a T cell receptor or a chimeric antigen receptor (CAR).
- the T cell receptor or CAR may have an antigen-binding moiety that is capable of targeting a tumor antigen or an infectious antigen.
- Non-limiting examples of tumor antigens that may be targeted by the modified T cell described herein include human epidermal growth factor receptor 2 (HER2), interleukin- 13 receptor subunit alpha-2 (IL-13Ra2), ephrin type-A receptor 2 (EphA2), A kinase anchor protein 4 (AKAP-4), adrenoceptor beta 3 (ADRB3), anaplastic lymphoma kinase (ALK), immunoglobulin lambda- like polypeptide 1 (IGLL1), androgen receptor, angiopoietin-binding cell surface receptor 2 (Tie 2), B7H3 (CD276), bone marrow stromal cell antigen 2 (BST2), carbonic anhydrase IX (CAIX), CCCTC-binding factor (Zinc Finger Protein)-like (BORIS), CD171, CD 179a, CD24, CD300 molecule-like family member f (CD300LF), CD38, CD44v6,
- Additional antigens that may be targeted by the modified T cell described herein include, but are not limited to, carbonic anhydrase EX, alpha-fetoprotein, A3, antigen specific for A33 antibody, Ba 733, BrE3-antigen, CA125, CD1, CDla, CD3, CD5, CD15, CD16, CD19, CD20, CD21, CD22, CD23, CD25, CD30, CD33, CD38, CD45, CD74, CD79a, CD80, CD138, colon-specific antigen-p (CSAp), CEA (CEACAM5), CEACAM6, CSAp, EGFR, EGP-I, EGP-2, Ep-CAM, EphAl, EphA3, EphA4, EphA5, EphA6, EphA7, EphA8, EphAlO, EphBl, EphB2, EphB3, EphB4, EphB6, FIt-I, Flt-3, folate receptor, HLA-DR, human chorionic gonado
- An infectious antigen may be a viral antigen, a bacterial antigen, a fungal antigen, a parasite antigen, or a prion antigen, or the like.
- Infectious antigens include the intact microorganism (e.g., virus, bacterium, fungus) as well as natural isolates and fragments or derivatives thereof and also synthetic or recombinant compounds which are identical to or similar to natural microorganism antigens and induce an immune response specific for that microorganism (e.g., virus, bacterium, fungus).
- a compound is similar to a natural microorganism antigen if it induces an immune response (humoral and/or cellular) to a natural microorganism antigen.
- Such antigens are used routinely in the art and are well known to the skilled artisan.
- An infectious antigen may be an infectious virus or derived from an infectious virus.
- infectious viruses that have been found in humans include but are not limited to: Adenoviridae (most adenoviruses); Arena viridae (hemorrhagic fever viruses); Bimaviridae; Bungaviridae (e.g., Hantaan viruses, bunga viruses, phleboviruses and Nairo viruses); Calciviridae (e.g., strains that cause gastroenteritis); Coronoviridae (e.g., coronaviruses); Filoviridae (e.g., ebola viruses); Flaviridae (e.g., dengue viruses, encephalitis viruses, yellow fever viruses); Hepadnaviridae (Hepatitis B virus); Herpesviridae (herpes simplex virus (HSV) 1 and 2, varicella zoster virus, cytomegalovirus (CMV), her
- An infectious antigen may be an infectious bacterium or derived from an infectious bacterium. Both gram negative and gram positive bacteria can serve as antigens in vertebrate animals. Such gram positive bacteria include, but are not limited to, Pasteurella species, Staphylococci species and Streptococcus species. Grain negative bacteria include, but are not limited to, Escherichia coli, Pseudomonas species, and Salmonella species. Non-limiting examples of infectious bacteria include but are not limited to: Actinomyces israelii, Bacillus antracis, Bacteroides sp., Borelia burgdorferi, Chlamydia.
- Clostridium perfringers Clostridium tetani, Corynebacterium diphtheriae, Corynebacterium sp., Enterobacter aerogenes, Enterococcus sp. , Erysipelothrix rhusiopathiae, Fusobacterium nucleatum, Haemophilus influenzae, Helicobacter pyloris, Klebsiella pneumoniae, Legionella pneumophilia, Leptospira, Listeria monocytogenes, Mycobacteria sps.
- M tuberculosis e.g., M tuberculosis, M avium, M gordonae, M intr acellular e, M kansaii
- Neisseria gonorrhoeae Neisseria meningitidis, Pasturella mult ocida, pathogenic Campylobacter sp., Rickettsia, Staphylococcus aureus, Streptobacillus monihformis, Streptococcus ⁇ anaerobic sps.)
- Streptococcus viridans group
- Streptococcus bovis Streptococcus faecalis
- Streptococcus pneumoniae Streptococcus pyogenes ⁇ Group A Streptococcus
- Treponema pallidium e.g., M tubercul
- An infectious antigen may be or derived from other infectious microorganisms.
- infectious fungi include Cryptococcus neoformans, Histoplasma capsulatuin, Coccidioides immitis, Blastomyces dernatitidis, Chlamydia trachomatis and Candida albicans.
- Other infectious organisms i.e., protists
- Plasmodium such as Plasmodium falciparum, Plasmodium malariae, Plasmodium ovale, Plasmodium vivax, Toxoplasma gondii and Shistosoma.
- Other medically relevant microorganisms have been descried extensively in the literature, e.g., see C. G. A. Thomas,“Medical Microbiology”, Bailliere Tindall, Great Britain 1983, which is hereby incorporated by reference in its entirety.
- infectious antigens include viral antigens such as HIV antigens (e.g., gpl20, gpl60, pi 8, Tat, Gag, Pol, Env, Nef), glycoprotein from Herpesvirus, and surface antigen and core antigen from Hepatitis B virus; bacterial antigens such as OspA, OspB and OspC antigens from Borrelia sp; fungal and parasite antigens such as MP65 from Candida albicans and CS protein from Plasmodium sp..
- viral antigens such as HIV antigens (e.g., gpl20, gpl60, pi 8, Tat, Gag, Pol, Env, Nef), glycoprotein from Herpesvirus, and surface antigen and core antigen from Hepatitis B virus; bacterial antigens such as OspA, OspB and OspC antigens from Borrelia sp; fungal and parasite antigens such as MP65 from Candida alb
- modifying the Regnase-1 gene and/or gene product in the T cell improves in vivo accumulation of the T cell.
- the in vivo accumulation of the T cell is improved more than at least about 10-fold as compared an unmodified T cell measured at day 7 after the Regnase-1 modification.
- the in vivo accumulation of the T cell is improved more than at least about 10-fold, about 30- fold, about 50-fold, about 70-fold, about 90-fold, about 100-fold, about 110-fold, about 120- fold, about 130-fold, about 140-fold, about 150-fold, about 160-fold, about 180-fold, about 200-fold, about 230-fold, about 250-fold or more as compared an unmodified T cell measured at day 7 after the Regnase-1 modification.
- the in vivo accumulation of the T cell is improved more than at least about 100-fold as compared an unmodified T cell measured at day 14 after the Regnase- 1 modification. In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 100-fold, about 200-fold, about 300-fold, about 400-fold, about 500-fold, about 550-fold, about 600-fold, about 650-fold, about 670-fold, about 690-fold, about 700- fold, about 710-fold, about 720-fold, about 730-fold, about 740-fold, about 750-fold, about 760-fold, about 770-fold, about 780-fold, about 790-fold, about 800-fold, about 900-fold, about 1000-fold or more as compared an unmodified T cell measured at day 14 after the Regnase-1 modification.
- the in vivo accumulation of the T cell is improved more than at least about 1000-fold as compared an unmodified T cell measured at day 21 after the Regnase-1 modification. In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 1000-fold, about 1100-fold, about 1200-fold, about 1300- fold, about 1400-fold, about 1500-fold, about 1600-fold, about 1700-fold, about 1800-fold, about 1900-fold, about 2000-fold, about 2100-fold, about 2200-fold, about 2300-fold, about 2350-fold, about 2400-fold, about 2500-fold, about 2550-fold, about 2600-fold, about 2700- fold, about 2800-fold, about 2900-fold, about 3000-fold, or more as compared an unmodified T cell measured at day 14 after the Regnase-1 modification.
- additional gene(s) or gene product(s) in the T cell may be modified alone or in combination with Regnase-1 to enhance expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell.
- Additional genes or gene products that may be modified can be selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
- Other suitable genes or gene products that may be modified include Ireb2. Vtila, or Pexl 3.
- Additional suitable genes or gene products that may be modified include those listed in Table 1. Modifying one or more of such genes or gene products in addition to Regnase-1 may have synergetic or additive effects in enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell.
- Ptpn2 has NCBI gene IDs of 5771 (human) and 19255 (mouse). Socsl has NCBI gene IDs of 8651 (human) and 12703 (mouse). Agps has NCBI gene IDs of 8540 (human) and 228061 (mouse). Rc3hl ( Roquin-1 ) has NCBI gene IDs of 149041 (human) and 381305 (mouse). Rcorl has NCBI gene IDs of 23186 (human) and 217864 (mouse). Ireb2 has NCBI gene IDs of 3658 (human) and 64602 (mouse). Vtila has NCBI gene IDs of 143187 (human) and 53611 (mouse). Pexl 3 has NCBI gene IDs of 5194 (human) and 72129 (mouse).
- the Regnase-1 gene and/or any additional gene(s) in the T cell are modified with a site-specific nuclease.
- site-specific nuclease refers to a nuclease capable of specifically recognizing and cleaving a nucleic acid (DNA or RNA) sequence.
- RNA- guided endonuclease e.g., CRISPR-associated (Cas) proteins
- Cas CRISPR-associated proteins
- zinc finger nuclease e.g., a TALEN nuclease
- mega-TALEN nuclease e.g., a TALEN nuclease
- Site-specific nucleases may create double-strand breaks (DSBs) or single-strand breaks (i.e., nicks) in a genomic DNA of a cell.
- these breaks are typically repaired by the cell using one of two mechanisms: non-homologous end joining (NHEJ) and homology-directed repair (HDR).
- NHEJ non-homologous end joining
- HDR homology-directed repair
- the double-strand breaks are repaired by direct ligation of the break ends to one another.
- no new nucleic acid material is inserted into the site, although a few bases may be lost or added, resulting in a small insertions and deletion (indel).
- a donor polynucleotide with homology to the cleaved target DNA sequence is used as a template to repair the cleaved target DNA sequence, resulting in the transfer of genetic information from the donor polynucleotide to the target DNA.
- new nucleic acid material may be inserted or copied into the cleavage site.
- an exogenous donor polynucleotide can be provided to the cell.
- the modifications of the target DNA due to NHEJ and/or HDR may lead to, for example, gene correction, gene replacement, gene tagging, transgene insertion, nucleotide deletion, gene disruption, gene mutation, sequence replacement, etc.
- cleavage of DNA by a site-directed nuclease may be used to delete nucleic acid material from a target DNA sequence by cleaving the target DNA sequence and allowing the cell to repair the sequence in the absence of an exogenously provided donor polynucleotide.
- the methods can be used to knock out a gene (resulting in complete lack of transcription or altered transcription) or to knock in genetic material (e.g., a transgene) into a locus of choice in the target DNA.
- the site-specific nuclease is an RNA-guided endonuclease.
- a group of RNA-guided endonucleases known as CRISPR-associated (Cas) proteins may be employed to genetically modify the T cell.
- a Cas protein may form an RNA-protein complex (referred to as RNP) with a guide RNA (gRNA) and is capable of cleaving a target site bearing sequence complementarity to a short sequence (typically about 20-40nt) in the gRNA.
- Cas proteins useful in the methods of the present disclosure include Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas5e (CasD), Cas6, Cas6e, Cas6f, Cas7, Cas8al, Cas8a2, Cas8b, Cas8c, Cas9 (Csnl or Csxl2), Casio, CaslOd, CasF, CasG, CasH, Cpfl, Csyl, Csy2, Csy3, Csel (CasA), Cse2 (CasB), Cse3 (CasE), Cse4 (CasC), Cscl, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmrl, Cmr3, Cmr4, Cmr5, Cmr6, Csbl, Csb2, Csb3, Csxl
- the Cas protein used in the methods described herein is a Cas9 protein.
- the Cas9 protein may be from S. pyogenes, Streptococcus thermophilus, Neisseria meningitidis, F. novicida, S. mutans or Treponema denticola.
- Cas proteins can be wild type proteins (i.e., those that occur in nature), modified Cas proteins (i.e., Cas protein variants), or fragments of wild type or modified Cas proteins. Cas proteins can also be active variants or fragments with respect to catalytic activity of wild type or modified Cas proteins.
- Active variants or fragments with respect to catalytic activity can comprise at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more sequence identity to the wild type or modified Cas protein or a portion thereof, wherein the active variants retain the ability to cut at a desired cleavage site and hence retain nick- inducing or double-strand-break-inducing activity.
- A“guide RNA” or“gRNA” is an RNA molecule that binds to a Cas protein (e.g., Cas9 protein), or functional fragment or derivative thereof, and targets the Cas protein to a specific location within a target DNA.
- the guide RNA is a single guide RNA (sgRNA).
- a single-guide RNA can comprise a crRNA fused to a tracrRNA (e.g., via a linker).
- the sgRNA is designed to target a locus within or near the Regnase-1 gene.
- the sgRNA is designed to target a locus within or near the Ptpn2 gene.
- the sgRNA is designed to target a locus within or near the Socsl gene.
- the sgRNA is designed to target a locus within or near the Agps gene.
- the sgRNA is designed to target a locus within or near the Rc3hl gene. In some embodiments, the sgRNA is designed to target a locus within or near the Rcorl gene. In some embodiments, the sgRNA is designed to target a locus within or near the Ireb2 gene. In some embodiments, the sgRNA is designed to target a locus within or near the Vli la gene. In some embodiments, the sgRNA is designed to target a locus within or near the Pexl 3 gene.
- Exemplary sgRNAs useful for modifying a target gene described in the present disclosure include those that comprise a nucleotide sequence set forth in any one of SEQ ID NOs: 1, 2, and 5-9.
- a sgRNA targeting the Regnase-1 gene may comprise a nucleotide sequence of SEQ ID NO: 1 or SEQ ID NO: 2, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 1 or SEQ ID NO: 2.
- a sgRNA targeting the Ptpn2 gene may comprise a nucleotide sequence of SEQ ID NO: 5 or SEQ ID NO: 6, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 5 or SEQ ID NO: 6.
- a sgRNA targeting the Socsl gene may comprise a nucleotide sequence of SEQ ID NO: 7 or SEQ ID NO: 8, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 7 or SEQ ID NO: 8.
- a sgRNA targeting the Agps gene may comprise a nucleotide sequence of SEQ ID NO: 9, or a variant having at least at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 9.
- a sgRNA targeting the Rc3hl gene may comprise a nucleotide sequence of SEQ ID NO: 42, or a variant having at least at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 42.
- sgRNAs targeting the Regnase-1 gene include those that comprise a nucleotide sequence set forth in any one of SEQ ID NOs: 29-34 and 36-41.
- an sgRNA targeting the Regnase-1 gene may comprise a nucleotide sequence of any one of SEQ ID NOs: 29-34 and 36-41, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NOs: 29-34 and 36-41.
- the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 29. In another embodiment, the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 34.
- the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 36. In another embodiment, the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 41.
- the site-specific nuclease used in the methods described herein is a zinc finger nuclease, a transcription activator-like effector nuclease (TALEN), a mega-TALEN nuclease, and/or a restriction endonuclease.
- TALEN transcription activator-like effector nuclease
- mega-TALEN nuclease a restriction endonuclease
- the site-specific nuclease used in the methods described herein may include a zinc finger nuclease (ZFN).
- Zinc finger nucleases are a class of engineered DNA-binding proteins that assist targeted editing of the genome by creating double-strand breaks in DNA at targeted locations.
- ZFNs typically comprise two functional domains: a) a DNA-binding domain comprising a chain of two-finger modules (each recognizing a unique hexamer (6 bp) sequence of DNA-two-finger modules are stitched together to form a Zinc Finger Protein, each with specificity of about 24 bp or more) and b) a DNA-cleaving domain comprising the nuclease domain of Fok I.
- a ZFN can act like a highly-specific pair of“genomic scissors”.
- the site-specific nuclease used in the methods described herein may include a transcription activator-like effector nuclease (TALEN).
- TALEN transcription activator-like effector nucleases
- TALEN Transcription activator-like effector nucleases
- They typically comprise a TAL effector DNA-binding domain fused to a DNA cleavage domain (a nuclease which cuts DNA strands).
- TAL effector nucleases can be created by fusing a native or engineered transcription activator-like (TAL) effector, or functional part thereof, to the catalytic domain of an endonuclease, such as, for example, Fokl.
- TAL transcription activator-like
- the unique, modular TAL effector DNA binding domain allows for the design of proteins with potentially any given DNA recognition specificity.
- the DNA binding domains of the TAL effector nucleases can be engineered to recognize specific DNA target sites and thus, used to make double-strand breaks at desired target sequences. See, WO 2010/079430; Morbitzer et al. (2010) PNAS 10.1073/pnas.l013133107; Scholze & Boch (2010) Virulence 1:428-432; Christian et al.
- RNA interference refers to the process of sequence-specific post-transcriptional gene silencing in animals mediated by small interfering RNAs (siRNAs) (Fire et al., 1998, Nature, 391, 806; Hamilton et al, 1999, Science, 286, 950-951).
- RNAi RNA capable of mediating RNAi
- a short interfering nucleic acid such as a short interfering nucleic acid (siNA), a small interfering RNA (siRNA), a double-stranded RNA (dsRNA), a micro-RNA (miRNA), and a short hairpin RNA (shRNA)
- siNA small interfering nucleic acid
- siRNA small interfering RNA
- dsRNA double-stranded RNA
- miRNA micro-RNA
- shRNA short hairpin RNA
- the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
- siRNAs also known as short interfering RNA or silencing RNA, are a class of double-stranded RNA molecules, 20-25 base pairs in length, and operating within the RNA interference (RNAi) pathway.
- shRNAs or short hairpin RNAs are a group of artificial RNA molecules with a tight hairpin turn that can be used to silence target gene expression via RNA interference (RNAi).
- the methods also include inhibiting a Regnase-1 protein with one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
- Regnase-1 inhibitors may include a Zc3hl2a gene inhibitor and a Zc3hl2a protein inhibitor as those described in US patent No. 8,894,996, which is incorporated herein by reference in its entirety.
- the present disclosure provides a method of enhancing expansion and/or persistence and/or an anti -tumor or an anti -infection function of a T cell, comprising increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
- BATF also known as basic leucine zipper transcription factor, ATF-like, is a nuclear basic leucine zipper protein that belongs to the AP-l/ATF superfamily of transcription factors.
- the Batf gene has NCBI gene IDs of 10538 (human) and 53314 (mouse).
- BATF was identified as a key target of Regnase-1.
- BATF may serve as a limiting factor for programming effective antitumor responses, in part through shaping mitochondrial metabolism.
- the method comprises introducing into the T cell a polynucleotide encoding a BATF protein, or functional fragment or derivative thereof.
- the BATF protein encoded by the polynucleotide comprises the amino acid sequence of
- the BATF protein encoded by the polynucleotide comprises the amino acid sequence of
- the polynucleotide encoding a BATF protein comprises the nucleotide sequence of aaagcgagcgacatgtccctttggggagcagtccctctgcaccccagagtgaggaggacgcaggggtcagaggtggctacagggc aggcagaggaggcacctgtagggggtggtgggctggtggcccaggagaagtcaggaagggagcccagctggtgacaagagagc ccagagctggggctgagtgtgagagcccggaagatttcagccatgcctcacagctccgacagtgactccagcttcagccccgacagtgactccagcttcagccccgacagtgactccagcttcagccccgacagtgactccagc
- the polynucleotide encoding a BATF protein comprises the nucleotide sequence of gcagtccctctgcacccgagagagaggaggacgcaggggtctgtcagaggttgctgttgggcaagcaggggaggtacctgtggaa ggtggtgtgctggtggcccctagcagtcaagaaggggagccagctagtgagaagatcgcccagaggcatctgggacggtgtggg agagcccggaagattagaaccatgcctcacagctccgacagtgactccagcttcagccgctctccccctggcaaacaggac tcatctgatgatgtgaggaaagttcagaggagaatcgcatctgtgaggaaagttcagaggagaatcgcatcgc
- the polynucleotide encoding a BATF protein, or functional fragment or derivative thereof is introduced into the T cell in a recombinant vector.
- the recombinant vector may be a viral vector or non-viral vector, such as those described herein.
- increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell is achieved by administering to the T cell an agent (e.g., a small molecule or an antibody) that upregulates Batf gene expression and/or directly enhances or activates the BATF protein function.
- an agent e.g., a small molecule or an antibody
- the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl), Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
- the additional gene(s) or gene product(s) is Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl).
- the present disclosure provides a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell, comprising modifying a Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
- a Regnase-1 REGNASE-1, Zc3hl2a, MCPIPl
- the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of said additional gene(s) or gene product(s) in said T cell is reduced or eliminated, wherein said additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, md Rcorl.
- the present disclosure provides a method of improving mitochondrial biogenesis and/or function in a T cell comprising modifying a Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and/or increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
- a Regnase-1 REGNASE-1, Zc3hl2a, MCPIPl
- the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of said additional gene(s) or gene product(s) in said T cell is reduced or eliminated, wherein said additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
- mitochondrial biogenesis refers to the process by which cells increase mitochondrial mass.
- mitochondrial function refers to any mitochondria-dependent cellular metabolism.
- Effects of improved mitochondrial function and/or mitochondrial biogenesis may include without limitation observations that the method of this invention improves T accumulation and function in tumors, helps promote endurance, helps promote recovery after exercise, helps reduce muscle fatigue, helps reduce muscle soreness, complements the immediate short term effect of caffeine with a sustained effect on energy generation, helps promote energy generation from fat, helps lower plasma lactate during exercise, helps maintain muscle force in conditions of oxidative stress, helps protect against exercise-induced oxidative stress, helps the body to come up with more energy in a natural and sustained way, helps the body to find more energy without getting too much caffeine, gives long-lasting energy to sustain through busy schedule, helps boost body’s own energy production in a natural sustained way, helps maintain more even energy levels throughout the day, helps the body to adapt to exercise, helps prepare the body for exercise goals, helps revamp shape, facilitates the restart of exercise program, increased muscle work capacity, improved aerobic capacity, enhanced physical performance, enhanced exercise performance, improved running endurance, improved running distance and/or improved running time, or stimulate energy formation from nutrients.
- Isol Isol
- the T cells may be autologous/autogeneic (“self’) or non-autologous (“non-self,” e.g., allogeneic, syngeneic or xenogeneic).
- the T cells are obtained from a mammalian subject.
- the T cells are obtained from a primate subject.
- the T cells are obtained from a human subject.
- Lymphocytes can be obtained from sources such as, but not limited to, peripheral blood mononuclear cells, bone marrow, lymph nodes tissue, cord blood, thymus issue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. Lymphocytes may also be generated by differentiation of stem cells. In some embodiments, lymphocytes can be obtained from blood collected from a subject using techniques generally known to the skilled person, such as sedimentation, e.g., FICOLLTM separation.
- the T cell is derived from a blood, marrow, tissue, or tumor sample.
- cells from the circulating blood of a subject are obtained by apheresis.
- An apheresis device typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
- the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing.
- the cells can be washed with PBS or with another suitable solution that lacks calcium, magnesium, and most, if not all other, divalent cations.
- a washing step may be accomplished by methods known to those in the art, such as, but not limited to, using a semiautomated flowthrough centrifuge (e.g., Cobe 2991 cell processor, or the Baxter CytoMate).
- a semiautomated flowthrough centrifuge e.g., Cobe 2991 cell processor, or the Baxter CytoMate.
- the cells may be resuspended in a variety of biocompatible buffers, cell culture medias, or other saline solution with or without buffer.
- T cells can be isolated from peripheral blood mononuclear cells (PBMCs) by lysing the red blood cells and depleting the monocytes.
- PBMCs peripheral blood mononuclear cells
- the cells can be sorted by centrifugation through a PERCOLLTM gradient.
- both cytotoxic and helper T lymphocytes can be sorted into naive, memory, and effector T cell subpopulations either before or after activation, expansion, and/or genetic modification.
- T lymphocytes can be enriched.
- a specific subpopulation of T lymphocytes expressing one or more markers such as, but not limited to, CD3, CD4, CD8, CD14, CD15, CD16, CD19, CD27, CD28, CD34, CD36, CD45RA, CD45RO, CD56, CD62, CD62L, CD122, CD123, CD127, CD235a, CCR7, HLA-DR or a combination thereof using either positive or negative selection techniques.
- the T lymphocytes for use in the compositions of the invention do not express or do not substantially express one or more of the following markers: CD57, CD244, CD160, PD-1, CTLA4, TIM3, and LAG3.
- a method of producing T cells for administration to a subject comprises stimulating the T cells to become activated in the presence of one or more stimulatory signals or agents (e.g., compound, small molecule, e.g., small organic molecule, nucleic acid, polypeptide, or a fragment, isoform, variant, analog, or derivative thereol).
- a method of producing T cells for administration to a subject comprises stimulating the T cells to become activated and to proliferate in the presence of one or more stimulatory signals or agents.
- T cells can be activated by inducing a change in their biologic state by which the cells express activation markers, produce cytokines, proliferate and/or become cytotoxic to target cells. All these changes can be produced by primary stimulatory signals. Co-stimulatory signals amplify the magnitude of the primary signals and suppress cell death following initial stimulation resulting in a more durable activation state and thus a higher cytotoxic capacity.
- T cells can be activated generally using methods as described, for example, in U.S. Patents 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; and 6,867,041, each of which is incorporated herein by reference in its entirety.
- the T cells can be activated by binding to an agent that activates O ⁇ 3z.
- a CD2-binding agent may be used to provide a primary stimulation signal to the T cells.
- CD2 agents include, but are not limited to, CD2 ligands and anti-CD2 antibodies, e.g., the T1 1.3 antibody in combination with the T1 1.1 or Tl 1.2 antibody (Meuer, S. C. et al. (1984) Cell 36:897-906) and the 9.6 antibody (which recognizes the same epitope as TI 1.1) in combination with the 9-1 antibody (Yang, S. Y. et al. (1986) J. Immunol. 137: 1097-1100, which is incorporated herein by reference in its entirety).
- Other antibodies which bind to the same epitopes as any of the above described antibodies can also be used.
- the T cells are activated by administering phorbol myristate acetate (PMA) and ionomycine.
- the T cells are activated by administering an appropriate antigen that induces activation and then expansion.
- PMA, ionomycin, and/or appropriate antigen are administered with CD3 induce activation and/or expansion.
- the activating agents used in the present invention includes, but is not limited to, an antibody, a fragment thereof and a proteinaceous binding molecule with antibody -like functions.
- Examples of (recombinant) antibody fragments are Fab fragments, Fv fragments, single-chain Fv fragments (scFv), a divalent antibody fragment such as an (Fab)2'- fragment, diabodies, triabodies (Iliades, P., et al, FEBS Lett (1997) 409, 437-441, which is incorporated herein by reference in its entirety), decabodies (Stone, E., et al., Journal of Immunological Methods (2007) 318, 88-94, which is incorporated herein by reference in its entirety) and other domain antibodies (Holt, L.
- the divalent antibody fragment may be an (Fab)2'-fragment, or a divalent single-chain Fv fragment while the monovalent antibody fragment may be selected from the group consisting of a Fab fragment, a Fv fragment, and a single-chain Fv fragment (scFv).
- one or more binding sites of the O ⁇ 3z agents may be a bivalent proteinaceous artificial binding molecule such as a dimeric lipocalin mutein ( /. e. duocalin).
- the receptor binding reagent may have a single second binding site, (i.e., monovalent).
- monovalent agents include, but are not limited to, a monovalent antibody fragment, a proteinaceous binding molecule with antibody-like binding properties or an MHC molecule.
- monovalent antibody fragments include, but are not limited to a Fab fragment, a Fv fragment, and a single-chain Fv fragment (scFv), including a divalent single-chain Fv fragment.
- the agent that specifically binds CD3 includes, but is not limited to, an anti-CD3- antibody, a divalent antibody fragment of an anti-CD3 antibody, a monovalent antibody fragment of an anti-CD3 -antibody, and a proteinaceous CD3-binding molecule with antibody- like binding properties.
- a proteinaceous CD3-binding molecule with antibody-like binding properties can be an aptamer, a mutein based on a polypeptide of the lipocalin family, a glubody, a protein based on the ankyrin scaffold, a protein based on the crystalline scaffold, an adnectin, and an avimer. It also can be coupled to a bead.
- the activating agent e.g., CD3-binding agents
- the activating agent can be present in a concentration of about 0.1 to about 10 pg/ml.
- the activating agent e.g., CD3-binding agents
- the activating agent e.g., CD3-binding agents
- the activating agent is administered at a concentration of about 0.1 pg/ml, about 0.2 pg/ml, about 0.3 pg/ml. about 0.4 pg/ml. about 0.5 pg/ml. about 0.6 pg/ml. about 0.7 pg/ml. about 0.8 mM, about 0.9 pg/ml. about 1 pg/ml. about 2 pg/ml. about 3 pg/ml.
- the CD3-binding agents can be present in a concentration of 1 pg/ml.
- the activating agent is attached to a solid support such as, but not limited to, a bead, an absorbent polymer present in culture plate or well or other matrices such as, but not limited to, Sepharose or glass; may be expressed (such as in native or recombinant forms) on cell surface of natural or recombinant cell line by means known to those skilled in the art.
- the T cells are genetically modified by introducing polynucleotides and/or polypeptide (e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, an antisense oligonucleotide, a CAR, or polynucleotides encoding the same) into the cells.
- the T cells can be genetically modified after stimulation/activation.
- the T cells are modified within 12 hours, 16 hours, 24 hours, 36 hours, or 48 hours of stimulation/activation.
- the cells are modified within 16 to 24 hours after stimulation/activation.
- the T cells are modified within 24 hours.
- the polynucleotides and/or polypeptide e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, an antisense oligonucleotide, a CAR, a BAFT protein, or polynucleotides encoding the same
- Polynucleotide and/or polypeptide transfer may be via viral, non-viral gene delivery methods, or a physical method.
- Suitable methods for polynucleotide and/or polypeptide delivery for use with the current methods include any method known by those of skill in the art, by which a polynucleotide and/or polypeptide can be introduced into an organelle, cell, tissue or organism.
- polypeptides or polynucleotides e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, an antisense oligonucleotide, a CAR, a BAFT protein, or polynucleotides encoding the same
- a site-specific nuclease e.g., a guide RNA, an RNAi molecule, an antisense oligonucleotide, a CAR, a BAFT protein, or polynucleotides encoding the same
- the vector is a viral vector.
- Suitable viral vectors that can be used in the present invention include, but are not limited to, a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated viral (AAV) vector, a herpes viral vector, or a baculoviral vector.
- the viral vector is a lentiviral vector.
- the viral vector is a retroviral vector.
- the T cells can be transduced via retroviral transduction.
- References describing retroviral transduction of genes are Anderson et al, U.S. Pat. No. 5,399,346; Mann et al, Cell 33: 153 (1983); Temin et al., U.S. Pat. No. 4,650,764; Temin et al., U.S. Pat. No. 4,980,289; Markowitz et al., J. Virol. 62: 1120 (1988); Temin et al., U.S. Pat. No. 5,124,263; International Patent Publication No. WO 95/07358, published Mar. 16, 1995, by Dougherty et al; and Kuo et al, Blood 82:845 (1993), each of which is incorporated herein by reference in its entirety.
- One method of genetic modification includes ex vivo modification.
- Various methods are available for transfecting cells and tissues removed from a subject via ex vivo modification.
- retroviral gene transfer in vitro can be used to genetically modified cells removed from the subject and the cell transferred back into the subject. See e.g., Wilson et al., Science, 244: 1344-1346, 1989 andNabel et al., Science, 244(4910): 1342-1344, 1989, both of which are incorporated herein by reference in their entity.
- the T cells may be removed from the subject and transfected ex vivo using the polynucleotides (e.g., expression vectors) of the invention.
- the T cells obtained from the subject can be transfected or transduced with the polynucleotides (e.g., expression vectors) of the invention and then administered back to the subject.
- polynucleotides and/or polypeptides are transferred to the cell in a non-viral vector (e.g., a transposon, a plasmid).
- a non-viral vector e.g., a transposon, a plasmid
- the non-viral vector may be an RNA and/or DNA vector.
- Nucleic acid vaccines may also be used to transfer polynucleotides into the T cells.
- Such vaccines include, but are not limited to non-viral polynucleotide vectors,“naked” DNA and RNA, and viral vectors. Methods of genetically modifying cells with these vaccines, and for optimizing the expression of genes included in these vaccines are known to those of skill in the art.
- the polynucleotide(s) is operatively linked to at least one regulatory element for expression of the gene product (e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, a CAR, a BAFT protein).
- the regulatory element can be capable of mediating expression of the gene product in the host cell (e.g., modified T cell). Regulatory elements include, but are not limited to, promoters, enhancers, initiation sites, polyadenylation (polyA) tails, IRES elements, response elements, and termination signals.
- the regulatory element regulates expression of the gene product.
- the regulatory element increased the expression of the gene product.
- the regulatory element increased the expression of the gene product once the host cell (e.g., modified T cell) is activated. In some embodiments, the regulatory element decreases expression of the gene product. In some embodiments, the regulatory element decreases expression of the gene product once the host cell (e.g., modified T cell) is activated.
- polypeptides or polynucleotides are introduced into the modified T cell using a physical means.
- Suitable physical means include, but are not limited to, electroporation, microinjection, magnetofection, ultrasound, a ballistic or hydrodynamic method, or a combination thereof.
- Electroporation is a method for polynucleotide and/or polypeptide delivery. See e.g., Potter et al, (1984) Proc. Nat’l Acad. Sci. USA, 81, 7161-7165 and Tur-Kaspa et al, (1986) Mol. Cell Biol., 6, 716-718, both of which are incorporated herein in their entirety for all purposes. Electroporation involves the exposure of a suspension of cells and DNA to a high- voltage electric discharge. In some embodiments, cell wall-degrading enzymes, such as pectin degrading enzymes, can be employed to render the T cells more susceptible to genetic modification by electroporation than untreated cells. See e.g., U.S. Pat. No. 5,384,253, incorporated herein by reference in its entirety for all purposes.
- In vivo electroporation involves a basic injection technique in which a vector is injected intradermally in a subject. Electrodes then apply electrical pulses to the intradermal site causing the cells localized there (e.g., resident dermal dendritic cells), to take up the vector. These tumor antigen-expressing dendritic cells activated by local inflammation can then migrate to lymph-nodes.
- Methods of electroporation for use with this invention include, for example, Sardesai, N. Y., and Weiner, D. B., Current Opinion in Immunotherapy 23:421-9 (2011) and Ferraro, B. et al, Human Vaccines 7: 120-127 (2011), both of which are hereby incorporated by reference herein in their entirety for all purposes.
- the present invention provides a method of modifying a gene in a cell, comprising introducing into the cell a site-specific nuclease via electroporation.
- Cas9 protein and one or more guide RNAs are combined to form a ribonucleoprotein (RNP) complex.
- the guide RNA comprises a nucleotide sequence as set forth in any one of SEQ ID NOs: 1-9, 29-34 and 36-42, or a nucleotide sequence having at least 80% identity thereof.
- the guide RNA comprises the nucleotide sequence of SEQ ID NO: 29, SEQ ID NO: 34, SEQ ID NO: 36 or SEQ ID NO: 41.
- Example 14 An exemplary protocol is detailed in Example 14 in the Examples section below. It was shown in Example 14 that this method results in higher targeting efficiency compared to application of CRISPR/Cas9 for gene editing using viral delivery of Cas9 and guide RNA. Using this method to edit a gene (e.g., Regnase-1 ), the editing efficiency was greater than 90% based on deep sequencing results. The RNP electroporation method also had lower toxicity for T cells compared to DNA electroporation.
- a gene e.g., Regnase-1
- a polypeptide, a polynucleotide or viral vector may be delivered to a cell, tissue, or organism via one or more injections (e.g., a needle injection).
- injections e.g., a needle injection.
- Non-limiting methods of injection include injection of a composition (e.g., a saline based composition).
- Polynucleotides and/or polynucleotides can also be introduced by direct microinjection.
- Non- limiting sites of injection include, subcutaneous, intradermal, intramuscular, intranodal (allows for direct delivery of antigen to lymphoid tissues) intravenous, intraprotatic, intratumor, intralymphatic (allows direct administration of DCs) and intraperitoneal. It is understood that proper site of injection preparation is necessary (e.g., shaving of the site of injection to observe proper needle placement).
- polynucleotide and/or polypeptide transfer include liposome- mediated transfection (e.g., polynucleotide entrapped in alipid complex suspended in an excess of aqueous solution. See e.g., Ghosh and Bachhawat, (1991) In: Liver Diseases, Targeted Diagnosis and Therapy Using Specific Receptors and Ligands pp. 87-104). Also contemplated is a polynucleotide and/or polypeptide complexed with Lipofectamine, or Superfect); DEAE- dextran (e.g., a polynucleotide is delivered into a cell using DEAE-dextran followed by polyethylene glycol.
- liposome- mediated transfection e.g., polynucleotide entrapped in alipid complex suspended in an excess of aqueous solution. See e.g., Ghosh and Bachhawat, (1991) In: Liver Diseases, Target
- microprojectile bombardment e.g., one or more particles may be coated with at least one polynucleotide and/or polypeptide and delivered into cells by apropelling force.
- microprojectile bombardment e.g., one or more particles may be coated with at least one polynucleotide and/or polypeptide and delivered into cells by apropelling force.
- microprojectile bombardment e.g., one or more particles may be coated with at least one polynucleotide and/or polypeptide and delivered into cells by apropelling force.
- T cells After the T cells are activated and transduced, the cells are cultured to proliferate. T cells may be cultured for at least 1, 2, 3, 4, 5, 6, or 7 days, at least 2 weeks, at least 1, 2, 3, 4, 5, or 6 months or more with 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more rounds of expansion.
- Agents that can be used for the expansion of T cells can include interleukins, such as IL-2, IL-7, IL-15, or IL-21 (see for example Cornish et al. 2006, Blood. 108(2):600-8, Bazdar and Sieg, 2007, Journal of Virology, 2007, 81(22): 12670-12674, Battalia et al, 2013, Immunology, 139(1): 109-120, each of which is incorporated by reference in their entirety for all purposes).
- Other illustrative examples for agents that may be used for the expansion of T cells are agents that bind to CD8, CD45 or CD90, such as a CD8, a CD45 or a CD90 antibodies.
- T cell population including antigen-specific T cells, T helper cells, cytotoxic T cells, memory T cell (an illustrative example of memory T-cells are CD62L
- Additional agents that can be used to expand T lymphocytes includes methods as described, for example, in U.S. Patents 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; and 6,867,041, each of which is incorporated herein by reference in its entirety.
- the agent(s) used for expansion are administered at about 20 units/ml to about 200 units/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 25 units/ml to about 190 units/ml, about 30 units/ml to about 180 units/ml, about 35 units/ml to about 170 units/ml, about 40 units/ml to about 160 units/ml, about 45 units/ml to about 150 units/ml, about 50 units/ml to about 140 units/ml, about 55 units/ml to about 130 units/ml, about 60 units/ml to about 120 units/ml, about 65 units/ml to about 110 units/ml, about 70 units/ml to about 100 units/ml, about 75 units/ml to about 95 units/ml, or about 80 units/ml to about 90 units/ml.
- the agent(s) used for expansion are administered at about 20 units/ml, about 25 units/ml, about 30 units/ml, 35 units/ml, 40 units/ml, 45 units/ml, about 50 units/ml, about 55 units/ml, about 60 units/ml, about 65 units/ml, about 70 units/ml, about 75 units/ml, about 80 units/ml, about 85 units/ml, about 90 units/ml, about 95 units/ml, about 100 units/ml, about 105 units/ml, about 110 units/ml, about 115 units/ml, about 120 units/ml, about 125 units/ml, about 130 units/ml, about 135 units/ml, about 140 units/ml, about 145 units/ml, about 150 units/ml, about 155 units/ml, about 160 units/ml, about 165 units/ml, about 170 units/ml, about 175
- the agent(s) used for expansion are administered at about 5 mg/ml to about 10 ng/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 5.5 ng/ml to about 9.5 ng/ml, about 6 ng/ml to about 9 ng/ml, about 6.5 ng/ml to about 8.5 ng/ml, or about 7 ng/ml to about 8 ng/ml.
- the agent(s) used for expansion e.g., IL-7, IL-15
- the agent(s) used for expansion are administered at about 5 ng/ml, 6 ng/ml, 7 ng/ml, 8 ng/ml, 9, ng/ml, or 10 ng/ml.
- Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media (MEM), RPMI Media 1640, Lonza RPMI 1640, Advanced RPMI, Clicks, AIM-V, DMEM, a-MEM, F-12, TexMACS, X-Vivo 15, andX-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion).
- MEM Minimal Essential Media
- RPMI Media 1640 e.g., Lonza RPMI 1640, Advanced RPMI
- Clicks e.g., AIM-V, DMEM, a-MEM, F-12, TexMACS, X-Vivo 15, andX-Vivo 20
- Optimizer e.g., Optimizer, with added amino acids, sodium pyruvate, and
- T cell expansion examples include, but are not limited to, surfactant, piasmanate, pH buffers such as HEPES, and reducing agents such as N-acetyl- cysteine and 2-mercaptoethanol, Antibiotics (e.g., penicillin and streptomycin), are included only in experimental cultures, not in cultures of cells that are to be infused into a subject.
- the target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C) and atmosphere (e.g., air plus 5% CO2).
- NK cell refers to a differentiated lymphocyte with a CD3- CD16 + , CD3- CD56 + , CD16 + CD56 + and/or CD57 + TCR- phenotype.
- NK cells can be isolated and/or enriched.
- a specific subpopulation of T lymphocytes expressing one or more markers such as, but not limited to, CD2, CD 16, CD56, CD57, CD94, CD 122 or a combination thereof may be selected using either positive or negative selection techniques.
- NK cells can be activated generally using methods as described, for example, in U.S. Patents 7,803,376, 6,949,520, 6,693,086, 8,834,900, 9,404,083, 9,464,274, 7,435,596, 8,026,097, 8,877,182; U.S. Patent Applications US2004/0058445, US2007/0160578, US2013/0011376, US2015/0118207, US2015/0037887; and PCT Patent Application WO2016/122147, each of which is incorporated herein by reference in its entirety.
- the NK based host cells can be activated by, for example and not limitation, inhibition of inhibitory receptors on NK cells (e.g., KIR2DL1, KIR2DL2/3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR3DL1, KIR3DL2, KIR3DL3, LILRBl, NKG2A, NKG2C, NKG2E or LILRB5 receptor).
- inhibitory receptors on NK cells e.g., KIR2DL1, KIR2DL2/3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR3DL1, KIR3DL2, KIR3DL3, LILRBl, NKG2A, NKG2C, NKG2E or LILRB5 receptor.
- the NK cells can be activated by, for example and not limitation, feeder cells (e.g., native K562 cells or K562 cells that are genetically modified to express 4-1BBL and cytokines such as IL15 or IL21).
- feeder cells e.g., native K562 cells or K562 cells that are genetically modified to express 4-1BBL and cytokines such as IL15 or IL21.
- interferons or macrophage-derived cytokines can be used to activate NK cells.
- interferons include but are not limited to interferon alpha and interferon gamma
- cytokines include but are not limited to IL- 15, IL-2, IL-21.
- the NK activating agent can be present in a concentration of about 0.1 to about 10 pg/ml. In certain embodiments, the NK activating agent can be present in a concentration of about 0.2 pg/ml to about 9 pg/ml, about 0.3 pg/ml to about 8 pg/ml, about 0.4 pg/ml to about 7 pg/ml, about 0.5 pg/ml to about 6 pg/ml, about 0.6 pg/ml to about 5 pg/ml, about 0.7 pg/ml to about 4 pg/ml, about 0.8 pg/ml to about 3 pg/ml, or about 0.9 pg/ml to about
- the NK activating agent is administered at a concentration of about 0.1 pg/ml, about 0.2 pg/ml, about 0.3 pg/ml, about 0.4 pg/ml, about 0.5 pg/ml, about 0.6 pg/ml, about 0.7 pg/ml, about 0.8 pM, about 0.9 pg/ml, about 1 pg/ml, about 2 pg/ml, about
- the NK activating agent can be present in a concentration of 1 pg/ml.
- NK cells After the NK cells are activated and transduced, the cells are cultured to proliferate. NK cells may be cultured for at least 1, 2, 3, 4, 5, 6, or 7 days, at least 2 weeks, at least 1, 2, 3, 4, 5, or 6 months or more with 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more rounds of expansion.
- Agents that can be used for the expansion of NK cells can include agents that bind to CD 16 or CD56, such as for example aCD16 or aCD56 antibodies.
- the binding agent includes antibodies (see for example Hoshino et al, Blood. 1991 Dec. 15; 78(12):3232-40.).
- Other agents that may be used for expansion of NK cells may be IL-15 (see for example Vitale et al. 2002. The Anatomical Record. 266:87-92, which is incorporated by reference in their entirety for all purposes).
- compositions of the present disclosure include, but are not limited to, cell compositions and pharmaceutical compositions.
- the present disclosure provides modified T cells produced by the methods described herein. Modified T cells of the present disclosure have enhanced expansion and/or persistence and/or anti-tumor or anti-infection function.
- the T cell is a CD8 + ab TCR T cell.
- the T cell is a CD4 + ab TCR T cell.
- the T cell is a regulatory T cell (Treg).
- the T cell is engineered to express a T cell receptor or chimeric antigen receptor (CAR).
- the present disclosure provides a pharmaceutical composition
- a pharmaceutical composition comprising the modified T cells prepared using the methods described herein and a pharmaceutically acceptable carrier and/or excipient.
- pharmaceutical carriers include but are not limited to sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions.
- compositions comprising modified T cells disclosed herein may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
- buffers such as neutral buffered saline, phosphate buffered saline and the like
- carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol
- proteins such as glucose, mannose, sucrose or dextrans, mannitol
- proteins such as glucose, mannose, sucrose or dextrans, mannitol
- proteins such as glucose, mannose, sucrose or dextrans, mannitol
- proteins such as glucose, mannose, sucrose or dextrans, mannitol
- compositions comprising modified T cells disclosed herein may comprise one or more of the following: sterile diluents such as water for injection, saline solution, preferably physiological saline, Ringer's solution, isotonic sodium chloride, fixed oils such as synthetic mono or diglycerides which may serve as the solvent or suspending medium, polyethylene glycols, glycerin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose.
- the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
- An injectable pharmaceutical composition is preferably sterile.
- the compositions are formulated for parenteral administration, e.g., intravascular (intravenous or intraarterial), intraperitoneal, intratumoral, intraventricular, intrapleural or intramuscular administration.
- parenteral administration e.g., intravascular (intravenous or intraarterial), intraperitoneal, intratumoral, intraventricular, intrapleural or intramuscular administration.
- the composition is reconstituted from a lyophilized preparation prior to administration.
- the modified T cells may be mixed with substances that adhere or penetrate prior to their administration, e.g., but not limited to, nanoparticles.
- an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of any one of SEQ ID NOs: 1-9, 29-34 and 36-42, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with any one of SEQ ID NOs: 1-9, 29-34 and 36-42.
- an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 1.
- an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 2.
- an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 29.
- an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 34.
- an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 36.
- an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 41.
- the isolated polynucleotide is a DNA molecule. In various embodiments, the isolated polynucleotide is an RNA molecule. In some embodiments, the isolated polynucleotide may comprise modified nucleotides. Modified nucleotides may include any of those known to a skilled artisan.
- the isolated polynucleotide is a guide RNA.
- the guide RNA is a single guide RNA (sgRNA).
- the isolated polynucleotide is or is encoded in a recombinant vector.
- the recombinant vector may be a viral vector or non-viral vector, such as those described herein. Therapeutic Methods
- the present disclosure provides a method of treating a disease in a subject in need thereof, including administering to the subject an effective amount of the modified T cells or the pharmaceutical composition described herein.
- the modified T cells may be prepared using the methods as disclosed above.
- the modified T cells are autologous cells. In some embodiments, the modified T cells are allogeneic cells.
- the treatment may be carried out by isolating a T cell or a population of T cells from the subject (e.g., for autologous cell transfer) or a donor (e.g., for allogeneic cell transfer); modifying a Regnase-1 gene or gene product in the T cell(s) such that the expression and/or function of Regnase-1 in the T cell(s) is reduced or eliminated; and administering an effective amount of the modified T cells to the subject.
- the T cell(s) may be activated and/or expanded before or after the modification step.
- one or more additional genes or gene products including but not limited to Ptpn2, Socsl, Agps, Rc3hl, Rcorl, Ireb2, Vtila, or Pexl 3, may be modified alone or in combination with Regnase-1 and/or Baff in the T cell(s) such that the expression and/or function of the modified gene(s) in the T cell(s) is reduced or eliminated.
- the treatment may be carried out by isolating a T cell or a population of T cells from the subject (e.g., for autologous cell transfer) or a donor (e.g., for allogeneic cell transfer); increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell; and administering an effective amount of the modified T cells to the subject.
- the T cell(s) may be activated and/or expanded before or after the modification step.
- the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl), Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
- the additional gene(s) or gene product(s) is Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl).
- the disease being treated by the therapeutic methods of the present disclosure is a cancer or an infectious disease.
- the terms“cancer” and“cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
- the term“cancer” includes, for example, the soft tissue tumors (e.g., lymphomas), and tumors of the blood and blood-forming organs (e.g., leukemias), and solid tumors, which is one that grows in an anatomical site outside the bloodstream (e.g., carcinomas).
- cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma (e.g., osteosarcoma or rhabdomyosarcoma), and leukemia or lymphoid malignancies.
- cancers include squamous cell cancer (e.g., epithelial squamous cell cancer), adenosquamous cell carcinoma, lung cancer (e.g., including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung), cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer (e.g., including gastrointestinal cancer, pancreatic cancer), cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, primary or metastatic melanoma, multiple myeloma and B-cell lymphoma, non-Hodgkin's lymphoma, Hodgkin
- the cancer is a solid tumor.
- solid tumors that may be treated by the therapeutic methods of this present disclosure include ovarian cancer, lung cancer (e.g., non-small cell lung squamous cell carcinoma, adenocarcinoma, large cell carcinoma types, and small cell lung cancer), breast cancer, colon cancer, kidney cancer (e.g., renal cell carcinomas), bladder cancer, liver cancer (e.g., hepatocellular carcinoma), stomach cancer, cervical cancer, prostate cancer, testicular cancer, pancreatic cancer, nasopharyngeal cancer, thyroid cancer (e.g., thyroid papillary carcinoma), skin cancers (e.g., melanoma), brain cancer (e.g., glioma, astrocytoma and medulloblastoma) and sarcoma (e.g., osteosarcoma and Ewing's sarcoma).
- the cancer is a melanoma, colon
- the cancer is a blood cancer.
- the blood cancer is a lymphoma, leukemia, or multiple myeloma.
- leukemia that may be treated by the therapeutic methods of this present disclosure include acute lymphoblastic leukemia (ALL), B-cell acute lymphoblastic leukemia, T-cell acute lymphoblastic leukemia, acute non-lymphocytic leukemia (ANLL), acute myeloblastic leukemia (AML), acute promyelocytic leukemia (APL), acute monocytic leukemia, acute erythroleukemia leukemia, acute megakaryoblastic leukemia, chronic myelogenous leukemia (CML), hairy cell leukemia, and chronic lymphocytic leukemia (CLL).
- ALL acute lymphoblastic leukemia
- B-cell acute lymphoblastic leukemia T-cell acute lymphoblastic leukemia
- ANLL acute non-lymphocytic leukemia
- AML acute myelobl
- Non-limiting examples of lymphoma that may be treated by the therapeutic methods of this present disclosure include lymphoplasmacytic lymphoma, small lymphocytic lymphoma (SLL), splenic marginal zone B cell lymphoma, nodal marginal band B cell lymphoma, prolymphocytic white blood, follicular lymphoma (FL), mantle cell lymphoma (MCL), Burkitf s lymphoma, and diffuse large B-cell lymphoma (DLBCL) Hodgkin lymphoma, lymphoblastic lymphoma, anaplastic large cell lymphoma (ALCL), subcutaneously T cell lymphoma, peripheral T-cell lymphoma, angioimmunoblastic ball lymphoma, angiocentric lymphoma (nasal type T cell lymphoma), malignant lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma, follicular lymphoma, and other
- the composition is administered in a therapeutically effective amount.
- the dosages of the composition administered in the methods of the invention will vary widely, depending upon the subject’s physical parameters, the frequency of administration, the manner of administration, the clearance rate, and the like.
- the initial dose may be larger, and might be followed by smaller maintenance doses.
- the dose may be administered as infrequently as weekly or biweekly, or fractionated into smaller doses and administered daily, semi-weekly, etc., to maintain an effective dosage level. It is contemplated that a variety of doses will be effective to achieve in vivo persistence of the modified T cells. It is also contemplated that a variety of doses will be effective to improve in vivo effector function of the modified T cells.
- composition comprising the T cells manufactured by the methods described herein may be administered at a dosage of 10 2 to 10 10 cells/kg body weight, 10 5 to 10 9 cells/kg body weight, 10 5 to 10 8 cells/kg body weight, 10 5 to 10 7 cells/kg body weight, 10 7 to 10 9 cells/kg body weight, or 10 7 to 10 8 cells/kg body weight, including all integer values within those ranges.
- the number of T cells will depend on the therapeutic use for which the composition is intended for.
- Modified T cells may be administered multiple times at dosages listed above.
- the T cells may be allogeneic, syngeneic, xenogeneic, or autologous to the patient undergoing therapy.
- compositions and methods described in the present disclosure may be utilized in conjunction with other types of therapy for cancer, such as chemotherapy, surgery, radiation, gene therapy, and so forth.
- compositions and methods described in the present disclosure may be used to treat an infectious disease.
- Infectious diseases are well known to those skilled in the art, and non-limiting examples include but are not limited to infections of viral etiology such as HIV, influenza, Herpes, viral hepatitis, Epstein Bar, polio, viral encephalitis, measles, chicken pox, Papilloma virus; infections of bacterial etiology such as pneumonia, tuberculosis, syphilis; or infections of parasitic etiology such as malaria, trypanosomiasis, leishmaniasis, trichomoniasis, amoebiasis.
- viral etiology such as HIV, influenza, Herpes, viral hepatitis, Epstein Bar, polio, viral encephalitis, measles, chicken pox, Papilloma virus
- infections of bacterial etiology such as pneumonia, tuberculosis, syphilis
- compositions and methods of the present disclosure can be utilized with other therapeutic methods/agents suitable for the same or similar diseases/disorders.
- Such other therapeutic methods/agents can be co-administered (simultaneously or sequentially) to generate additive or synergistic effects.
- Suitable therapeutically effective dosages for each agent may be lowered due to the additive action or synergy.
- the method further comprises administering to the subject one or more additional compounds selected from the group consisting of immuno-suppressives, biologicals, probiotics, prebiotics, and cytokines (e.g., IFN or IL-2).
- additional compounds selected from the group consisting of immuno-suppressives, biologicals, probiotics, prebiotics, and cytokines (e.g., IFN or IL-2).
- the invention can be combined with other therapies that block inflammation (e.g., via blockage of IL1, INFa/b, IL6, TNF, IL23, etc.).
- compositions of the disclosure can be combined with other immunomodulatory treatments such as, e.g., therapeutic vaccines (including but not limited to GVAX, DC-based vaccines, etc.), checkpoint inhibitors (including but not limited to agents that block CTLA4, PD1, LAG3, TIM3, etc.) or activators (including but not limited to agents that enhance 4-1BB, 0X40, etc.).
- therapeutic vaccines including but not limited to GVAX, DC-based vaccines, etc.
- checkpoint inhibitors including but not limited to agents that block CTLA4, PD1, LAG3, TIM3, etc.
- activators including but not limited to agents that enhance 4-1BB, 0X40, etc.
- the methods of the invention can be also combined with other treatments that possess the ability to modulate NKT function or stability, including but not limited to CD Id, CD ld-fusion proteins, CD Id dimers or larger polymers of CD Id either unloaded or loaded with antigens, CD 1 d-chimeric antigen receptors (CDld-CAR), or any other of the five known CD1 isomers existing in humans (CDla, CDlb, CDlc, CDle).
- CDld-CAR CD 1 d-chimeric antigen receptors
- the methods of the invention can also be combined with other treatments such as midostaurin, enasidenib, or a combination thereof.
- compositions of the invention can be used in combination with conventional cancer therapies, such as, e.g., surgery, radiotherapy, chemotherapy or combinations thereof, depending on type of the tumor, patient condition, other health issues, and a variety of factors.
- conventional cancer therapies such as, e.g., surgery, radiotherapy, chemotherapy or combinations thereof, depending on type of the tumor, patient condition, other health issues, and a variety of factors.
- other therapeutic agents useful for combination cancer therapy with the inhibitors of the invention include anti-angiogenic agents.
- anti-angiogenic agents include, e.g., TNP-470, platelet factor 4, thrombospondin- 1, tissue inhibitors of metalloproteases (TIMP1 and TIMP2), prolactin (16-Kd fragment), angiostatin (38-Kd fragment of plasminogen), endostatin, bFGF soluble receptor, transforming growth factor beta, interferon alpha, soluble KDR and FLT-1 receptors, placental proliferin-related protein, as well as those listed by Carmeliet and Jain (2000).
- the T cells of the invention can be used in combination with a VEGF antagonist or a VEGF receptor antagonist such as anti-VEGF antibodies, VEGF variants, soluble VEGF receptor fragments, aptamers capable of blocking VEGF or VEGFR, neutralizing anti-VEGFR antibodies, inhibitors of VEGFR tyrosine kinases and any combinations thereof (e.g., anti-hVEGF antibody A4.6.1, bevacizumab or ranibizumab).
- a VEGF antagonist or a VEGF receptor antagonist such as anti-VEGF antibodies, VEGF variants, soluble VEGF receptor fragments, aptamers capable of blocking VEGF or VEGFR, neutralizing anti-VEGFR antibodies, inhibitors of VEGFR tyrosine kinases and any combinations thereof (e.g., anti-hVEGF antibody A4.6.1, bevacizumab or ranibizumab).
- Non-limiting examples of chemotherapeutic compounds which can be used in combination treatments of the present invention include, for example, aminoglutethimide, amsacrine, anastrozole, asparaginase, azacitidine, beg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, decitabine, dienestrol, diethylstilbestrol, docetaxel, doxorubicin, epirubicin, estradiol, estramnustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorour
- chemotherapeutic compounds may be categorized by their mechanism of action into, for example, following groups: anti-metabolites/anti-cancer agents, such as pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine) and purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiprobferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (pacbtaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthr
- the subject is a human.
- the subject may be a juvenile or an adult, of any age or sex.
- EXAMPLE 1 Identification of Regnase-1 as a major negative regulator of CD8 + T cell antitumor responses using in vivo CRISPR-Cas9 mutagenesis screening
- mice 18 constitutive //av «26-Cas9-e ⁇ pressing mice 18 (The Jackson Laboratory) were crossed with OT-I T-cell receptor transgenic mice 19 (The Jackson Laboratory) to express Cas9 in ovalbumin-specific CD8 + T cells (OT-I cells) that recognize B16 melanoma cells expressing ovalbumin as a surrogate tumor antigen (B 16-Ova cells) 20 .
- All mice were kept in a specific pathogen-free facility in the Animal Resource Center at St. Jude Children’s Research Hospital. Animal protocols were approved by the Institutional Animal Care and Use Committee of St. Jude Children’s Research Hospital.
- Naive Cas9-expressing OT-I cells were isolated from the spleen and peripheral lymph nodes (PLNs) of Cas9-OT-I mice using naive CD8a + T cell isolation kit (Miltenyi Biotec 130-096-543) according to manufacturer's instructions. Purified naive OT-I cells were activated in vitro for 18 h with 10 pg/ml anti-CD3 (2C11; Bio X Cell), 5 pg/ml anti-CD28 (37.51; Bio X Cell) before viral transduction.
- sgRNAs were developed, each consisting of 9,051 sgRNAs targeting 3,017 cell metabolism-related genes (6 sgRNAs per gene altogether) encoding metabolic enzymes, small molecule transporters, and metabolism-related transcriptional regulators 21 , as well as 500 non-targeting control sgRNAs in a lentiviral vector containing Ametrine fluorescent protein.
- Viral transduction was performed by spin-infection at 800 g at 25 °C for 3 h with 10 pg/ml polybrene (Sigma).
- IL-2 (20 Ul/ml; PeproTech), mouse IL-7 (25 ng/ml; PeproTech) and IL-15 (12.5 ng/ml; PeproTech) for 3-4 days.
- Transduced cells were sorted using a Reflection (i-Cyt) before adoptive transfer into recipients.
- sgRNA-transduced OT-I cells were adoptively transferred into B16-Ova melanoma-bearing mice. Seven days later, OT-I cells in tumor-infiltrating lymphocytes (TILs) were purified by flow cytometry, and library representation in TILs and pre-transfer (input) OT-I cells was examined by deep sequencing of sgRNA cassehe. sgRNAs capable of improving ACT were expected to be enriched in tumor-infiltrating OT-I cells.
- TILs tumor-infiltrating lymphocytes
- candidate genes were ranked based on the average enrichment of their 6 gene-specific sgRNAs in tumor-infiltrating OT-I cells relative to input (log2 ratio (TIL/input); adjusted P ⁇ 0.05).
- Zc3hl2a also known as Regnase-1, encodes Regnase-1 was the mostly highly enriched gene in this screening (Figure IB), with all of its targeting sgRNAs ranked at top 6 of the most enriched sgRNAs, suggesting that Regnase-1 could be a major negative regulator of antitumor responses.
- Lentiviral and retroviral sgRNA vector design The lentiviral sgRNA vector was generated from lentiGuide-puro vector by replacing the“EF-la PuroR” fragment with a mouse PGK promoter-driven Ametrine (or GFP or mCherry) fluorescent protein.
- the retroviral sgRNA vector was generated from pLMPd-Amt vector 27 by replacing the miR30 shRNA cassette with the U6 promoter driven gRNA cassette from the lentiGuide-puro vector.
- Lentiviral sgRNA metabolic library construction The gene list of mouse metabolic library was based on the reported human metabolic genes 21 . A total of 6 gRNAs were designed for each mouse metabolic gene according to previously -published selection criteria 28 and were split into two sub-libraries (AAAQ05 and AAAR07), each containing 500 non-targeting controls. sgRNAs were designed by using the online sgRNA design tool (portals.broadinstitute.org/gpp/public/analysis-tools/sgma-design).
- Oligonucleotides containing the guide sequence were synthesized (Custom Array), PCR amplified, and cloned into the recipient vector via a Golden Gate cloning procedure, including 5 pi Tango Buffer (ThermoFisher), 5 m ⁇ DTT (10 mM stock); 5 m ⁇ ATP (10 mM stock); 500 ng vector, pre digested with Esp3I, gel -extracted, and isopropanol-precipitation purified; 100 ng insert PCR product; 1 m ⁇ Esp3I (ThermoFisher ER0452); 1 m ⁇ T7 ligase (Enzymatics, 3,000 Units/ m ⁇ , L6020L); and water, up to 50 m ⁇ , and incubated in cycle (5 min at 37 °C and 5 min at 20 °C) for 100 times. The product was then purified by isopropanol precipitation and electroporated into STBL4 cells (Life Technologies 11635018). The distribution
- non-targeting control sgRNA ATGACACTTACGGTACTCGT (SEQ ID NO: 10);
- sgRegnase-1 AAGGCAGTGGTTTCTTACGA (SEQ ID NO: 1);
- sgRegnase-1 #2 GGAGTGGAAACGCTTCATCG (SEQ ID NO: 2);
- sgBatf#2 AGGACTCATCTGATGATGTG (SEQ ID NO: 4);
- sg Ptpn2 AAGAAGTTACATCTTAACAC (SEQ ID NO: 5);
- sg Ptpn2 #2 CACTCTATGAGGATAGTCAT (SEQ ID NO: 6);
- sg Socsl TGATGCGCCGGTAATCGGAG (SEQ ID NO: 7); sg Socsl #2: TGGTGCGCGACAGTCGCCAA (SEQ ID NO: 8);
- sg Agps GTACCAATGAGTGCAAAGCG (SEQ ID NO: 9);
- sgRc3hl GGTAGAGGGTTACTACCCGG (SEQ ID NO: 42).
- Lentivirus was produced by co-transfecting HEK293T cells with the lentiviral metabolic library plasmids, psPAX2 (Addgene plasmid # 12260) and pCAG4- Eco. At 48 h after transfection, virus was harvested and froze at -80 °C. Four hundred to five hundred million naive Cas9-expressing OT-I cells were isolated from 8-14 Cas9-OT-I mice and transduced at a MOI of 0.3 to achieve -20% transduction efficiency.
- mice After viral transduction, cells were cultured with human IL-2 (20 IU/ml; PeproTech), mouse IL-7 (25 ng/ml; PeproTech) and IL-15 (12.5 ng/ml; PeproTech) for 4 days. Transduced cells expressing Ametrine were sorted using a Reflection sorter (i-Cyt), and an aliquot of 5 c 10 6 transduced OT-I cells was saved as“input” (-500 c cell coverage per sgRNA). Transduced OT-I cells (5 x 10 6 cells per recipient) were z.v. transferred into mice at day 14 after B 16-Ova melanoma engraftment.
- human IL-2 (20 IU/ml; PeproTech
- mouse IL-7 25 ng/ml
- IL-15 12.5 ng/ml
- PeproTech IL-15
- Sequencing library preparation Genomic DNA was extracted by using the DNeasy Blood & Tissue Kits (Qiagen 69506). Primary PCR was performed by using the KOD Hot Start DNA Polymerase (Millipore 71086) and the following pair of Nextera NGS primers (Nextera NGS-F: TCGTCGGCAGCGTCAGATGTGTATAAGAGACAGttgtggaaaggacgaaacaccg
- the gene level false discovery rate adjusted P-value was calculated among multiple sgRNAs of each gene, using a paired two-tailed /-test between log2 transformed average normalized read counts of tumor samples and those of input sample, and a value of less than 0.05 was considered to be statistically significant.
- TIL tumor-infiltrating lymphocyte
- lymphocytes were labeled with CellTrace Violet (CTV; Life Technologies).
- CTV CellTrace Violet
- Flow cytometry data were analyzed using Flowjo 9.9.4 (Tree Star).
- OT-I cells were transduced with two different sgRNAs targeting Regnase-1.
- the relative proportion of Regnase-1 -null OT-I cells was drastically increased in both the spleen and tumor after adoptive transfer ( Figures 5B and 5C).
- Altering the fluorescent protein reporters for sgRegnase-1 yielded similar results ( Figure 5D), and this further excluded the contribution from the different fluorescent proteins.
- Imaging analysis identified significantly more Regnase-1 -null OT-I cells within tumors than wild-type controls ( Figure ID).
- Membranes were blocked using 5% BSA for 1 h and then incubated for overnight with anti-MCPIPl antibody (604421) (R&D), anti- BATF (D7C5) (Cell Signaling Technology), anti-PTPN2 (E-l l) (Santa Cruz Biotechnology), anti-SOCSl (E-9) (Santa Cruz Biotechnology), anti-Hsp90 (MAB3286) (R&D) and anti-b- actin (8H10D10) (Cell Signaling Technology).
- Membranes were washed 6 times with TBST and then incubated with 1:5,000 diluted HRP conjugated anti-mouse IgG (W4021) (from Promega) for 1 h. Following another 6 times of washes with TBST, the membranes were imaged using the ODYSSEY Fc Analyzer (LI-COR).
- B16-Ova melanomas were fixed in PBS containing 2% PFA, 0.3% Triton-100 and 1% DMSO for 24 h prior to cryoprotection in 30% sucrose. Cryosections were blocked with 1% BSA and 0.05% Tween-20 in TBS (20 mM Tris, pH 8.0, 100 mM NaCl) for 1 h at room temperature prior to overnight incubation in blocking buffer containing the following antibodies; anti-mCherry (Biorbyt orbl l618), anti-GFP (Rockland Immuno 600- 401-215), anti-TCF-7 (C63D9) (Cell Signaling Technology 2203), and anti-Tom20 (2F8.1) (Millipore MABT166).
- the number of cells per square area was determined following manual delineation of the tumor border. Analysis of transcription factor localization was performed using a Marianis spinning disk confocal microscope (Intelligent Imaging Innovations) equipped with a IOO c 1.4NA objective and Prime 95B sCMOS camera, and analyzed using Slidebook software (Intelligent Imaging Innovations).
- EXAMPLE 3 Evaluation of Regnase- 1-deficient CD8 + T cells in tumor models [00290] Given the improved longevity and drastically increased cellularity of Regnase-l-null CD8 + T cells within tumors, the efficacy of Regnase-l-null CD8 + T cells in ACT was assessed in three tumor models. First, the therapeutic efficacy of Regnase-l-null OT-I cells was determined against B 16-Ova melanoma, an aggressive tumor that is difficult to treat 29 .
- Aggressive mouse BCR-ABL1 + B progenitor acute lymphoblastic leukemia (Ph + B-ALL) cells 31 were also generated that express huCD19 as a surrogate tumor antigen and luciferase for in vivo imaging (huCD19-Ph + B-ALL).
- huCD19-Ph + B-ALL B progenitor acute lymphoblastic leukemia
- Regnase-l-null CD8 + CAR-T cells showed much stronger therapeutic efficacy against huCD19-Ph + B-ALL as indicated by the greatly increased survival ( Figure 2E) and reduced luciferase signals measured by in vivo imaging ( Figure 2F and Figure 6).
- Regnase-1 deletion markedly enhances the efficacy of ACT against both solid and blood cancers.
- B 16-Ova cells (2 c 10 5 ; provided by Dr. Dario Vignali at University of Pittsburgh) or B16-F10 cells (2 c 10 5 ; ATCC) were injected subcutaneously into female C57BL/6 mice (7-10 weeks age; from The Jackson Laboratory).
- mice bearing tumors of similar size were randomly divided into 3 groups (5-8 mice per group), and sgRNA-transduced OT-I cells (5 c 10 6 ) (for the treatment of B16-Ova melanomas) or pmel-1 (5 c 10 6 ) (for the treatment of B16-F10 melanomas) were injected intravenously.
- Tumors were measured every three days with digital calipers and tumor volumes were calculated by the formula: Length c Width c [(Length c Width) L 0.5] c p/6 32 . Death was defined as the point at which a progressively growing tumor reached 15 mm in the longest dimension.
- mice engrafted with huCD19-Ph + B-ALL (1 x 10 6 ; provided by Dr. Terrence Geiger at St. Jude Children's Research Hospital) were treated at day 7 with sgRNA-transduced CD8 + CAR-T cells (5 c 10 6 ). Mice were imaged using the Xenogen imaging system (Caliper Life Science).
- RNA-Sequencing RNA-Sequencing
- bioinformatic analyses of cells isolated from the in vivo dual transfer system were performed to address cell-intrinsic effects.
- GSEA gene set enrichment analysis
- peripheral Regnase-l-null OT-I cells were enriched with genes related to effector cells or those downregulated in memory formation or naive cells ( Figure 7E).
- GSEA was performed using previously defined gene modules associated with different functional states of CD8 + T cells in tumor immunity 10 . While tumor-infiltrating Regnase-l-null OT-I cells were enriched with naive or memory module, peripheral Regnase-l-null cells were associated with activation- associated but not naive or memory module ( Figures 7F and 7G).
- tumor-infiltrating Regnase-l-null OT-I cells had increased expression of the memory or naive T cell-associated marker CD27 and reduced expression of the effector cell-associated marker CD43a, as compared to wild-type controls ( Figure 3B) 34 ⁇ 35 .
- tumor-infiltrating Regnase-l-null OT-I cells expressed higher levels of transcription factors associated with naive or memory CD8 + T cells, including M3, Lefl, Tcf7 (encodes TCF-1), Bach2, Foxpl, Bcl6, and Fos/ 36 40 ( Figures 8A and 8B), but had lower expression of effector or exhausted CD8 + T cell-associated transcription factors including lrf2. Irf4, Hmgb2, M2, and Prdml (encodes Blimpl) 37,41 45 ( Figures 8C and 8D), and not significantly altered expression of Eomes, Tbx21 and Tox ( Figures 8A and 8C).
- chromatin accessibility was next measured using ATAC-Seq (assay for transposase accessible chromatin using sequencing 46 ) of tumor-infiltrating Regnase- l-null and wild-type OT-I cells, and motif searches were performed on accessible regions of assembled ATAC-Seq reads to explore enriched transcription factor binding motifs.
- ATAC-Seq assay for transposase accessible chromatin using sequencing 46
- motif searches were performed on accessible regions of assembled ATAC-Seq reads to explore enriched transcription factor binding motifs.
- Regnase-l-null cells showed significant enrichments in TCF-1, Bach2 and Bcl6 motifs, but downregulated the IRF4 motif ( Figures 8E and 8F).
- GSEA gene set enrichment analysis
- WGCNA weighted gene co-expression network analysis
- RNA-Seq RNA was quantified using the Quant-iT RiboGreen assay (Life Technologies) and quality checked by 2100 Bioanalyzer RNA 6000 Nano assay (Agilent) or LabChip RNA Pico Sensitivity assay (PerkinElmer) prior to library generation.
- Libraries were prepared from total RNA with the TruSeq Stranded Total RNA Library Prep Kit according to the manufacturer’s instructions (Illumina, PN 20020595). Libraries were analyzed for insert size distribution on a 2100 BioAnalyzer High Sensitivity kit (Agilent Technologies) or Caliper LabChip GX DNA High Sensitivity Reagent Kit (PerkinElmer.) Libraries were quantified using the Quant-iT PicoGreen dsDNA assay (Life Technologies) or low pass sequencing with a MiSeq nano kit (Illumina). Paired end 100 cycle sequencing was run on the HiSeq 4000 (Illumina).
- the raw reads were trimmed for adapter sequences using Trimmomatic v.0.36 using parameters ILLUMINACLIP : adapter. fa: 2 : 30: 10 LEADING: 10 TRAILING: 10 SLIDINGWINDOW:4: 18 MINLEN:32, followed by mapping to mm9 reference genome downloaded from gencode release Ml (www.gencodegenes.org/mouse/releases.html) using star v.2.5.2b. with default parameters. Reads were summarized at gene level using python script htseq-count. Differential expression analysis was performed using R package DEseq2 v. 1.18.1.
- the expression signals were summarized robust multi-array average algorithm Affymetrix Expression Console vl. l, followed by differential expression analysis performed using R package limma v.3.34.9. All the plots were generated using R package ggplot2 v.2.2.1. Differentially expressed transcripts were identified by ANOVA (Partek Genomics Suite version 6.5), and the Benjamini-Hochberg method was used to estimate the false discovery rate (FDR) as described 47 . Differentially expressed (DE) genes were defined by
- GSEA was performed as described 62 using the“Hallmark” database.
- microarray dataset (GSE84105) 7 was used for generating“CXCR5 + exhausted CD8 (Ahmed)” and CXCR5 exhausted CD8 (Ahmed)” gene signatures ( ⁇ 5% FDR); as total upregulated and downregulated genes were more than 200, genes were ranked by their log2 fold change of expression in CXCR5 + vs CXCR5 comparison and used top 200 upregulated genes as “CXCR5 + exhausted CD8 (Ahmed)” and top 200 downregulated genes as CXCR5 exhausted CD8 (Ahmed)”.
- RNA-Seq data 48 was processed using DEseq2 R package v 1.16.1 to generate“CXCR5 + exhausted CD8 (Yu)” and CXCR5 exhausted CD8 (Yu)” using the similar strategy as the other signatures above.
- gene signatures of different subsets of hematopoietic stem cells HSCs
- HSCs hematopoietic stem cells
- WGCNA Weighted gene co-expression network analysis
- Co-expression clusters were defined by hybrid dynamic tree cutting method with minimum height for merging module set at 0.2, as described 85 .
- a consensus trend for each co-expression cluster was defined based on the first principal component, and cluster membership was defined as Pearson correlation between individual genes and the consensus trend of the co-expression cluster.
- Genes were assigned to the most correlated co-expression cluster with cutoff of r > 0.7, as described 85 .
- Sorted T cells were incubated in 50 pi ATAC-Seq lysis buffer (10 mM Tris-HCl, pH 7.4, 10 mM NaCl, 3 mM MgCh. 0.1% IGEPAL CA-630) on ice for 10 min. Resulting nuclei were pelleted at 500 g for 10 min at 4°C. Supernatant was carefully removed with a pipette and discarded. The pellet was resuspended in 50 m ⁇ transposase reaction mix (25 m ⁇ 2* TD buffer, 22.5 m ⁇ nuclease-free water, 2.5 m ⁇ Transposase) and incubated for 30 min at 37 °C.
- 50 pi ATAC-Seq lysis buffer 10 mM Tris-HCl, pH 7.4, 10 mM NaCl, 3 mM MgCh. 0.1% IGEPAL CA-630
- the DNA was cleaned up using the Qiagen MinElute kit.
- the barcoding reaction was run using the NEBNext HiFi kit based on manufacturer’s instructions and amplified for 5 cycles according to Buenrostro et al. 46 using the same primers.
- Ideal cycle numbers were determined from 5 m ⁇ (of 50 m ⁇ ) from the previous reaction mix using KAPA SYBRFast (Kapa Biosystems) and 20 cycle amplification on an Applied Biosystems 7900HT.
- Optimal cycles were determined from the linear part of the amplification curve and the remaining 45 m ⁇ of PCR reaction was amplified in the same reaction mix using the optimal cycle number.
- ATAC-Seq analysis was performed as described previously 50 . Briefly, 2 c 100 bp paired-end reads obtained from all samples were trimming for Nextera adapter by cutadapt (version 1.9, paired-end mode, default parameter with“ -m 6 -O 20”) and aligned to mouse genome mm9 (NCBIM37 from Sanger) by BWA (version 0.7.12-rl039, default parameter) 51 , duplicated reads were then marked with Picard (version 2.6.0-SNAPSHOT) and only non- duplicated proper paired reads have been kept by samtools (parameter“-q 1 -F 1804” version 1.2) 52 .
- nucleosome free reads were first finalized as only retained a peak if it called with higher cutoff (macs2 -q 0.05) in one merged sample and at least called with lower cutoff (macs2 -q 0.5) in the other merged sample. There reproducible peaks were further merged between WT and KO and then nucleosome free reads from each of the 8 samples were counted by bedtools (v2.24.0) 55 .
- FIMO from MEME suite (version 4.11.3,“-thresh le-4 -motif-pseudo O.OOOT’) 57 have been used for scanning motif (TRANSFAC database, only included Vertebrata and not 3D structure-based) matches in the nucleosome free regions and Fisher’s Exact tests have been used to test whether a motif is significant enriched for differential accessible regions compared to the control regions.
- ATAC-Seq data have been deposited into the GEO series database
- Transcription factor binding site footprinting was performed as described previously 50 . Briefly, bigwig files have been first generated by all tags of adjusted reads and normalized by autosomes reads number to 2 c 10 8 reads (e.g. sample with 1 c 10 8 autosome reads would be scaled to double the bigwig profile). Then average bigwig files have been generated by mean of replicates at each bp for each sample and motif matches within nucleosome free region have been used for footprinting taking the average profile across all motif matches at each bp from -100 bp from motif match centers to +100 bp. Finally, the footprinting profiles have been smoothed with 10 bp bins and plot by deeptools (v2.5.7) 58 .
- nucleosome-free differentially accessible regions were defined at
- differentially accessible peaks were overlapped with BATF ChIP-Seq peaks (downloaded from GSE54191 56 ) to identify the common regions between ATAC-Seq peaks and BATF ChIP-Seq peaks using bedtools (version 2.25.0).
- FIMO 591 from MEME suite (version 4.9.0) was used to scan the overlapping regions with TRANSFAC motifs associated with BATF to identify the number of motifs enriched in the differentially accessible regions in Regnase-l-null (shown as Match (Regnase-l-null)’ in Figure 17A) or wild-type control samples (shown as Match (wild-type)’), and Fisher’s exact test was used to test the significance of enrichment.
- This statistical bioinformatic method has been used successfully by us and others to circumvent cell number limitations 50 ⁇ 60 .
- T cell differentiation state is an important determinant of in vivo persistence 13 ⁇ 61
- the enhanced accumulation of Regnase-l-null TILs prompted determination of their differentiation status by performing gene set enrichment analysis (GSEA) using previously defined gene modules associated with different functional states of CD8 + T cells in tumor immunity 10 .
- GSEA gene set enrichment analysis
- tumor-infiltrating Regnase-l-null OT-I cells were enriched with naive or memory module ( Figure 7F).
- gene targets repressed by Regnase-1 i.e.
- Tumor-infiltrating Regnase-l-null OT-I cells also expressed higher mRNA levels of transcription factors associated with naive or memory CD8 + T cells, including Lefl, Bach2, Tcfl (encodes TCF-1), Foxpl, Bcl6, and Fosb 36 ’ 38-40 (Figure 8A), but had lower expression of effector or exhausted CD8 + T cell- associated transcription factors, including Irf2, Irf4 and Hmgb2 41 45 ( Figures 8C, 8D), and not significantly altered expression of Eomes, Tbx21 and Tox ( Figures 8A, 8C).
- Regnase-1 expression was measured in pre-activated OT-I cells upon stimulation with TCR, IL-2 or IL-21 62 .
- TCR engagement with anti-CD3 (aCD3) antibody decreased Regnase-1 expression and also potently induced Regnase-1 cleavage (Figure 15C).
- aCD3 anti-CD3
- Regnase-l-null OT-I cells were transferred into mice bearing either B 16-Ova or B16-F10 tumor cells that express or lack the expression of the cognate antigen, respectively. Strikingly, antigen recognition was crucial in driving Regenase- 1 deletion-induced CD8 + T cell accumulation in TILs, as evidenced by significantly reduced Regnase-l-null OT-I cells in B16-F10 melanoma-bearing mice ( Figure 15D).
- Antigen stimulation was also required for Regnase-l-null cells to acquire increased naive/memory cell- like phenotype, as indicated by the decreased TCF-1 expression in Regnase-l-null cells in B16- F 10 compared with B 16-Ova-bearing mice ( Figure 15E). While hypoxia is one of the hallmark features of the TME and regulates tumor-infiltrating CD8 + T cell functional states 14 , hypoxia did not alter Regnase-1 expression (Figure 15F), or expression of activation or differentiation molecules, including BATF, CD69, GzmB, CD25, and TCF-1, in wild-type or Regnase-l-null OT-I cells ( Figure 15G). These results further indicate that Regnase-l-null effector CD8 + T cells undergo specific reprogramming in the TME, and establish Regnase-1 as an intrinsic component of the signaling processes downstream of tumor antigen-TCR stimulation but not hypoxia.
- Tumor-infiltrating Regnase- l-null OT-I cells also had reduced levels of DNA damage, as measured by a specific staining to detect phosphorylation of the histone variant H2A.X at Serl39 61 ⁇ 63 ( Figure 9N). Therefore, tumor-infiltrating Regnase-l-null OT-I cells are less proliferative after initial effector expansion and more importantly, exhibit better survival than wild-type cells in tumors, in line with enhanced survival and the more quiescent state of naive/memory CD8 + T cells and long- lived stem cells 64 66 .
- peripheral Regnase-l-null OT-I cells were enriched with cell cycling and apoptosis-associated signatures (Figure 9K), which was validated by increased BrdU incorporation and active caspase-3 expression in Regnase-l-null OT-I cells in the spleen of tumor-bearing mice ( Figures 9L and 9M). These results further support TME- specific phenotypes of Regnase-l-null CD8 + T cells.
- tumor-infiltrating Regnase-l-null CD8 + T cells are characterized by in vivo quiescence and cellular survival, and exhibit better in vivo persistence in response to both antigen stimulation and homeostatic signals.
- Naive or memory cells and terminally differentiated effector cells are generally considered as exclusive cell fates 64 ⁇ 67 .
- Tet2-deficient CAR-T cells can adopt a memory cell phenotype with better persistence, but with impaired effector function 4 .
- they despite the acquisition of naive/memory cell-associated gene programs of Regnase-l-null OT-I cells in tumors, they had higher expression of activation-associated markers, including CD69, CD49a, KLRG1, ICOS, Tim3, Lag3, PD-1 and CTLA4, while CD25 and CXCR3 expression was largely normal (Figure 10A).
- tumor-infiltrating Regnase-l- null OT-I cells retained an effector surface phenotype (CD44'CD62L ) ( Figure 10B) and, more importantly, contained more IFN-g- and granzyme B (GzmB)- expressing cells within tumors (except for a minor reduction of GzmB + T cell percentage at day 7) ( Figures 3H, 31, IOC).
- IFN-g 1 and GzmB + Regnase-l-null OT-I cells the expression levels of IFN-g and GzmB were also increased on a per cell basis (Figure 3J).
- Regnase-l-null OT-I cells largely preserved the capacity to produce TNF-a ( Figures 10D and 10E), while there were more TNF-a-producing Regnase-l-null OT-I cells than wild-type cells ( Figure 10F).
- Regnase-l-null OT-I cells produced more IL-2 than wild-type controls at day 7 after adoptive transfer ( Figure 10D and 10E), with increased number of IL-2 -producing cells ( Figure 10F).
- Regnase-l-null OT-I cells also had increased proportion and number of IFN- y'TNF-a 1 IL-2 1 polyfunctional T cells ( Figures 10G).
- tumor-infiltrating CD8 + T cells lacking Regnase-1 acquire better persistence and survival advantage, they retain terminally differentiated effector function.
- scRNA-Seq single cell RNA-Sequencing
- Tcf7 h ' cells in wild-type and Regnase-1 -null TILs expressed Tox ( Figure 16A), but, compared with Tcf7 l ° cells, had reduced expression of Pdcdl (encodes PD- 1) and Havcr2 (encodes Tim3) ( Figure 16B).
- Tcf7 l cells were enriched with memory- or progenitor-like CD8 + T cell gene signatures derived from chronic infection 7 ⁇ 8 ( Figure 16C) and the expression of Slamf6 (a TCF-1 -dependent target 73 ⁇ 74 ; Figure 3M), all of which showed increased expression in Regnase-1 -null cells ( Figures 3M, 16C).
- TCF-1 + cells While CD127/IL-7R was unchanged, TCF-1 + cells had high expression levels of Slamf6, which was further elevated in Regnase-1 -null cells ( Figure 16G). Conversely, TCF-1 + cells had low KLRG1 and Tim3 and intermediate PD-1 expression levels, and these patterns were largely retained in Regnase-1 -null cells with modestly enhanced abundance ( Figure 16G).
- the TCF-1 + subset observed in the adoptive transfer system largely resembles the TCF-1 + memory-like progenitor cells described in chronic infection and other tumor models 7 ⁇ 69 71 ⁇ 73 .
- the cells were then counted and examined for viability using a Luna Dual Florescence Cell Counter (Logos Biosystems). Cell counts were about 1 x 10 6 cells per milliliter and viability was above 98%. Single-cell suspensions were loaded onto the Chromium Controller according to their respective cell counts to generate 6,000 single cell GEMs (gel beads in emulsion) per sample. Each sample was loaded into a separate channel. Libraries were prepared using the Chromium Single Cell 3’ v2 Library and Gel Bead Kit (10x Genomics).
- the cDNA content of each sample after cDNA amplification of 12 cycles was quantified and quality checked using a High-Sensitivity DNA chip with a 2100 Bioanalyzer (Agilent Technologies) to determine the number of PCR amplification cycles to yield sufficient library for sequencing.
- DNA 1000 chip Agilent Technologies
- samples were diluted to 3.5 nM for loading onto the HiSeq 4000 (Illumina) with a 2 x 75 paired-end kit using the following read length: 26 bp Readl, 8 bp i7 Index, and 98 bp Read2. An average of 400,000,000 reads per sample was obtained (-approximately 80,000 reads per cell).
- EXAMPLE 10 Identification of immune regulators and OXPHOS metabolic pathway using genome-scale CRISPR-Cas9 screening
- OT-I T cells were transduced with sgRegnase-1 and Brie lentiviral genome-scale sgRNA library that consists of 78,637 sgRNAs targeting 19,674 genes 77 , and after selection of dual-transduced cells (based on puromycin resistance and Ametrine + cell sorting) and adoptive transfer into tumor-bearing host, isolated OT-I cells for deep sequencing.
- Candidate genes were ranked based on the average enrichment of their sgRNAs (4 sgRNAs per gene) in tumor-infiltrating OT-I cells relative to input (log2 ratio (TIL/input); adjusted P ⁇ 0.05) ( Figure 11A and Table 1).
- oxidative phosphorylation (OXPHOS) hallmark was the top-ranked pathway ( Figure 11B), suggesting a possible role for oxidative metabolism in supporting the excessive accumulation of Regnase-l-null OT-I cells in tumor immunity.
- OXPHOS metabolism has been shown to correlate with improved fitness of effector T cells and their antitumor activity 13,83 ’ 84 .
- OXPHOS was the top ranking one ( Figure 11C). Therefore, mitochondrial profiles and oxidative metabolism were measured.
- Oxygen consumption rates were measured in XF media under basal conditions and in response to 1 mM oligomycin, 1.5 mM fluoro- carbonyl cyanide phenylhydrazone (FCCP) and 500 nM rotenone using an XF96 Extracellular Flux Analyzer (EFA) (Seahorse Bioscience). Regnase-l-null OT-I cells had increased mitochondrial fitness, as indicated by increased mitochondrial mass, membrane potential ( Figure 4B) and volume (Figure 11D). They also had significantly higher basal and maximal OCR) (Figure 4C), indicating enhanced oxidative metabolism.
- OCR Oxygen consumption rates
- Lentivirus was produced by co-transfecting HEK293T cells with lentiviral genome-scale Brie library plasmids with the puromycin resistant gene 77 , psPAX2 and pCAG4-Eco. At 48 h after transfection, virus was harvested and froze at -80 °C. Two hundred million Cas9-expressing OT-I cells were isolated from 12 Cas9-OT-I mice and co-transduced with Brie sgRNA library and sg//eg/i ve- / - Ametri ne.
- IL-2 (20 IU/ml; PeproTech), mouse IL-7 (25 ng/ml; PeproTech) and IL- 15 (12.5 ng/ml; PeproTech) for 2 days.
- Brie sgRNA library -transduced cells were then selected by culture with 4 pg/ml puromycin in the presence of the abovementioned cytokines for another 3 days.
- Ametrine + cells were sorted using a Reflection sorter (i-Cyt) to select for cells co-transduced with sg Renase-1 and Brie library sgRNAs, and an aliquot of 10 c 10 6 transduced OT-I cells was saved as input (-120 c cells coverage per sgRNA).
- the majority of the co-transduced OT-I cells (5 c 10 6 cells per recipient) were then i.v. transferred into mice at day 14 after B 16-Ova melanoma engraftment. Twenty recipients were randomly divided into 2 groups as biological replicates.
- OT-I cells were recovered from the tumor pooled from 10 recipients per sample using a Reflection sorter (i-Cyt). On average, 3 x 10 6 OT-I cells per sample (-40 c cell coverage per sgRNA) were recovered. DNA extraction and sequencing library preparation were as described in Example 1.
- Gene ranking was based on the average enrichment among replicates in representation of 4 individual corresponding sgRNAs in the genome-scale sgRNA Brie library.
- the gene level false discovery rate (FDR) adjusted P-value was calculated among multiple sgRNAs of each gene, using a paired two-tailed /-test between log2 transformed average normalized read counts of tumor samples and those of input sample, and a value of less than 0.05 was considered to be statistically significant.
- Identified candidate genes with log2 ratio (TIL/input) > 1 are presented in Table 1.
- RNA-Seq analysis of Regnase-1-null OT-I cells revealed 2 common candidates, including the transcription factor Batf ( Figure 12A).
- BATF is a pioneer factor that controls chromatin accessibility allowing subsequent binding by other transcription factors, and is important for T cell differentiation and effector function 9 , 75 .
- BATF/Regnase-l-null OT-I cells had reduced effector surface phenotypes ( Figure 12G) and expression of effector molecules, including Iftig, Gzmb and Gzma, compared with Regnase-1 -null cells ( Figures 12H and 121).
- Transcriptome analysis of BATF/Regnase-l-null and Regnase-1 -null OT-I cells were performed next, and GSEA was performed using“Hallmark” gene sets.
- BATF/Regnase- l-null cells had downregulation of OXPHOS and cell cycle-associated hallmarks ( Figures 12 J and 12K), consistent with the role of BATF in mediating Regnase-1 -null effector cell expansion and accumulation.
- Figures 12 J and 12K mitochondrial profiles, including mitochondrial mass and membrane potential, were dampened in BATF/Regnase-l-null OT-I cells, compared with Regnase-1 -null cells.
- the full-length 3' UTR constructs of Batf (MmiT031430- MT06), 112 (MmiT092987-MT06) and 114 (MmiT092992-MT06) mRNAs were purchased from GeneCopoeia, each containing two luciferase genes: firefly luciferase gene for 3' UTR of the targeted gene, and Renilla luciferase gene as an internal control.
- the cDNA of wild-type Regnase-1 (Dharmacon MMM1013-202800061) was cloned into the pMIG-II vector.
- the D141N mutant Regnase-1 was generated by site-directed mutagenesis using the KOD Hot Start DNA Polymerase (Millipore 71086).
- HEK293T cells were transfected with 3' UTR construct of interest together with wild-type or D141N mutant Regnase-1 expression plasmid or empty control plasmid.
- cells were lysed and luciferase activities in the lysates were determined using the Luc-Pair Duo-Luciferase Assay Kit (GeneCopoeia LF002) according to manufacturer’s instructions.
- Example 11 The results from Example 11 suggest that aberrant BATF expression is, at least in part, responsible for the excessive accumulation of Regnase-1 -null OT-I cells.
- BATF co deletion also elevated cell death (active caspase-3 staining) of Regnase-1 -null OT-I cells, although not to the same extent as BATF deletion alone ( Figure 17E).
- BATF/Regnase-l-null OT-I cells still had increased TCF-1 expression compared to wild-type OT-I cells ( Figure 17F), suggesting that the increased TCF-1 expression in Regnase-l-null OT-I cells is not dependent on aberrant BATF expression.
- BATF co deletion blocked the increased IFN-g production in Regnase-l-null OT-I cells ( Figure 17G).
- BATF co-deletion significantly decreased the therapeutic efficacy of Regnase-l-null cells against melanoma ( Figure 17H). Therefore, Regnase-1 targets BATF to impair the accumulation and effector function of CD8 + T cells in tumor immunity, but not TCF-1 expression.
- BATF is an important rheostat in mediating antitumor CD8 + T cell effector responses by serving as a limiting factor in this process.
- wild-type OT-I cells were transduced with BATF and transferred them into tumor-bearing mice (Figure 18B).
- BATF overexpression improved cell accumulation in the spleen ( Figures 18C, 18D) and even more profoundly in the tumor (Figure 4K, Figure 18C).
- BATF-overexpressing OT-I cells in the tumor had increased cell proliferation and modestly reduced active caspase-3 expression (Figure 18E, 18F), and produced more effector molecules, including IFN-g, GzmB and TNF-a but not IL-2 ( Figure 18G).
- TCF-1 expression was reduced in BATF-overexpressing OT-I cells ( Figure 18H).
- BATF is a pioneer factor that controls chromatin accessibility, which allows subsequent binding by other transcription factors 9 ⁇ 75 .
- ATAC-Seq analysis was performed by comparing wild-type, Regnase-l-null, BATF -null, and BATF/Regnase-l-null cells isolated from TILs.
- transcriptome analysis was performed by comparing wild-type, Regnase- l-null, BATF-null, and BATF/Regnase-l-null cells isolated from TILs.
- Principal component analysis (PCA) of global expression profiles revealed that compared with Regnase-l-null cells, BATF/Regnase-l-null OT-I cells showed considerably less variance from wild-type cells ( Figure 4L), suggesting the partial correction of Regnase-1 -null-induced gene expression programs by BATF co-deletion.
- WGCNA 12 weighted gene correlation network analysis 12 was applied and differentially expressed genes were grouped into nine distinct co-expression clusters (Figure 19B).
- WGCNA weighted gene correlation network analysis
- four clusters (clusters 3, 4, 6 and 7) showed upregulated gene expression in the absence of Regnase-1 that was blocked or partially blocked by BATF co-deletion in BATF/Regnase-l-null cells.
- gene expression in cells lacking BATF alone was either largely unaltered (clusters 3 and 6) or reduced (clusters 4 and 7), compared with wild-type controls (Figure 19B).
- cluster 1 gene expression in cluster 1 was downregulated in Regnase-l-null cells but partially rectified by BATF co-deletion (Figure 19B).
- Figure 19B Functional enrichment analysis using gene modules associated with different functional states of CD8 + T cells in tumor immunity 10 , as described above, revealed that these clusters were enriched with genes in the activation and/or dysfunction module ( Figure 19C), thereby reinforcing the abovementioned role of BATF in mediating the effector function of Regnase-l-null OT-I cells.
- clusters 2, 5, 8 and 9 contained gene profiles that were altered in Regnase-l-null cells but not rescued by BATF co-deletion (Figure 19A).
- clusters 5 and 8 were enriched with genes in the naive or memory module ( Figure 19C), which, together with the analysis of TCF-1 expression described above ( Figures 17F, 18H), support the idea that the increased naive/memory -like gene signatures in Regnase-l-null cells are largely independent of BATF.
- the aberrant mitochondrial gene expression in Regnase-1 -null cells is at least partially dependent on BATF.
- these results reveal a Regnase-1 -BATF axis in reprogramming mitochondrial metabolism of CD8 + T cells, and highlight important contributions of increased BATF activity to altered chromatin accessibility and transcript expression of mitochondrial genes in Regnase-1 -null cells.
- PCA plot of the transcriptome profiles revealed largely distinct patterns for Regnase- l-null, PTPN2-null and SOCSl-null OT-I cells, which were further segregated from the combined loss of PTPN2 and Regnase-1 or of SOCS1 and Regnase-1 ( Figure 4T), thereby highlighting differential gene expression programs.
- the CRISPR-Cas9 mutagenesis screening identifies additional potential targets to combine with Regnase-1 deletion for combinatorial cancer immunotherapy.
- “long O” refers to the number of sites in genome that are an exact match to the full-length (“long”) 23nt gRNA target sequence listed in the table, including the target site
- “long_l” refers to the number of sites in genome that contain up to 1 mismatch in the 23nt gRNA target sequence listed in the table, including the target site
- “long_2” refers to the number of sites in genome that contain up to 2 mismatches in the 23nt gRNA target sequence listed in the table, including the target site
- “short_0” refers to the number of sites in genome that match to the 15nt fragment (“short”) at the 3’ end of the gRNA target sequence listed in the table, including the target site.
- sequences for gRNAs 1-5 were designed by CAGE while the sequence for gRNA-6 was selected from portals.broadinstitute.org/gpp/public/analysis-tools/sgma-design.
- human naive CD4 or CD8 T cells were isolated by sorting CCR7 + CD45RA + CD45RO CD4 + T cells or CCR7 + CD45RA + CD45RO CD8 + T cells.
- the isolated CD4 and CD8 T cells were activated by plating on CD3/CD28 coated plates.
- CD 19-CAR transduction using a lentiviral vector was used to introduce CD 19-CAR into the activated CD4 or CD8 T cells.
- RNP ribonucleoprotein
- the RNP was prepared by mixing the gRNA and Cas9 protein following these conditions in PCR tubes: 1.8 pL (100 pmol/pl, 180 pmol) gRNA is mixed with 1 pL (40 pmol/pL, 40 pmol) Cas9 protein, for a total volume of 2.8 pi. After briefly mixing, the RNP was incubated at room temperature for 10 minutes before being placed at 4 °C until ready for use.
- the T cells were resuspended in complete RPMI medium and counted.
- the T cells were centrifuged for 5 min at 1300rpm, aspirated, washed with PBS once, and resuspended at 25M/ml in Lonza electroporation buffer P3 from the Lonza AmaxaTM P3 primary cell 96-well NucleofectorTM Kit (Cat. No. V4SP-3096).
- the T cells were resuspended at a ratio of 20 pi Lonza electroporation buffer P3 per 0.5 million cells.
- the T cells were briefly mixed by pipetting with 2.8 pi RNP mixture. The RNP and cells mixture was transferred to an electroporation cuvette.
- T cells were electroporated per well using a Lonza 4D 96-well electroporation system (Lonza 4D NucleofectorTM Core Unit) with pulse code E0115. Electroporation was completed until green crossing was observed on the samples. Alternate cell concentrations from 200,000 up to 2 million cells per well resulted in lower transformation efficiencies.
- the T cell status was checked and the ability of the T cells to be co-cultured with Raji cells, including killing of the Raji cells, was measured for 24 hrs and 48 hrs.
- the gRNA-6 oligonucleotide led to a knock-out of Regnase- 1 as measured by protein level, while gRNA-1 and gRNA-2 led to a partial knock out of Regenase-1 protein level.
- gRNA-1 targets the N141 site of Regnase-1, which is very important to its RNase function. Based on these results, gRNA-1 and gRNA-6 were selected for further analysis.
- the human Regnase-l-null CAR-T cells were tested to see if they could be multi- activated with bulk T cells.
- the CAR-T cells were stimulated with irradiated Raji cells at a ratio of 2: 1 every 7 days. T cell phenotypes were measured 24 hours after each stimulation.
- Figures 23A-23B show that human Regnase-l-null CAR-T cells had improved survival ex vivo.
- Figure 23A shows improved survival of human CD4 Regnase-l-null CAR-T cells with the two selected guide RNAs gRNAl and gRNA6.
- Figure 23B shows improved survival of human CD8 Regnase-l-null CAR-T cells with the two selected guide RNAs gRNAl and gRNA6.
- the ability of the Regnase-l-null CAR-T cells to generate different types of memory T cells was studied.
- the differentiation status of CD4 and CD8 Regenase-l-null CAR-T cells was determined after each of three rounds of stimulation with irradiated Raji tumor cells.
- the differentiated T cells were sorted based on CCR7 and CD45RO expression into the following four groups: (1) naive (CD45RO CCR7 + ), (2) central memory (CD45RO + CCR7 + ), (3) effector memory (CD45RO + CCR7 ), and (4) effector (CD45RO CCR7 ).
- Figures 25A-25B show that human CD4 Regnase-l-null (Figure 25A) and CD8 Regnase-l-null (Figure 25B) CAR-T cells have more memory subsets upon antigen activation ex vivo in comparison to control wildtype CD4 and CD8 CAR-T cells.
- FIGS. 27A-27D show that human CD4 Regnase-l- null CAR-T cells secrete more cytokines ex vivo, specifically IL-2 (Figure 27A), TNFa (Figure 27B), IFN-gamma (Figure 27C), and GrzB (Figure 27D).
- FIGS 31A-31B show that mice treated with Regnase- l-null CD8 CAR-T cells in vivo had lower tumor burden as indicated by the luciferase activity of each treatment group ( Figure 31A) and individual recipient ( Figure 31B).
- the transcription factor BATF operates as an essential
- Matsushita, K. et al. Zc3hl2a is an RNase essential for controlling immune responses by regulating mRNA decay. Nature 458, 1185-1190, doi: 10.1038/nature07924 (2009).
- RNA interference screens identify regulators of antiviral CD4(+) and CD8(+) T cell differentiation. Immunity 41, 325-338,
- T. Bcl6 acts as an amplifier for the generation and proliferative capacity of central memory CD8+ T cells. J Immunol 173, 883-891 (2004).
- Zeng, H. et al. mTORCl couples immune signals and metabolic programming to establish T(reg)-cell function. Nature 499, 485-490, doi: 10.1038/nature 12297 (2013). He, R. et al. Follicular CXCR5- expressing CD8(+) T cells curtail chronic viral infection. Nature 537, 412-428, doi: 10.1038/naturel9317 (2016).
- Ciofani M. et al. A validated regulatory network for Thl7 cell specification. Cell 151, 289-303, doi: 10.1016/j.cell.2012.09.016 (2012).
- SEQ ID NO: 10 non-targeting control sgRNA nucleic acid sequence
- SEP ID NO: 29 - gRNA-1, N is A, T, C, or G
- SEP ID NO: 30 - gRNA-2, N is A, T, C, or G
- SEP ID NO: 31 - g-RNA-3, N is A, T, C, or G
- SEP ID NO: 32 - gRNA-4, N is A, T, C, or G
- SEP ID NO: 33 - gRNA-5, N is A, T, C, or G
- SEP ID NO: 35 - control gRNA, N is A, T, C, or G
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Biotechnology (AREA)
- Medicinal Chemistry (AREA)
- General Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Cell Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Physics & Mathematics (AREA)
- Pharmacology & Pharmacy (AREA)
- Plant Pathology (AREA)
- Hematology (AREA)
- Virology (AREA)
- Urology & Nephrology (AREA)
- Mycology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Tropical Medicine & Parasitology (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
Abstract
The present application provides methods of enhancing T cell function (e.g., expansion, persistence and/or effector functions), particularly by genetic modification of the Regnase-1, Batf, and additional genes (alone or in combination). The application also provides modified T cells manufactured using the methods provided by this invention and related pharmaceutical compositions. The application further provides methods of using the modified T cells for treating a disease (e.g., a cancer or an infectious disease).
Description
GENE KNOCK-OUTS TO IMPROVE T CELL FUNCTION
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional Application Nos. 62/838,060, filed April 24, 2019, and 62/912,231, filed October 8, 2019, both of which are herein incorporated by reference in their entirety.
FIELD
[0002] The application relates to methods of enhancing T cell function, particularly by genetic modification of the Regnase-1, Batf, and additional genes (alone or in combination). The application further relates to the modified T cells and related pharmaceutical compositions. The application further relates to the therapeutic use of the modified T cells for treating diseases.
BACKGROUND
[0003] Adoptive cell therapy (ACT) using engineered T cells has produced unprecedented results in the clinic and represents a new paradigm in cancer immunotherapy. However, the therapeutic efficacy, especially in solid tumors, is often limited by poor in vivo expansion, persistence and function of adoptively transferred T cells1·2. Furthermore, T cell fate decisions in the tumor microenvironment (TME) and the underlying processes remain elusive.
[0004] CD8+ T cells play a pivotal role in the control of cancer. The efficacy of ACT, including the use of T cells engineered to express chimeric antigen receptors (CARs), depends upon T cell longevity and their differentiation state1·2. Paradoxically, fully differentiated effector CD8+ T cells have been shown to have reduced antitumor efficacy and exhibit poor in vivo persistence2·3, while the long-term persistence of 7e/2-mutated T cells, despite the impaired effector function, is associated with tumor remission in a clinical case4. Another major challenge of ACT against solid tumors is that antitumor T cell responses can be blunted in the highly immunosuppressive TME1·2·5, as evidenced by the poor accumulation of adoptively transferred T cells and limited therapeutic efficacy in human solid tumors and mouse ACT models.
[0005] As such, there is a need in the art for strategies to enhance T cell function, in particular T cell expansion, persistence and/or effector function, to allow for improved ACT efficacy in cancer immunotherapy6. The present invention addresses this and other related needs.
SUMMARY OF THE INVENTION
[0006] In one aspect provided herein is a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell, comprising modifying a Regnase-
1 (REGNASE-1, Zc3h12a, MCPIPl ) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated.
[0007] In some embodiments, the T cell is selected from a CD8+ ab T cell receptor (TCR) T cell, a CD4+ ab TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a gd T cell. In some embodiments, the T cell is a CD8+ ab TCR T cell. In some embodiments, the T cell is a CD4+ ab TCR T cell.
[0008] In some embodiments, the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR). In some embodiments, the CAR targets a tumor antigen or an infectious antigen.
[0009] In some embodiments, the modifying step comprises disrupting the Regnase-1 gene with a site-specific nuclease. In some embodiments, the site-specific nuclease comprises a Cas protein and a guide RNA. In some embodiments, the Cas protein is a Cas9 protein. In some embodiments, the guide RNA is a single guide RNA (sgRNA). In some embodiments, the sgRNA targets Regnase-1. In some embodiments, the sgRNA comprises TTCACACCATCACGACGCGTNGG (SEQ ID NO: 29),
CAGCTCCCTCTAGTCCCGCGNGG (SEQ ID NO: 34), TTCACACCATCACGACGCGT (SEQ ID NO: 36) or CAGCTCCCTCTAGTCCCGCG (SEQ ID NO: 41), or a nucleotide sequence having at least 80% identity thereof. In some embodiments, the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
[0010] In some embodiments, the modifying step comprises silencing a Regnase-1 mRNA with an RNA interference (RNAi) molecule or an antisense oligonucleotide. In some embodiments, the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
[0011] In some embodiments, the modifying step comprises inhibiting a Regnase-1 protein with one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
[0012] In some embodiments, in vivo accumulation of the T cell is improved more than 100- fold as compared an unmodified T cell at day 7 after the Regnase-1 modification.
[0013] In some embodiments, the method further comprises modifying one or more additional genes or gene products alone or in combination with Regnase-1 in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
[0014] In some embodiments, modifying of one or more additional genes comprises
disrupting the gene(s) with a site-specific nuclease. In some embodiments, the site-specific nuclease comprises a Cas protein and a guide RNA. In some embodiments, the Cas protein is a Cas9 protein. In some embodiments, the guide RNA is a single guide RNA (sgRNA). In some embodiments, the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
[0015] In some embodiments, modifying of one or more additional gene products comprises administering an RNA interference (RNAi) molecule or an antisense oligonucleotide. In some embodiments, the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
[0016] In some embodiments, modifying of one or more additional gene products comprises administering one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
[0017] In another aspect provided herein is a modified T cell produced by any of the methods described above. In some embodiments, the T cell is a CD8+ T cell. In some embodiments, the T cell is derived from a blood, marrow, tissue, or tumor sample. In some embodiments, the T cell is an allogeneic T cell. In some embodiments, the T cell is an autologous T cell. In some embodiments, the T cell has been activated and/or expanded ex vivo.
[0018] In another aspect provided herein is a pharmaceutical composition comprising the modified T cell described above and a pharmaceutically acceptable carrier and/or excipient.
[0019] In another aspect provided herein is a method of treating a disease in a subj ect in need thereof comprising administering to the subject an effective amount of the modified T cells or the pharmaceutical composition described above. In some embodiments, the modified T cells are autologous cells. In some embodiments, the modified T cells are allogeneic cells. In some embodiments, the disease is a cancer or an infectious disease. In some embodiments, the cancer is a solid tumor. In some embodiments, the cancer is melanoma, colon cancer, breast cancer, or brain cancer. In some embodiments, the cancer is a blood cancer. In some embodiments, the cancer is a lymphoma, leukemia, or multiple myeloma.
[0020] In some embodiments, the method comprises: a) isolating a T cell from the subject or a donor; b) modifying a Regnase-1 gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated; c) optionally, activating and/or expanding the T cell before or after step b); and d) administering an effective amount of the modified T cells to the subject.
[0021] In various embodiments, the subject is a human.
[0022] In another aspect provided herein is a method of enhancing expansion and/or
persistence and/or an anti -tumor or an anti-infection function of aT cell, comprising increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
[0023] In some embodiments, the T cell is selected from a CD8+ ab T cell receptor (TCR) T cell, a CD4+ ab TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a gd T cell. In some embodiments, the T cell is a CD8+ ab TCR T cell. In some embodiments, the T cell is a CD4+ ab TCR T cell.
[0024] In some embodiments, the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR). In some embodiments, the CAR targets a tumor antigen or an infectious antigen.
[0025] In some embodiments, the method comprises introducing into the T cell a polynucleotide encoding a BATF protein, or functional fragment or derivative thereof.
[0026] In some embodiments, the polynucleotide encoding a BATF protein comprises the nucleotide sequence of SEQ ID NO: 27, or a nucleotide sequence having at least 80% identity therof. In some embodiments, the BATF protein encoded by the polynucleotide comprises the amino acid sequence of SEQ ID NO: 25, or an amino acid sequence having at least 80% identity therof.
[0027] In some embodiments, the polynucleotide encoding a BATF protein, or functional fragment or derivative thereof, is introduced into the T cell in a recombinant vector. In some embodiments, the recombinant vector is a viral vector. In some embodiments, the viral vector is a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated virus vector, an alphaviral vector, a herpes virus vector, or a vaccinia virus vector. In some embodiments, the viral vector is a retroviral vector. In some embodiments, the recombinant vector is a non- viral RNA and/or DNA vector.
[0028] In some embodiments, the method further comprises modifying one or more additional genes or gene products, alone or in combination, in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl), Ptpn2, Socsl, Agps, Pc3hl, and Rcorl. In some embodiments, the additional gene(s) or gene product(s) is Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl).
[0029] In some embodiments, modifying of one or more additional genes comprises disrupting the gene(s) with a site-specific nuclease. In some embodiments, the site-specific nuclease comprises a Cas protein and a guide RNA. In some embodiments, the Cas protein is a Cas9 protein. In some embodiments, the guide RNA is a single guide RNA (sgRNA). In some
embodiments, the sgRNA comprises TTCACACCATCACGACGCGTNGG (SEQ ID NO: 29), CAGCTCCCTCTAGTCCCGCGNGG (SEQ ID NO: 34),
TTCACACCATCACGACGCGT (SEQ ID NO: 36) or CAGCTCCCTCTAGTCCCGCG (SEQ ID NO: 41), or a nucleotide sequence having at least 80% identity thereof. In some embodiments, the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
[0030] In some embodiments, modifying of one or more additional gene products comprises administering an RNA interference (RNAi) molecule or an antisense oligonucleotide. In some embodiments, the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
[0031] In some embodiments, modifying of one or more additional gene products comprises administering one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
[0032] In another aspect provided herein is a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell, comprising modifying a Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell. In some embodiments, the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
[0033] In various embodiments, the site-specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, small molecule inhibitor, antibody or antibody fragment, or aptamer is introduced into the T cell via a physical means. In some embodiments, the physical means is electroporation, microinjection, magnetofection, ultrasound, a ballistic or hydrodynamic method, or a combination thereof. In some embodiments, the physical means is electroporation.
[0034] In various embodiments, the site-specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, antibody or antibody fragment, or aptamer is introduced into the T cell in a recombinant vector. In some embodiments, the recombinant vector is a viral vector. In some embodiments, the viral vector is a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated virus vector, an alphaviral vector, a herpes virus vector, or a vaccinia virus vector. In some embodiments, the recombinant vector is a non-viral RNA and/or DNA vector.
[0035] In another aspect provided herein is a modified T cell produced by any of the method described above that involves increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell. In some embodiments, the T cell is a CD8+ T cell. In some embodiments, the T cell is derived from a blood, marrow, tissue, or tumor sample. In some embodiments, the T cell is an allogeneic T cell. In some embodiments, the T cell is an autologous T cell. In some embodiments, the T cell has been activated and/or expanded ex vivo.
[0036] In another aspect provided herein is a pharmaceutical composition comprising the modified T cell described above and a pharmaceutically acceptable carrier and/or excipient.
[0037] In another aspect provided herein is a method of treating a disease in a subj ect in need thereof comprising administering to the subject an effective amount of the modified T cells described above or the pharmaceutical composition described above. In some embodiments, the modified T cells are autologous cells. In some embodiments, the modified T cells are allogeneic cells. In some embodiments, the disease is a cancer or an infectious disease. In some embodiments, the cancer is a solid tumor. In some embodiments, the cancer is melanoma, colon cancer, breast cancer, or brain cancer. In some embodiments, the cancer is a blood cancer. In some embodiments, the cancer is a lymphoma, leukemia, or multiple myeloma.
[0038] In some embodiments, the method comprises a) isolating a T cell from the subject or a donor; b) increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell; c) optionally, activating and/or expanding the T cell before or after step b); and d) administering an effective amount of the modified T cells to the subject.
[0039] In various embodiments of the methods described above, the subject is a human.
[0040] In another aspect provided herein is a method of improving mitochondrial biogenesis and/or function in a T cell comprising modifying a Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and/or increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell. In some embodiments, the method further comprises modifying one or more additional genes or gene products alone or together with Regnase-1 in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
[0041] In another aspect provided herein is an isolated polynucleotide, comprising the nucleotide sequence of any one of SEQ ID NOs: 1-9, 29-34 and 36-42, or a nucleotide sequence having at least 80% identity thereof. In some embodiments, the isolated polynucleotide comprises the nucleotide sequence of SEQ ID NO: 1 or 2. In some embodiments, the isolated
polynucleotide comprises the nucleotide sequence of SEQ ID NO: 29, 34, 36 or 41. In some embodiments, the polynucleotide is a guide RNA. In some embodiments, the guide RNA is a single guide RNA (sgRNA).
[0042] In another aspect provided herein is a method of modifying a gene in a cell, comprising introducing into the cell a site-specific nuclease. In some embodiments, the cell is a T cell. In some embodiments, the T cell is selected from a CD8+ ab T cell receptor (TCR) T cell, a CD4+ ab TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a gd T cell. In some embodiments, the T cell is a CD8+ ab TCR T cell. In some embodiments, the T cell is a CD4+ ab TCR T cell. In some embodiments, the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR). In some embodiments, the cell is a human cell.
[0043] In some embodiments of the method of modifying a gene in a cell, the site-specific nuclease comprises a Cas protein and one or more guide RNAs. In some embodiments, the Cas protein is a Cas9 protein. In some embodiments, the one or more guide RNAs are one or more single guide RNAs (sgRNAs). In some embodiments, at least one sgRNA targets Regnase-1. In some embodiments, the sgRNA comprises TTCACACCATCACGACGCGTNGG (SEQ ID NO: 29), CAGCTCCCTCTAGTCCCGCGNGG (SEQ ID NO: 34),
TTCACACCATCACGACGCGT (SEQ ID NO: 36) or CAGCTCCCTCTAGTCCCGCG (SEQ ID NO: 41), or a nucleotide sequence having at least 80% identity thereof. In some embodiments, the Cas protein and the guide RNA are mixed to form a ribonucleoprotein (RNP) complex.
[0044] In some embodiments of the method of modifying a gene in a cell, the site-specific nuclease is introduced into the cell via a physical means. In some embodiments, the physical means is electroporation, microinjection, magnetofection, ultrasound, a ballistic or hydrodynamic method, or a combination thereof. In some embodiments, the physical means is electroporation.
[0045] In another aspect provided herein is a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell, comprising modifying one or more genes or gene products thereof in the T cell such that the expression and/or function of gene or gene product in the T cell is reduced or eliminated, wherein the one or more genes are selected from Ptpn2, Socsl, Agps, Rc3hl ( Roquin-1 ) and Rear I .
[0046] In some embodiments, the T cell is selected from a CD8+ ab T cell receptor (TCR) T cell, a CD4+ ab TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a gd T cell. In some embodiments, the T cell is a CD8+ ab TCR T cell. In some embodiments, the T cell is
a CD4+ ab TCR T cell.
[0047] In some embodiments, the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR). In some embodiments, the CAR targets a tumor antigen or an infectious antigen.
[0048] In some embodiments, the modifying step comprises disrupting said one or more genes with a site-specific nuclease. In some embodiments, the site-specific nuclease comprises a Cas protein and a guide RNA. In some embodiments, the Cas protein is a Cas9 protein. In some embodiments, the guide RNA is a single guide RNA (sgRNA). In some embodiments, the sgRNA targets said one or more genes. In some embodiments, the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
[0049] In some embodiments, the modifying step comprises silencing an mRNA produced from said one or more genes with an RNA interference (RNAi) molecule or an antisense oligonucleotide. In some embodiments, the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
[0050] In some embodiments, the modifying step comprises inhibiting a protein produced from said one or more genes with one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
[0051] In some embodiments, the site-specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, small molecule inhibitor, antibody or antibody fragment, or aptamer is introduced into the T cell via a physical means. In some embodiments, the physical means is electroporation, microinjection, magnetofection, ultrasound, a ballistic or hydrodynamic method, or a combination thereof. In some embodiments, the physical means is electroporation.
[0052] In various embodiments, the site-specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, antibody or antibody fragment, or aptamer is introduced into the T cell in a recombinant vector. In some embodiments, the recombinant vector is a viral vector. In some embodiments, the viral vector is a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated virus vector, an alphaviral vector, a herpes virus vector, or a vaccinia virus vector. In some embodiments, the recombinant vector is a non-viral RNA and/or DNA vector.
[0053] In another aspect, provided herein is a modified T cell produced by the method described above that involves modifying one or more genes selected from one or more genes are selected from Ptpn2, Socsl, Agps, Rc3hl ( Roquin-1 ) and Rcorl, or gene products threof. In some embodiments, the T cell is a CD8+ T cell. In some embodiments, the T cell is derived from a blood, marrow, tissue, or tumor sample. In some embodiments, the T cell is an
allogeneic T cell. In some embodiments, the T cell is an autologous T cell. In some embodiments, the T cell has been activated and/or expanded ex vivo.
[0054] In another aspect, provided herein is a pharmaceutical composition comprising the modified T cell described above and a pharmaceutically acceptable carrier and/or excipient.
[0055] In another aspect, provided herein is a method of treating a disease in a subject in need thereof comprising administering to the subject an effective amount of the modified T cells described above or the pharmaceutical composition described above. In some embodiments, the modified T cells are autologous cells. In some embodiments, the modified T cells are allogeneic cells. In some embodiments, the disease is a cancer or an infectious disease. In some embodiments, the cancer is a solid tumor. In some embodiments, the cancer is melanoma, colon cancer, breast cancer, or brain cancer. In some embodiments, the cancer is a blood cancer. In some embodiments, the cancer is a lymphoma, leukemia, or multiple myeloma.
[0056] In some embodiments, the method comprises:
a) isolating a T cell from the subject or a donor;
b) modifying one or more genes or gene products thereof in the T cell such that the expression and/or function of the gene or gene product in the T cell is reduced or eliminated, wheren the one or more genes are selected from Ptpn2, Socs 1 , Agps , Rc3hl ( Roquin-1 ) and Rcor I
c) optionally, activating and/or expanding the T cell before or after step b); and d) administering an effective amount of the modified T cells to the subject.
[0057] In various embodiments of the methods described above, the subject is a human.
[0058] These and other aspects of the present invention will be apparent to those of ordinary skill in the art in the following description, claims and drawings.
BRIEF DESCRIPTION OF THE DRAWINGS
[0059] U.S. Provisional Application Nos. 62/838,060 and 62/912,231 contain copies of several of the drawing(s) below in color, which can be provided by the United States Patent and Trademark Office upon request and payment of the necessary fee.
[0060] Figures 1A-1G illustrate the identification of Regnase-1 as a major negative regulator of CD8+ T cell antitumor responses using in vivo CRISPR-Cas9 mutagenesis screening. (Figure 1A) Diagram of the screening system. Naive Cas9-expressing OT-I cells were transduced with lentiviral sgRNA metabolic library and expanded in vitro before adoptive transfer into B 16-Ova melanoma-bearing mice. OT-I cells were purified from tumor- infiltrating lymphocytes (TILs) at 7 days after transfer, and library representation in TILs and
pre-transfer (input) OT-I cells was examined by deep sequencing of sgRNA cassette. (Figure IB) Scatterplot of the enrichment of each gene versus its adjusted P values. Gene enrichment was calculated by averaging the enrichment of their 6 sgRNAs in tumor-infiltrating OT-I cells relative to input (log2 ratio (TIL/input)), with the most extensively enriched (black solid circle) and selective depleted (stripe-filled circle) genes (adjustedP < 0.05), as well as‘dummy’ genes (empty circle; generated by random combinations of 6 out of 1,000 non-targeting control sgRNAs per‘dummy’ gene) highlighted. (Figure 1C) Diagram of in vivo dual transfer system. OT-I cells transduced with sgRNA viral vectors expressing distinct fluorescent proteins were mixed and transferred into the same tumor-bearing hosts where further analyses were performed. (Figure ID) Representative images (left) and quantification of relative OT-I cell number per area (pm2) normalized to input (right) in the whole tumor section (n = 4 mice). OT- I cells transduced with non-targeting control sgRNA- (referred to as “control sgRNA” hereafter) (mCherry+; red) and sg Regnase-1 (Ametrine+; green) were mixed at a 10: 1 ratio and transferred into tumor-bearing mice, followed by imaging analysis of tumors at day 7. Scale bars, 500 pm. (Figure IE) Immunoblot analysis of Regnase-1 expression in control sgRNA- and sg/ri¾v¥.ve-/-transduced OT-I cells isolated from TILs at 7 days after adoptive transfer. (Figure 1F-1G) OT-I cells transduced with control sgRNA- (mCherry+) and sg Regnase-1 (Ametrine+) were mixed at a 10: 1 ratio (to obtain sufficient numbers of control sgRNA- transduced cells at later stages for analysis) and transferred into tumor-bearing mice, followed by analyses of the proportion of donor-derived OT-I cells in total CD8a+ cells (Figure IF), and quantification of relative OT-I cell percentage in CD8a+ cells normalized to input (Figure 1G, left) and normalized OT-I cell number relative to input (Figure 1G, right) in the spleen and tumor at days 7, 14 and 21 after transfer (n = 10 mice at days 7 and 14, n = 6 mice at day 21). Cell number in the tumor is shown as cell number per gram tissue. Numbers in plots indicate frequencies of OT-I cells in gates (Figure IF). Numbers above bar graphs indicate fold change of sg Regnase-1- versus control sgRNA-transduced OT-I cells (Figure 1G). Mean ± s.e.m. in Figures ID and 1G. *P < 0.05; **P < 0.01; ***P < 0.001; two-tailed unpaired Student’s /-test in Figures ID and 1G. Data are representative of one (Figure IB) or two (Figures 1D-1F) independent experiments, or pooled from two (Figure 1G) independent experiments.
[0061] Figures 2A-2F show the enhanced therapeutic efficacy of Regnase-1 -deficient engineered CD8+ T cells against solid and blood cancers. (Figures 2A-2B) OT-I cells (5 c 106) transduced with control sgRNA (Ametrine+) (n = 7 recipients) or sg Regnase-1 (Ametrine+) n = 8 recipients) were transferred into mice at day 12 after B 16-Ova melanoma engraftment,
followed by analyses of tumor size (Figure 2A) and mouse survival (Figure 2B). Non treatment control group mice received no T cell transfer (n = 5 recipients). (Figures 2C-2D) Pmel-1 cells (5 c 106) transduced with control sgRNA (Ametrine+) (n = 5 recipients) or sg Regnase-1 (Ametrine+) (n = 5 recipients) were transferred into mice at day 12 after B16-F 10 melanoma engraftment, followed by analyses of tumor size (Figure 2C) and mouse survival (Figure 2D). Non-treatment control group mice received no T cell transfer (n = 5 recipients). (Figures 2E-2F) CD8+ CAR-T cells (5 c 106) transduced with control sgRNA (Ametrine+) (n = 5 recipients) or sg Regnase-1 (Ametrine+) (n = 5 recipients) were transferred into mice at day 7 after Ph+ B-ALL cell engraftment, followed by analyses of mouse survival (Figure 2E) and tumor burden via Xenogen imaging of bioluminescent signal intensities (Figure 2F). Non treatment control group mice received no T cell transfer (n = 5 recipients). NS, not significant; *P < 0.05; **P < 0.01; ***P < 0.001; two-way ANOVA in Figures 2A, 2C, and Log-rank (Mantel-Cox) test in Figures 2B, 2D, and 2E. Data are representative of two (Figures 2A, AB, 2E, 2F) or four (Figures 2C, 2D) independent experiments.
[0062] Figures 3A-3M demonstrate that deletion of Regnase-1 reprograms tumor- infiltrating effector CD8+ T cells to acquire better persistence capacity while retaining robust effector function. (Figure 3A) GSEA enrichment plots of sg Regnase-1- transduced OT-I cells isolated from TILs, using gene sets of antigen-specific CXCR5+ and CXCR5 exhausted CD8+ T cells from chronic infection and hematopoietic stem cells. (Figure 3B) Control sgRNA- (mCherry+) and sgRegnas e- / - 1 ran s d uced OT-I cells (Ametrine+) were mixed and transferred into tumor-bearing mice (n = 5 mice), and tumor-infiltrating OT-I T cells were analyzed at day 7 for expression of CD27, CD43 activation-associated glycoform (CD43a) (left), and quantification of mean fluorescence intensity (MFI; numbers above graphs) of CD27 and CD43a (right). (Figures 3C-3D) OT-I cells transduced with control sgRNA (mCherry+) and sg Regnase-1 (Ametrine+) were mixed and transferred into tumor-bearing mice (n = 5 mice), and tumor-infiltrating OT-I T cells were analyzed at day 14 for BrdU incorporation (Figure 3C, left; pulse for 18 h) and active caspase-3 expression (Figure 3D, left), and quantification of frequencies of BrdU+ (Figure 3C, right) and active caspase-3+ cells (Figure 3D, right). Numbers in graphs indicate frequencies of cells in gates. (Figures 3E-3G) T cell in vivo persistence assays. Diagram of in vivo persistence assay (Figure 3E): OT-I cells transduced with control sgRNA (GFP+) (1 c 105) and sg Regnase-1 (Ametrine+) (1 x 105) were isolated from TILs at 7 days after adoptive transfer, and then mixed at a 1: 1 ratio (1 c 105 each cell population) and transferred into tumor-bearing hosts (Figure 3F) or naive mice (Figure 3G). Flow cytometry analysis of OT-I cells in the TILs of CD8a+ cells in tumor-bearing hosts at
days 3 (n = 6 mice) and 7 (n = 6 mice) after adoptive transfer (Figure 3F, upper) or in the spleen of naive hosts at days 7 (n = 6 mice) and 14 (n = 6 mice) after adoptive transfer (Figure 3G, upper), and quantification of normalized OT-I cell frequency in the TILs of tumor-bearing hosts (Figure 3G, lower) or in the spleen of naive host (Figure 3G, lower). Numbers in graphs indicate frequencies of cells in gates. (Figures 3H-3J) Control sgRNA- (mCherry+) and sg//eq/i ve- /-transduced OT-I cells (Ametrine+) were mixed at 5: 1 ratio and transferred into tumor-bearing mice, followed by analyses at days 7 (n = 10 mice) or 14 ( n = 10 mice). Flow cytometry analysis of expression of IFN-g (Figure 3H, upper) and GzmB (Figure 3H, lower) in TIL OT-I cells, and quantification of frequency of IFN-y+ cells and GzmB+ cells (Figure 31) in TILs, and MFI of IFN-g in IFN-g1 cells and MFI of GzmB in GzmB+ cells (Figure 3J) in TILs. Numbers adjacent to outlined areas indicate frequency of IFN-g1 cells and MFI of IFN- g in IFN-g1 cells (Figure 3H, upper), and frequency of GzmB+ cells and MFI of GzmB in GzmB+ cells (Figure 3H, lower). (Figure 3K) OT-I cells transduced with control sgRNA (mCherry+) and sg Regnase-1 (Ametrine+) were mixed and transferred into tumor-bearing mice (n = 5 mice), and tumor-infiltrating OT-I cells were analyzed at day 7 for expression of TCF- 1 (left), and quantification of frequency of TCF-1+ cells (right). Numbers in graphs indicate frequencies of cells in gates. (Figures 3L, 3M) scRNA-Seq analysis of control sgRNA- and sg//eq/i ve- /-transduced OT-I cells isolated from TILs. Specifically, control sgRNA- and sg//eq/i ve- /-transduced OT-I cells were mixed and transferred into tumor-bearing mice, and tumor-infiltrating OT-I cells were isolated at day 7 for transcriptional profiling by scRNA-Seq. tSNE visualization of control sgRNA- and sg//eq/i ve- /-transduced cells indicating genotypes (Figure 3L, left), Tcf7u and Tcf7l° cells (Figure 3L, right; numbers in parentheses indicate cell numbers of each subset), and Tcf7 (Figure 3M, left) and Slamf6 (Figure 3M, right) gene expression in individual cells. I'cf7l" cells were defined with the highest third quantile of Tcf7 expression (with log2 gene expression intensity = 2.910317 as threshold) among all cells. Mean ± s.e.m. in Figures 3B-3D, 3F, 3G, 31, 3J, and 3K. *P < 0.05; **P < 0.01; ***P < 0.001; two- tailed unpaired Student’s /-test in Figures 3B-3D, 3F, 3G and 3K; two-tailed paired Student’s /-test in Figures 31 and 3J. Data are representative of one (Figures 3A, 3L, and 3M) or two (Figures 3B and 3H) or three (Figure 3K) independent experiments, or pooled from two (Figures 3C, 3D, 3F, 3G, 31, and 3J) independent experiments.
[0063] Figures 4A-4U illustrate the identification of BATF as a key Regnase-1 functional target as well as PTPN2 and SOCS1 as additional modifiers using genome-scale CRISPR-Cas9 screening. (Figure 4A) Diagram of genome-scale screening system. Naive Cas9-expressing OT-I cells were co-transduced with lentiviral sg Regnase-1 and genome-scale sgRNA library
and expanded in vitro before transfer into tumor-bearing mice. OT-I cells were purified from TILs at 7 days after adoptive transfer, and library representation in TILs and pre-transfer (input) OT-I cells was examined by deep sequencing of sgRNA cassette. (Figure 4B) OT-I cells transduced with control sgRNA (mCherry+) and sg Regnase-1 (Ametrine+) were mixed and transferred into tumor-bearing mice (n = 6 mice), and tumor-infiltrating OT-I cells were analyzed at day 7 for TMRM and Mitotracker staining (Figure 4B, upper), and quantification of MFI of TMRM and Mitotracker (Figure 4B, lower). Numbers in graphs indicate MFI of TMRM and Mitotracker (Figure 4B, upper). (Figure 4C) Oxygen consumption rate (OCR) bioenergetics profiling of control sgRNA- and sg/ri¾v¥.ve- / -transduced OT-I cells cultured in vitro for basal (left) and maximal OCR (right). (Figure 4D) OT-I cells transduced with control sgRNA (mChenyA) and sg Regnase-1 (Ametrine+) were mixed and transferred into tumor bearing mice (n = 6 mice), and tumor-infiltrating OT-I cells were analyzed at day 7 for BATF (left) expression, and quantification of BATF MFI (right). Numbers in graphs indicate MFI of BATF. (Figure 4E) Summary of ATAC-Seq motif enrichment data showing log2 (odds ratio) and logio (FDR) of cells from control- (n = 4 samples) and sgRegnase-1 -transduced OT-I cells (n = 4 samples) isolated from TILs at 7 days after adoptive transfer. (Figure 4F) Luciferase activity of HEK293T cells measured at 48 h after transfection with Batf mRNA 3' UTR luciferase reporter, together with control (mock), wild-type or D141N Regnase-1 -expressing plasmid (n= 3 samples each group). (Figure 4G-4I) In vivo accumulation of double sgRNA- transduced OT-I cells in tumor-bearing mice. Specifically, OT-I cells transduced with sg Regnase-1 (mCherry+) were mixed at 1: 1 ratio with cells transduced with control sgRNA (Ametrine+; upper), sg Regnase-1 (Ametrine+; middle) or sg Regnase-1 and sg Batf (Ametrine+ and GFP+ respectively; lower), and transferred into tumor-bearing hosts (n = 5 mice each group) (Figure 4G). Similar transfer system was used in (Figure 4H) (n = 5 mice each group) and (Figure 41) (n = 5 mice each group), except that sg Ptpn2 and sg Socsl, respectively, were used in lieu of sg Batf (A second sgRNA, targeting Batf, Ptpn2 or Socsl, was examined in Figures 12D and 13A). Mice were analyzed at 7 days after adoptive transfer for proportion of OT-I cells in CD8a+ cells (Figures 4G-4I, left), and quantification of relative OT-I cell percentage in CD8a+ cells normalized to input in the spleen (Figures 4G-4I, upper right) and TILs (Figures 4G-4I, lower right). Numbers in plots indicate frequencies of OT-I cells (Figures 4G-4I, left). (Figure 4J) In vivo accumulation of double sgRNA-transduced OT-I cells in tumor-bearing mice. Specifically, OT-I cells transduced with control sgRNA (mCherry+; spike) were mixed at a 1 :1 ratio with cells transduced with control sgRNA (Ametrine+), sg Regnase-1 (Ametrine+), sg Batf (GFP+) or sg Batf! Regnase-1 (GFP+ and
Ametrine+), and transferred into tumor-bearing hosts individually (n = 6 mice each group). Mice were analyzed at 7 days after adoptive transfer for quantification of relative OT-I cell percentage in CD8a+ cells normalized to spike in the spleen (left) and TILs (right). (Figure 4K) In vivo accumulation of BATF-overexpressing OT-I cells in tumor-bearing mice. Specifically, OT-I cells transduced with control retrovirus (mCherry+) were mixed at a 1 : 1 ratio with cells transduced with 7>«//-overe\pressing retrovirus (GFP+), and transferred into tumor bearing hosts (n = 6 mice each group). Mice were analyzed at days 7 and 14 after adoptive transfer for quantification of relative OT-I cell percentage in CD8a+ cells normalized to input in TILs. (Figure 4L) Principal component analysis (PCA) of transcriptomes. OT-I cells transduced with control sgRNA (mCherry+) (n = 7 samples), sg Regnase-1 (Ametrine+) (n = 4 samples), sg Batf (GFP+) (n = 3 samples) or sgBatf/Regnase-1 (GFP+ and Ametrine+) (n = 4 samples), and transferred into tumor-bearing hosts individually. OT-I cells were isolated from TILs at day 7 for transcriptional profiling by microarray. (Figure 4M) The same transfer system as in (Figure 4J) was used (n = 6 mice each group). Tumor-infiltrating OT-I cells were analyzed at day 7 for quantification of relative MFI of TMRM (left) and Mitotracker (right) normalized to spike. (Figure 4N) The same transfer system as in (Figure 4K) was used (n = 8 mice each group). Tumor-infiltrating OT-I cells were analyzed at day 7 for quantification of MFI of TMRM (left) and Mitotracker (right). (Figures 40-4S) OT-I cells transduced with control sgRNA (mCherry+; spike) were mixed at a 1: 1 ratio with cells transduced with control
), sgPtpn2i Regnase-1 (GFP+
d Ametrine+), and transferred into tumor-bearing hosts individually (n = 6 mice each group). Tumor-infiltrating OT-I cells were analyzed at day 7 for quantification of relative OT-I cell percentage in CD8a+ cells normalized to spike (Figure 40), quantification of relative MFI of TMRM (Figure 4P), Mitotracker (Figure 4Q) and BATF (Figure 4R) normalized to spike, and quantification of relative frequency of TCF-1+ cells normalized to spike (Figure 4S). (Figure 4T) Principal component analysis (PCA) of transcriptomes to compare Rengase-l-null, PTPN2-null and SOCS 1-null cells. OT-I cells transduced with control sgRNA (Ametrine+), sg Regnase-1 (Ametrine+), sg Ptpn2 (GFP+), sgPtpn2/Regnase-l (GFP+ and Ametrine+), sg Socsl (GFP+) or sg Socsl! Regnase-1 (GFP+ and Ametrine+) (n = 4 samples each group) were transferred into tumor-bearing hosts individually. OT-I cells were isolated from TILs at day 7 for transcriptional profiling by microarray. (Figure 4U) 4 c 106 pmel-1 cells transduced with control sg Regnase-1 (Ametrine+), sgPtpn2/Regnase-l (GFP+ and Ametrine+), or sg Socsl! Regnase-1 (GFP+ and Ametrine+) (n = 10 recipients each group) were transferred into
mice at day 12 after B16-F10 melanoma engraftment, followed by analysis of tumor size. Mean ± s.e.m. in Figures 4B-4D, 4G-4I, 4J, 4K, 4M-4S. Mean ± s.d. in Figure 4F. NS, not significant; *P < 0.05; **P < 0.01; ***P < 0.001; two-tailed paired Student’s /-test in Figure 4B, two-tailed unpaired Student’s /-test in Figures 4C, 4D, 4F-4I, 4K, and 4N, one-way ANOVA in Figures 4F, 4J, 4M, and 40-4S, and two-way ANOVA in Figure 4U. Data are representative of one (Figure 4E, 4L) or two (Figures 4C, and 4F-4I) independent experiments, or pooled from two (Figures 4B 4D, 4K, 4M-4S, and 4U) independent experiments.
[0064] Figures 5A-5E illustrate the validation of the effect of Regnase-1 in CD8+ T cell accumulation in tumor immunity using the in vivo dual transfer system. (Figure 5A) Gating strategy for sgRNA-transduced OT-I cells. (Figures 5B-5C) OT-I cells transduced with control sgRNA (mCherry+) were mixed at a 1 : 1 ratio with either cells transduced with control sgRNA (Ametrine+) (Figures 5B-5C, upper left) or two different sgRNAs targeting Regnase- 1 (sg Regnase-1, Ametrine+; Figure 5B, lower left; or sg Regnase-1 #2, Ametrine+; Figure 5C, lower left), and transferred into tumor-bearing hosts (n = 2-5 mice). Mice were analyzed at 7 days after adoptive transfer for analysis of the proportion of OT-I cells in CD8a+ cells (Figures 5B-5C, left), and quantification of relative OT-I cell percentage in CD8a+ cells normalized to input in the spleen and TILs (Figures 5B-5C, right). Numbers in plots indicate frequencies of OT-I cells. (Figure 5D) OT-I cells transduced with control sgRNA (Ametrine+) were mixed at a 1 : 1 ratio with cells transduced with sg Regnase-1 (mCherry+), and transferred into tumor bearing hosts (n = 5 mice). Mice were analyzed at 7 days after adoptive transfer for analysis of the proportion of OT-I cells in CD8a+ cells (left), and quantification of relative OT-I cell percentage in CD8a+ cells normalized to input in the spleen and TILs (right). Numbers in plots indicate frequencies of OT-I cells. (Figure 5E) Indel mutations after CRISPR-Cas9 targeted disruption in the in vitro cultured OT-I cells transduced with either control gRNA or sg Regnase-1, via deep sequencing analysis of indels generated at the exonic target site of Regnase-1 gene. Mean ± s.e.m. in Figures 5B-5D. *P < 0.05; ***P < 0.001; two-tailed unpaired Student’s /-test in Figures 5B-5D. Data are representative of two (Figure 5D) independent experiments
[0065] Figure 6 shows the antitumor efficacy of Regnase-1 -deficient CD8+ CAR-T cells. Xenogen images of bioluminescent intensities of mice received CD8+ CAR-T cell therapy are presented. CD8+ CAR-T cells (5 c 106) transduced with control sgRNA or sg Regnase-1 (n = 5 recipients each group) were transferred into mice at day 7 after Ph+ B-ALL cell engraftment. Non-treatment control group mice received no T cell transfer (n = 5 recipients). Data are
representative of two independent experiments.
[0066] Figures 7A-7H demonstrate that tumor-infiltrating and peripheral Regnase-l-null CD8+ T cells show distinct immune signatures. (Figures 7A-7B) GSEA enrichment plots of antigen-specific CXCR5+ and CXCR5 exhausted CD8+ T cells from chronic infection using gene targets repressed by Regnase-1 (i.e. top 100 upregulated genes in TIL sg Regnase-1- compared to control sgRNA-transduced OT-I cells as identified by bulk RNA-Seq). (Figure 7C) Venn diagram showing the overlap of significantly upregulated (left, sg Regnase-1- (n = 5 samples) versus control sgRNA-transduced OT-I cells (n = 4 samples)) or downregulated genes (right, sg Regnase-1- versus control sgRNA-transduced OT-I cells) by bulk RNA-Seq profiling between TIL and PLN OT-I cells. Specifically, control sgRNA- and sgRegna.se- 1 -t rans duced OT-I cells were mixed and transferred into tumor-bearing mice, and OT-I cells were isolated at day 7 for transcriptional profiling by RNA-Seq. (Figures 7D-7E) List of the top 10 significantly (FDR < 0.05) upregulated and downregulated pathways in TIL sg Regnase-1 - versus control sgRNA-transduced OT-I cells (Figure 7D) and PLN sg Regnase-1- versus control sgRNA-transduced OT-I cells (Figure 7E), as revealed by performing GSEA using “immunologic signatures” gene sets. (Figures 7F-7G) GSEA enrichment plots of TIL sg Regnase-1- versus control sgRNA-transduced OT-I cells (Figure 7F) and PLN sg Regnase- 1- versus control sgRNA-transduced OT-I cells (Figure 7G) using gene sets of four different tumor-infiltrating CD8 T cell activation states. Specifically, control sgRNA- and sg Regnase- 7 -transduced OT-I cells were mixed and transferred into tumor-bearing mice, and PLN OT-I cells were isolated at day 7 for transcriptional profiling by RNA-Seq. (Figure 7H) OT-I cells transduced with control sgRNA (mCherry+) and sg Regnase-1 (Ametrine+) were mixed and transferred into tumor-bearing mice (n = 5 mice), and OT-I cells in the spleen were analyzed at day 7 for expression of TCF-1 (left), and quantification of frequency of TCF-1+ cells (right). Numbers in graphs indicate frequencies of cells in gates.
[0067] Figures 8A-8F show the altered transcriptional programs and chromatin accessibility of TIL Regnase-l-null CD8+ T cells. (Figure 8A) Gene expression heat maps normalized by row (z-score) for the naive or memory T cell-associated transcription factors in control sgRNA- and sg//c¾VM.ve- /-transduced OT-I cells isolated from TILs. (Figure 8B) Representative images (left) and quantification of MFI (right) of TCF-1 expression (pink) in control sgRNA- (mCherry+; red) and sg//eq/¥.ve- /-transduced OT-I cells (Ametrine+; green) in the whole tumor section (n = 4 mice). Scale bars, 20 pm. (Figure 8C) Gene expression heat maps normalized by row (z-score) for the effector or exhausted T cell-associated transcription factors in control sgRNA- and sg//eq/¥.ve- /-transduced OT-I cells isolated from TILs. Specifically, control
sgRNA- and sgRegnase-1 -transduced OT-I cells were mixed and transferred into tumor bearing mice, and tumor-infiltrating OT-I cells were isolated at day 7 for transcriptional profiling by RNA-Seq. (Figure 8D) Real-time PCR analysis of Irf4 mRNA expression in control sgRNA- (n = 4 samples) and sgRegnase-J -transduced OT-I cells (n = 5 samples) isolated from TILs. (Figure 8E) Summary of ATAC-Seq motif enrichment data showing log2 (odds ratio) and logio (FDR) of cells from control sgRNA- (n = 4 samples) and sg Regncise-1- transduced OT-I cells (n = 4 samples) isolated from TILs. Specifically, control sgRNA- and sgRegnase-1-transduced OT-I cells were mixed and transferred into tumor-bearing mice, and tumor-infiltrating OT-I cells were isolated at day 7 for ATAC-Seq analysis. (Figure 8F) Tn5 insert sites from ATAC-Seq analysis were aligned to motifs for transcription factors from the TRANSFAC database, and the binding profiles of TCF-1, Bach2, Bcl6 and IRF4 are shown. Mean ± s.e.m. in Figures 8B and 8D. *P < 0.05; **P < 0.01; two-tailed unpaired Student’s t- test in Figures 8B and 8D. Data are representative of one (Figures 8A, 8C, 8E, and 8F) or two (Figures 8B and 8D) independent experiments.
[0068] Figures 9A-9N show the proliferation and survival analyses of Regnase-l-null CD8+ T cells in tumor immunity. (Figure 9A) List of the top 10 significantly (FDR < 0.05) upregulated and downregulated pathways in TIL sgPeq/M.ve- / -transduced OT-I cells, as revealed by performing GSEA using“Hallmark” gene sets. Specifically, control sgRNA- and sgRegnase-1-transduced OT-I cells were mixed and transferred into tumor-bearing mice, and tumor-infiltrating OT-I cells were isolated at day 7 for transcriptional profiling by RNA-Seq. (Figure 9B) GSEA enrichment plots of TIL sgRegnct.se- 1 -transduced OT-I cells using cell cycling-associated gene sets, including E2F targets (left), G2M checkpoint (middle) and mitotic spindle (right). (Figures 9C-9E) OT-I cells transduced with control sgRNA (mCherry+) and sgRegnase-1 (Ametrine+) were mixed and transferred into tumor-bearing mice, and tumor-infiltrating OT-I cells were analyzed at day 7 (Figures 9D and 9E) (n = 6 mice) and day 14 (Figure 9C) (n = 5 mice) for flow cytometry analysis of Ki-67 expression (Figures 9C, left; 9E, upper) and BrdU incorporation (Figure 9D, upper; pulse for 18 h), and quantification of MFI of Ki-67 (Figures 9C, right; 9E, lower) and frequency of BrdU+ cells (Figure 9D, lower). Numbers in graphs indicate MFI of Ki-67 (Figures 9C, left; 9E, upper). Numbers in plots indicate frequencies of BrdU+ cells (Figure 9D, upper). (Figure 9F) GSEA enrichment plots of TIL sgRegnase-1-transduced OT-I cells using apoptosis gene set. (Figure 9G) Gene expression heat maps normalized by row (z-score) for anti-apoptotic Bcl2ll (encodes Bcl-xL) and pro-apoptotic Bcl2l 11 (encodes Bim) in control sgRNA- and sgRegnase-1-transduced OT- I cells isolated from TILs. (Figure 9H) Real-time PCR analysis of Bcl2ll mRNA expression
in control sgRNA- (n = 4 samples) and sg//c¾w ve- /-transduced OT-I cells (n = 5 samples) isolated from TILs. (Figures 91 and 9J) Control sgRNA (mCherry+) and sg Regnase-1- transduced OT-I cells (Ametrine+) were mixed and transferred into tumor-bearing mice (n = 6 mice), and tumor-infiltrating OT-I cells were analyzed at day 7 for Bim expression (Figure 91, left) and the active caspase-3 expression (Figure 9 J, left), and quantification of MFI of Bim (Figure 91, right) and frequency of active caspase-3+ cells (Figure 9J, right). Numbers in graphs indicate MFI of Ki-67 (Figure 91, left). Numbers in plots indicate frequencies of active caspase-3+ cells (Figure 9J, left). (Figure 9K) List of the top 15 significantly (FDR < 0.05) upregulated and top 4 significantly downregulated pathways in PLN sgRegna.se- 1 -transduced OT-I cells, as revealed by performing GSEA using“Hallmark” gene sets. (Figures 9L and 9M) Control sgRNA- (mCherry+) and sgPeq/ ve- /-transduced OT-I cells (Ametrine+) were mixed and transferred into tumor-bearing mice (n = 6 mice), and splenic OT-I cells were analyzed for BrdU incorporation (Figure 9L, upper; pulse for 18 h) and the active caspase-3 expression (Figure 9M, upper), and quantification of frequency of BrdU+ cells (Figure 9L, lower) and active caspase-3+ cells (Figure 9M, lower). Numbers in plots indicate frequencies of BrdU+ cells (Figure 9L, upper) or active caspase-3+ cells (Figure 9M, upper). (Figure 9N) OT-I cells transduced with control sgRNA (mCherry+) and sg Regnase-1 (Ametrine+) were mixed and transferred into tumor-bearing mice, and tumor-infiltrating OT-I cells were analyzed at day 7 (n = 6 mice) for flow cytometry analysis of a DNA damage marker Seri 39 phosphorylation of histone variant H2A.X (Figure 9N, upper) and quantification of frequency of Serl39 phosphorylated histone variant H2A.X+ cells (Figure 9N, lower). Numbers in plots indicate frequencies of Serl39 phosphorylated histone variant H2A.X+ cells (Figure 9N, upper). Numbers in graphs indicate frequencies of Seri 39 phosphorylated histone variant H2A.X+ cells (Figure 9N, upper). Mean ± s.e.m. in Figures 9C-9E, 9H-9J, 9L, 9M, and 9N. *P < 0.05; **P < 0.01; ***P < 0.001; and two-tailed unpaired Student’s /-test in Figures 9C- 9E, 9H-9J, 9L, and 9M. Data are representative of one (Figures 9A, 9B, 9F, 9G, and 9K) or two (Figure 9C) independent experiments, or pooled from two (Figures 9D, 9E, 91, 9J, 9L, 9M and 9N) independent experiments.
[0069] Figures 10A-10G show the effector molecular expression of tumor-infiltrating Regnase-1 -null CD8+ T cells. (Figures 10A-10B) Control sgRNA- (mCherry+) and sg Regnase- 7-transduced OT-I cells (Ametrine+) were mixed at 5: 1 ratio and transferred into tumor-bearing mice (n = 5 mice), and tumor-infiltrating OT-I cells were analyzed at day 7 for the expression of CD69, CD25, CD49a, CXCR3, KLRG1, ICOS, Tim3, Lag3, PD-1 and CTLA4 (Figure 10A, upper) and CD44 and CD62L (Figure 10B, upper), and quantification of MFI of CD69,
CD25, CD49a, CXCR3, KLRG1, ICOS, Tim3, Lag3, PD-1 and CTLA4 (Figure 10A, lower) and frequency of CD44'CD62L cells (Figure 10B, lower). Numbers in graphs indicate MFI (Figure 10A, upper). Numbers in plots indicate frequency of CD44 'CD62L cells (Figure 10B, upper). (Figures 10C-10G) Control sgRNA (mCherry+) and sgRegna.se- 1 -t rans duced OT-I cells (Ametrine+) were mixed at 5: 1 ratio and transferred into tumor-bearing mice, and analyzed at days 7 (n = 10 mice) or 14 (n = 10 mice) for the number of IFN-g1 cells or GzmB+ cells normalized to input per gram tissue (Figure IOC), expression of TNF-a (Figure 10D, upper) and IL-2 (Figure 10D, lower) in TIL OT-I cells, and quantification of frequencies of TNF-a+ cells and IL-2+ cells (Figure 10E) in TILs, and number of TNF-a+ cells or IL-2+ cells normalized to input per gram tissue (Figure 10F) in tumors, and frequency (Figure 10G, left) and number (normalized to input) per gram tissue (Figure 10G, right) of polyfunctional IFN- g' TNF-a1 IL-21 cells in TILs. Numbers in plots indicate frequencies of TNF-a+ cells (Figure 10D, upper), or IL-2+ cells (Figure 10D, lower). Mean ± s.e.m. in Figures 10A-10C and 10E- 10G. NS, not significant; *P < 0.05; **P < 0.01; ***P < 0.001; two-tailed unpaired Student’s /-test in Figures 10A-10B, and two-tailed paired Student’s /-test in Figures IOC and 10E- 10G. Data are representative of two (Figures 10A, 10B, and 10D) independent experiments, or pooled from two (Figures IOC and 10E-10G) independent experiments.
[0070] Figures 11A-11D illustrate the identification of immune regulators and OXPHOS metabolic pathway using genome-scale CRISPR-Cas9 screening. (Figure 11A) Scatterplot of the enrichment of each gene versus its adjusted P values in genome-scale CRISPR-Cas9 screening. Gene enrichment was calculated by averaging the enrichment of their 4 sgRNAs in tumor-infiltrating OT-I cells relative to input (log2 ratio (TIL/input)), with the most extensively enriched (dark solid circle) and selective depleted (stripe-filled circle) genes (adjusted P < 0.05), as well as‘dummy’ genes (empty circle; generated by random combinations of 4 out of 1,000 non-targeting control sgRNAs per‘dummy’ gene) highlighted. (Figure 11B) Functional enrichment plots of the top 10 significantly (FDR < 0.05) enriched pathways in top-ranking depleted genes identified in the genome-scale CRISPR-Cas9 screening (by less than -3.5 log2 (TIL/input) fold change; adjusted P < 0.05). (Figure 11C) GSEA enrichment plots of TIL sgPeq/ ve- /-transduced OT-I cells using OXPHOS gene set. (Figure 11D) Representative images (left) and quantification of mitochondrial volume (stained with Tom20, white) per cell (right) in control sgRNA- (mCherry+; red) and sg Regnase-1 transduced OT-I cells (Ametrine+; green) in tumors at 7 days after adoptive transfer (n = 4 mice). Mean ± s.e.m. in Figure 11D. *P < 0.05; two-tailed unpaired Student’s /-test in Figure 11D. Data are representative of one
(Figures 11A-11C) or two (Figure 11D) independent experiments.
[0071] Figures 12A-12L demonstrates that BATF is a key Regnase-1 target in tumor immunity and regulates mitochondrial function. (Figure 12A) Venn diagram showing the overlap of genes between top depleted genes in genome-scale CRISPR-Cas9 screening (by less than -3.5 log2 (TIL/input) fold change; adjusted P < 0.05) and top upregulated genes in TIL sgRegnase-1- versus control sgRNA-transduced OT-I cells as identified by bulk RNA-Seq (by greater than 1.5 log2 fold change; P < 0.05). (Figure 12B) Tn5 insert sites from ATAC-Seq analysis were aligned to motifs for transcription factors from the TRANSFAC database, and the binding profiles of BATF are shown. (Figure 12C) Luciferase activity of HEK293T cells measured at 48 h after transfection with 112 mRNA 3' UTR (upper) or 114 mRNA 3' UTR (lower) luciferase reporter plasmid, together with control (mock), wild-type or D141N Regnase-1 -expressing plasmid (n = 3 samples each group). (Figure 12D) In vivo accumulation of double sgRNA-transduced OT-I cells in tumor-bearing mice, similar as Figure 4G, for the use of the second sgRNA targeting Batf (see Figure 4G legend for details). (Figure 12E) Flow cytometry analysis of BATF expression in control sgRNA, sgRegnase-1, sg Batf and sg Batf and sgRegnase-1 co-transduced OT-I cells cultured in vitro and stimulated with anti-CD3 and anti- CD28 for indicated time. Numbers in graphs indicate MFI of BATF and are listed in the same order as the legend. (Figure 12F) OT-I cells transduced with control sgRNA (mCherry+) were mixed with cells transduced with sg Batf (GFP+), and transferred into tumor-bearing hosts (n = 5 mice). Mice were analyzed at 7 days after adoptive transfer for analysis of the proportion of OT-I cells in CD8a+ cells (left), and quantification of relative OT-I cell percentage in CD8a+ cells normalized to input in the spleen and TILs (right). Numbers in plots indicate frequencies of OT-I cells. (Figure 12G) OT-I cells transduced with sgRegnase-1 (mCherry+) were mixed with cells co-transduced with sgRegnase-1 and sg Batf (Ametrine+ and GFP+, respectively) and transferred into tumor-bearing hosts (n = 3 mice), and TILs were analyzed at 7 days after adoptive transfer for CD44 and CD62L expression (left), and quantification of the frequency of CD44 'CD62L cells (right) in OT-I cells. Numbers in plots indicate frequencies of CD44 'CD62L cells. (Figure 12H) Gene expression heat maps normalized by row (z-score) for Ifng, Gzmb and Gzma expression in sgRegnase-1-transduced and sg Batf and sgRegnase-1 co-transduced OT-I cells isolated from TILs. (Figure 121) Real-time PCR analysis of Ifng, Gzmb and Gzma mRNA expression in sgRegnase-1-transduced and sg Batf and sgRegnase-1 co-transduced OT-I cells isolated from TILs (n = 4 mice each group). (Figure 12J) List of the top 2 significantly (FDR < 0.05) upregulated and top 8 significantly downregulated pathways
in TIL sg Batf and sgRegnase-1 co-transduced (n = 3 samples) versus sgRegnase-1-transduced (n = 3 samples) OT-I cells isolated from TILs, as revealed by performing GSEA using “Hallmark” gene sets. (Figure 12K) GSEA enrichment plots of TIL sg Batf and sgRegnase-1 co-transduced OT-I cells using OXPHOS gene set. (Figure 12L) OT-I cells transduced with sgRegnase-1 (Ametrine+) were mixed with cells co-transduced with sgRegnase-1 and sg Batf (Ametrine+ and GFP+, respectively) and transferred into the tumor-bearing mice (n = 6 mice), and tumor-infiltrating OT-I cells were analyzed at day 7 for TMRM and Mitotracker staining (left), and quantification of the MFI of TMRM and Mitotracker (right) in OT-I cells. Numbers in graphs indicate MFI of TMRM and Mitotracker. Mean ± s.e.m. in Figures 12D, 12F, 12G, 121, and 12L, and mean ± s.d. in Figure 12C. NS, not significant; *P < 0.05; **P < 0.01; ***P < 0.001; two-tailed unpaired Student’s /-test in Figures 12C and 12F and two-tailed paired Student’s /-test in Figures 12G, 121, and 12L. Data are representative of one (Figures 12B, 12D, 12H, 12J, and 12K) or two (Figures 12C, 12E, and 12G) independent experiments, or pooled from two (Figures 12F and 12L) independent experiments.
[0072] Figures 13A-13E illustrate the identification of additional targets for ACT in cancer immunotherapy using genome-scale CRISPR-Cas9 screening. (Figure 13A) In vivo accumulation of double sgRNA-transduced OT-I cells in tumor-bearing mice, similar as Figure 4G, except for the use of the sgRNAs targeting Ptpn2, Socsl and Agps (see Figure 4G legend for details). (Figures 13B and 13C) OT-I cells transduced with control sgRNA (mCherry+) were mixed with either cells transduced with sg Ptpn2 (GFP+) (n = 3 mice) (Figure 13B, upper), sg Socsl (GFP+) (n = 5 mice) (Figure 13B, lower) or sgRoquin-1 ( sgRc3hl ) (GFP+) (n = 3 mice) (Figure 13C), and transferred into tumor-bearing hosts. Mice were analyzed at 7 days after adoptive transfer for analysis of the proportion of OT-I cells in CD8a+ cells (Figures 13B and 13C, left), and quantification of relative OT-I cell percentage in CD8a+ cells normalized to input in the spleen and TILs (Figure 13B and 13C, right). Numbers in plots indicate frequencies of OT-I cells. (Figure 13D) List of the top 9 significantly (FDR < 0.05) upregulated and top 13 significantly downregulated pathways in sg Ptpn2 and sgRegnase-1 co- transduced (n = 3 samples) versus sgRegnase-1-transduced (n = 3 samples) OT-I cells isolated from the TILs, as revealed by performing GSEA using“Hallmark” gene sets. (Figure 13E) List of the top 10 significantly (FDR < 0.05) upregulated and downregulated pathways in TIL sg Socsl and sgRegnase-1 co-transduced (n = 3 samples) versus sgRepnase-l -transduced ( n = 3 samples) OT-I cells isolated from the TILs, as revealed by performing GSEA using “Hallmark” gene sets. Mean ± s.e.m. in Figures 13A-13C. *P < 0.05; **P < 0.01; two-tailed unpaired Student’s /-test in Figures 13B and 13C. Data are representative of one (Figures 13A,
13C, 13D, and 13E) or pooled from two (Figures 13B) independent experiments.
[0073] Figure 14 depicts a schematic of deletion of Regnase-1 reprograms CD8+ T cells for improved cancer immunotherapy. Regnase-1 is a major negative regulator of CD8+ T cell antitumor responses, and TCR and IL-2 inhibit its expression and activity. Deletion of Regnase- 1 unleashes potent therapeutic efficacy of engineered tumor-specific CD8+ T cells against cancers by coordinating transcriptional and metabolic programs to achieve greatly improved cell accumulation and function. As a key functional target of Regnase-1, excessive BATF drives robust cell accumulation and effector function, in part through enhancing mitochondrial metabolism, in Regnase-1 -null CD8+ T cells. Regnase-1 deletion also reprograms cells to acquire increased naive/memory cell-associated gene signatures and gain survival advantage, which contribute to the improved persistence of Regnase-1 -null effector CD8+ T cells. Targeting PTPN2 and SOCS1 (not depicted here) acts in coordination with Regnase-1 inhibition to promote CD8+ T cell antitumor responses.
[0074] Figures 15A-15G demonstrate that upstream signals regulate Regnase-1 expression and Regnase-1 -null cell phenotypes. (Figure 15A) Immunoblot analysis of Regnase-1 expression in wild-type OT-I cells isolated from PLN and TILs at 7 days after adoptive transfer (n = 4 samples each group) (upper). Quantification of relative intensity of Regnase-1 expression (lower). (Figure 15B) GSEA enrichment plots of PLN and TIL control sgRNA- OT-I cells used in (Figure 15A) by using gene targets repressed by Regnase-1 (i.e. top 100 upregulated genes in TIL sgRegnase-1- compared to control sgRNA-transduced cells as identified by RNA-Seq). (Figure 15C) OT-I cells were stimulated with aCD3 and aCD28 for overnight before viral transduction, and then cultured in IL-7 and IL- 15 -containing medium for another 3 days in vitro. Pre-activated OT-I cells were then stimulated with aCD3, IL-2 or IL-21 for 0, 1 and 4 h (n = 5 samples each group) for immunoblot analysis of full length and cleaved Regnase-1 (upper), and quantification of relative intensity of full length (lower left) and cleaved Regnase-1 expression (lower right). (Figures 15D, 15E) OT-I cells transduced with control sgRNA (mCherry+) and sgRegnase-1 (AmetrineQ were mixed at a 1 : 1 ratio and transferred into mice bearing B 16-Ova (n = 6 mice) or B16-F10 (n = 6 mice) tumors. Mice were analyzed at day 7 after adoptive transfer for quantification of relative OT-I cell percentage in total cells normalized to input in the spleen and TILs (Figure 15D), and expression of TCF- 1 (Figure 15E, left), and quantification of frequency of TCF-1+ cells (Figure 15E, right) in tumor-infiltrating OT-I cells. (Figure 15F, 15G) OT-I cells were stimulated with aCD3 and aCD28 for overnight before viral transduction, and then cultured in IL-2, IL-7 and IL-15- containing medium for another 3 days in vitro. Pre-activated OT-I cells were then continuously
cultured in normoxia (21% O2) or hypoxia (1% O2) condition for 48 h for immunoblot analysis of expression of HIFla, Regnase-1 and BATF (Figure 15F), and for flow cytometry analysis of expression of BATF, CD69, GzmB, CD25 and TCF-1 (Figure 15G). Numbers in graphs indicate MFI and appear in the same order as the legend (Figure 15G). Mean ± s.e.m. in Figures 15A, 15C-15E. *P < 0.05; **P < 0.01; ***P < 0.001; two-tailed unpaired Student’s /-test in Figure 15A, and one-way ANOVA in Figures 15C-15E. Data are representative of two (Figures 15C, 15F, 15G) independent experiments, or pooled from two (Figures 15D, 15E) independent experiments.
[0075] Figures 16A-16G show scRNA-Seq and flow cytometry analyses of tumor- infiltrating Regnase-1 -null OT-I cells. (Figures 16A-16F) scRNA-Seq analysis of control sgRNA- and sgRegnase-1-transduced OT-I cells isolated from TILs. Specifically, control sgRNA- and sgRegnase-1-transduced OT-I cells were mixed and transferred into tumor bearing mice, and tumor-infiltrating OT-I cells were isolated at day 7 for transcriptional profiling by scRNA-Seq. tSNE visualization of Tox (Figure 16A, left), Pdcdl (Figure 16B, upper left), Haver 2 (Figure 16B, lower left), Iftig (Figure 16D, upper left), Gzmb (Figure 16D, lower left), Batf (Figure 16E, left) and Id2 (Figure 16F, left) gene expression, and“CXCR5+ exhausted CD8 (Ahmed)7” (Figure 16C, upper left) and“CXCR5+ exhausted CD8 (Yu)8” (Figure 16C, lower left) gene signatures in individual cells. Violin plots of Tox (Figure 16A, right), Pdcdl (Figure 16B, upper right), Haver 2 (Figure 16B, lower right), Iftig (Figure 16D, upper right), Gzmb (Figure 16D, lower right), Batf (Figure 16E, right) and M2 (Figure 16F, right) gene expression, and“CXCR5+ exhausted CD8 (Ahmed)” (Figure 16C, upper right) and “CXCR5+ exhausted CD8 (Yu)” (Figure 16C, lower right) gene signatures among the four cell subsets. The black dots in the center of the violin plots indicate the median values. (Figure 16G) OT-I cells transduced with control sgRNA and sgRegnase-1 were mixed and transferred into tumor-bearing mice (n = 5 mice; data from one representative mouse were shown), and tumor-infiltrating OT-I cells were analyzed at day 7 for the expression of TOX, Slamf6, CD127, KLRG1, Tim3 and PD-1 in TCF-1+ and TCF-1 cells of control sgRNA- and sgRegnase-1-transduced OT-I cells. Numbers in graphs indicate mean ± s.e.m. of MFI of markers on the X-axis after gating TCF-1+ (control sgRNA: 15.5 ± 2.9 %; sgRegnase-1: 28.2 ± 5.6 %) and TCF-1- subsets. Data are representative of one (Figures 16A-16F) or two (Figure 16G) independent experiments.
[0076] Figures 17A-17H demonstrate that genome-scale CRISPR-Cas9 screening identifies BATF as an important Regnase-1 functional target in tumor immunity. (Figure 17A) Enrichment of BATF-binding motifs in the genomic regions with upregulated accessibility in
Regnase-l-null cells. First, common regions were analyzed in the Regnase-l-null ATAC-Seq data and published BATF ChIP-Seq peaks (GSE54199). Next, these common regions with TRANSFAC motifs for BATF were scanned, and numbers of motif matches and associated Fisher’s exact test P values and log2 (odds ratios) are shown (a positive log2 (odds ratio) value indicates that a motif is more likely to occur in Regnase-l-null cells than in wild-type samples; Έ - x’ denotes x 10 ). (Figures 17B, 17C) OT-I cells transduced with control sgRNA (mCherry+; spike) were mixed at a 1 :1 ratio with cells transduced with control sgRNA (Ametrine+), sgRegnase-1 (Ametrine+), sg Batf (GFP+) or sg Batf/Regnase-1 (GFP+ and Ametrine+), and transferred into tumor-bearing hosts individually (n = 4 mice each group). Mice were analyzed at 5 days after adoptive transfer for quantification of relative OT-I cell percentage in CD8a+ cells normalized to spike in the spleen (Figure 17B, left) and TILs (Figure 17B, right), and quantification of relative MFI of BATF normalized to spike in the tumor-infiltrating OT-I cells (Figure 17C). (Figure 17D) Immunoblot analysis of Regnase-1 and BATF expression in in vitro cultured OT-I cells 3 days after transduction with control sgRNA or sg Batf/Regnase-1. (Figures 17E-17G) The same transfer system as in (Figure 17F) was used. Tumor-infiltrating OT-I cells were analyzed at day 5 (n = 4 mice each group) for quantification of relative frequency of active caspase-3+ cells normalized to spike (Figure 17E), and quantification of relative frequency of TCF-1+ cells normalized to spike (Figure 17F), or at day 7 (n = 6 mice each group) for quantification of relative frequency of IFN-y1 cells normalized to spike (Figure 17G). (Figure 17H) 4 x 106 pmel-1 cells transduced with sgRegnase-1 (Ametrine+) (n = 10 recipients) or sgBatf/Regnase-1 (GFP+ and Ametrine+) (n = 10 recipients) were transferred into mice at day 12 after B16-F10 melanoma engraftment, followed by analyses of tumor size. Mean ± s.e.m. in Figures 17B, 17C, 17E-17G. NS, not significant; *P < 0.05; **P < 0.01; ***P < 0.001; one-way ANOVA in Figures 17B-17C, 17E-17G, and two-way ANOVA in Figure 17H. Data are representative of one (Figure 17A) or three (Figure 17D) independent experiments, or pooled from two (Figures 17B, 17C, 17E- 17H) independent experiments.
[0077] Figures 18A-18H show BATF overexpression markedly enhances CD8+ T cell antitumor responses. (Figure 18A) OT-I cells were stimulated with aCD3 and aCD28 for overnight before viral transduction, and then cultured in IL-7 and IL- 15 -containing medium for another 3 days in vitro. Control sgRNA- and sgRegnase-1 ransduced OT-I cells were then stimulated with aCD3, IL-2 or IL-21 for overnight for flow cytometry analysis of BATF expression (upper), and quantification of the MFI of BATF (lower) (n = 6 samples each group).
Numbers in graphs indicate MFI (upper) and fold change between comparisons (lower). (Figure 18B-18H) OT-I cells transduced with control retrovirus (mCherry+) were mixed at a 1 : 1 ratio with cells transduced with /i«//-o\ erex pressing retrovirus (GFP+), and transferred into tumor-bearing hosts. Mice were analyzed at day 4 (Figure 18E) (n = 4 mice), day 5 (Figures 18B, 18H) (n = 4 mice), day 7 (Figures 18C, 18D, 18F, 18G) (n = 6-8 mice) or day 14 (Figures 18C, 18D) (n = 6 mice) for the expression of BATF (Figure 18B, left), active caspase- 3 (Figure 18F, left), IFN-g, GzmB, TNF-a and IL-2 (Figure 18G, left), and TCF-1 (Figure 18H, upper) in TIL OT-I cells, and quantification of MFI of BATF in TIL OT-I cells (Figure 18B, right), and quantification of frequencies of active caspase-3+ cells (Figure 18F, right), IFN-y1. GzmB+, TNF-a+ and IL-2+ cells (Figure 18G, right), and TCF-1+ cells (Figure 18H, lower) in TIL OT-I cells, and analysis of the proportion of donor-derived OT-I cells in total CD8a+ cells in TILs and spleen (Figure 18C), and quantification of relative OT-I cell percentage in CD8a+ cells normalized to input in the spleen (Figure 18D), and the dilution of CellTrace Violet (CTV) in TIL OT-I cells (Figure 18E, left), and quantification of MFI of CTV in TIL OT-I cells (Figure 18E, right). Numbers in graphs indicate MFI and appear in the same order as the legend (Figure 18B, left; Figure 18E, left), frequencies of OT-I cells in gates (Figures 18C), frequency of active caspase-3+ cells (Figure 18F, left), frequencies of IFN-y+, GzmB+, TNF-a+ or IL-2+ cells (Figure 18G, left), and frequency of TCF-1+ cells (Figure 18H, upper). Mean ± s.e.m. in Figures 18A, 18B, 18D-18H. *P < 0.05; **P < 0.01; ***P < 0.001; two-tailed unpaired Student’s /-test in Figures 18A, 18B, 18D-18H. Data are representative of two (Figures 18A, 18C) independent experiments, or pooled from two (Figures 18B, 18D- 18H) independent experiments.
[0078] Figures 19A-19D show ATAC-Seq and WCGNA analyses of wild-type, Regnase-1- null, BATF -null and BATF/Regnase-l-null cells. OT-I cells transduced with control sgRNA (mCherry+), sgRegnase-1 (Ametrine+), sg Batf (GFP+) or sgBatf/Regnase-1 (GFP+ and Ametrine+) ( n = 2-4 samples each group) were transferred into tumor-bearing hosts individually. OT-I cells were isolated from TILs at day 7 for ATAC-Seq analysis (Figure 19A) or transcriptional profiling by microarrays (Figures 19B, 19C). (Figure 19A) Venn diagram depicting genes with differential chromatin accessibility (by |log2 FC| > 0.5; P < 0.05) in sgRegnase-1-, sg Batf- or sgP«//vPeq/¥.ve- /-transduced tumor-infiltrating OT-I cells. The differential accessibility (DA) regions were annotated in ATAC-Seq for the nearest genes. The numbers indicate the shared and independent genes in each category. (Figure 19B) Weighted gene correlation network analysis (WGCNA) of control gRNA-, sgRegnase-1-, sg Batf-, and
sgfkiifl Regnase- 1 -Uansduced tumor-infiltrating OT-I cells. The number of genes in each cluster is indicated. Red dashed lines represent the relative gene expression level in control gRNA-transduced cells. Mitochondrial genes that were upregulated in the absence of Regnase- 1 were shown in the corresponding clusters. (Figure 19C) Functional enrichment of the clusters from WGCNA (Figure 19B) using four tumor-infiltrating CD8+ T cell activation states10. (Figure 19D) Venn diagram depicting mitochondrial genes with differential chromatin accessibility (by |log2 FC| > 0.5; P < 0.05) in sgRegnase-1-, sg Batf- or sg Batf/Regnase-1- transduced tumor-infiltrating OT-I cells as determined by ATAC-Seq as described in Figure 19A. The differential accessibility (DA) regions in ATAC-Seq were annotated for the nearest genes, and these genes were superimposed with 1,158 mitochondrial genes defined in MitoCarta 2.0 database11 12. The numbers indicate the shared and independent genes in each category. Data are representative of one (Figures 19A-19D) experiment.
[0079] Figures 20A-20B demonstrate PTPN2 and SOCS 1 deletion efficiency and expression in Regnase-1 -null cells. (Figure 20A) Immunoblot analysis of Regnase-1, PTPN2 and SOCS1 expression in in vitro cultured OT-I cells 3 days after transduction with control sgRNA, sgPtpn2/Regnase-l (left), or sg Socsl! Regnase-1 (right). (Figure 20B) Immunoblot analysis of Regnase-1, BATF, SOCS1 and PTPN2 expression in control sgRNA- and sgRegnase-1 - transduced OT-I cells cultured in vitro for 3 days after viral transduction. Data are representative of three (Figures 20A, 20B) independent experiments.
[0080] Figure 21 shows a schematic of the six guide RNAs (gRNAl-gRNA6) selected in silico for knocking out Regnase-1 in human CAR-T cells.
[0081] Figures 22A-22B show Regnase-1 knockout confirmation in human T cells. Figure 22A shows deep sequence results for three selected guide RNAs (gRNAl, gRNA2, and gRNA6). Figure 22B is a Western blot showing the knock-down effect of three selected guide RNAs (gRNAl, gRNA2, and gRNA6) on Regnase-1 protein levels. From these data, two guide RNAs, gRNAl and gRNA6, were selected for further testing.
[0082] Figures 23A-23B show that human CAR-T Regnase-1 -null cells have improved survival ex vivo. Figure 23A shows survival of human CD4 CAR-T Regnase-1 -null cells with the two selected guide RNAs gRNAl and gRNA6. Figure 23B shows survival of human CD8 CAR-T Regnase-1 -null cells with the two selected guide RNAs gRNAl and gRNA6.
[0083] Figures 24A-24B show that human CAR-T Regnase-1 -null cells have improved proliferation (Figure 24A) and reduced apoptosis (Figure 24B) ex vivo.
[0084] Figures 25A-25B show that human CD4 Regnase-1 -null (Figure 25 A) and CD8 Regnase-1 -null (Figure 25B) CAR-T cells have more memory subsets upon antigen activation
ex vivo.
[0085] Figures 26A-26D show that human CD8 CAR-T Regnase-l-null cells secrete more cytokines ex vivo, specifically IL-2 (Figure 26A), TNFa (Figure 26B), IFN-gamma (Figure 26C), and GrzB (Figure 26D).
[0086] Figures 27A-27D show that human CD4 CAR-T Regnase-l-null cells secrete more cytokines ex vivo, specifically IL-2 (Figure 27A), TNFa (Figure 27B), IFN-gamma (Figure 27C), and GrzB (Figure 27D).
[0087] Figure 28 shows that CD8 Regnase-l-null CAR-T cells can hyperproliferate ex vivo.
[0088] Figures 29A-29B show that CD8 Regnase-l-null CAR-T naive (top panel) and bulk (bottom panel) cells have upregulated mitochondrial activity ex vivo as measured by TMRM (Figure 29A) and mitotracker (Figure 29B).
[0089] Figure 30 shows upregulation of genes related to T cell proliferation and mitochondrial activity in Regnase-l-null CAR-T cells ex vivo upon antigen stimulation by GSEA analysis.
[0090] Figures 31A-31B show that mice treated with Regnase-l-null CAR-T cells in vivo have lower tumor burden as indicated by the luciferase activity of each treatment group (Figure 31A) and individual recipient (Figure 31B).
[0091] Figures 32A-32B show that human Regnase-l-null CAR-T cells have improved cytotoxicity (Figure 32A) and improved survival (Figure 32B) ex vivo.
[0092] Figures 33A-33B show hyperactivation of CD8 Regnase-l-null (Figure 33A) and CD4 Regnase-l-null (Figure 33B) CAR-T cells ex vivo.
DESCRIPTION
[0093] The present invention generally provides methods for enhancing expansion and/or persistence and/or effector function (e.g., an anti-tumor or an anti-infection function) of T cells. The present invention also provides modified T cells with enhanced expansion and/or persistence and/or effector function (e.g., an anti-tumor or an anti-infection function), as well as pharmaceutical compositions comprising such modified T cells. The present invention further provides methods of using such modified T cells to treat a disease (e.g., cancer or infectious disease) in a subject.
[0094] T cells undergo extensive metabolic programing during differentiation and in adaptation to different contexts. T cell longevity and function in cancer immunotherapy have been proposed to be closely correlated with cell metabolic fitness13 14, although the underlying molecular mechanisms are unclear. The present invention is based on an unexpected discovery that Regnase-1 (also known as Zc3hl2a or MCPIPl) is a major negative regulator of antitumor
responses, whose deficiency results in drastically increased CD8+ T cell accumulation in tumors. Data in support of these findings is presented in the Examples section, below. For instance, it was demonstrated that Regnase-1 deficient CD8+ T cells are long-lived effector cells with extensive accumulation, better persistence and robust effector function in tumors. Surprisingly, Regnase-1 -deficient CD8+ T cells show profoundly improved therapeutic efficacy in mouse melanoma and leukemia tumor models. Regnase-1 -deficient CD8+ T cells are reprogrammed specifically in tumor microenvironment (TME) to acquire naive/memory cell-associated gene signatures for better persistence and survival advantage, but also retain high-level expression of effector molecules such as IFN-g and granzyme B.
[0095] The present invention is also based on another unexpected discovery that BATF is a key functional target of Regnase-1 in reprogramming antitumor responses of CD8+ T cells. As detailed in the Examples section below, through a secondary in vivo genome-scale CRISPR- Cas9 screening, BATF was identified as the key target of Regnase-1 and a rheostat in shaping antitumor responses. Loss of BATF suppresses the elevated accumulation and mitochondrial fitness of Regnase-1 -deficient CD8+ T cells. Moreover, genome-scale CRISPR-Cas9 screening also identifies additional genes, such as Ptpn2, Socsl and Rc3hl, that could be targeted alone or in combination with Regnase-1 and/or Batf to further improve T-cell based therapy.
Definitions
[0096] The terms“T cell” and“T lymphocyte” are interchangeable and used synonymously herein. As used herein, T cell includes thymocytes, naive T lymphocytes, immature T lymphocytes, mature T lymphocytes, resting T lymphocytes, or activated T lymphocytes. A T cell can be a T helper (Th) cell, for example a T helper 1 (Thl), a T helper 2 (Th2) cell, a T helper 17 (Thl7) or regulatory T (Treg) cell. The T cell can be a T helper cell (Th; CD4+ T cell) CD4+ T cell, a cytotoxic T cell (CTL; CD8+ T cell), a tumor infiltrating cytotoxic T cell (TIL; CD8+ T cell), CD4+CD8+ T cell, or any other subset of T cells. Other illustrative populations of T cells suitable for use in particular embodiments include naive T cells and memory T cells. Also included are“NKT cells”, which refer to a specialized population of T cells that express a semi-invariant ab T-cell receptor, but also express a variety of molecular markers that are typically associated with NK cells, such as NK1.1. NKT cells include NK1.1 + and NKT 1 , as well as CD4+, CD4 , CD8+ and CD8 cells. The TCR on NKT cells is unique in that it recognizes glycolipid antigens presented by the MHC I-like molecule CD Id. NKT cells can have either protective or deleterious effects due to their abilities to produce cytokines that promote either inflammation or immune tolerance. Also included are“gamma-delta T cells (gd T cells),” which refer to a specialized population that to a small subset of T cells possessing
a distinct TCR on their surface, and unlike the majority of T cells in which the TCR is composed of two glycoprotein chains designated a- and b-TCR chains, the TCR in gd T cells is made up of a g-chain and a d-chain. gd T cells can play a role in immunosurveillance and immunoregulation, and were found to be an important source of IL-17 and to induce robust CD8+ cytotoxic T cell response. Also included are“regulatory T cells” or“Tregs” refers to T cells that suppress an abnormal or excessive immune response and play a role in immune tolerance. Tregs cells are typically transcription factor Foxp3-positive CD4+ T cells and can also include transcription factor Foxp3 -negative regulatory T cells that are IL-10-producing CD4+T cells.
[0097] The terms“natural killer cell” and“NK cell” are used interchangeable and used synonymously herein. As used herein, NK cell refers to a differentiated lymphocyte with a CD 16+ CD56+ and/or CD57+ TCR- phenotype. NKs are characterized by their ability to bind to and kill cells that fail to express“self’ MHC/HLA antigens by the activation of specific cytolytic enzymes, the ability to kill tumor cells or other diseased cells that express a ligand for NK activating receptors, and the ability to release protein molecules called cytokines that stimulate or inhibit the immune response.
[0098] The term“chimeric antigen receptor” or“CAR” as used herein is defined as a cell- surface receptor comprising an extracellular target-binding domain, a transmembrane domain and a cytoplasmic domain, comprisilng a lymphocyte activation domain and optionally at least one co-stimulatory signaling domain, all in a combination that is not naturally found together on a single protein. This particularly includes receptors wherein the extracellular domain and the cytoplasmic domain are not naturally found together on a single receptor protein. The chimeric antigen receptors of the present invention are intended primarily for use with lymphocyte such as T cells and natural killer (NK) cells.
[0099] As used herein, the term“antigen” refers to any agent (e.g., protein, peptide, polysaccharide, glycoprotein, glycolipid, nucleic acid, portions thereof, or combinations thereof) molecule capable of being bound by a T-cell receptor. An antigen is also able to provoke an immune response. An example of an immune response may involve, without limitation, antibody production, or the activation of specific immunologically competent cells, or both. A skilled artisan will understand that an antigen need not be encoded by a“gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample, or might be macromolecule besides a polypeptide. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components, organisms, subunits of proteins/antigens, killed or inactivated whole
cells or lysates.
[00100] The term“antigen-binding moiety” refers to a target-specific binding element that may be any ligand that binds to the antigen of interest or a polypeptide or fragment thereof, wherein the ligand is either naturally derived or synthetic. Examples of antigen-binding moieties include, but are not limited to, antibodies; polypeptides derived from antibodies, such as, for example, single chain variable fragments (scFv), Fab, Fab', F(ab')2, and Fv fragments; polypeptides derived from T Cell receptors, such as, for example, TCR variable domains; secreted factors (e.g., cytokines, growth factors) that can be artificially fused to signaling domains; and any ligand or receptor fragment (e.g., CD27, NKG2D) that binds to the antigen of interest. Combinatorial libraries could also be used to identify peptides binding with high affinity to the therapeutic target.
[00101] Terms“antibody” and“antibodies” refer to monoclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, chimeric antibodies, single-chain Fvs (scFv), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), intrabodies, minibodies, diabodies and anti-idiotypic (anti-id) antibodies (including, e.g., anti- id antibodies to antigen-specific TCR), and epitope-binding fragments of any of the above. The terms“antibody” and“antibodies” also refer to covalent diabodies such as those disclosed in U.S. Pat. Appl. Pub. 2007/0004909 and Ig-DARTS such as those disclosed in U.S. Pat. Appl. Pub. 2009/0060910. Antibodies useful as a TCR-binding molecule include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an antigen-binding site. Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgMl, IgM2, IgAl and IgA2) or subclass.
[00102] The terms“activation” or“stimulation” means to induce a change in their biologic state by which the cells (e.g., T cells and NK cells) express activation markers, produce cytokines, proliferate and/or become cytotoxic to target cells. All these changes can be produced by primary stimulatory signals. Co-stimulatory signals can amplify the magnitude of the primary signals and suppress cell death following initial stimulation resulting in a more durable activation state and thus a higher cytotoxic capacity. A“co-stimulatory signal” refers to a signal, which in combination with a primary signal, such as TCR/CD3 ligation, leads to T cell and/or NK cell proliferation and/or upregulation or downregulation of key molecules.
[00103] The term“proliferation” refers to an increase in cell division, either symmetric or asymmetric division of cells. The term“expansion” refers to the outcome of cell division and cell death.
[00104] The term “differentiation” refers to a method of decreasing the potency or proliferation of a cell or moving the cell to a more developmentally restricted state.
[00105] The terms“express” and“expression” mean allowing or causing the information in a gene or DNA sequence to become produced, for example producing a protein by activating the cellular functions involved in transcription and translation of a corresponding gene or DNA sequence. A DNA sequence is expressed in or by a cell to form an“expression product” such as a protein. The expression product itself, e.g., the resulting protein, may also be said to be “expressed” by the cell. An expression product can be characterized as intracellular, extracellular or transmembrane.
[00106] The term“transfection” means the introduction of a“foreign” (i.e., extrinsic or extracellular) nucleic acid into a cell using recombinant DNA technology. The term“genetic modification” means the introduction of a“foreign” (i.e., extrinsic or extracellular) gene, DNA or RNA sequence to a host cell, so that the host cell will express the introduced gene or sequence to produce a desired substance, typically a protein or enzyme coded by the introduced gene or sequence. The introduced gene or sequence may also be called a“cloned” or“foreign” gene or sequence, may include regulatory or control sequences operably linked to polynucleotide encoding the chimeric antigen receptor, such as start, stop, promoter, signal, secretion, or other sequences used by a cell's genetic machinery. The gene or sequence may include nonfunctional sequences or sequences with no known function. A host cell that receives and expresses introduced DNA or RNA has been“genetically engineered.” The DNA or RNA introduced to a host cell can come from any source, including cells of the same genus or species as the host cell, or from a different genus or species.
[00107] The term“transduction” means the introduction of a foreign nucleic acid into a cell using a viral vector.
[00108] The terms“genetically modified” or“genetically engineered” refers to the addition of extra genetic material in the form of DNA or RNA into a cell.
[00109] As used herein, the term“derivative” in the context of proteins or polypeptides (e.g., CAR constructs or domains thereol) refer to: (a) a polypeptide that has at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 99.5% sequence identity to the polypeptide it is a derivative of; (b) a polypeptide encoded by a nucleotide sequence that has at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 99.5% sequence identity to a nucleotide sequence encoding the polypeptide it is a derivative of; (c) a polypeptide that contains 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acid mutations (i.e., additions, deletions and/or substitutions) relative to the
polypeptide it is a derivative of; (d) a polypeptide encoded by nucleic acids can hybridize under high, moderate or typical stringency hybridization conditions to nucleic acids encoding the polypeptide it is a derivative of; (e) a polypeptide encoded by a nucleotide sequence that can hybridize under high, moderate or typical stringency hybridization conditions to a nucleotide sequence encoding a fragment of the polypeptide, it is a derivative of, of at least 20 contiguous amino acids, at least 30 contiguous amino acids, at least 40 contiguous amino acids, at least 50 contiguous amino acids, at least 75 contiguous amino acids, at least 100 contiguous amino acids, at least 125 contiguous amino acids, or at least 150 contiguous amino acids; or (f) a fragment of the polypeptide it is a derivative of.
[00110] The term“functional fragment” or“functional derivative” as used herein refers to a fragment or derivative of the polypeptide or protein, or a polynucleotide encoding the polypeptide or protein, that retains at least one function of the full-length polypeptide or protein, or the polypeptide or protein it is a derivative of. A functional fragment may comprise an amino acid sequence of at least 5 contiguous amino acid residues, at least 6 contiguous amino acid residues, at least 7 contiguous amino acid residues, at least 8 contiguous amino acid residues, at least 9 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 11 contiguous amino acid residues, at least 12 contiguous amino acid residues, at least 13 contiguous amino acid residues, at least 14 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least contiguous 80 amino acid residues, at least contiguous 90 amino acid residues, at least contiguous 100 amino acid residues, at least contiguous 125 amino acid residues, at least 150 contiguous amino acid residues, at least contiguous 175 amino acid residues, at least contiguous 200 amino acid residues, or at least contiguous 250 amino acid residues of the amino acid sequence of the full-length polypeptide or protein. The functional fragment or functional derivative of a polypeptide or protein may retain one, two, three, four, five, or more functions of the full-length polypeptide or protein, or the polypeptide or protein it is a derivative of.
[00111] Percent sequence identity can be determined using any method known to one of skill in the art. In a specific embodiment, the percent identity is determined using the“Best Fit” or “Gap” program of the Sequence Analysis Software Package (Version 10; Genetics Computer Group, Inc., University of Wisconsin Biotechnology Center, Madison, Wisconsin). Information regarding hybridization conditions (e.g., high, moderate, and typical stringency
conditions) have been described, see, e.g. , U.S. Patent Application Publication No. US 2005/0048549 (e.g., paragraphs 72-73).
[00112] The terms“vector”,“cloning vector” and“expression vector” mean the vehicle by which a DNA or RNA sequence (e.g., a foreign gene) can be introduced into a host cell, so as to genetically modify the host and promote expression (e.g., transcription and translation) of the introduced sequence. Vectors include plasmids, synthesized RNA and DNA molecules, phages, viruses, etc. In certain embodiments, the vector is a viral vector such as, but not limited to, viral vector is an adenoviral, adeno-associated, alphaviral, herpes, lentiviral, retroviral, or vaccinia vector.
[00113] The term“regulatory element” refers to any cis-acting genetic element that controls some aspect of the expression of nucleic acid sequences. In some embodiments, the term “promoter” comprises essentially the minimal sequences required to initiate transcription. In some embodiments, the term“promoter” includes the sequences to start transcription, and in addition, also include sequences that can upregulate or downregulate transcription, commonly termed“enhancer elements” and“repressor elements”, respectively.
[00114] As used herein, the term“operatively linked,” and similar phrases, when used in reference to nucleic acids or amino acids, refer to the operational linkage of nucleic acid sequences or amino acid sequence, respectively, placed in functional relationships with each other. For example, an operatively linked promoter, enhancer elements, open reading frame, 5' and 3' UTR, and terminator sequences result in the accurate production of a nucleic acid molecule (e.g., RNA). In some embodiments, operatively linked nucleic acid elements result in the transcription of an open reading frame and ultimately the production of a polypeptide (i.e., expression of the open reading frame). As another example, an operatively linked peptide is one in which the functional domains are placed with appropriate distance from each other to impart the intended function of each domain.
[00115] The terms“enhance” or“promote” or“increase” or“expand” or“improve” refer generally to the ability of a composition contemplated herein to produce, elicit, or cause a greater physiological response (i.e., downstream effects) compared to the response caused by either vehicle or a control molecule/composition. A measurable physiological response may include an increase in T cell expansion, activation, effector function, persistence, and/or an increase in cancer cell death killing ability, among others apparent from the understanding in the art and the description herein. In certain embodiments, an“increased” or“enhanced” amount can be a“statistically significant” amount, and may include an increase that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all
integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response produced by vehicle or a control composition.
[00116] The terms“decrease” or“lower,” or“lessen,” or“reduce,” or“abate” refer generally to the ability of composition contemplated herein to produce, elicit, or cause a lesser physiological response (i.e., downstream effects) compared to the response caused by either vehicle or a control molecule/composition. In certain embodiments, a“decrease” or“reduced” amount can be a“statistically significant” amount, and may include a decrease that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response (reference response) produced by vehicle, a control composition, or the response in a particular cell lineage.
[00117] The terms “treat” or“treatment” of a state, disorder or condition include: (1) preventing, delaying, or reducing the incidence and/or likelihood of the appearance of at least one clinical or sub-clinical symptom of the state, disorder or condition developing in a subject that may be afflicted with or predisposed to the state, disorder or condition, but does not yet experience or display clinical or subclinical symptoms of the state, disorder or condition; or (2) inhibiting the state, disorder or condition, i.e., arresting, reducing or delaying the development of the disease or a relapse thereof or at least one clinical or sub-clinical symptom thereof; or (3) relieving the disease, i.e., causing regression of the state, disorder or condition or at least one of its clinical or sub-clinical symptoms. The benefit to a subject to be treated is either statistically significant or at least perceptible to the patient or to the physician.
[00118] The term“effective” applied to dose or amount refers to that quantity of a compound or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a subject in need thereof. Note that when a combination of active ingredients is administered, the effective amount of the combination may or may not include amounts of each ingredient that would have been effective if administered individually. The exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the condition being treated, the particular drug or drugs employed, the mode of administration, and the like.
[00119] The phrase“pharmaceutically acceptable”, as used in connection with compositions described herein, refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to a mammal (e.g., a human). Preferably, the term“pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the
U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans.
[00120] The term“protein” is used herein encompasses all kinds of naturally occurring and synthetic proteins, including protein fragments of all lengths, fusion proteins and modified proteins, including without limitation, glycoproteins, as well as all other types of modified proteins (e.g., proteins resulting from phosphorylation, acetylation, myristoylation, palmitoylation, glycosylation, oxidation, formylation, amidation, polyglutamylation, ADP- ribosylation, pegylation, biotinylation, etc.).
[00121] The terms“nucleic acid”,“nucleotide”, and“polynucleotide” encompass both DNA and RNA unless specified otherwise. By a“nucleic acid sequence” or“nucleotide sequence” is meant the nucleic acid sequence encoding an amino acid, the term may also refer to the nucleic acid sequence including the portion coding for any amino acids added as an artifact of cloning, including any amino acids coded for by linkers
[00122] The terms“patient”,“individual”,“subject”, and“animal” are used interchangeably herein and refer to mammals, including, without limitation, human and veterinary animals (e.g., cats, dogs, cows, horses, sheep, pigs, etc.) and experimental animal models. In a preferred embodiment, the subject is a human.
[00123] The term“carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions. Alternatively, the carrier can be a solid dosage form carrier, including but not limited to one or more of a binder (for compressed pills), a glidant, an encapsulating agent, a flavorant, and a colorant. Suitable pharmaceutical carriers are described in “Remington’s Pharmaceutical Sciences” by E.W. Martin.
[00124] Singular forms“a”,“an”, and“the” include plural references unless the context clearly dictates otherwise. Thus, for example, a reference to“a method” includes one or more methods, and/or steps of the type described herein and/or which will become apparent to those persons skilled in the art upon reading this disclosure.
[00125] The term“about” or“approximately” includes being within a statistically meaningful range of a value. Such a range can be within an order of magnitude, preferably within 50%, more preferably within 20%, still more preferably within 10%, and even more preferably within 5% of a given value or range. The allowable variation encompassed by the term“about” or
“approximately” depends on the particular system under study, and can be readily appreciated by one of ordinary skill in the art.
[00126] The practice of the present invention employs, unless otherwise indicated, conventional techniques of statistical analysis, molecular biology (including recombinant techniques), microbiology, cell biology, and biochemistry, which are within the skill of the art. Such tools and techniques are described in detail in e.g., Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual. 3rd ed. Cold Spring Harbor Laboratory Press: Cold Spring Harbor, New York; Ausubel et al. eds. (2005) Current Protocols in Molecular Biology. John Wiley and Sons, Inc.: Hoboken, NJ; Bonifacino et al. eds. (2005) Current Protocols in Cell Biology. John Wiley and Sons, Inc.: Hoboken, NJ; Coligan et al. eds. (2005) Current Protocols in Immunology, John Wiley and Sons, Inc.: Hoboken, NJ; Coico et al. eds. (2005) Current Protocols in Microbiology, John Wiley and Sons, Inc.: Hoboken, NJ; Coligan et al. eds. (2005) Current Protocols in Protein Science, John Wiley and Sons, Inc.: Hoboken, NJ; and Enna et al. eds. (2005) Current Protocols in Pharmacology, John Wiley and Sons, Inc.: Hoboken, NJ. Additional techniques are explained, e.g., in U.S. Patent No. 7,912,698 and U.S. Patent Appl. Pub. Nos. 2011/0202322 and 2011/0307437.
[00127] The technology illustratively described herein suitably may be practiced in the absence of any element(s) not specifically disclosed herein.
[00128] The terms and expressions which have been employed are used as terms of description and not of limitation, and use of such terms and expressions do not exclude any equivalents of the features shown and described or portions thereof, and various modifications are possible within the scope of the technology claimed.
Methods of Enhancing T Cell Function
[00129] In one aspect, the present disclosure provides a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell. The method includes modifying a Regnase-1 gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated.
[00130] The terms“expand” or“expansion” when used in relation to a T cell refer to the ability of the T cell to undergo cellular proliferation (i.e., to increase the number of cells). The terms used herein encompass both in vivo and in vitro T cell expansion.
[00131] The terms“persist” or“persistence” when used in relation to a T cell refer to the ability of the T cell (and/or its progenies) to be maintained in a recipient (e.g., a subject) for a period of time. The terms used herein encompass both in vivo and in vitro T cell persistence.
[00132] The term“anti-tumor function” as used herein refers to the ability of a T cell to inhibit
tumor growth and/or to kill the tumor cells (cancer cells).
[00133] The term“anti-infection function” as used herein refers to the ability of a T cell to inhibit the growth of a pathogen or a population of pathogens and/or kill a pathogen or a population of pathogens. A pathogen may be a virus, a bacterium, a fungus, a parasite, or a prion, or the like.
[00134] Regnase-1, also known as Zc3hl2a or MCPIPl, is an RNase that destabilizes a set of mRNAs, through cleavage of their 3’ untranslated regions (UTRs). The Regnase-1 gene has NCBI gene IDs of 80149 (human) and 230738 (mouse). As described in the Examples section below, Regnase-1 was identified as a major regulator of T cell effector responses, whose deficiency can cause reprogramming of T cells (specifically in the TME), resulting in markedly improved therapeutic efficacy. While not wishing to be bound by theory, Regnase-1 may function after initial T cell activation15 16 to enable precise temporal and spatial control of effector T cell responses. Further, Regnase-1 may restrain mitochondrial oxidative metabolism to limit effector T cell responses in tumor immunity, and function through a gene target BATF (Figure 14).
[00135] T cells that may be used in the present disclosure include, but are not limited to, thymocytes, naive T lymphocytes, immature T lymphocytes, mature T lymphocytes, resting T lymphocytes, or activated T lymphocytes. A T cell can be a T helper (Th) cell, for example a T helper 1 (Thl) or a T helper 2 (Th2) cell. The T cell can be a helper T cell (HTL; CD4+ T cell) CD4+ T cell, a cytotoxic T cell (CTL; CD8+ T cell), a tumor infiltrating cytotoxic T cell (TIL; CD8+ T cell), CD4+ CD8+ T cell, or any other subset of T cells. Other illustrative populations of T cells suitable for use in particular embodiments include naive T cells memory T cells, and NKT cells.
[00136] In some embodiments, the T cell a CD8+ ab T cell receptor (TCR) T cell, a CD4+ ab TCR T cell, a regulatory T cell (Treg), a natural killer T (NKT) cell, or a gd T cell. In a specific embodiment, the T cell is a CD8+ ab TCR T cell. In another specific embodiment, the T cell is a CD4+ ab TCR T cell. In a specific embodiment, the T cell is a regulatory T cell (Treg). The T cell may have the ability to target a tumor antigen or an infectious antigen.
[00137] T cells may be further engineered to express a T cell receptor or a chimeric antigen receptor (CAR). The T cell receptor or CAR may have an antigen-binding moiety that is capable of targeting a tumor antigen or an infectious antigen.
[00138] Non-limiting examples of tumor antigens that may be targeted by the modified T cell described herein include human epidermal growth factor receptor 2 (HER2), interleukin- 13 receptor subunit alpha-2 (IL-13Ra2), ephrin type-A receptor 2 (EphA2), A kinase anchor
protein 4 (AKAP-4), adrenoceptor beta 3 (ADRB3), anaplastic lymphoma kinase (ALK), immunoglobulin lambda- like polypeptide 1 (IGLL1), androgen receptor, angiopoietin-binding cell surface receptor 2 (Tie 2), B7H3 (CD276), bone marrow stromal cell antigen 2 (BST2), carbonic anhydrase IX (CAIX), CCCTC-binding factor (Zinc Finger Protein)-like (BORIS), CD171, CD 179a, CD24, CD300 molecule-like family member f (CD300LF), CD38, CD44v6, CD72, CD79a, CD79b, CD97, chromosome X open reading frame 61 (CXORF61), claudin 6 (CLDN6), CS-1 (CD2 subset 1, CRACC, SLAMF7, CD319, or 19A24), C-type lectin domain family 12 member A (CLEC12A), C-type lectin-like molecule-1 (CLL-1), Cyclin B 1, Cytochrome P450 IB 1 (CYP1B 1), EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2), epidermal growth factor receptor (EGFR), ERG (transmembrane protease, serine 2 (TMPRSS2) ETS fusion gene), ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML), Fc fragment of IgA receptor (FCAR), Fc receptor-like 5 (FCRL5), Fms-like tyrosine kinase 3 (FLT3), Folate receptor beta, Fos-related antigen 1, Fucosyl GM1, G protein-coupled receptor 20 (GPR20), G protein-coupled receptor class C group 5, member D (GPRC5D), ganglioside GD3, ganglioside GM3, glycoceramide (GloboH), Glypican-3 (GPC3), Hepatitis A virus cellular receptor 1 (HAVCR1), hexasaccharide portion of globoH, high molecular weight-melanoma-associated antigen (HMWMAA), human Telomerase reverse transcriptase (hTERT), interleukin 11 receptor alpha (IL-l lRa), KIT (CD117), leukocyte-associated immunoglobulin-like receptor 1 (LAIR1), leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2), Lewis(Y) antigen, lymphocyte antigen 6 complex, locus K 9 (LY6K), lymphocyte antigen 75 (LY75), lymphocyte-specific protein tyrosine kinase (LCK), mammary gland differentiation antigen (NY-BR-1), melanoma cancer testis antigen-1 (MAD-CT-1), melanoma cancer testis antigen- 2 (MAD-CT-2), melanoma inhibitor of apoptosis (ML-IAP), mucin 1, cell surface associated (MUC1), N-acetyl glucosaminyl-transferase V (NA17), neural cell adhesion molecule (NCAM), o-acetyl-GD2 ganglioside (OAcGD2), olfactory receptor 51E2 (OR51E2), p53 mutant, paired box protein Pax-3 (PAX3), paired box protein Pax-5 (PAX5), pannexin 3 (PANX3), placenta-specific 1 (PLAC1), platelet-derived growth factor receptor beta (PDGFR- beta), Poly sialic acid, proacrosin binding protein sp32 (OY-TES 1), prostate stem cell antigen (PSCA), Protease Serine 21 (PRSS21), Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2), Ras Homolog Family Member C (RhoC), sarcoma translocation breakpoints, sialyl Lewis adhesion molecule (sLe), sperm protein 17 (SPA17), squamous cell carcinoma antigen recognized by T cells 3 (SART3), stage-specific embryonic antigen-4 (SSEA-4), synovial sarcoma, X breakpoint 2 (SSX2), TCR gamma alternate reading frame protein (TARP), TGS5,
thyroid stimulating hormone receptor (TSHR), Tn antigen (Tn Ag), tumor endothelial marker 1 (TEM1/CD248), tumor endothelial marker 7-related (TEM7R), uroplakin 2 (UPK2), vascular endothelial growth factor receptor 2 (VEGFR2), v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN), Wilms tumor protein (WT1), and X Antigen Family, Member 1 A (XAGE1), or a fragment or variant thereof.
[00139] Additional antigens that may be targeted by the modified T cell described herein include, but are not limited to, carbonic anhydrase EX, alpha-fetoprotein, A3, antigen specific for A33 antibody, Ba 733, BrE3-antigen, CA125, CD1, CDla, CD3, CD5, CD15, CD16, CD19, CD20, CD21, CD22, CD23, CD25, CD30, CD33, CD38, CD45, CD74, CD79a, CD80, CD138, colon-specific antigen-p (CSAp), CEA (CEACAM5), CEACAM6, CSAp, EGFR, EGP-I, EGP-2, Ep-CAM, EphAl, EphA3, EphA4, EphA5, EphA6, EphA7, EphA8, EphAlO, EphBl, EphB2, EphB3, EphB4, EphB6, FIt-I, Flt-3, folate receptor, HLA-DR, human chorionic gonadotropin (HCG) and its subunits, hypoxia inducible factor (HIF-I), la, IL-2, IL-6, IL-8, insulin growth factor-1 (IGF-I), KC4-antigen, KS-l-antigen, KS1-4, Le-Y, macrophage inhibition factor (MIF), MAGE, MUC1, MUC2, MUC3, MUC4, NCA66, NCA95, NCA90, antigen specific for PAM-4 antibody, placental growth factor, p53, prostatic acid phosphatase, PSA, PSMA, RS5, SI 00, TAC, TAG-72, tenascin, TRAIL receptors, Tn antigen, Thomson- Friedenreich antigens, tumor necrosis antigens, VEGF, ED-B fibronectin, 17-lA-antigen, an angiogenesis marker, an oncogene marker or an oncogene product.
[00140] An infectious antigen may be a viral antigen, a bacterial antigen, a fungal antigen, a parasite antigen, or a prion antigen, or the like. Infectious antigens include the intact microorganism (e.g., virus, bacterium, fungus) as well as natural isolates and fragments or derivatives thereof and also synthetic or recombinant compounds which are identical to or similar to natural microorganism antigens and induce an immune response specific for that microorganism (e.g., virus, bacterium, fungus). A compound is similar to a natural microorganism antigen if it induces an immune response (humoral and/or cellular) to a natural microorganism antigen. Such antigens are used routinely in the art and are well known to the skilled artisan.
[00141] An infectious antigen may be an infectious virus or derived from an infectious virus. Non-limiting examples of infectious viruses that have been found in humans include but are not limited to: Adenoviridae (most adenoviruses); Arena viridae (hemorrhagic fever viruses); Bimaviridae; Bungaviridae (e.g., Hantaan viruses, bunga viruses, phleboviruses and Nairo viruses); Calciviridae (e.g., strains that cause gastroenteritis); Coronoviridae (e.g., coronaviruses); Filoviridae (e.g., ebola viruses); Flaviridae (e.g., dengue viruses, encephalitis
viruses, yellow fever viruses); Hepadnaviridae (Hepatitis B virus); Herpesviridae (herpes simplex virus (HSV) 1 and 2, varicella zoster virus, cytomegalovirus (CMV), herpes virus); Iridoviridae (e.g., African swine fever virus); Norwalk and related viruses, and astroviruses.; Orthomyxoviridae (e.g., influenza viruses); Papovaviridae (papilloma viruses, polyoma viruses); Paramyxoviridae (e.g., parainfluenza viruses, mumps virus, measles virus, respiratory syncytial virus); Parvovirida (parvoviruses); Picomaviridae (e.g., polio viruses, hepatitis A virus; enteroviruses, human Coxsackie viruses, rhinoviruses, echoviruses); Poxviridae (variola viruses, vaccinia viruses, pox viruses); Reoviridae (e.g., reoviruses, orbiviurses and rotaviruses); Retroviridae (e.g., human immunodeficiency viruses, such as HIV-1 (also referred to as HTLV-III, LAV or HTLV-III/LAV, or HIV-III); and other isolates, such as HIV-LP); Rhabdoviradae (e.g., vesicular stomatitis viruses, rabies viruses); Togaviridae (e.g., equine encephalitis viruses, rubella viruses); and unclassified viruses (e.g., the etiological agents of Spongiform encephalopathies, the agent of delta hepatitis, the agents of non- A, non-B hepatitis (class l=intemally transmitted; class 2=parenterally transmitted (i.e. Hepatitis C)).
[00142] An infectious antigen may be an infectious bacterium or derived from an infectious bacterium. Both gram negative and gram positive bacteria can serve as antigens in vertebrate animals. Such gram positive bacteria include, but are not limited to, Pasteurella species, Staphylococci species and Streptococcus species. Grain negative bacteria include, but are not limited to, Escherichia coli, Pseudomonas species, and Salmonella species. Non-limiting examples of infectious bacteria include but are not limited to: Actinomyces israelii, Bacillus antracis, Bacteroides sp., Borelia burgdorferi, Chlamydia. , Clostridium perfringers, Clostridium tetani, Corynebacterium diphtheriae, Corynebacterium sp., Enterobacter aerogenes, Enterococcus sp. , Erysipelothrix rhusiopathiae, Fusobacterium nucleatum, Haemophilus influenzae, Helicobacter pyloris, Klebsiella pneumoniae, Legionella pneumophilia, Leptospira, Listeria monocytogenes, Mycobacteria sps. (e.g., M tuberculosis, M avium, M gordonae, M intr acellular e, M kansaii), Neisseria gonorrhoeae, Neisseria meningitidis, Pasturella mult ocida, pathogenic Campylobacter sp., Rickettsia, Staphylococcus aureus, Streptobacillus monihformis, Streptococcus {anaerobic sps.), Streptococcus ( viridans group), Streptococcus agalactiae {Group B Streptococcus), Streptococcus bovis, Streptococcus faecalis, Streptococcus pneumoniae, Streptococcus pyogenes {Group A Streptococcus), Treponema pallidium, and Treponema pertenue.
[00143] An infectious antigen may be or derived from other infectious microorganisms. Non- limiting examples of infectious fungi include Cryptococcus neoformans, Histoplasma capsulatuin, Coccidioides immitis, Blastomyces dernatitidis, Chlamydia trachomatis and
Candida albicans. Other infectious organisms (i.e., protists) include: Plasmodium such as Plasmodium falciparum, Plasmodium malariae, Plasmodium ovale, Plasmodium vivax, Toxoplasma gondii and Shistosoma. Other medically relevant microorganisms have been descried extensively in the literature, e.g., see C. G. A. Thomas,“Medical Microbiology”, Bailliere Tindall, Great Britain 1983, which is hereby incorporated by reference in its entirety.
[00144] Other non-limiting examples of infectious antigens include viral antigens such as HIV antigens (e.g., gpl20, gpl60, pi 8, Tat, Gag, Pol, Env, Nef), glycoprotein from Herpesvirus, and surface antigen and core antigen from Hepatitis B virus; bacterial antigens such as OspA, OspB and OspC antigens from Borrelia sp; fungal and parasite antigens such as MP65 from Candida albicans and CS protein from Plasmodium sp..
[00145] In some embodiments, modifying the Regnase-1 gene and/or gene product in the T cell improves in vivo accumulation of the T cell. In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 10-fold as compared an unmodified T cell measured at day 7 after the Regnase-1 modification. In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 10-fold, about 30- fold, about 50-fold, about 70-fold, about 90-fold, about 100-fold, about 110-fold, about 120- fold, about 130-fold, about 140-fold, about 150-fold, about 160-fold, about 180-fold, about 200-fold, about 230-fold, about 250-fold or more as compared an unmodified T cell measured at day 7 after the Regnase-1 modification.
[00146] In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 100-fold as compared an unmodified T cell measured at day 14 after the Regnase- 1 modification. In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 100-fold, about 200-fold, about 300-fold, about 400-fold, about 500-fold, about 550-fold, about 600-fold, about 650-fold, about 670-fold, about 690-fold, about 700- fold, about 710-fold, about 720-fold, about 730-fold, about 740-fold, about 750-fold, about 760-fold, about 770-fold, about 780-fold, about 790-fold, about 800-fold, about 900-fold, about 1000-fold or more as compared an unmodified T cell measured at day 14 after the Regnase-1 modification.
[00147] In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 1000-fold as compared an unmodified T cell measured at day 21 after the Regnase-1 modification. In some embodiments, the in vivo accumulation of the T cell is improved more than at least about 1000-fold, about 1100-fold, about 1200-fold, about 1300- fold, about 1400-fold, about 1500-fold, about 1600-fold, about 1700-fold, about 1800-fold, about 1900-fold, about 2000-fold, about 2100-fold, about 2200-fold, about 2300-fold, about
2350-fold, about 2400-fold, about 2500-fold, about 2550-fold, about 2600-fold, about 2700- fold, about 2800-fold, about 2900-fold, about 3000-fold, or more as compared an unmodified T cell measured at day 14 after the Regnase-1 modification.
[00148] In addition to Regnase-1, additional gene(s) or gene product(s) in the T cell may be modified alone or in combination with Regnase-1 to enhance expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell. Additional genes or gene products that may be modified can be selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl. Other suitable genes or gene products that may be modified include Ireb2. Vtila, or Pexl 3. Additional suitable genes or gene products that may be modified include those listed in Table 1. Modifying one or more of such genes or gene products in addition to Regnase-1 may have synergetic or additive effects in enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell.
[00149] Ptpn2 has NCBI gene IDs of 5771 (human) and 19255 (mouse). Socsl has NCBI gene IDs of 8651 (human) and 12703 (mouse). Agps has NCBI gene IDs of 8540 (human) and 228061 (mouse). Rc3hl ( Roquin-1 ) has NCBI gene IDs of 149041 (human) and 381305 (mouse). Rcorl has NCBI gene IDs of 23186 (human) and 217864 (mouse). Ireb2 has NCBI gene IDs of 3658 (human) and 64602 (mouse). Vtila has NCBI gene IDs of 143187 (human) and 53611 (mouse). Pexl 3 has NCBI gene IDs of 5194 (human) and 72129 (mouse).
[00150] In some embodiments, the Regnase-1 gene and/or any additional gene(s) (e.g , Ptpn2, Socsl, Agps, RcShl, Rcorl, Ireb2, Vtila, or Pexl 3 ) in the T cell are modified with a site- specific nuclease. The term“site-specific nuclease” as used herein refers to a nuclease capable of specifically recognizing and cleaving a nucleic acid (DNA or RNA) sequence. Suitable site- specific nucleases for use in the present invention include, but are not limited to, an RNA- guided endonuclease (e.g., CRISPR-associated (Cas) proteins), a zinc finger nuclease, a TALEN nuclease, or a mega-TALEN nuclease.
[00151] Site-specific nucleases may create double-strand breaks (DSBs) or single-strand breaks (i.e., nicks) in a genomic DNA of a cell. Although not wishing to be bound by theory, these breaks are typically repaired by the cell using one of two mechanisms: non-homologous end joining (NHEJ) and homology-directed repair (HDR). In NHEJ, the double-strand breaks are repaired by direct ligation of the break ends to one another. As a result, no new nucleic acid material is inserted into the site, although a few bases may be lost or added, resulting in a small insertions and deletion (indel). In HDR, a donor polynucleotide with homology to the cleaved target DNA sequence is used as a template to repair the cleaved target DNA sequence, resulting in the transfer of genetic information from the donor polynucleotide to the target DNA. As
such, new nucleic acid material may be inserted or copied into the cleavage site. In some cases, an exogenous donor polynucleotide can be provided to the cell. The modifications of the target DNA due to NHEJ and/or HDR may lead to, for example, gene correction, gene replacement, gene tagging, transgene insertion, nucleotide deletion, gene disruption, gene mutation, sequence replacement, etc. Accordingly, cleavage of DNA by a site-directed nuclease may be used to delete nucleic acid material from a target DNA sequence by cleaving the target DNA sequence and allowing the cell to repair the sequence in the absence of an exogenously provided donor polynucleotide. Thus, the methods can be used to knock out a gene (resulting in complete lack of transcription or altered transcription) or to knock in genetic material (e.g., a transgene) into a locus of choice in the target DNA.
[00152] In some embodiments, the site-specific nuclease is an RNA-guided endonuclease. In particular, a group of RNA-guided endonucleases known as CRISPR-associated (Cas) proteins may be employed to genetically modify the T cell. A Cas protein may form an RNA-protein complex (referred to as RNP) with a guide RNA (gRNA) and is capable of cleaving a target site bearing sequence complementarity to a short sequence (typically about 20-40nt) in the gRNA.
[00153] Examples of Cas proteins useful in the methods of the present disclosure include Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas5e (CasD), Cas6, Cas6e, Cas6f, Cas7, Cas8al, Cas8a2, Cas8b, Cas8c, Cas9 (Csnl or Csxl2), Casio, CaslOd, CasF, CasG, CasH, Cpfl, Csyl, Csy2, Csy3, Csel (CasA), Cse2 (CasB), Cse3 (CasE), Cse4 (CasC), Cscl, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmrl, Cmr3, Cmr4, Cmr5, Cmr6, Csbl, Csb2, Csb3, Csxl7, Csxl4, CsxlO, Csxl6, CsaX, Csx3, Csxl, Csxl5, Csfl, Csf2, Csf3, Csf4, and Cul966, and homologs or modified versions thereof.
[00154] In some embodiments, the Cas protein used in the methods described herein is a Cas9 protein. The Cas9 protein may be from S. pyogenes, Streptococcus thermophilus, Neisseria meningitidis, F. novicida, S. mutans or Treponema denticola.
[00155] Cas proteins can be wild type proteins (i.e., those that occur in nature), modified Cas proteins (i.e., Cas protein variants), or fragments of wild type or modified Cas proteins. Cas proteins can also be active variants or fragments with respect to catalytic activity of wild type or modified Cas proteins. Active variants or fragments with respect to catalytic activity can comprise at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more sequence identity to the wild type or modified Cas protein or a portion thereof, wherein the active variants retain the ability to cut at a desired cleavage site and hence retain nick- inducing or double-strand-break-inducing activity.
[00156] A“guide RNA” or“gRNA” is an RNA molecule that binds to a Cas protein (e.g., Cas9 protein), or functional fragment or derivative thereof, and targets the Cas protein to a specific location within a target DNA. In some embodiments, the guide RNA is a single guide RNA (sgRNA). For Cas9, for example, a single-guide RNA can comprise a crRNA fused to a tracrRNA (e.g., via a linker). In some embodiments, the sgRNA is designed to target a locus within or near the Regnase-1 gene. In some embodiments, the sgRNA is designed to target a locus within or near the Ptpn2 gene. In some embodiments, the sgRNA is designed to target a locus within or near the Socsl gene. In some embodiments, the sgRNA is designed to target a locus within or near the Agps gene. In some embodiments, the sgRNA is designed to target a locus within or near the Rc3hl gene. In some embodiments, the sgRNA is designed to target a locus within or near the Rcorl gene. In some embodiments, the sgRNA is designed to target a locus within or near the Ireb2 gene. In some embodiments, the sgRNA is designed to target a locus within or near the Vli la gene. In some embodiments, the sgRNA is designed to target a locus within or near the Pexl 3 gene.
[00157] Exemplary sgRNAs useful for modifying a target gene described in the present disclosure include those that comprise a nucleotide sequence set forth in any one of SEQ ID NOs: 1, 2, and 5-9. For example, a sgRNA targeting the Regnase-1 gene may comprise a nucleotide sequence of SEQ ID NO: 1 or SEQ ID NO: 2, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 1 or SEQ ID NO: 2. For example, a sgRNA targeting the Ptpn2 gene may comprise a nucleotide sequence of SEQ ID NO: 5 or SEQ ID NO: 6, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 5 or SEQ ID NO: 6. For example, a sgRNA targeting the Socsl gene may comprise a nucleotide sequence of SEQ ID NO: 7 or SEQ ID NO: 8, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 7 or SEQ ID NO: 8. For example, a sgRNA targeting the Agps gene may comprise a nucleotide sequence of SEQ ID NO: 9, or a variant having at least at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 9. For example, a sgRNA targeting the Rc3hl gene may comprise a nucleotide sequence of SEQ ID NO: 42, or a variant having at least at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NO: 42.
[00158] Further exemplary sgRNAs targeting the Regnase-1 gene include those that comprise a nucleotide sequence set forth in any one of SEQ ID NOs: 29-34 and 36-41. For example, an sgRNA targeting the Regnase-1 gene may comprise a nucleotide sequence of any one of SEQ ID NOs: 29-34 and 36-41, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with SEQ ID NOs: 29-34 and 36-41.
[00159] In one embodiment, the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 29. In another embodiment, the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 34.
[00160] In one embodiment, the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 36. In another embodiment, the sgRNA targeting the Regnase-1 gene comprises a nucleotide sequence of SEQ ID NO: 41.
[00161] In alternative embodiments, the site-specific nuclease used in the methods described herein is a zinc finger nuclease, a transcription activator-like effector nuclease (TALEN), a mega-TALEN nuclease, and/or a restriction endonuclease.
[00162] The site-specific nuclease used in the methods described herein may include a zinc finger nuclease (ZFN). Zinc finger nucleases (ZFNs) are a class of engineered DNA-binding proteins that assist targeted editing of the genome by creating double-strand breaks in DNA at targeted locations. ZFNs typically comprise two functional domains: a) a DNA-binding domain comprising a chain of two-finger modules (each recognizing a unique hexamer (6 bp) sequence of DNA-two-finger modules are stitched together to form a Zinc Finger Protein, each with specificity of about 24 bp or more) and b) a DNA-cleaving domain comprising the nuclease domain of Fok I. When the DNA-binding and -cleaving domains are fused together, a ZFN can act like a highly-specific pair of“genomic scissors”.
[00163] The site-specific nuclease used in the methods described herein may include a transcription activator-like effector nuclease (TALEN). Transcription activator-like effector nucleases (TALEN) are a class of sequence-specific nucleases that can be used to make double strand breaks at specific target sequences in the genome of a prokaryotic or eukaryotic organism. They typically comprise a TAL effector DNA-binding domain fused to a DNA cleavage domain (a nuclease which cuts DNA strands). TAL effector nucleases can be created by fusing a native or engineered transcription activator-like (TAL) effector, or functional part thereof, to the catalytic domain of an endonuclease, such as, for example, Fokl. The unique, modular TAL effector DNA binding domain allows for the design of proteins with potentially
any given DNA recognition specificity. Thus, the DNA binding domains of the TAL effector nucleases can be engineered to recognize specific DNA target sites and thus, used to make double-strand breaks at desired target sequences. See, WO 2010/079430; Morbitzer et al. (2010) PNAS 10.1073/pnas.l013133107; Scholze & Boch (2010) Virulence 1:428-432; Christian et al. Genetics (2010) 186:757-761; Li et al. (2010) Nuc. Acids Res. doi: 10.1093/nar/gkq704; and Miller et al. (2011) Nature Biotechnology 29: 143-148; all of which are herein incorporated by reference in their entirety and for all purposes.
[00164] In some embodiments, the method involves silencing a Regnase-1 mRNA with an RNA interference (RNAi) molecule or an antisense oligonucleotide. RNA interference (RNAi) refers to the process of sequence-specific post-transcriptional gene silencing in animals mediated by small interfering RNAs (siRNAs) (Fire et al., 1998, Nature, 391, 806; Hamilton et al, 1999, Science, 286, 950-951). Any small nucleic acid molecules capable of mediating RNAi, such as a short interfering nucleic acid (siNA), a small interfering RNA (siRNA), a double-stranded RNA (dsRNA), a micro-RNA (miRNA), and a short hairpin RNA (shRNA), may be used to inhibit the expression of the Regnase-1 gene. An antisense oligonucleotide (ASO) is a short nucleotide sequence that can hybridize or bind (e.g., by Watson-Crick base pairing) in a complementary fashion to its target sequence.
[00165] In some embodiments, the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA). siRNAs, also known as short interfering RNA or silencing RNA, are a class of double-stranded RNA molecules, 20-25 base pairs in length, and operating within the RNA interference (RNAi) pathway. shRNAs or short hairpin RNAs are a group of artificial RNA molecules with a tight hairpin turn that can be used to silence target gene expression via RNA interference (RNAi).
[00166] In some embodiments, the methods also include inhibiting a Regnase-1 protein with one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
[00167] In some embodiments, Regnase-1 inhibitors may include a Zc3hl2a gene inhibitor and a Zc3hl2a protein inhibitor as those described in US patent No. 8,894,996, which is incorporated herein by reference in its entirety.
[00168] In another aspect, the present disclosure provides a method of enhancing expansion and/or persistence and/or an anti -tumor or an anti -infection function of a T cell, comprising increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
[00169] BATF, also known as basic leucine zipper transcription factor, ATF-like, is a nuclear
basic leucine zipper protein that belongs to the AP-l/ATF superfamily of transcription factors. The Batf gene has NCBI gene IDs of 10538 (human) and 53314 (mouse). As described in the Examples section below, BATF was identified as a key target of Regnase-1. BATF may serve as a limiting factor for programming effective antitumor responses, in part through shaping mitochondrial metabolism.
[00170] In some embodiments, the method comprises introducing into the T cell a polynucleotide encoding a BATF protein, or functional fragment or derivative thereof.
[00171] As a non-limiting example, the BATF protein encoded by the polynucleotide comprises the amino acid sequence of
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLE SEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQ PHVSSPRFQP ( Homo sapiens, UniProtKB-Q 16520; SEQ ID NO: 25), or an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more sequence identity to SEQ ID NO: 25. As another non-limiting example, the BATF protein encoded by the polynucleotide comprises the amino acid sequence of
MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLE SEDLEKQNAALRKEIKQLTEELKYFTS VL S SHEPLC S VL AS GTP S PPEV V Y S AHAFHQ PHISSPRFQP ( Mus musculus UniProtKB-035284; SEQ ID NO: 26), or an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more sequence identity to SEQ ID NO: 26.
[00172] As a non-limiting example, the polynucleotide encoding a BATF protein comprises the nucleotide sequence of aaagcgagcgacatgtccctttggggagcagtccctctgcaccccagagtgaggaggacgcaggggtcagaggtggctacagggc aggcagaggaggcacctgtagggggtggtgggctggtggcccaggagaagtcaggaagggagcccagctggtgacaagagagc ccagaggtgcctggggctgagtgtgagagcccggaagatttcagccatgcctcacagctccgacagcagtgactccagcttcagcc gctctcctccccctggcaaacaggactcatctgatgatgtgagaagagttcagaggagggagaaaaatcgtattgccgcccagaaga gccgacagaggcagacacagaaggccgacaccctgcacctggagagcgaagacctggagaaacagaacgcggctctacgcaag gagatcaagcagctcacagaggaactgaagtacttcacgtcggtgctgaacagccacgagcccctgtgctcggtgctggccgccag cacgccctcgccccccgaggtggtgtacagcgcccacgcattccaccaacctcatgtcagctccccgcgcttccagccctgagcttcc gatgcggggagagcagagcctcgggaggggcacacagactgtggcagagctgcgcccatcccgcagaggcccctgtccacctgg agacccggagacagaggcctggacaaggagtgaacacgggaactgtcacgactggaagggcgtgaggcctcccagcagtgccg cagcgtttcgaggggcgtgtgctggaccccaccactgtgggttgcaggcccaatgcagaagagtattaagaaagatgctcaagtccc atggcacagagcaaggcgggcagggaacggttatttttctaaataaatgctttaaaagaaa ( Homo sapiens, NCBI gene
ID of 10538; SEQ ID NO: 27), or a nucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more sequence identity to SEQ ID NO: 27. As another non-limiting example, the polynucleotide encoding a BATF protein comprises the nucleotide sequence of gcagtccctctgcacccgagagagaggaggacgcaggggtctgtcagaggttgctgttgggcaagcaggggaggtacctgtggaa ggtggtgtgctggtggccccctagcagtcaagaaggggagccagctagtgagaagatcgcccagaggcatctgggacggtgtggg agagcccggaagattagaaccatgcctcacagctccgacagcagtgactccagcttcagccgctctcctccccctggcaaacaggac tcatctgatgatgtgaggaaagttcagaggagagagaagaatcgcatcgctgcccagaagagccgacagagacagacacagaaag ccgacacccttcacctggagagtgaggacctggagaaacagaacgcagctctccgcaaagagatcaaacagctcaccgaggagct caagtacttcacatcagtgctgagcagccacgagcccctgtgctccgtgctggccagtggcaccccctcgccccccgaggtggtata cagtgcccatgccttccaccagcctcacatcagctcgccacgcttccagccctgaccttctggacaagaagggcgatgctactcccgt gatcccttggaggggcatgtaaactgaggccgggctgccctcatacctctacccagaggcccagtggcagaggcctggacaagtatt gaacacaagaactgtagtggtcagagggacttaaggcctcccagggaagtatagtcaatgtactggactctcccagggaagtcgagc caatgtactggacccaaaaaatgacaagtcaaccctggactgtcatgaatgatgcccaaaatacacagcacagagggaggagggca gggggtggatagttttctaaataaatattttctaaaaaacca (Mus musculus NCBI gene ID of 53314; SEQ ID NO: 28), or anucleotide sequence having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more sequence identity to SEQ ID NO: 28.
[00173] In certain embodiments, the polynucleotide encoding a BATF protein, or functional fragment or derivative thereof, is introduced into the T cell in a recombinant vector. The recombinant vector may be a viral vector or non-viral vector, such as those described herein.
[00174] In certain embodiments, increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell is achieved by administering to the T cell an agent (e.g., a small molecule or an antibody) that upregulates Batf gene expression and/or directly enhances or activates the BATF protein function.
[00175] In certain embodiments, in addition to increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell, the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl), Ptpn2, Socsl, Agps, Rc3hl, and Rcorl. In some embodiments, the additional gene(s) or gene product(s) is Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl).
[00176] In another aspect, the present disclosure provides a method of enhancing expansion and/or persistence and/or an anti-tumor or an anti-infection function of a T cell, comprising modifying a Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl) gene or gene product in the T cell
such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell. In certain embodiments, the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of said additional gene(s) or gene product(s) in said T cell is reduced or eliminated, wherein said additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, md Rcorl.
[00177] In another aspect, the present disclosure provides a method of improving mitochondrial biogenesis and/or function in a T cell comprising modifying a Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and/or increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell. In certain embodiments, the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of said additional gene(s) or gene product(s) in said T cell is reduced or eliminated, wherein said additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
[00178] As used herein, the term“mitochondrial biogenesis” refers to the process by which cells increase mitochondrial mass. As used herein, the term“mitochondrial function” refers to any mitochondria-dependent cellular metabolism.
[00179] Effects of improved mitochondrial function and/or mitochondrial biogenesis may include without limitation observations that the method of this invention improves T accumulation and function in tumors, helps promote endurance, helps promote recovery after exercise, helps reduce muscle fatigue, helps reduce muscle soreness, complements the immediate short term effect of caffeine with a sustained effect on energy generation, helps promote energy generation from fat, helps lower plasma lactate during exercise, helps maintain muscle force in conditions of oxidative stress, helps protect against exercise-induced oxidative stress, helps the body to come up with more energy in a natural and sustained way, helps the body to find more energy without getting too much caffeine, gives long-lasting energy to sustain through busy schedule, helps boost body’s own energy production in a natural sustained way, helps maintain more even energy levels throughout the day, helps the body to adapt to exercise, helps prepare the body for exercise goals, helps revamp shape, facilitates the restart of exercise program, increased muscle work capacity, improved aerobic capacity, enhanced physical performance, enhanced exercise performance, improved running endurance, improved running distance and/or improved running time, or stimulate energy formation from nutrients.
[00180] Isolation/Enrichment of T cells
[00181] The T cells may be autologous/autogeneic (“self’) or non-autologous (“non-self,” e.g., allogeneic, syngeneic or xenogeneic). In some embodiments, the T cells are obtained from a mammalian subject. In other embodiments, the T cells are obtained from a primate subject. In some embodiments, the T cells are obtained from a human subject.
[00182] Lymphocytes can be obtained from sources such as, but not limited to, peripheral blood mononuclear cells, bone marrow, lymph nodes tissue, cord blood, thymus issue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. Lymphocytes may also be generated by differentiation of stem cells. In some embodiments, lymphocytes can be obtained from blood collected from a subject using techniques generally known to the skilled person, such as sedimentation, e.g., FICOLL™ separation.
[00183] In some embodiments, the T cell is derived from a blood, marrow, tissue, or tumor sample.
[00184] In some embodiments, cells from the circulating blood of a subject are obtained by apheresis. An apheresis device typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In some embodiments, the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing. The cells can be washed with PBS or with another suitable solution that lacks calcium, magnesium, and most, if not all other, divalent cations. A washing step may be accomplished by methods known to those in the art, such as, but not limited to, using a semiautomated flowthrough centrifuge (e.g., Cobe 2991 cell processor, or the Baxter CytoMate). After washing, the cells may be resuspended in a variety of biocompatible buffers, cell culture medias, or other saline solution with or without buffer.
[00185] In some embodiments, T cells can be isolated from peripheral blood mononuclear cells (PBMCs) by lysing the red blood cells and depleting the monocytes. As an example, the cells can be sorted by centrifugation through a PERCOLL™ gradient. In some embodiments, after isolation of PBMC, both cytotoxic and helper T lymphocytes can be sorted into naive, memory, and effector T cell subpopulations either before or after activation, expansion, and/or genetic modification.
[00186] In some embodiments, T lymphocytes can be enriched. For example, a specific subpopulation of T lymphocytes, expressing one or more markers such as, but not limited to, CD3, CD4, CD8, CD14, CD15, CD16, CD19, CD27, CD28, CD34, CD36, CD45RA, CD45RO, CD56, CD62, CD62L, CD122, CD123, CD127, CD235a, CCR7, HLA-DR or a
combination thereof using either positive or negative selection techniques. In some embodiments, the T lymphocytes for use in the compositions of the invention do not express or do not substantially express one or more of the following markers: CD57, CD244, CD160, PD-1, CTLA4, TIM3, and LAG3.
[00187] Stimulation/ Activation of T cells
[00188] In order to reach sufficient therapeutic doses of T cell compositions, T cells are often subjected to one or more rounds of stimulation/activation. In some embodiments, a method of producing T cells for administration to a subject comprises stimulating the T cells to become activated in the presence of one or more stimulatory signals or agents (e.g., compound, small molecule, e.g., small organic molecule, nucleic acid, polypeptide, or a fragment, isoform, variant, analog, or derivative thereol). In some embodiments, a method of producing T cells for administration to a subject comprises stimulating the T cells to become activated and to proliferate in the presence of one or more stimulatory signals or agents.
[00189] T cells can be activated by inducing a change in their biologic state by which the cells express activation markers, produce cytokines, proliferate and/or become cytotoxic to target cells. All these changes can be produced by primary stimulatory signals. Co-stimulatory signals amplify the magnitude of the primary signals and suppress cell death following initial stimulation resulting in a more durable activation state and thus a higher cytotoxic capacity.
[00190] T cells can be activated generally using methods as described, for example, in U.S. Patents 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; and 6,867,041, each of which is incorporated herein by reference in its entirety.
[00191] In some embodiments, the T cells can be activated by binding to an agent that activates Oϋ3z.
[00192] In other embodiments, a CD2-binding agent may be used to provide a primary stimulation signal to the T cells. For example, and not by limitation, CD2 agents include, but are not limited to, CD2 ligands and anti-CD2 antibodies, e.g., the T1 1.3 antibody in combination with the T1 1.1 or Tl 1.2 antibody (Meuer, S. C. et al. (1984) Cell 36:897-906) and the 9.6 antibody (which recognizes the same epitope as TI 1.1) in combination with the 9-1 antibody (Yang, S. Y. et al. (1986) J. Immunol. 137: 1097-1100, which is incorporated herein by reference in its entirety). Other antibodies which bind to the same epitopes as any of the above described antibodies can also be used.
[00193] In some embodiments, the T cells are activated by administering phorbol myristate acetate (PMA) and ionomycine. In some embodiments, the T cells are activated by
administering an appropriate antigen that induces activation and then expansion. In some embodiments, PMA, ionomycin, and/or appropriate antigen are administered with CD3 induce activation and/or expansion.
[00194] In general, the activating agents used in the present invention includes, but is not limited to, an antibody, a fragment thereof and a proteinaceous binding molecule with antibody -like functions. Examples of (recombinant) antibody fragments are Fab fragments, Fv fragments, single-chain Fv fragments (scFv), a divalent antibody fragment such as an (Fab)2'- fragment, diabodies, triabodies (Iliades, P., et al, FEBS Lett (1997) 409, 437-441, which is incorporated herein by reference in its entirety), decabodies (Stone, E., et al., Journal of Immunological Methods (2007) 318, 88-94, which is incorporated herein by reference in its entirety) and other domain antibodies (Holt, L. J., et al, Trends Biotechnol. (2003), 21, 11, 484-490, which is incorporated herein by reference in its entirety). The divalent antibody fragment may be an (Fab)2'-fragment, or a divalent single-chain Fv fragment while the monovalent antibody fragment may be selected from the group consisting of a Fab fragment, a Fv fragment, and a single-chain Fv fragment (scFv).
[00195] In some embodiments, one or more binding sites of the Oϋ3z agents may be a bivalent proteinaceous artificial binding molecule such as a dimeric lipocalin mutein ( /. e. duocalin). In some embodiments the receptor binding reagent may have a single second binding site, (i.e., monovalent). Examples of monovalent agents include, but are not limited to, a monovalent antibody fragment, a proteinaceous binding molecule with antibody-like binding properties or an MHC molecule. Examples of monovalent antibody fragments include, but are not limited to a Fab fragment, a Fv fragment, and a single-chain Fv fragment (scFv), including a divalent single-chain Fv fragment.
[00196] The agent that specifically binds CD3 includes, but is not limited to, an anti-CD3- antibody, a divalent antibody fragment of an anti-CD3 antibody, a monovalent antibody fragment of an anti-CD3 -antibody, and a proteinaceous CD3-binding molecule with antibody- like binding properties. A proteinaceous CD3-binding molecule with antibody-like binding properties can be an aptamer, a mutein based on a polypeptide of the lipocalin family, a glubody, a protein based on the ankyrin scaffold, a protein based on the crystalline scaffold, an adnectin, and an avimer. It also can be coupled to a bead.
[00197] In some embodiments, the activating agent (e.g., CD3-binding agents) can be present in a concentration of about 0.1 to about 10 pg/ml. In some embodiments, the activating agent (e.g., CD3-binding agents) can be present in a concentration of about 0.2 pg/ml to about 9 pg/ml, about 0.3 pg/ml to about 8 pg/ml, about 0.4 pg/ml to about 7 pg/ml, about 0.5 pg/ml to
about 6 mg/ml, about 0.6 pg/ml to about 5 pg/ml. about 0.7 pg/ml to about 4 pg/ml. about 0.8 pg/ml to about 3 pg/ml. or about 0.9 pg/ml to about 2 pg/ml. In some embodiments, the activating agent (e.g., CD3-binding agents) is administered at a concentration of about 0.1 pg/ml, about 0.2 pg/ml, about 0.3 pg/ml. about 0.4 pg/ml. about 0.5 pg/ml. about 0.6 pg/ml. about 0.7 pg/ml. about 0.8 mM, about 0.9 pg/ml. about 1 pg/ml. about 2 pg/ml. about 3 pg/ml. about 4 mM, about 5 pg/ml. about 6 pg/ml. about 7 pg/ml. about 8 pg/ml. about 9 pg/ml . or about 10 pg/ml. In some embodiments, the CD3-binding agents can be present in a concentration of 1 pg/ml.
[00198] In some embodiments, the activating agent is attached to a solid support such as, but not limited to, a bead, an absorbent polymer present in culture plate or well or other matrices such as, but not limited to, Sepharose or glass; may be expressed (such as in native or recombinant forms) on cell surface of natural or recombinant cell line by means known to those skilled in the art.
[00199] Polynucleotide and/or Polypeptide Transfer in T cells
[00200] In some embodiments, the T cells are genetically modified by introducing polynucleotides and/or polypeptide (e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, an antisense oligonucleotide, a CAR, or polynucleotides encoding the same) into the cells. The T cells can be genetically modified after stimulation/activation. In some embodiments, the T cells are modified within 12 hours, 16 hours, 24 hours, 36 hours, or 48 hours of stimulation/activation. In some embodiments, the cells are modified within 16 to 24 hours after stimulation/activation. In some embodiments, the T cells are modified within 24 hours.
[00201] In order to genetically modify the T cell, the polynucleotides and/or polypeptide (e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, an antisense oligonucleotide, a CAR, a BAFT protein, or polynucleotides encoding the same) must be transferred into the cell. Polynucleotide and/or polypeptide transfer may be via viral, non-viral gene delivery methods, or a physical method. Suitable methods for polynucleotide and/or polypeptide delivery for use with the current methods include any method known by those of skill in the art, by which a polynucleotide and/or polypeptide can be introduced into an organelle, cell, tissue or organism.
[00202] In various embodiments, polypeptides or polynucleotides (e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, an antisense oligonucleotide, a CAR, a BAFT protein, or polynucleotides encoding the same) described in the present invention are introduced to the T cell via a recombinant vector.
[00203] In some embodiments, the vector is a viral vector. Suitable viral vectors that can be
used in the present invention include, but are not limited to, a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated viral (AAV) vector, a herpes viral vector, or a baculoviral vector. In one specific embodiment, the viral vector is a lentiviral vector. In one specific embodiment, the viral vector is a retroviral vector.
[00204] In some embodiments, the T cells can be transduced via retroviral transduction. References describing retroviral transduction of genes are Anderson et al, U.S. Pat. No. 5,399,346; Mann et al, Cell 33: 153 (1983); Temin et al., U.S. Pat. No. 4,650,764; Temin et al., U.S. Pat. No. 4,980,289; Markowitz et al., J. Virol. 62: 1120 (1988); Temin et al., U.S. Pat. No. 5,124,263; International Patent Publication No. WO 95/07358, published Mar. 16, 1995, by Dougherty et al; and Kuo et al, Blood 82:845 (1993), each of which is incorporated herein by reference in its entirety.
[00205] One method of genetic modification includes ex vivo modification. Various methods are available for transfecting cells and tissues removed from a subject via ex vivo modification. For example, retroviral gene transfer in vitro can be used to genetically modified cells removed from the subject and the cell transferred back into the subject. See e.g., Wilson et al., Science, 244: 1344-1346, 1989 andNabel et al., Science, 244(4910): 1342-1344, 1989, both of which are incorporated herein by reference in their entity. In some embodiments, the T cells may be removed from the subject and transfected ex vivo using the polynucleotides (e.g., expression vectors) of the invention. In some embodiments, the T cells obtained from the subject can be transfected or transduced with the polynucleotides (e.g., expression vectors) of the invention and then administered back to the subject.
[00206] In some embodiments, polynucleotides and/or polypeptides are transferred to the cell in a non-viral vector (e.g., a transposon, a plasmid). The non-viral vector may be an RNA and/or DNA vector.
[00207] Nucleic acid vaccines may also be used to transfer polynucleotides into the T cells. Such vaccines include, but are not limited to non-viral polynucleotide vectors,“naked” DNA and RNA, and viral vectors. Methods of genetically modifying cells with these vaccines, and for optimizing the expression of genes included in these vaccines are known to those of skill in the art.
[00208] In some embodiments, the polynucleotide(s) is operatively linked to at least one regulatory element for expression of the gene product (e.g., a site-specific nuclease, a guide RNA, an RNAi molecule, a CAR, a BAFT protein). The regulatory element can be capable of mediating expression of the gene product in the host cell (e.g., modified T cell). Regulatory elements include, but are not limited to, promoters, enhancers, initiation sites, polyadenylation
(polyA) tails, IRES elements, response elements, and termination signals. In some embodiments, the regulatory element regulates expression of the gene product. In some embodiments, the regulatory element increased the expression of the gene product. In some embodiments, the regulatory element increased the expression of the gene product once the host cell (e.g., modified T cell) is activated. In some embodiments, the regulatory element decreases expression of the gene product. In some embodiments, the regulatory element decreases expression of the gene product once the host cell (e.g., modified T cell) is activated.
[00209] In various embodiment, polypeptides or polynucleotides (e.g., a CAR, a signaling molecule, site-specific nuclease, an RNAi molecule or an antisense oligonucleotide, a BAFT protein, or polynucleotides encoding the same) are introduced into the modified T cell using a physical means. Suitable physical means include, but are not limited to, electroporation, microinjection, magnetofection, ultrasound, a ballistic or hydrodynamic method, or a combination thereof.
[00210] Electroporation is a method for polynucleotide and/or polypeptide delivery. See e.g., Potter et al, (1984) Proc. Nat’l Acad. Sci. USA, 81, 7161-7165 and Tur-Kaspa et al, (1986) Mol. Cell Biol., 6, 716-718, both of which are incorporated herein in their entirety for all purposes. Electroporation involves the exposure of a suspension of cells and DNA to a high- voltage electric discharge. In some embodiments, cell wall-degrading enzymes, such as pectin degrading enzymes, can be employed to render the T cells more susceptible to genetic modification by electroporation than untreated cells. See e.g., U.S. Pat. No. 5,384,253, incorporated herein by reference in its entirety for all purposes.
[00211] In vivo electroporation involves a basic injection technique in which a vector is injected intradermally in a subject. Electrodes then apply electrical pulses to the intradermal site causing the cells localized there (e.g., resident dermal dendritic cells), to take up the vector. These tumor antigen-expressing dendritic cells activated by local inflammation can then migrate to lymph-nodes.
[00212] Methods of electroporation for use with this invention include, for example, Sardesai, N. Y., and Weiner, D. B., Current Opinion in Immunotherapy 23:421-9 (2011) and Ferraro, B. et al, Human Vaccines 7: 120-127 (2011), both of which are hereby incorporated by reference herein in their entirety for all purposes.
[00213] In some embodiments, the present invention provides a method of modifying a gene in a cell, comprising introducing into the cell a site-specific nuclease via electroporation. In some embodiments, Cas9 protein and one or more guide RNAs are combined to form a ribonucleoprotein (RNP) complex. In some embodiments, the guide RNA comprises a
nucleotide sequence as set forth in any one of SEQ ID NOs: 1-9, 29-34 and 36-42, or a nucleotide sequence having at least 80% identity thereof. In some embodiments, the guide RNA comprises the nucleotide sequence of SEQ ID NO: 29, SEQ ID NO: 34, SEQ ID NO: 36 or SEQ ID NO: 41. An exemplary protocol is detailed in Example 14 in the Examples section below. It was shown in Example 14 that this method results in higher targeting efficiency compared to application of CRISPR/Cas9 for gene editing using viral delivery of Cas9 and guide RNA. Using this method to edit a gene (e.g., Regnase-1 ), the editing efficiency was greater than 90% based on deep sequencing results. The RNP electroporation method also had lower toxicity for T cells compared to DNA electroporation.
[00214] Another method for polynucleotide and/or polypeptide transfer includes injection. In some embodiments, a polypeptide, a polynucleotide or viral vector may be delivered to a cell, tissue, or organism via one or more injections (e.g., a needle injection). Non-limiting methods of injection include injection of a composition (e.g., a saline based composition). Polynucleotides and/or polynucleotides can also be introduced by direct microinjection. Non- limiting sites of injection include, subcutaneous, intradermal, intramuscular, intranodal (allows for direct delivery of antigen to lymphoid tissues) intravenous, intraprotatic, intratumor, intralymphatic (allows direct administration of DCs) and intraperitoneal. It is understood that proper site of injection preparation is necessary (e.g., shaving of the site of injection to observe proper needle placement).
[00215] Additional methods of polynucleotide and/or polypeptide transfer include liposome- mediated transfection (e.g., polynucleotide entrapped in alipid complex suspended in an excess of aqueous solution. See e.g., Ghosh and Bachhawat, (1991) In: Liver Diseases, Targeted Diagnosis and Therapy Using Specific Receptors and Ligands pp. 87-104). Also contemplated is a polynucleotide and/or polypeptide complexed with Lipofectamine, or Superfect); DEAE- dextran (e.g., a polynucleotide is delivered into a cell using DEAE-dextran followed by polyethylene glycol. See e.g., Gopal, T. U., MoI Cell Biol. 1985 May; 5(5): 1188-90); calcium phosphate (e.g., polynucleotide is introduced to the cells using calcium phosphate precipitation. See e.g., Graham and van der Eb, (1973) Virology, 52, 456-467; Chen and Okayama, Mol. Cell Biol., 7(8):2745-2752, 1987), and Rippe et al, Mol. Cell Biol., 10:689-695, 1990); sonication loading (introduction of a polynucleotide by direct sonic loading. See e.g., Fechheimer et al, (1987) Proc. Nat'lAcad. Sci. USA, 84, 8463-8467); microprojectile bombardment (e.g., one or more particles may be coated with at least one polynucleotide and/or polypeptide and delivered into cells by apropelling force. See e.g., U.S. Pat. No. 5,550,318; U.S. Pat. No. 5,538,880; U.S. Pat. No. 5,610,042; and PCT Application WO 94/09699; Klein et al, (1987) Nature, 327, 70-
73, Yang et al., (1990) Proc. Nat'l Acad. Sci. USA, 87, 9568-9572); and receptor-mediated transfection (e.g., selective uptake of macromolecules by receptor-mediated endocytosis that will be occurring in a target cell using cell type-specific distribution of various receptors. See e.g., Wu and Wu, (1987) J. Biol. Chem., 262, 4429-4432; Wagner et al., Proc. Natl. Acad. Sci. USA, 87(9):3410-3414, 1990; Perales et al., Proc. Natl. Acad. Sci. USA, 91 :4086-4090, 1994; Myers, EPO 0273085; Wu and Wu, Adv. Drug Delivery Rev., 12: 159-167, 1993; Nicolau et al., (1987) Methods Enzymol., 149, 157-176), each reference cited here is incorporated by reference in their entirety for all purposes.
[00216] Expansion/Proliferation of T cells
[00217] After the T cells are activated and transduced, the cells are cultured to proliferate. T cells may be cultured for at least 1, 2, 3, 4, 5, 6, or 7 days, at least 2 weeks, at least 1, 2, 3, 4, 5, or 6 months or more with 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more rounds of expansion.
[00218] Agents that can be used for the expansion of T cells can include interleukins, such as IL-2, IL-7, IL-15, or IL-21 (see for example Cornish et al. 2006, Blood. 108(2):600-8, Bazdar and Sieg, 2007, Journal of Virology, 2007, 81(22): 12670-12674, Battalia et al, 2013, Immunology, 139(1): 109-120, each of which is incorporated by reference in their entirety for all purposes). Other illustrative examples for agents that may be used for the expansion of T cells are agents that bind to CD8, CD45 or CD90, such as a CD8, a CD45 or a CD90 antibodies. Illustrative examples of T cell population including antigen-specific T cells, T helper cells, cytotoxic T cells, memory T cell (an illustrative example of memory T-cells are CD62L|CD8| specific central memory T cells) or regulatory T cells (an illustrative example of Treg are CD4+CD25+CD45RA+ Treg cells).
[00219] Additional agents that can be used to expand T lymphocytes includes methods as described, for example, in U.S. Patents 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; and 6,867,041, each of which is incorporated herein by reference in its entirety.
[00220] In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 20 units/ml to about 200 units/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 25 units/ml to about 190 units/ml, about 30 units/ml to about 180 units/ml, about 35 units/ml to about 170 units/ml, about 40 units/ml to about 160 units/ml, about 45 units/ml to about 150 units/ml, about 50 units/ml to about 140 units/ml, about 55 units/ml to about 130 units/ml, about 60 units/ml to
about 120 units/ml, about 65 units/ml to about 110 units/ml, about 70 units/ml to about 100 units/ml, about 75 units/ml to about 95 units/ml, or about 80 units/ml to about 90 units/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 20 units/ml, about 25 units/ml, about 30 units/ml, 35 units/ml, 40 units/ml, 45 units/ml, about 50 units/ml, about 55 units/ml, about 60 units/ml, about 65 units/ml, about 70 units/ml, about 75 units/ml, about 80 units/ml, about 85 units/ml, about 90 units/ml, about 95 units/ml, about 100 units/ml, about 105 units/ml, about 110 units/ml, about 115 units/ml, about 120 units/ml, about 125 units/ml, about 130 units/ml, about 135 units/ml, about 140 units/ml, about 145 units/ml, about 150 units/ml, about 155 units/ml, about 160 units/ml, about 165 units/ml, about 170 units/ml, about 175 units/ml, about 180 units/ml, about 185 units/ml, about 190 units/ml, about 195 units/ml, or about 200 units/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 5 mg/ml to about 10 ng/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 5.5 ng/ml to about 9.5 ng/ml, about 6 ng/ml to about 9 ng/ml, about 6.5 ng/ml to about 8.5 ng/ml, or about 7 ng/ml to about 8 ng/ml. In some embodiments, the agent(s) used for expansion (e.g., IL-7, IL-15) are administered at about 5 ng/ml, 6 ng/ml, 7 ng/ml, 8 ng/ml, 9, ng/ml, or 10 ng/ml.
[00221] Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media (MEM), RPMI Media 1640, Lonza RPMI 1640, Advanced RPMI, Clicks, AIM-V, DMEM, a-MEM, F-12, TexMACS, X-Vivo 15, andX-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion).
[00222] Examples of other additives for T cell expansion include, but are not limited to, surfactant, piasmanate, pH buffers such as HEPES, and reducing agents such as N-acetyl- cysteine and 2-mercaptoethanol, Antibiotics (e.g., penicillin and streptomycin), are included only in experimental cultures, not in cultures of cells that are to be infused into a subject. The target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C) and atmosphere (e.g., air plus 5% CO2).
[00223] In further embodiments, methods of the present disclosure described herein (e.g., modifying a Regnase-1 gene or gene product) may be applied to enhance a NK cell function. NK cell refers to a differentiated lymphocyte with a CD3- CD16+, CD3- CD56+, CD16+ CD56+ and/or CD57+ TCR- phenotype.
[00224] In some embodiments, NK cells can be isolated and/or enriched. For example, a specific subpopulation of T lymphocytes, expressing one or more markers such as, but not
limited to, CD2, CD 16, CD56, CD57, CD94, CD 122 or a combination thereof may be selected using either positive or negative selection techniques.
[00225] NK cells can be activated generally using methods as described, for example, in U.S. Patents 7,803,376, 6,949,520, 6,693,086, 8,834,900, 9,404,083, 9,464,274, 7,435,596, 8,026,097, 8,877,182; U.S. Patent Applications US2004/0058445, US2007/0160578, US2013/0011376, US2015/0118207, US2015/0037887; and PCT Patent Application WO2016/122147, each of which is incorporated herein by reference in its entirety.
[00226] In some embodiments, the NK based host cells can be activated by, for example and not limitation, inhibition of inhibitory receptors on NK cells (e.g., KIR2DL1, KIR2DL2/3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR3DL1, KIR3DL2, KIR3DL3, LILRBl, NKG2A, NKG2C, NKG2E or LILRB5 receptor).
[00227] In some embodiments, the NK cells can be activated by, for example and not limitation, feeder cells (e.g., native K562 cells or K562 cells that are genetically modified to express 4-1BBL and cytokines such as IL15 or IL21).
[00228] In some embodiments, interferons or macrophage-derived cytokines can be used to activate NK cells. For example and not limitation, such interferons include but are not limited to interferon alpha and interferon gamma, and such cytokines include but are not limited to IL- 15, IL-2, IL-21.
[00229] In some embodiments, the NK activating agent can be present in a concentration of about 0.1 to about 10 pg/ml. In certain embodiments, the NK activating agent can be present in a concentration of about 0.2 pg/ml to about 9 pg/ml, about 0.3 pg/ml to about 8 pg/ml, about 0.4 pg/ml to about 7 pg/ml, about 0.5 pg/ml to about 6 pg/ml, about 0.6 pg/ml to about 5 pg/ml, about 0.7 pg/ml to about 4 pg/ml, about 0.8 pg/ml to about 3 pg/ml, or about 0.9 pg/ml to about
2 pg/ml. In certain embodiments, the NK activating agent is administered at a concentration of about 0.1 pg/ml, about 0.2 pg/ml, about 0.3 pg/ml, about 0.4 pg/ml, about 0.5 pg/ml, about 0.6 pg/ml, about 0.7 pg/ml, about 0.8 pM, about 0.9 pg/ml, about 1 pg/ml, about 2 pg/ml, about
3 pg/ml, about 4 pM, about 5 pg/ml, about 6 pg/ml, about 7 pg/ml, about 8 pg/ml, about 9 pg/ml, or about 10 pg/ml. In certain embodiments, the NK activating agent can be present in a concentration of 1 pg/ml.
[00230] After the NK cells are activated and transduced, the cells are cultured to proliferate. NK cells may be cultured for at least 1, 2, 3, 4, 5, 6, or 7 days, at least 2 weeks, at least 1, 2, 3, 4, 5, or 6 months or more with 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more rounds of expansion.
[00231] Agents that can be used for the expansion of NK cells can include agents that bind to CD 16 or CD56, such as for example aCD16 or aCD56 antibodies. In some embodiments, the
binding agent includes antibodies (see for example Hoshino et al, Blood. 1991 Dec. 15; 78(12):3232-40.). Other agents that may be used for expansion of NK cells may be IL-15 (see for example Vitale et al. 2002. The Anatomical Record. 266:87-92, which is incorporated by reference in their entirety for all purposes).
Compositions of the Invention
[00232] Compositions of the present disclosure include, but are not limited to, cell compositions and pharmaceutical compositions.
[00233] In one aspect, the present disclosure provides modified T cells produced by the methods described herein. Modified T cells of the present disclosure have enhanced expansion and/or persistence and/or anti-tumor or anti-infection function. In some embodiments, the T cell is a CD8+ ab TCR T cell. In some embodiments, the T cell is a CD4+ ab TCR T cell. In some embodiments, the T cell is a regulatory T cell (Treg). In some embodiments, the T cell is engineered to express a T cell receptor or chimeric antigen receptor (CAR).
[00234] In one aspect, the present disclosure provides a pharmaceutical composition comprising the modified T cells prepared using the methods described herein and a pharmaceutically acceptable carrier and/or excipient. Examples of pharmaceutical carriers include but are not limited to sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions.
[00235] Compositions comprising modified T cells disclosed herein may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
[00236] Compositions comprising modified T cells disclosed herein may comprise one or more of the following: sterile diluents such as water for injection, saline solution, preferably physiological saline, Ringer's solution, isotonic sodium chloride, fixed oils such as synthetic mono or diglycerides which may serve as the solvent or suspending medium, polyethylene glycols, glycerin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of
glass or plastic. An injectable pharmaceutical composition is preferably sterile.
[00237] In some embodiments, the compositions are formulated for parenteral administration, e.g., intravascular (intravenous or intraarterial), intraperitoneal, intratumoral, intraventricular, intrapleural or intramuscular administration. In some embodiments, the composition is reconstituted from a lyophilized preparation prior to administration.
[00238] In some embodiments, the modified T cells may be mixed with substances that adhere or penetrate prior to their administration, e.g., but not limited to, nanoparticles.
[00239] In another aspect, provided herein are isolated polynucleotides for use in the methods and compositions described herein. In some embodiments, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of any one of SEQ ID NOs: 1-9, 29-34 and 36-42, or a variant having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% sequence identity with any one of SEQ ID NOs: 1-9, 29-34 and 36-42.
[00240] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 1.
[00241] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 2.
[00242] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 29.
[00243] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 34.
[00244] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 36.
[00245] In one embodiment, an isolated polynucleotide of the present disclosure comprises the nucleotide sequence of SEQ ID NO: 41.
[00246] In various embodiments, the isolated polynucleotide is a DNA molecule. In various embodiments, the isolated polynucleotide is an RNA molecule. In some embodiments, the isolated polynucleotide may comprise modified nucleotides. Modified nucleotides may include any of those known to a skilled artisan.
[00247] In some embodiments, the isolated polynucleotide is a guide RNA. In some embodiments, the guide RNA is a single guide RNA (sgRNA).
[00248] In some embodiments, the isolated polynucleotide is or is encoded in a recombinant vector. The recombinant vector may be a viral vector or non-viral vector, such as those described herein.
Therapeutic Methods
[00249] In one aspect, the present disclosure provides a method of treating a disease in a subject in need thereof, including administering to the subject an effective amount of the modified T cells or the pharmaceutical composition described herein. The modified T cells may be prepared using the methods as disclosed above.
[00250] In some embodiments, the modified T cells are autologous cells. In some embodiments, the modified T cells are allogeneic cells.
[00251] The treatment may be carried out by isolating a T cell or a population of T cells from the subject (e.g., for autologous cell transfer) or a donor (e.g., for allogeneic cell transfer); modifying a Regnase-1 gene or gene product in the T cell(s) such that the expression and/or function of Regnase-1 in the T cell(s) is reduced or eliminated; and administering an effective amount of the modified T cells to the subject. Optionally, the T cell(s) may be activated and/or expanded before or after the modification step. In some embodiments, one or more additional genes or gene products, including but not limited to Ptpn2, Socsl, Agps, Rc3hl, Rcorl, Ireb2, Vtila, or Pexl 3, may be modified alone or in combination with Regnase-1 and/or Baff in the T cell(s) such that the expression and/or function of the modified gene(s) in the T cell(s) is reduced or eliminated.
[00252] The treatment may be carried out by isolating a T cell or a population of T cells from the subject (e.g., for autologous cell transfer) or a donor (e.g., for allogeneic cell transfer); increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell; and administering an effective amount of the modified T cells to the subject. Optionally, the T cell(s) may be activated and/or expanded before or after the modification step. In some embodiments, the method further comprises modifying one or more additional genes or gene products in the T cell such that the expression and/or function of the additional gene(s) or gene product(s) in the T cell is reduced or eliminated, wherein the additional gene(s) or gene product(s) are selected from Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl), Ptpn2, Socsl, Agps, Rc3hl, and Rcorl. In some embodiments, the additional gene(s) or gene product(s) is Regnase-1 (REGNASE-1, Zc3hl2a, MCPIPl).
[00253] In some embodiments, the disease being treated by the therapeutic methods of the present disclosure is a cancer or an infectious disease.
[00254] The terms“cancer” and“cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. The term“cancer” includes, for example, the soft tissue tumors (e.g., lymphomas), and tumors of the blood and blood-forming organs (e.g., leukemias), and solid tumors, which is one that grows in an
anatomical site outside the bloodstream (e.g., carcinomas). Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma (e.g., osteosarcoma or rhabdomyosarcoma), and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g., epithelial squamous cell cancer), adenosquamous cell carcinoma, lung cancer (e.g., including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung), cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer (e.g., including gastrointestinal cancer, pancreatic cancer), cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, primary or metastatic melanoma, multiple myeloma and B-cell lymphoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, brain (e.g., high grade glioma, diffuse pontine glioma, ependymoma, neuroblastoma, or glioblastoma), as well as head and neck cancer, and associated metastases. Additional examples of cancer can be found in The Merck Manual of Diagnosis and Therapy, 19th Edition, § on Hematology and Oncology, published by Merck Sharp & Dohme Corp., 2011 (ISBN 978-0-911910-19-3); The Merck Manual of Diagnosis and Therapy, 20th Edition, § on Hematology and Oncology, published by Merck Sharp & Dohme Corp., 2018 (ISBN 978-0-911-91042-1) (2018 digital online edition at internet website of Merck Manuals); and SEER Program Coding and Staging Manual 2016, each of which are incorporated by reference in their entirety for all purposes.
[00255] In some embodiments, the cancer is a solid tumor. Non-limiting examples of solid tumors that may be treated by the therapeutic methods of this present disclosure include ovarian cancer, lung cancer (e.g., non-small cell lung squamous cell carcinoma, adenocarcinoma, large cell carcinoma types, and small cell lung cancer), breast cancer, colon cancer, kidney cancer (e.g., renal cell carcinomas), bladder cancer, liver cancer (e.g., hepatocellular carcinoma), stomach cancer, cervical cancer, prostate cancer, testicular cancer, pancreatic cancer, nasopharyngeal cancer, thyroid cancer (e.g., thyroid papillary carcinoma), skin cancers (e.g., melanoma), brain cancer (e.g., glioma, astrocytoma and medulloblastoma) and sarcoma (e.g., osteosarcoma and Ewing's sarcoma). In some embodiments, the cancer is a melanoma, colon cancer, breast cancer, or brain cancer.
[00256] In some embodiments, the cancer is a blood cancer. In some embodiments, the blood cancer is a lymphoma, leukemia, or multiple myeloma. Non-limiting examples of leukemia that may be treated by the therapeutic methods of this present disclosure include acute
lymphoblastic leukemia (ALL), B-cell acute lymphoblastic leukemia, T-cell acute lymphoblastic leukemia, acute non-lymphocytic leukemia (ANLL), acute myeloblastic leukemia (AML), acute promyelocytic leukemia (APL), acute monocytic leukemia, acute erythroleukemia leukemia, acute megakaryoblastic leukemia, chronic myelogenous leukemia (CML), hairy cell leukemia, and chronic lymphocytic leukemia (CLL). Non-limiting examples of lymphoma that may be treated by the therapeutic methods of this present disclosure include lymphoplasmacytic lymphoma, small lymphocytic lymphoma (SLL), splenic marginal zone B cell lymphoma, nodal marginal band B cell lymphoma, prolymphocytic white blood, follicular lymphoma (FL), mantle cell lymphoma (MCL), Burkitf s lymphoma, and diffuse large B-cell lymphoma (DLBCL) Hodgkin lymphoma, lymphoblastic lymphoma, anaplastic large cell lymphoma (ALCL), subcutaneously T cell lymphoma, peripheral T-cell lymphoma, angioimmunoblastic ball lymphoma, angiocentric lymphoma (nasal type T cell lymphoma), malignant lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma, follicular lymphoma, and other lymphomas of lymphoid origin and skin.
[00257] In some embodiments of therapeutic methods described above, the composition is administered in a therapeutically effective amount. The dosages of the composition administered in the methods of the invention will vary widely, depending upon the subject’s physical parameters, the frequency of administration, the manner of administration, the clearance rate, and the like. The initial dose may be larger, and might be followed by smaller maintenance doses. The dose may be administered as infrequently as weekly or biweekly, or fractionated into smaller doses and administered daily, semi-weekly, etc., to maintain an effective dosage level. It is contemplated that a variety of doses will be effective to achieve in vivo persistence of the modified T cells. It is also contemplated that a variety of doses will be effective to improve in vivo effector function of the modified T cells.
[00258] In some embodiments, composition comprising the T cells manufactured by the methods described herein may be administered at a dosage of 102 to 1010 cells/kg body weight, 105 to 109 cells/kg body weight, 105 to 108 cells/kg body weight, 105 to 107 cells/kg body weight, 107 to 109 cells/kg body weight, or 107 to 108 cells/kg body weight, including all integer values within those ranges. The number of T cells will depend on the therapeutic use for which the composition is intended for.
[00259] Modified T cells may be administered multiple times at dosages listed above. The T cells may be allogeneic, syngeneic, xenogeneic, or autologous to the patient undergoing therapy.
[00260] The compositions and methods described in the present disclosure may be utilized in
conjunction with other types of therapy for cancer, such as chemotherapy, surgery, radiation, gene therapy, and so forth.
[00261] The compositions and methods described in the present disclosure may be used to treat an infectious disease. Infectious diseases are well known to those skilled in the art, and non-limiting examples include but are not limited to infections of viral etiology such as HIV, influenza, Herpes, viral hepatitis, Epstein Bar, polio, viral encephalitis, measles, chicken pox, Papilloma virus; infections of bacterial etiology such as pneumonia, tuberculosis, syphilis; or infections of parasitic etiology such as malaria, trypanosomiasis, leishmaniasis, trichomoniasis, amoebiasis.
[00262] It is also contemplated that when used to treat various diseases/disorders, the compositions and methods of the present disclosure can be utilized with other therapeutic methods/agents suitable for the same or similar diseases/disorders. Such other therapeutic methods/agents can be co-administered (simultaneously or sequentially) to generate additive or synergistic effects. Suitable therapeutically effective dosages for each agent may be lowered due to the additive action or synergy.
[00263] In some embodiments of any of the above therapeutic methods, the method further comprises administering to the subject one or more additional compounds selected from the group consisting of immuno-suppressives, biologicals, probiotics, prebiotics, and cytokines (e.g., IFN or IL-2).
[00264] As a non-limiting example, the invention can be combined with other therapies that block inflammation (e.g., via blockage of IL1, INFa/b, IL6, TNF, IL23, etc.).
[00265] The methods and compositions of the disclosure can be combined with other immunomodulatory treatments such as, e.g., therapeutic vaccines (including but not limited to GVAX, DC-based vaccines, etc.), checkpoint inhibitors (including but not limited to agents that block CTLA4, PD1, LAG3, TIM3, etc.) or activators (including but not limited to agents that enhance 4-1BB, 0X40, etc.). The methods of the invention can be also combined with other treatments that possess the ability to modulate NKT function or stability, including but not limited to CD Id, CD ld-fusion proteins, CD Id dimers or larger polymers of CD Id either unloaded or loaded with antigens, CD 1 d-chimeric antigen receptors (CDld-CAR), or any other of the five known CD1 isomers existing in humans (CDla, CDlb, CDlc, CDle). The methods of the invention can also be combined with other treatments such as midostaurin, enasidenib, or a combination thereof.
[00266] Therapeutic methods of the disclosure can be combined with additional immunotherapies and therapies. For example, when used for treating cancer, the compositions
of the invention can be used in combination with conventional cancer therapies, such as, e.g., surgery, radiotherapy, chemotherapy or combinations thereof, depending on type of the tumor, patient condition, other health issues, and a variety of factors. In certain aspects, other therapeutic agents useful for combination cancer therapy with the inhibitors of the invention include anti-angiogenic agents. Many anti-angiogenic agents have been identified and are known in the art, including, e.g., TNP-470, platelet factor 4, thrombospondin- 1, tissue inhibitors of metalloproteases (TIMP1 and TIMP2), prolactin (16-Kd fragment), angiostatin (38-Kd fragment of plasminogen), endostatin, bFGF soluble receptor, transforming growth factor beta, interferon alpha, soluble KDR and FLT-1 receptors, placental proliferin-related protein, as well as those listed by Carmeliet and Jain (2000). In one embodiment, the T cells of the invention can be used in combination with a VEGF antagonist or a VEGF receptor antagonist such as anti-VEGF antibodies, VEGF variants, soluble VEGF receptor fragments, aptamers capable of blocking VEGF or VEGFR, neutralizing anti-VEGFR antibodies, inhibitors of VEGFR tyrosine kinases and any combinations thereof (e.g., anti-hVEGF antibody A4.6.1, bevacizumab or ranibizumab).
[00267] Non-limiting examples of chemotherapeutic compounds which can be used in combination treatments of the present invention include, for example, aminoglutethimide, amsacrine, anastrozole, asparaginase, azacitidine, beg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, decitabine, dienestrol, diethylstilbestrol, docetaxel, doxorubicin, epirubicin, estradiol, estramnustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, genistein, goserelin, hydroxyurea, idarubicin, ifosfamide, imatinib, interferon, irinotecan, ironotecan, letrozole, leucovorin, leuprobde, levamisole, lomustine, mechlorethamine, medroxyprogesterone, megestrol, melphalan, mercaptopurine, mesna, methotrexate, mitomycin, mitotane, mitoxantrone, nilutamide, nocodazole, octreotide, oxabplatin, pacbtaxel, pamidronate, pentostatin, plicamycin, porfimer, procarbazine, raltitrexed, rituximab, streptozocin, suramin, tamoxifen, temozolomide, teniposide, testosterone, thioguanine, thiotepa, titanocene dichloride, topotecan, trastuzumab, tretinoin, vinblastine, vincristine, vindesine, and vinorelbine.
[00268] These chemotherapeutic compounds may be categorized by their mechanism of action into, for example, following groups: anti-metabolites/anti-cancer agents, such as pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine) and
purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiprobferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (pacbtaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthracy dines, bleomycin, busulfan, camptothecin, carboplatin, chlorambucil, cisplatin, cyclophosphamide, cytoxan, dactinomycin, daunorubicin, doxorubicin, epirubicin, hexamethyhnelamineoxabplatin, iphosphamide, melphalan, merchlorehtamine, mitomycin, mitoxantrone, nitrosourea, plicamycin, procarbazine, taxol, taxotere, teniposide, triethylenethiophosphoramide and etoposide (VP 16)); antibiotics such as dactinomycin (actinomycin D), daunorubicin, doxorubicin (adriamycin), idarubicin, anthracycbnes, mitoxantrone, bleomycins, plicamycin (mithramycin) and mitomycin; enzymes (L-asparaginase which systemically metabolizes L-asparagine and deprives cells which do not have the capacity to synthesize their own asparagine); antiplatelet agents; antiprobferative/antimitotic alkylating agents such as nitrogen mustards (mechlorethamine, cyclophosphamide and analogs, melphalan, chlorambucil), ethylenimines and methylmelamines (hexamethylmelamine and thiotepa), alkyl sulfonates-busulfan, nitrosoureas (carmustine (BCNU) and analogs, streptozocin), trazenes-dacarbazinine (DTIC); antiprobferative/antimitotic antimetabolites such as folic acid analogs (methotrexate); platinum coordination complexes (cisplatin, carboplatin), procarbazine, hydroxyurea, mitotane, aminoglutethimide; hormones, hormone analogs (estrogen, tamoxifen, goserelin, bicalutamide, nilutamide) and aromatase inhibitors (letrozole, anastrozole); anticoagulants (heparin, synthetic heparin salts and other inhibitors of thrombin); fibrinolytic agents (such as tissue plasminogen activator, streptokinase and urokinase), aspirin, dipyridamole, ticlopidine, clopidogrel, abciximab; antimigratory agents; antisecretory agents (breveldin); immunosuppressives (cyclosporine, tacrolimus (FK-506), sirolimus (rapamycin), azathioprine, mycophenolate mofetil); anti-angiogenic compounds (e.g., TNP-470, genistein, bevacizumab) and growth factor inhibitors (e.g., fibroblast growth factor (FGF) inhibitors); angiotensin receptor blocker; nitric oxide donors; anti-sense oligonucleotides; antibodies (trastuzumab); cell cycle inhibitors and differentiation inducers (tretinoin); mTOR inhibitors, topoisomerase inhibitors (doxorubicin (adriamycin), amsacrine, camptothecin, daunorubicin, dactinomycin, eniposide, epirubicin, etoposide, idarubicin and mitoxantrone, topotecan, irinotecan), corticosteroids (cortisone, dexamethasone, hydrocortisone, methylpednisolone, prednisone, and prenisolone); growth factor signal transduction kinase inhibitors; mitochondrial
dysfunction inducers and caspase activators; and chromatin disruptors.
[00269] In various embodiments of the therapeutic methods described herein, the subject is a human. The subject may be a juvenile or an adult, of any age or sex.
[00270] In accordance with the present invention there may be numerous tools and techniques within the skill of the art, such as those commonly used in molecular biology, pharmacology, and microbiology. Such tools and techniques are described in detail in e.g., Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual. 3rd ed. Cold Spring Harbor Laboratory Press: Cold Spring Harbor, New York; Ausubel et al. eds. (2005) Current Protocols in Molecular Biology. John Wiley and Sons, Inc.: Hoboken, NJ; Bonifacino et al. eds. (2005) Current Protocols in Cell Biology. John Wiley and Sons, Inc.: Hoboken, NJ; Coligan et al. eds. (2005) Current Protocols in Immunology, John Wiley and Sons, Inc.: Hoboken, NJ; Coico et al. eds. (2005) Current Protocols in Microbiology, John Wiley and Sons, Inc.: Hoboken, NJ; Coligan et al. eds. (2005) Current Protocols in Protein Science, John Wiley and Sons, Inc.: Hoboken, NJ; and Enna et al. eds. (2005) Current Protocols in Pharmacology, John Wiley and Sons, Inc.: Hoboken, NJ.
EXAMPLES
[00271] The present invention is also described and demonstrated by way of the following examples. However, the use of these and other examples anywhere in the specification is illustrative only and in no way limits the scope and meaning of the invention or of any exemplified term. Likewise, the invention is not limited to any particular preferred embodiments described here. Indeed, many modifications and variations of the invention may be apparent to those skilled in the art upon reading this specification, and such variations can be made without departing from the invention in spirit or in scope. The invention is therefore to be limited only by the terms of the appended claims along with the full scope of equivalents to which those claims are entitled.
EXAMPLE 1. Identification of Regnase-1 as a major negative regulator of CD8+ T cell antitumor responses using in vivo CRISPR-Cas9 mutagenesis screening
[00272] To systematically investigate metabolism-associated factors whose loss can improve T cell accumulation within tumors, a pooled CRISPR-Cas9 mutagenesis screening approach was developed in a mouse melanoma ACT model (Figure 1A), which has been used successfully in a short hairpin RNA (shRNA)-based screening17.
[00273] First, constitutive //av«26-Cas9-e\pressing mice18 (The Jackson Laboratory) were crossed with OT-I T-cell receptor transgenic mice19 (The Jackson Laboratory) to express Cas9 in ovalbumin-specific CD8+ T cells (OT-I cells) that recognize B16 melanoma cells expressing
ovalbumin as a surrogate tumor antigen (B 16-Ova cells)20. All mice were kept in a specific pathogen-free facility in the Animal Resource Center at St. Jude Children’s Research Hospital. Animal protocols were approved by the Institutional Animal Care and Use Committee of St. Jude Children’s Research Hospital. Naive Cas9-expressing OT-I cells were isolated from the spleen and peripheral lymph nodes (PLNs) of Cas9-OT-I mice using naive CD8a+ T cell isolation kit (Miltenyi Biotec 130-096-543) according to manufacturer's instructions. Purified naive OT-I cells were activated in vitro for 18 h with 10 pg/ml anti-CD3 (2C11; Bio X Cell), 5 pg/ml anti-CD28 (37.51; Bio X Cell) before viral transduction.
[00274] Next, two sub-libraries of sgRNAs were developed, each consisting of 9,051 sgRNAs targeting 3,017 cell metabolism-related genes (6 sgRNAs per gene altogether) encoding metabolic enzymes, small molecule transporters, and metabolism-related transcriptional regulators21, as well as 500 non-targeting control sgRNAs in a lentiviral vector containing Ametrine fluorescent protein. Viral transduction was performed by spin-infection at 800 g at 25 °C for 3 h with 10 pg/ml polybrene (Sigma). Cells were continued to culture with human IL-2 (20 Ul/ml; PeproTech), mouse IL-7 (25 ng/ml; PeproTech) and IL-15 (12.5 ng/ml; PeproTech) for 3-4 days. Transduced cells were sorted using a Reflection (i-Cyt) before adoptive transfer into recipients.
[00275] After transduction of the sgRNA library and in vitro activation and expansion to allow gene editing to occur, sgRNA-transduced OT-I cells were adoptively transferred into B16-Ova melanoma-bearing mice. Seven days later, OT-I cells in tumor-infiltrating lymphocytes (TILs) were purified by flow cytometry, and library representation in TILs and pre-transfer (input) OT-I cells was examined by deep sequencing of sgRNA cassehe. sgRNAs capable of improving ACT were expected to be enriched in tumor-infiltrating OT-I cells. After merging the quantification results from two sub-libraries, candidate genes were ranked based on the average enrichment of their 6 gene-specific sgRNAs in tumor-infiltrating OT-I cells relative to input (log2 ratio (TIL/input); adjusted P < 0.05).
[00276] There were a total of 218 genes significantly depleted (by less than -1.0 log2 ratio (TIL/input); adjusted P < 0.05) in the screening, indicative of impaired survival or expansion in the absence of these putative positive regulators of T cell responses, including Txnrdl 22 (log2 ratio (TIL/input) = -4.23), Ldha23 (log2 ratio (TIL/input) = -3.30), Fthl24 (log2 ratio (TIL/input) = -3.25), and Foxol25·26 (log2 ratio (TIL/input) = -2.39) that are important regulators of T cell survival and expansion (Figure IB). Strikingly, Zc3hl2a (also known as Regnase-1, encodes Regnase-1) was the mostly highly enriched gene in this screening (Figure
IB), with all of its targeting sgRNAs ranked at top 6 of the most enriched sgRNAs, suggesting that Regnase-1 could be a major negative regulator of antitumor responses.
[00277] For the lentiviral sgRNA metabolic library CRISPR-Cas9 mutagenesis screening, the following methods were used.
[00278] Lentiviral and retroviral sgRNA vector design: The lentiviral sgRNA vector was generated from lentiGuide-puro vector by replacing the“EF-la PuroR” fragment with a mouse PGK promoter-driven Ametrine (or GFP or mCherry) fluorescent protein. The retroviral sgRNA vector was generated from pLMPd-Amt vector27 by replacing the miR30 shRNA cassette with the U6 promoter driven gRNA cassette from the lentiGuide-puro vector.
[00279] Lentiviral sgRNA metabolic library construction: The gene list of mouse metabolic library was based on the reported human metabolic genes21. A total of 6 gRNAs were designed for each mouse metabolic gene according to previously -published selection criteria28 and were split into two sub-libraries (AAAQ05 and AAAR07), each containing 500 non-targeting controls. sgRNAs were designed by using the online sgRNA design tool (portals.broadinstitute.org/gpp/public/analysis-tools/sgma-design). Oligonucleotides containing the guide sequence were synthesized (Custom Array), PCR amplified, and cloned into the recipient vector via a Golden Gate cloning procedure, including 5 pi Tango Buffer (ThermoFisher), 5 mΐ DTT (10 mM stock); 5 mΐ ATP (10 mM stock); 500 ng vector, pre digested with Esp3I, gel -extracted, and isopropanol-precipitation purified; 100 ng insert PCR product; 1 mΐ Esp3I (ThermoFisher ER0452); 1 mΐ T7 ligase (Enzymatics, 3,000 Units/ mΐ, L6020L); and water, up to 50 mΐ, and incubated in cycle (5 min at 37 °C and 5 min at 20 °C) for 100 times. The product was then purified by isopropanol precipitation and electroporated into STBL4 cells (Life Technologies 11635018). The distribution ofthe library was determined by Illumina sequencing.
[00280] Selected sgRNAs used in this study were as follows:
non-targeting control sgRNA: ATGACACTTACGGTACTCGT (SEQ ID NO: 10);
sgRegnase-1: AAGGCAGTGGTTTCTTACGA (SEQ ID NO: 1);
sgRegnase-1 #2: GGAGTGGAAACGCTTCATCG (SEQ ID NO: 2);
sg Batf AGAGATCAAACAGCTCACCG (SEQ ID NO: 3);
sgBatf#2 : AGGACTCATCTGATGATGTG (SEQ ID NO: 4);
sg Ptpn2: AAGAAGTTACATCTTAACAC (SEQ ID NO: 5);
sg Ptpn2 #2: CACTCTATGAGGATAGTCAT (SEQ ID NO: 6);
sg Socsl: TGATGCGCCGGTAATCGGAG (SEQ ID NO: 7);
sg Socsl #2: TGGTGCGCGACAGTCGCCAA (SEQ ID NO: 8);
sg Agps: GTACCAATGAGTGCAAAGCG (SEQ ID NO: 9);
sgRc3hl: GGTAGAGGGTTACTACCCGG (SEQ ID NO: 42).
[00281] In vivo screening: Lentivirus was produced by co-transfecting HEK293T cells with the lentiviral metabolic library plasmids, psPAX2 (Addgene plasmid # 12260) and pCAG4- Eco. At 48 h after transfection, virus was harvested and froze at -80 °C. Four hundred to five hundred million naive Cas9-expressing OT-I cells were isolated from 8-14 Cas9-OT-I mice and transduced at a MOI of 0.3 to achieve -20% transduction efficiency. After viral transduction, cells were cultured with human IL-2 (20 IU/ml; PeproTech), mouse IL-7 (25 ng/ml; PeproTech) and IL-15 (12.5 ng/ml; PeproTech) for 4 days. Transduced cells expressing Ametrine were sorted using a Reflection sorter (i-Cyt), and an aliquot of 5 c 106 transduced OT-I cells was saved as“input” (-500 c cell coverage per sgRNA). Transduced OT-I cells (5 x 106 cells per recipient) were z.v. transferred into mice at day 14 after B 16-Ova melanoma engraftment. Sixty recipients were randomly divided into 3 groups as biological replicates in each sub-library screening. At 7 days after adoptive transfer, transferred Ametrine+ OT-I cells were recovered from the tumor pooled from 20 recipients per sample using a Reflection sorter (i-Cyt). On average, 5 c 105 OT-I cells per sample (-50 c cell coverage per sgRNA) were recovered for further analysis.
[00282] Sequencing library preparation: Genomic DNA was extracted by using the DNeasy Blood & Tissue Kits (Qiagen 69506). Primary PCR was performed by using the KOD Hot Start DNA Polymerase (Millipore 71086) and the following pair of Nextera NGS primers (Nextera NGS-F: TCGTCGGCAGCGTCAGATGTGTATAAGAGACAGttgtggaaaggacgaaacaccg
(SEQ ID NO: 11); Nextera NGS-R: GTCTCGTGGGCTCGGAGATGTGTATAAGAGAC AGccactttttcaagttgataacgg (SEQ ID NO: 12). Primary PCR products were purified using the AMPure XP beads (Beckman A63881). A second PCR was performed to add adaptors and indexes to each sample. Hi-Seq 50-bp single-end sequencing (Illumina) was performed.
[00283] Data processing: For data analysis, FastQ files obtained after sequencing were demultiplexed using the HiSeq Analysis software (Illumina). Single-end reads were trimmed and quality-filtered using the CLC Genomics Workbench vl l (Qiagen) and matched against sgRNA sequences from the sgRNA metabolic library. Read counts for sgRNAs were normalized against total read counts across all samples. For each sgRNA, the fold change (log2 ratio) for enrichment was calculated between each of the biological replicates and the input experiment. Gene ranking was based on the average enrichment among replicates in
representation of 6 individual corresponding sgRNAs (combing two sub-libraries) in sgRNA metabolic sub-libraries, respectively. The gene level false discovery rate adjusted P-value was calculated among multiple sgRNAs of each gene, using a paired two-tailed /-test between log2 transformed average normalized read counts of tumor samples and those of input sample, and a value of less than 0.05 was considered to be statistically significant.
[00284] For tumor-infiltrating lymphocyte (TIL) isolation, B 16-Ova melanoma was excised, minced and digested with 0.5 mg/ml Collagenase IV (Roche) + 200 IU/ml DNase I (Sigma) for 1 h at 37°C, and then passed through 70 pm filters to remove undigested tumor. TILs were then isolated by density-gradient centrifugation over Percoll (Life Technologies).
[00285] For flow cytometry analysis, cells were stained in PBS (Gibco) containing 2% (wt/vol) BSA (Sigma). Surface proteins were stained for 30 min on ice. Intracellular staining was performed with Foxp3/Transcription Factor Staining Buffer Set according to manufacturer’s instructions (eBioscience). Intracellular staining for cytokines was performed with fixation/permeabilization kit (BD Biosciences). Caspase-3 staining was performed using instructions and reagents from the“Active Caspase-3 Apoptosis Kit” (BD Biosciences). BrdU staining was performed using instructions and reagents from the“APC BrdU Flow Kit” (BD Biosciences). 7-AAD (Sigma) or Fixable viability dye (eBioscience) was used for dead cell exclusion. The following antibodies were used: anti-CD27 (LG.7F9), anti-IFN-g (XMG1.2), anti-TNFa (MAbl l), anti-IL-2 (JES6-5H4), anti-CD69 (H1.2F3), anti-CD25 (PC61.5), anti- CD62L (DREG-56), anti-CXCR3 (CXCR3-173), anti-KLRGl (2F1), anti-ICOS (7E.17G9), anti-Lag3 (C9B7W), anti-PD-1 (J43), anti-CTLA4 (1B8), anti-TOX (TXRX10) (all from eBioscience); anti-GzmB (QA16A02), anti-CD43a (1B11), anti-CD49a (HMal), anti-CD44 (IM7), anti-Ki-67 (16A8), anti-CD127 (A7R34) (all from Biolegend); anti-BrdU (3D4), anti active caspase-3 (C92-605), anti-pH2A.X-S139 (Nl-431), anti-Slamf6 (13G3) (all from BD Biosciences); anti-BATF (D7C5), anti-Bim (C34C5), anti-TCF-1 (C63D9) (all from Cell Signaling Technology); anti-CD8a (53-6.7) (from SONY); anti-CD62L (MEL-14) (from TONBO Bioscience) and anti-Tim3 (215008) (from R&D). To monitor cell division, lymphocytes were labeled with CellTrace Violet (CTV; Life Technologies). For staining mitochondria, lymphocytes were incubated for 30 min at 37 °C with 10 nM Mito Tracker Deep Red (Life Technologies) or 20 nM TMRM (tetramethylrhodamine, methyl ester; ImmunoChemistry Technologies) after staining surface markers. Flow cytometry data were analyzed using Flowjo 9.9.4 (Tree Star).
[00286] For biological experiment (non-omics) analyses, data were analyzed using Prism 6
software (GraphPad) by two-tailed paired Student’s /-test or two-tailed unpaired Student’s t- test, or one-way ANOVA with Newman-Keuls’s test. Two-way ANOVA was performed for comparing tumor growth curves. Log-rank (Mantel-Cox) test was performed for comparing mouse survival curves. P < 0.05 was considered significant. Data are presented as mean ± s.d. or mean ± s.e.m.
EXAMPLE 2. Validation of Regnase-1 effects
[00287] To validate the screening results, an in vivo dual transfer system was developed to compare the relative accumulation of OT-I cells transduced with sgRNA lentiviral vectors expressing distinct fluorescent proteins in the same tumor-bearing host (Figure 1C). To exclude the possibility that the different fluorescent proteins could affect cell accumulation, OT-I cells transduced with lentiviral vectors encoding the same control sgRNA were mixed but with different fluorescent proteins. At 7 days after adoptive transfer into B 16-Ova melanoma-bearing host, their relative proportions in both the spleen and tumor were preserved as the pre-transfer mixture (Figures 5A-5C, upper panels). To verify the inhibitory effect of Regnase-1 on CD8+ T cell accumulation, OT-I cells were transduced with two different sgRNAs targeting Regnase-1. The relative proportion of Regnase-1 -null OT-I cells was drastically increased in both the spleen and tumor after adoptive transfer (Figures 5B and 5C). Altering the fluorescent protein reporters for sgRegnase-1 yielded similar results (Figure 5D), and this further excluded the contribution from the different fluorescent proteins. Imaging analysis identified significantly more Regnase-1 -null OT-I cells within tumors than wild-type controls (Figure ID). Analysis of guide targeting efficacy showed 97.3% indel events in sg/ri¾viave- /-transduced cells isolated from tumors as compared to 1.3% in control sgRNA- transduced cells (Figure 5E), and immunoblot analysis further validated the loss of Regnase- 1 expression in tumor-infiltrating OT-I cells transduced with Regnase-1 sgRNA (Figure IE). Next, the persistence of Regnase-1 -null OT-I cells was examined at days 7, 14 and 21 after transfer, since adoptively transferred effector CD8+ T cells are known to show limited long term persistence in tumor-bearing hosts1 3. While both the proportion and number of wild-type OT-I cells declined drastically over time in the spleen and tumor, Regnase-1 -null OT-I cells had markedly better persistence, especially in the tumor (Figures IF and 1G). The persistence advantage of Regnase-1 -null OT-I cells over wild-type controls in the tumor became more pronounced at days 14 (~700x) and 21 (~2,000x) as compared to day 7 (~100x), while in the spleen, Regnase-1 -null OT-I cells showed modest advantage at days 14 (~5x) and 21 (~20x) compared with day 7 (~200x) (Figures IF and 1G). Therefore, loss of Regnase-1 endows
tumor-specific CD8+ T cells with greatly improved accumulation and long-term persistence, preferentially within the tumor.
[00288] For the protein immunoblot analysis, cells were lysed in RIPA buffer (ThermoFisher 89900), resolved in 4-12% Criterion™ XT Bis-Tris Protein Gel (Bio-Rad 3450124) and transferred to PVDF membrane (Bio-Rad 1620177). Membranes were blocked using 5% BSA for 1 h and then incubated for overnight with anti-MCPIPl antibody (604421) (R&D), anti- BATF (D7C5) (Cell Signaling Technology), anti-PTPN2 (E-l l) (Santa Cruz Biotechnology), anti-SOCSl (E-9) (Santa Cruz Biotechnology), anti-Hsp90 (MAB3286) (R&D) and anti-b- actin (8H10D10) (Cell Signaling Technology). Membranes were washed 6 times with TBST and then incubated with 1:5,000 diluted HRP conjugated anti-mouse IgG (W4021) (from Promega) for 1 h. Following another 6 times of washes with TBST, the membranes were imaged using the ODYSSEY Fc Analyzer (LI-COR).
[00289] For imaging, B16-Ova melanomas were fixed in PBS containing 2% PFA, 0.3% Triton-100 and 1% DMSO for 24 h prior to cryoprotection in 30% sucrose. Cryosections were blocked with 1% BSA and 0.05% Tween-20 in TBS (20 mM Tris, pH 8.0, 100 mM NaCl) for 1 h at room temperature prior to overnight incubation in blocking buffer containing the following antibodies; anti-mCherry (Biorbyt orbl l618), anti-GFP (Rockland Immuno 600- 401-215), anti-TCF-7 (C63D9) (Cell Signaling Technology 2203), and anti-Tom20 (2F8.1) (Millipore MABT166). Slides were washed in TBS before application of AF488, Cy3 or AF647 secondary antibodies (Jackson Immuno) for 1 h at room temperature prior to mounting with Prolong Diamond hardset media containing DAPI (Thermofisher). Widefield fluorescence microscopy was performed using a motorized Nikon TiE inverted microscope equipped with a 20x Plan Apo 0.75NA objective, standard DAPI, FITC and TRITC filter sets, and an EMCCD camera (Andor). The entire tissue section was stitched based on the DAPI fluorescent signal and the subsequent large images were analyzed using NIS Elements software (Nikon Instruments). Images were segmented per channel, and further refined using a spot identification algorithm to identify single cells and positional information within the tumor. The number of cells per square area was determined following manual delineation of the tumor border. Analysis of transcription factor localization was performed using a Marianis spinning disk confocal microscope (Intelligent Imaging Innovations) equipped with a IOOc 1.4NA objective and Prime 95B sCMOS camera, and analyzed using Slidebook software (Intelligent Imaging Innovations).
EXAMPLE 3. Evaluation of Regnase- 1-deficient CD8+ T cells in tumor models
[00290] Given the improved longevity and drastically increased cellularity of Regnase-l-null CD8+ T cells within tumors, the efficacy of Regnase-l-null CD8+ T cells in ACT was assessed in three tumor models. First, the therapeutic efficacy of Regnase-l-null OT-I cells was determined against B 16-Ova melanoma, an aggressive tumor that is difficult to treat29. While wild-type OT-I cells had modest therapeutic effects against melanoma, as expected17, Regnase- l-null OT-I cells showed much stronger antitumor effects, evidenced by markedly inhibited tumor growth and increased survival of melanoma-bearing mice (Figures 2A and 2B). Next, CD8+ T cells from pmel-1 T-cell receptor-transgenic mice30 (pmel-1 cells, which recognize the endogenous melanoma antigen gplOO; from the Jackson Laboratory) crossed with Cas9- expressing mice18 were used. Although wild-type pmel-1 cells were unable to effectively inhibit B16-F10 melanoma growth, Regnase-l-null pmel-1 cells had greatly increased therapeutic efficacy (Figures 2C and 2D). Last, to assess the ability of Regnase-1 deletion to enhance the efficacy of CAR-T cells against leukemia, Cas9-expressing mice18 were crossed with transgenic mice that express CARs (consisting of anti -human CD 19 (huCD19) scFv fragments, mouse CD8 transmembrane domain and mouse 4- 1 BB-6Ό3z signaling tail; provided by Dr. Terrence Geiger at St. Jude Children's Research Hospital) under the CD2 promoter to generate CAR-T cells. Aggressive mouse BCR-ABL1+ B progenitor acute lymphoblastic leukemia (Ph+ B-ALL) cells31 were also generated that express huCD19 as a surrogate tumor antigen and luciferase for in vivo imaging (huCD19-Ph+ B-ALL). Strikingly, as compared to wild-type CD8+ CAR-T cells, Regnase-l-null CD8+ CAR-T cells showed much stronger therapeutic efficacy against huCD19-Ph+ B-ALL as indicated by the greatly increased survival (Figure 2E) and reduced luciferase signals measured by in vivo imaging (Figure 2F and Figure 6). Collectively, Regnase-1 deletion markedly enhances the efficacy of ACT against both solid and blood cancers.
[00291] For adoptive T cell transfer for tumor therapy, B 16-Ova cells (2 c 105; provided by Dr. Dario Vignali at University of Pittsburgh) or B16-F10 cells (2 c 105; ATCC) were injected subcutaneously into female C57BL/6 mice (7-10 weeks age; from The Jackson Laboratory). At day 12, mice bearing tumors of similar size were randomly divided into 3 groups (5-8 mice per group), and sgRNA-transduced OT-I cells (5 c 106) (for the treatment of B16-Ova melanomas) or pmel-1 (5 c 106) (for the treatment of B16-F10 melanomas) were injected intravenously. Tumors were measured every three days with digital calipers and tumor volumes were calculated by the formula: Length c Width c [(Length c Width) L 0.5] c p/632. Death was defined as the point at which a progressively growing tumor reached 15 mm in the longest
dimension. For the treatment of huCD19-Ph+B-ALL, mice engrafted with huCD19-Ph+B-ALL (1 x 106; provided by Dr. Terrence Geiger at St. Jude Children's Research Hospital) were treated at day 7 with sgRNA-transduced CD8+ CAR-T cells (5 c 106). Mice were imaged using the Xenogen imaging system (Caliper Life Science).
EXAMPLE 4. Gene expression profiling in Regnase-l-deficient CD8+ T cells
[00292] To systemically identify the differences in immune processes and functional states between Regnase-l-null and wild-type OT-I cells, RNA-Sequencing (RNA-Seq) and bioinformatic analyses of cells isolated from the in vivo dual transfer system were performed to address cell-intrinsic effects. The association of the enhanced long-term persistence of Regnase-l-null TILs with stem-like properties by performing gene set enrichment analysis (GSEA) was determined using gene signatures representative of memory-like CD8+ T cells (CXCR5+ vs CXCR5 exhausted cells) in chronic infection7·8, as well as hematopoietic stem cells (HSCs)33. As compared to wild-type controls, tumor-infiltrating Regnase-l-null OT-I cells had highly enriched gene signatures associated with stem-like CD8+ T cells and HSC progenitors (Figure 3A). Consistent with this notion, gene targets repressed by Regnase-1 (i.e. those upregulated upon its deletion) were significantly enriched in stem-like CD8+ T cells (Figures 7A and 7B), suggesting that these cells may have low Regnase-1 activity. Interestingly, transcriptional profiling revealed marked differences between tumor-infiltrating and peripheral (from lymph nodes) Regnase-l-null OT-I cells (Figure 7C), raising the possibility that Regnase-l-null effector CD8+ T cells undergo specific reprogramming in the TME. To test this idea and obtain an unbiased view of immune processes regulated by Regnase- 1, GSEA was performed using “immunologic signatures” gene sets. Tumor-infiltrating Regnase-l-null OT-I cells were highly enriched for gene signatures associated with memory formation and naive cells (Figure 7D), consistent with the enrichment of stem-like signatures described above (Figure 3A). In contrast, peripheral Regnase-l-null OT-I cells were enriched with genes related to effector cells or those downregulated in memory formation or naive cells (Figure 7E). Moreover, to further support these findings, GSEA was performed using previously defined gene modules associated with different functional states of CD8+ T cells in tumor immunity10. While tumor-infiltrating Regnase-l-null OT-I cells were enriched with naive or memory module, peripheral Regnase-l-null cells were associated with activation- associated but not naive or memory module (Figures 7F and 7G). Consistent with the bioinformatics inference, tumor-infiltrating Regnase-l-null OT-I cells had increased expression of the memory or naive T cell-associated marker CD27 and reduced expression of the effector cell-associated marker CD43a, as compared to wild-type controls (Figure 3B)34·35.
Additionally, tumor-infiltrating Regnase-l-null OT-I cells expressed higher levels of transcription factors associated with naive or memory CD8+ T cells, including M3, Lefl, Tcf7 (encodes TCF-1), Bach2, Foxpl, Bcl6, and Fos/ 36 40 (Figures 8A and 8B), but had lower expression of effector or exhausted CD8+ T cell-associated transcription factors including lrf2. Irf4, Hmgb2, M2, and Prdml (encodes Blimpl)37,41 45 (Figures 8C and 8D), and not significantly altered expression of Eomes, Tbx21 and Tox (Figures 8A and 8C). Given the extensive transcriptional changes, chromatin accessibility was next measured using ATAC-Seq (assay for transposase accessible chromatin using sequencing46) of tumor-infiltrating Regnase- l-null and wild-type OT-I cells, and motif searches were performed on accessible regions of assembled ATAC-Seq reads to explore enriched transcription factor binding motifs. Compared to wild-type controls, Regnase-l-null cells showed significant enrichments in TCF-1, Bach2 and Bcl6 motifs, but downregulated the IRF4 motif (Figures 8E and 8F). These results suggest that Regnase-l-null effector CD8+ T cells are reprogrammed in the TME and acquire naive/memory cell-associated gene expression programs.
[00293] For gene expression profiling, gene set enrichment analysis (GSEA) and weighted gene co-expression network analysis (WGCNA), control sgRNA- and sgRegna.se- 1 -t rans duced OT-I cells ( n = 4-5 biological replicates each group) were isolated from the tumors or PLN of the hosts of the in vivo dual color transfer assay, and analyzed with RNA-Seq. For RNA-Seq, RNA was quantified using the Quant-iT RiboGreen assay (Life Technologies) and quality checked by 2100 Bioanalyzer RNA 6000 Nano assay (Agilent) or LabChip RNA Pico Sensitivity assay (PerkinElmer) prior to library generation. Libraries were prepared from total RNA with the TruSeq Stranded Total RNA Library Prep Kit according to the manufacturer’s instructions (Illumina, PN 20020595). Libraries were analyzed for insert size distribution on a 2100 BioAnalyzer High Sensitivity kit (Agilent Technologies) or Caliper LabChip GX DNA High Sensitivity Reagent Kit (PerkinElmer.) Libraries were quantified using the Quant-iT PicoGreen dsDNA assay (Life Technologies) or low pass sequencing with a MiSeq nano kit (Illumina). Paired end 100 cycle sequencing was run on the HiSeq 4000 (Illumina). The raw reads were trimmed for adapter sequences using Trimmomatic v.0.36 using parameters ILLUMINACLIP : adapter. fa: 2 : 30: 10 LEADING: 10 TRAILING: 10 SLIDINGWINDOW:4: 18 MINLEN:32, followed by mapping to mm9 reference genome downloaded from gencode release Ml (www.gencodegenes.org/mouse/releases.html) using star v.2.5.2b. with default parameters. Reads were summarized at gene level using python script htseq-count. Differential expression analysis was performed using R package DEseq2 v. 1.18.1. Donor-derived T cells isolated from the tumor-bearing mice that received the individual transfer of sgRNA-
transduced OT-I cells (n = 3-4 biological replicates each group) were analyzed using microarrays (Affymetrix Mouse Clariom S Assay), which were collected in the following three batches: (a) Control sgRNA-, sgRegnase-1-, and sgBatf/Regnase-1-transduced TIL OT-I cells (n = 4 replicates each group); (b) Control sgRNA- and sgBatf- transduced TIL OT-I cells ( n = 3 replicates each group); and (c) Control sgRNA-, sgRegnase-1-, sgPtpn2-, sgPtpn2/Regnase- 1-, sgSocs1-, and sgSocs1/Regnase -1-transduced TIL OT-I cells (n = 4 replicates each group). For microarray, the expression signals were summarized robust multi-array average algorithm Affymetrix Expression Console vl. l, followed by differential expression analysis performed using R package limma v.3.34.9. All the plots were generated using R package ggplot2 v.2.2.1. Differentially expressed transcripts were identified by ANOVA (Partek Genomics Suite version 6.5), and the Benjamini-Hochberg method was used to estimate the false discovery rate (FDR) as described47. Differentially expressed (DE) genes were defined by |log2 FC| > 0.5; P < 0.05. To analyze microarray samples from the two different batches (a) and (b) as described above, the batch effect was corrected using removeBatchEffect function implemented in R package limma v.3.34.9. GSEA was performed as described62 using the“Hallmark” database. For GSEA using manually curated gene signatures from public datasets, microarray dataset (GSE84105)7 was used for generating“CXCR5+ exhausted CD8 (Ahmed)” and CXCR5 exhausted CD8 (Ahmed)” gene signatures (< 5% FDR); as total upregulated and downregulated genes were more than 200, genes were ranked by their log2 fold change of expression in CXCR5+ vs CXCR5 comparison and used top 200 upregulated genes as “CXCR5+ exhausted CD8 (Ahmed)” and top 200 downregulated genes as CXCR5 exhausted CD8 (Ahmed)”. RNA-Seq data (GSE76279)48 was processed using DEseq2 R package v 1.16.1 to generate“CXCR5+ exhausted CD8 (Yu)” and CXCR5 exhausted CD8 (Yu)” using the similar strategy as the other signatures above. Similarly, gene signatures of different subsets of hematopoietic stem cells (HSCs) were generated33. Weighted gene co-expression network analysis (WGCNA) was performed as described12·49. Briefly, the analysis was performed using WGCNA R package v. 1.66. Total mRNA co-expression clusters were defined using DE genes defined as described above. Pearson correlation matrix was calculated for each experiment followed by an adjacency matrix calculation by raising the correlation matrix to a power of 10 to meet the scale-free topology criterion49. Co-expression clusters were defined by hybrid dynamic tree cutting method with minimum height for merging module set at 0.2, as described85. A consensus trend for each co-expression cluster was defined based on the first principal component, and cluster membership was defined as Pearson correlation between individual genes and the consensus trend of the co-expression cluster. Genes were assigned to
the most correlated co-expression cluster with cutoff of r > 0.7, as described85. RNA-Seq and microarray data have been deposited into the GEO series database (www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE126072, token for access: ofafckgkxlelxux).
[00294] For ATAC-Seq library preparation, tumor-infiltrating sgRNA-transduced OT-I cells were collected in the following two batches: (a) Control sgRNA- and sgRegnase- 1 -t rans duced OT-I cells (n = 4 biological replicates each group) were isolated from tumor-bearing mice using the in vivo dual color transfer assay; (b) Control sgRNA-, sgRegnase-1-, sg Batf- and sgBatf/Regnase-l-trmsduccd TIL OT-I cells ( n = 2-4 replicates each group) were isolated from the tumor-bearing mice that received the individual transfer of sgRNA-transduced OT-I cells. Sorted T cells were incubated in 50 pi ATAC-Seq lysis buffer (10 mM Tris-HCl, pH 7.4, 10 mM NaCl, 3 mM MgCh. 0.1% IGEPAL CA-630) on ice for 10 min. Resulting nuclei were pelleted at 500 g for 10 min at 4°C. Supernatant was carefully removed with a pipette and discarded. The pellet was resuspended in 50 mΐ transposase reaction mix (25 mΐ 2* TD buffer, 22.5 mΐ nuclease-free water, 2.5 mΐ Transposase) and incubated for 30 min at 37 °C. After the reaction, the DNA was cleaned up using the Qiagen MinElute kit. The barcoding reaction was run using the NEBNext HiFi kit based on manufacturer’s instructions and amplified for 5 cycles according to Buenrostro et al.46 using the same primers. Ideal cycle numbers were determined from 5 mΐ (of 50 mΐ) from the previous reaction mix using KAPA SYBRFast (Kapa Biosystems) and 20 cycle amplification on an Applied Biosystems 7900HT. Optimal cycles were determined from the linear part of the amplification curve and the remaining 45 mΐ of PCR reaction was amplified in the same reaction mix using the optimal cycle number.
[00295] ATAC-Seq analysis was performed as described previously50. Briefly, 2 c 100 bp paired-end reads obtained from all samples were trimming for Nextera adapter by cutadapt (version 1.9, paired-end mode, default parameter with“ -m 6 -O 20”) and aligned to mouse genome mm9 (NCBIM37 from Sanger) by BWA (version 0.7.12-rl039, default parameter)51, duplicated reads were then marked with Picard (version 2.6.0-SNAPSHOT) and only non- duplicated proper paired reads have been kept by samtools (parameter“-q 1 -F 1804” version 1.2)52. After adjustment of Tn5 shift (reads were offset were offset by +4 bp for the sense strand and -5 bp for the antisense strand) reads were separated into nucleosome free, mononucleosome, dinucleosome, trinucleosome as described46 by fragment size and generated bigwig files by using the center 80 bp of fragments and scale to 30 c 106 nucleosome free reads. Reasonable nucleosome free peaks and pattern of mono-, di-, tri-nucleosome on IGV (version 2.4.13)53 were observed and all 8 samples have about 10 c 106 nucleosome free reads so the
data qualities were concluded as good. Next each 2 replicates were merged to enhance peak calling on nucleosome free reads by MACS2 (version 2.1.1.20160309 default parameters with extsize 200—nomodel ")54. To assure the replicability, nucleosome free regions for each genotype were first finalized as only retained a peak if it called with higher cutoff (macs2 -q 0.05) in one merged sample and at least called with lower cutoff (macs2 -q 0.5) in the other merged sample. There reproducible peaks were further merged between WT and KO and then nucleosome free reads from each of the 8 samples were counted by bedtools (v2.24.0)55. To find the differential accessible regions, raw nucleosome free reads counts were first normalized using trimmed mean of M-values normalization method and applied Empirical Bayes Statistics test after linear fitting from voom package (R 3.23, edgeR 3.12.1, limma 3.26.9)56. FDR-correct P-value 0.05 and fold change > 2 were used as cutoff for more accessible regions in KO (KO Larger) or less accessible regions in KO (KO Smaller). For motif analysis, regions < 0.05 fold change and P-value > 0.5 were further selected as control region. At last, FIMO from MEME suite (version 4.11.3,“-thresh le-4 -motif-pseudo O.OOOT’)57 have been used for scanning motif (TRANSFAC database, only included Vertebrata and not 3D structure-based) matches in the nucleosome free regions and Fisher’s Exact tests have been used to test whether a motif is significant enriched for differential accessible regions compared to the control regions. ATAC-Seq data have been deposited into the GEO series database
(www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE126072, token for access: ofafckgkxlelxux).
[00296] Transcription factor binding site footprinting was performed as described previously50. Briefly, bigwig files have been first generated by all tags of adjusted reads and normalized by autosomes reads number to 2 c 108 reads (e.g. sample with 1 c 108 autosome reads would be scaled to double the bigwig profile). Then average bigwig files have been generated by mean of replicates at each bp for each sample and motif matches within nucleosome free region have been used for footprinting taking the average profile across all motif matches at each bp from -100 bp from motif match centers to +100 bp. Finally, the footprinting profiles have been smoothed with 10 bp bins and plot by deeptools (v2.5.7)58.
[00297] To identify the enrichment of BATF binding motifs, nucleosome-free differentially accessible regions were defined at |log2 FC| > 0.5; P < 0.05, and the peaks were further annotated as more or less accessible regions in Regnase-l-null OT-I cells compared to wild- type controls. For each group, differentially accessible peaks were overlapped with BATF ChIP-Seq peaks (downloaded from GSE5419156) to identify the common regions between ATAC-Seq peaks and BATF ChIP-Seq peaks using bedtools (version 2.25.0). Finally, FIMO591
from MEME suite (version 4.9.0) was used to scan the overlapping regions with TRANSFAC motifs associated with BATF to identify the number of motifs enriched in the differentially accessible regions in Regnase-l-null (shown as
Match (Regnase-l-null)’ in Figure 17A) or wild-type control samples (shown as
Match (wild-type)’), and Fisher’s exact test was used to test the significance of enrichment. This statistical bioinformatic method has been used successfully by us and others to circumvent cell number limitations50·60.
[00298] For real-time PCR, RNA was isolated using the RNeasy Micro Kit (Qiagen 74004) following the manufacturer’s instructions. RNA was converted to cDNA using the High Capacity cDNA Reverse Transcription Kit (ThermoFisher 4368813) according to manufacturer’s instructions. Real time PCR was performed on the QuantStudio 7 Flex System (Applied Biosystems) using the PowerSYBR Green PCR Master Mix (ThermoFisher 4367659) and the following primers: Bcl2ll-F: GAC AAGGAGAT GC AGGT ATT GG (SEQ ID NO: 13), Bcl2ll-R: TC C C GT AGAGAT C C AC A A A AGT (SEQ ID NO: 14); Ifng- F: ACAGCAAGGCGAAAAAGGATG (SEQ ID NO: 15), Ifng- R: TGGTGGACCACTCGGA TGA (SEQ ID NO: 16); Irf4- TCCGACAGTGGTTGATCGAC (SEQ ID NO: 17), Irf4- R: CCTCACGATTGTAGTCCTGCTT (SEQ ID NO: 18); Gzma- F: TGCTGCCCACTGTAAC GTG (SEQ ID NO: 19), Gzma- R: GGTAGGTGAAGGATAGCCACAT (SEQ ID NO: 20); Gzmb- F: CCACTCTCGACCCTACATGG (SEQ ID NO: 21), Gzmb-R : GGCCCCC AAAGTGACATTTATT (SEQ ID NO: 22); Actin- F: CGCCACCAGTTCGCCATGGA (SEQ ID NO: 23), Actin-R: TACAGCCCGGGGAGCATCGT (SEQ ID NO: 24).
EXAMPLE 5. Reprogramming tumor-specific CD8+ T cells by Regnase-1 deletion
[00299] Since T cell differentiation state is an important determinant of in vivo persistence13 ·61, the enhanced accumulation of Regnase-l-null TILs prompted determination of their differentiation status by performing gene set enrichment analysis (GSEA) using previously defined gene modules associated with different functional states of CD8+ T cells in tumor immunity10. As compared to wild-type controls, tumor-infiltrating Regnase-l-null OT-I cells were enriched with naive or memory module (Figure 7F). Additionally, gene targets repressed by Regnase-1 (i.e. those upregulated upon its deletion) were significantly enriched in memory- like CD8+ T cells (CXCR5+ vs CXCR5 exhausted cells) in chronic infection7·8 (Figures 7A, 7B). Consistent with the bioinformatic inference, tumor-infiltrating Regnase-l-null OT-I cells had increased expression of a key memory or naive T cell-associated transcription factor, TCF- l36·38, as compared to wild-type controls (Figures 3K, 8B). Tumor-infiltrating Regnase-l-null OT-I cells also expressed higher mRNA levels of transcription factors associated with naive or memory CD8+ T cells, including Lefl, Bach2, Tcfl (encodes TCF-1), Foxpl, Bcl6, and
Fosb36’38-40 (Figure 8A), but had lower expression of effector or exhausted CD8+ T cell- associated transcription factors, including Irf2, Irf4 and Hmgb241 45 (Figures 8C, 8D), and not significantly altered expression of Eomes, Tbx21 and Tox (Figures 8A, 8C). Given the extensive transcriptional changes, next chromatin accessibility was measured using ATAC-Seq (assay for transposase accessible chromatin using sequencing46) of tumor-infiltrating Regnase- 1-null and wild-type OT-I cells, and performed motif searches on accessible regions of assembled ATAC-Seq reads to explore enriched transcription factor binding motifs. Compared to wild-type controls, Regnase-l-null cells showed significant enrichments in TCF-1, Bach2 and Bcl6 motifs, but downregulated the IRF4 motif (Figures 8E, 8F). These results suggest that Regnase-l-null effector CD8+ T cells are reprogrammed in the TME and exhibit enhanced naive/memory cell-associated gene expression programs.
[00300] Interestingly, transcriptional profiling revealed marked differences between tumor- infiltrating and peripheral (from lymph nodes) Regnase-l-null OT-I cells (Figure 7C). Unlike the enrichment of naive or memory module in Regnase-l-null cells in tumors (Figure 7F), peripheral Regnase-l-null cells were associated with activation-associated but not naive or memory module (Figure 7G), and had reduced expression of TCF-1 in the spleen of tumor bearing mice (Figure 7H). Given the TME-specific phenotypes of Regnase-l-null cells, the regulation of Regnase-1 expression and activity was assessed in tumor-infiltrating and peripheral wild-type OT-I cells. Tumor-infiltrating OT-I cells had lower Regnase-1 expression than peripheral OT-I cells (Figure 15A). Additionally, gene targets repressed by Regnase-1 were significantly enriched in tumor-infiltrating OT-I cells (Figure 15B), indicative of dampened Regnase-1 activity and in line with the elevated OT-I cell activation in TME than secondary lymphoid organs17. To explore upstream signals controlling Regnase-1 activity, Regnase-1 expression was measured in pre-activated OT-I cells upon stimulation with TCR, IL-2 or IL-2162. TCR engagement with anti-CD3 (aCD3) antibody decreased Regnase-1 expression and also potently induced Regnase-1 cleavage (Figure 15C). A modest level of Regnase-1 cleavage was observed upon IL-2, and to an even lesser extent, IL-21 stimulation (Figure 15C). To determine the role of TCR signaling in driving the reprogramming of Regnase-l-null CD8+ T cells in TME in vivo, Regnase-l-null OT-I cells were transferred into mice bearing either B 16-Ova or B16-F10 tumor cells that express or lack the expression of the cognate antigen, respectively. Strikingly, antigen recognition was crucial in driving Regenase- 1 deletion-induced CD8+ T cell accumulation in TILs, as evidenced by significantly reduced Regnase-l-null OT-I cells in B16-F10 melanoma-bearing mice (Figure 15D). Antigen stimulation was also required for Regnase-l-null cells to acquire increased naive/memory cell-
like phenotype, as indicated by the decreased TCF-1 expression in Regnase-l-null cells in B16- F 10 compared with B 16-Ova-bearing mice (Figure 15E). While hypoxia is one of the hallmark features of the TME and regulates tumor-infiltrating CD8+ T cell functional states14, hypoxia did not alter Regnase-1 expression (Figure 15F), or expression of activation or differentiation molecules, including BATF, CD69, GzmB, CD25, and TCF-1, in wild-type or Regnase-l-null OT-I cells (Figure 15G). These results further indicate that Regnase-l-null effector CD8+ T cells undergo specific reprogramming in the TME, and establish Regnase-1 as an intrinsic component of the signaling processes downstream of tumor antigen-TCR stimulation but not hypoxia.
EXAMPLE 6. Proliferation and survival analyses of Regnase- 1-deficient CD8+ T cells
[00301] The cellular homeostasis of Regnase-l-null OT-I cells was determined. GSEA using “Hallmark” gene sets revealed that cell cycling-associated hallmarks, including E2F targets, G2M checkpoint and mitotic spindle, were the top three downregulated pathways in tumor- infiltrating Regnase-l-null cells as compared to wild-type cells (Figures 9A and 9B). To validate this result, the proliferation of Regnase-l-null OT-I cells was examined by measuring BrdU incorporation and Ki-67 staining. Significantly reduced BrdU incorporation (Figure 3C) and Ki-67 expression (Figure 9C) in tumor-infiltrating Regnase-l-null OT-I cells was observed at day 14 after adoptive transfer and, while no difference in BrdU incorporation and Ki-67 expression was observed at day 7 (Figures 9D and 9E). The apoptosis hallmark was also one of the top downregulated pathways in tumor-infiltrating Regnase-l-null OT-I cells (Figures 9A and 9F). This alteration was associated with increased and reduced expression of anti-apoptotic Bcl2II (encodes Bcl-xL) and pro-apoptotic Bcl2II I (encodes Bim), respectively (Figure 9G), which was subsequently validated (Figures 9H and 91). In agreement with these results, tumor-infiltrating Regnase-l-null OT-I cells had reduced staining of active caspase-3 at both days 7 and 14 after adoptive transfer (Figures 3D and 9J). Tumor-infiltrating Regnase- l-null OT-I cells also had reduced levels of DNA damage, as measured by a specific staining to detect phosphorylation of the histone variant H2A.X at Serl3961·63 (Figure 9N). Therefore, tumor-infiltrating Regnase-l-null OT-I cells are less proliferative after initial effector expansion and more importantly, exhibit better survival than wild-type cells in tumors, in line with enhanced survival and the more quiescent state of naive/memory CD8+ T cells and long- lived stem cells64 66. In contrast, but consistent with the increased activation signatures described above (Figures 7E and 7G), peripheral Regnase-l-null OT-I cells were enriched with cell cycling and apoptosis-associated signatures (Figure 9K), which was validated by increased BrdU incorporation and active caspase-3 expression in Regnase-l-null OT-I cells in
the spleen of tumor-bearing mice (Figures 9L and 9M). These results further support TME- specific phenotypes of Regnase-l-null CD8+ T cells.
EXAMPLE 7. T cell in vivo persistence assays
[00302] It was hypothesized that tumor-infiltrating Regnase-l-null OT-I cells show enhanced in vivo persistence. To this end, WT and Regnase-l-null OT-I cells were isolated from TILs, mixed at 1 : 1, and transferred them into either inflammation-matched tumor-bearing hosts or naive mice (Figure 3E). In response to tumor antigen stimulation, Regnase-l-null OT-I cells showed much greater accumulation in tumor sites (Figure 3F). Moreover, in response to homeostatic signals upon transfer into naive recipients, Regnase-l-null OT-I cells still showed better persistence in the spleen as compared to wild-type cells (Figure 3G). Altogether, these extensive bioinformatic analyses and experimental validations indicate that tumor-infiltrating Regnase-l-null CD8+ T cells are characterized by in vivo quiescence and cellular survival, and exhibit better in vivo persistence in response to both antigen stimulation and homeostatic signals.
EXAMPLE 8. Effector molecular expression in tumor-infiltrating Regnase-l-deflcient CD8+ T cells
[00303] Naive or memory cells and terminally differentiated effector cells are generally considered as exclusive cell fates64·67. For instance, Tet2-deficient CAR-T cells can adopt a memory cell phenotype with better persistence, but with impaired effector function4. Interestingly, despite the acquisition of naive/memory cell-associated gene programs of Regnase-l-null OT-I cells in tumors, they had higher expression of activation-associated markers, including CD69, CD49a, KLRG1, ICOS, Tim3, Lag3, PD-1 and CTLA4, while CD25 and CXCR3 expression was largely normal (Figure 10A). Also, tumor-infiltrating Regnase-l- null OT-I cells retained an effector surface phenotype (CD44'CD62L ) (Figure 10B) and, more importantly, contained more IFN-g- and granzyme B (GzmB)- expressing cells within tumors (except for a minor reduction of GzmB+ T cell percentage at day 7) (Figures 3H, 31, IOC). Among IFN-g1 and GzmB+ Regnase-l-null OT-I cells, the expression levels of IFN-g and GzmB were also increased on a per cell basis (Figure 3J). Additionally, Regnase-l-null OT-I cells largely preserved the capacity to produce TNF-a (Figures 10D and 10E), while there were more TNF-a-producing Regnase-l-null OT-I cells than wild-type cells (Figure 10F). Moreover, Regnase-l-null OT-I cells produced more IL-2 than wild-type controls at day 7 after adoptive transfer (Figure 10D and 10E), with increased number of IL-2 -producing cells (Figure 10F). Regnase-l-null OT-I cells also had increased proportion and number of IFN-
y'TNF-a1 IL-21 polyfunctional T cells (Figures 10G). Thus, although tumor-infiltrating CD8+ T cells lacking Regnase-1 acquire better persistence and survival advantage, they retain terminally differentiated effector function.
EXAMPLE 9. scRNA-Seq and flow cytometry analyses of tumor-infiltrating Regnase-1- null OT-I cells
[00304] To further determine the effects of Regnase-1 deletion on tumor-specific OT-I cells, single cell RNA-Sequencing (scRNA-Seq)68 was used to unbiasedly profile transcriptional programs of TILs isolated from the in vivo dual transfer system at day 7 after adoptive transfer, and identified distinct distribution patterns between Regnase-1 -null and wild-type cells (Figure 3L). Consistent with the increased TCF-1 expression revealed by flow cytometry (Figure 3K), Regnase-1 -null OT-I cells had an increased proportion of 7T/7w cells (control sgRNA: 19.2%; sgRegnase-1 : 31.0 %), which also expressed modestly higher levels of Tcf7 than wild-type counterparts (Figures 3L and 3M). In chronic infection and tumor-elicited immune responses, the TCF-1 + memory-like progenitor population has been recently shown to express the transcription factor TOX but have lower expression of immune exhaustion molecules7·69 73. Indeed, it was found that Tcf7h' cells in wild-type and Regnase-1 -null TILs expressed Tox (Figure 16A), but, compared with Tcf7l° cells, had reduced expression of Pdcdl (encodes PD- 1) and Havcr2 (encodes Tim3) (Figure 16B). Moreover, Tcf7 l cells were enriched with memory- or progenitor-like CD8+ T cell gene signatures derived from chronic infection7·8 (Figure 16C) and the expression of Slamf6 (a TCF-1 -dependent target73·74; Figure 3M), all of which showed increased expression in Regnase-1 -null cells (Figures 3M, 16C). In further support of the memory-like phenotype of 7-c/7hl cells, they had lower expression of effector genes Ifng and Gzmb than Tcf7l° cells (Figure 16D). In the absence of Regnase-1, the expression of Ifng and Gzmb was increased in both Tcf7l" and Tcf7l° cells (Figure 16D), consistent with the increased expression levels of IFN-g and GzmB (Figure 3J). Moreover, the expression of effector cell-associated transcription factors, including Batf and /rL?9·37·75’76, was also increased in Regnase-1 -null cells, but with distinct patterns of expression (Figures 16E, 16F). Specifically, in wild-type cells, expression of Batf and M2 was enriched in Tcf7l° cells (Figures 16E, 16F). However, in Regnase-1 -null cells, while M2 was still predominantly expressed in Tcf7l° cells, Batf expression was highly expressed by both 7-c/7hl and Tcf7l° cells (Figures 16E, 16F), indicative of unique transcriptional reprogramming in the absence of Regnase-1. Consistent with the scRNA-Seq analysis, flow cytometry analysis revealed that TCF-1+ cells did express TOX, with a modestly higher level observed in the absence of
Regnase-1 (Figure 16G). While CD127/IL-7R was unchanged, TCF-1+ cells had high expression levels of Slamf6, which was further elevated in Regnase-1 -null cells (Figure 16G). Conversely, TCF-1+ cells had low KLRG1 and Tim3 and intermediate PD-1 expression levels, and these patterns were largely retained in Regnase-1 -null cells with modestly enhanced abundance (Figure 16G). Thus, the TCF-1+ subset observed in the adoptive transfer system largely resembles the TCF-1+ memory-like progenitor cells described in chronic infection and other tumor models7·69 71·73. Collectively, these results provide additional support for the dual roles of Regnase-1 in coordinating T cell effector function and persistence in antitumor immunity, by increasing the proportion and signature molecules of memory/progenitor-like CD8+ T cells while retaining the robust effector function.
[00305] For scRNA-Seq library preparation, control sgRNA- and sgRegna.se- 1 -t ran s duced OT-I cells were sorted on an iCyt Reflection cell sorter from TILs pooled from the in vivo dual transfer hosts (6-8 mice per sample) at day 7 after adoptive transfer into tumor-bearing mice. The cells were counted and examined for viability using a Luna Dual Florescence Cell Counter (Logos Biosystems). All samples were spun down at 2,000 rpm for 5 min. The supernatant was removed, and cells were re-suspended in 100 mΐ of 1 x PBS (Thermo Fisher Scientific) + 0.04% BSA (Amresco). The cells were then counted and examined for viability using a Luna Dual Florescence Cell Counter (Logos Biosystems). Cell counts were about 1 x 106 cells per milliliter and viability was above 98%. Single-cell suspensions were loaded onto the Chromium Controller according to their respective cell counts to generate 6,000 single cell GEMs (gel beads in emulsion) per sample. Each sample was loaded into a separate channel. Libraries were prepared using the Chromium Single Cell 3’ v2 Library and Gel Bead Kit (10x Genomics). The cDNA content of each sample after cDNA amplification of 12 cycles was quantified and quality checked using a High-Sensitivity DNA chip with a 2100 Bioanalyzer (Agilent Technologies) to determine the number of PCR amplification cycles to yield sufficient library for sequencing. After library quantification and quality check by DNA 1000 chip (Agilent Technologies), samples were diluted to 3.5 nM for loading onto the HiSeq 4000 (Illumina) with a 2 x 75 paired-end kit using the following read length: 26 bp Readl, 8 bp i7 Index, and 98 bp Read2. An average of 400,000,000 reads per sample was obtained (-approximately 80,000 reads per cell).
[00306] For Alignment, barcode assignment and unique molecular identifier (UMI) counting, the Cell Ranger 1.3 Single-Cell software suite (10x Genomics) was implemented to process the raw sequencing data from the Illumina HiSeq run. This pipeline performed demultiplexing,
alignment (using the mouse genome mmlO from ENSEMBL GRCm38), and barcode processing to generate gene-cell matrices used for downstream analysis. Specifically, data from two control sgRNA and two sgRegnase-1 -transduced TIL OT-I cell samples were combined into one data set for consistent filtering, and UMIs mapped to genes encoding ribosomal proteins were removed. Cells with low UMI counts (potentially dead cells with broken membranes) or high UMI counts (potentially two or more cells in a single droplet) were filtered. A small fraction of outlier cells (888) was further removed because of their low transcriptome diversity (meaning that fewer genes were detected than in other cells with a comparable number of captured UMIs). A total of 13,879 cells (control sgRNA-transduced, 6,811; sgRegnase-1- transduced, 7,068) were captured, with an average of 11,040 messenger RNA molecules (UMIs, median: 9,391; range: 2,928-44,330). The expression level of each gene was normalized to 100,000 UMIs per cell and log-transformed them by adding 0.5 to the expression matrix.
[00307] For data visualization, underlying cell variations derived from control sgRNA- and sgRegnase-1-transduced TIL OT-I cell single-cell gene expression were visualized in a two- dimensional projection by t-distributed stochastic neighbour embedding (tSNE). Expression of individual genes or pathway scores was color-coded (from low to high, blue-red) for each cell on tSNE plots. To visualize Tcf7-expressing cells, Tcf7 ' cells were defined as cells with the highest third quantile of Tcf7 expression (with log2 gene expression intensity = 2.910317 as threshold) among all cells.
EXAMPLE 10. Identification of immune regulators and OXPHOS metabolic pathway using genome-scale CRISPR-Cas9 screening
[00308] To probe the molecular pathways underlying Regnase-1 -mediated protective immunity in tumor-specific CD8+ T cells, a secondary in vivo genome-scale CRISPR-Cas9 mutagenesis screening was performed using Regnase-1 -deficient OT-I cells in the melanoma B 16-Ova model (Figure 4A). Given that Regnase-1 has RNase activity and inhibits target gene expression15 16, the enhanced immune responses of Regnase-1 -null OT-I cells were expected to be suppressed by deleting functionally important targets of Regnase-1. Specifically, OT-I T cells were transduced with sgRegnase-1 and Brie lentiviral genome-scale sgRNA library that consists of 78,637 sgRNAs targeting 19,674 genes77, and after selection of dual-transduced cells (based on puromycin resistance and Ametrine+ cell sorting) and adoptive transfer into tumor-bearing host, isolated OT-I cells for deep sequencing. Candidate genes were ranked based on the average enrichment of their sgRNAs (4 sgRNAs per gene) in tumor-infiltrating OT-I cells relative to input (log2 ratio (TIL/input); adjusted P < 0.05) (Figure 11A and Table
1). Using a stringent cutoff (by less than -3.5 log2 ratio or >10 fold reduction (TIL/input); adjusted P < 0.05), a total of 331 genes were identified that were strongly depleted in the screening, including known regulators of T cell expansion and effector differentiation such as Slc7a5 (encodes LAT1)7S (log2 ratio (TIL/input) = -4.75), Itk79 (log2 ratio (TIL/input) = -4.29), Prkaal (encodes AMPKal)80 (log2 ratio (TIL/input) = -4.09), Mapkl (encodes Erk2)81 (log2 ratio (TIL/input) = -4.03) and Tbx21 (encodes T-bet)82 (log2 ratio (TIL/input) = -3.95) (Figure 11A). Functional enrichment of the top-ranking depleted genes was performed next, which revealed that oxidative phosphorylation (OXPHOS) hallmark was the top-ranked pathway (Figure 11B), suggesting a possible role for oxidative metabolism in supporting the excessive accumulation of Regnase-l-null OT-I cells in tumor immunity. In support with this notion, increased OXPHOS metabolism has been shown to correlate with improved fitness of effector T cells and their antitumor activity13,83’84. Among the gene sets enriched in tumor-infiltrating Regnase-l-null OT-I cells relative to wild-type cells (Figure 9A), OXPHOS was the top ranking one (Figure 11C). Therefore, mitochondrial profiles and oxidative metabolism were measured. Oxygen consumption rates (OCR, indicative of OXPHOS activity) were measured in XF media under basal conditions and in response to 1 mM oligomycin, 1.5 mM fluoro- carbonyl cyanide phenylhydrazone (FCCP) and 500 nM rotenone using an XF96 Extracellular Flux Analyzer (EFA) (Seahorse Bioscience). Regnase-l-null OT-I cells had increased mitochondrial fitness, as indicated by increased mitochondrial mass, membrane potential (Figure 4B) and volume (Figure 11D). They also had significantly higher basal and maximal OCR) (Figure 4C), indicating enhanced oxidative metabolism.
[00309] For the genome-scale sgRNA Brie library CRISPR-Cas9 mutagenesis screening, the following methods were used.
[00310] In vivo screening: Lentivirus was produced by co-transfecting HEK293T cells with lentiviral genome-scale Brie library plasmids with the puromycin resistant gene77, psPAX2 and pCAG4-Eco. At 48 h after transfection, virus was harvested and froze at -80 °C. Two hundred million Cas9-expressing OT-I cells were isolated from 12 Cas9-OT-I mice and co-transduced with Brie sgRNA library and sg//eg/i ve- / - Ametri ne. After viral transduction, cells were cultured with human IL-2 (20 IU/ml; PeproTech), mouse IL-7 (25 ng/ml; PeproTech) and IL- 15 (12.5 ng/ml; PeproTech) for 2 days. Brie sgRNA library -transduced cells were then selected by culture with 4 pg/ml puromycin in the presence of the abovementioned cytokines for another 3 days. Following puromycin selection, Ametrine+ cells were sorted using a Reflection sorter (i-Cyt) to select for cells co-transduced with sg Renase-1 and Brie library sgRNAs, and an
aliquot of 10 c 106 transduced OT-I cells was saved as input (-120 c cells coverage per sgRNA). The majority of the co-transduced OT-I cells (5 c 106 cells per recipient) were then i.v. transferred into mice at day 14 after B 16-Ova melanoma engraftment. Twenty recipients were randomly divided into 2 groups as biological replicates. At 7 days after adoptive transfer, transferred Ametrine+ OT-I cells were recovered from the tumor pooled from 10 recipients per sample using a Reflection sorter (i-Cyt). On average, 3 x 106 OT-I cells per sample (-40 c cell coverage per sgRNA) were recovered. DNA extraction and sequencing library preparation were as described in Example 1.
[00311] Data processing: For data analysis, FastQ files obtained after sequencing were demultiplexed using the HiSeq Analysis software (Illumina). sgRegnase-1 (GGAGTGGAAACGCTTCATCG; (SEQ ID NO: 2)) reads were removed, and single-end reads were trimmed and quality-filtered using the CLC Genomics Workbench vl l (Qiagen) and matched against sgRNA sequences from the genome-scale sgRNA Brie library. Read counts for sgRNAs were normalized against total read counts across all samples. For each sgRNA, the fold change (log2 ratio) for enrichment was calculated between each of the biological replicates and the input experiment. Gene ranking was based on the average enrichment among replicates in representation of 4 individual corresponding sgRNAs in the genome-scale sgRNA Brie library. The gene level false discovery rate (FDR) adjusted P-value was calculated among multiple sgRNAs of each gene, using a paired two-tailed /-test between log2 transformed average normalized read counts of tumor samples and those of input sample, and a value of less than 0.05 was considered to be statistically significant. Identified candidate genes with log2 ratio (TIL/input) > 1 are presented in Table 1.
Table 1. Brie library CRISPR-Cas9 mutagenesis screening results
EXAMPLE 11. Identification of a functional target of Regnase-1 in tumor immunity
[00312] Studies were carried out to probe the functional target whose deletion could suppress the excessive accumulation of Regnase-1 -null OT-I cells in tumor immunity. Given the role of Regnase-1 in inhibiting gene expression15 16, two criteria were applied to narrow down the candidates: such candidates should be upregulated in the absence of Regnase-1 in the RNA- Seq analysis, and depleted in TILs in the genome-scale CRISPR-Cas9 screening. Overlaying the top depleted genes (by less than -3.5 log2 (TIL/input) fold change; adjusted P < 0.05) of the genome-scale CRISPR-Cas9 screening with the top upregulated genes (by greater than 1.5 log2 fold change; P < 0.05) in RNA-Seq analysis of Regnase-1-null OT-I cells revealed 2 common candidates, including the transcription factor Batf (Figure 12A). BATF is a pioneer factor that controls chromatin accessibility allowing subsequent binding by other transcription factors, and is important for T cell differentiation and effector function9 , 75. Flow cytometry analysis revealed significantly increased BATF expression in Regnase-1-null OT-I cells (Figure 4D), in agreement with the scRNA-Seq data (Figure 16E). Consistent with the increased BATF expression, BATF binding motifs were highly enriched in open chromatin regions in Regnase-1 -null cells (Figures 4E 12B, and 8E). Moreover, the published BATF- binding targets identified from in vitro activated CD8+ T cells9 were superimposed with the differentially accessible peaks altered in Regnase-1 -null cells in the ATAC-Seq data, based on the statistical bioinformatic method used successfully in the context of limited cell numbers50·60. It was found that BATF binding motifs were significantly enriched in Regnase- 1-null but not wild-type cells (Figure 17A). As Regnase-1 has RNase activity and mediates mRNA degradation via targeting the 3' UTR15·16, whether Batf mRNA is regulated by Regnase- 1 was determined by following a published procedure16. Consistent with a published report16, the 3' UTR of 112, but not 114, was sufficient to confer destabilization of luciferase upon Regnase-1 overexpression, and this regulation was lost when using a nuclease-inactive form of Regnase-1 (Regnase-1 D141N) (Figure 12C). Notably, the 3' UTR of Batf was dose- dependently inhibited by Regnase-1, but not Regnase-1 D141N (Figure 4F), indicating that BATF is a novel Regnase-1 target. To directly examine the contribution of aberrant BATF expression to the excessive accumulation of Regnase-1 -null OT-I cells, the accumulation of Regnase-1 -null OT-I cells transduced with sgRNA targeting Batf was measured. Remarkably, co-deletion of BATF drastically reduced the accumulation of Regnase-1 -null OT-I cells in both the periphery and tumor (Figures 4G and 12D) at days 5 (Figure 17B) and 7 (Figure 4J) after
adoptive transfer, with the loss of BATF expression validated by flow cytometry and immunoblot analyses (Figures 12E, 17C and 17D) . Deletion of BATF itself was also found to impair the accumulation of OT-I cells in the tumor, albeit not in the periphery (Figure 12F). Therefore, Regnase-1 targets BATF to impair accumulation of CD8+ T cells in tumor immunity. Consistent with the context-dependent roles of BATF in mediating antiviral CD8+ T cell effector responses9·85, BATF/Regnase-l-null OT-I cells had reduced effector surface phenotypes (Figure 12G) and expression of effector molecules, including Iftig, Gzmb and Gzma, compared with Regnase-1 -null cells (Figures 12H and 121). Transcriptome analysis of BATF/Regnase-l-null and Regnase-1 -null OT-I cells were performed next, and GSEA was performed using“Hallmark” gene sets. Compared with Regnase-1 -null cells, BATF/Regnase- l-null cells had downregulation of OXPHOS and cell cycle-associated hallmarks (Figures 12 J and 12K), consistent with the role of BATF in mediating Regnase-1 -null effector cell expansion and accumulation. In support of a role of BATF in promoting oxidative metabolism of Regnase-1 -null OT-I cells, mitochondrial profiles, including mitochondrial mass and membrane potential, were dampened in BATF/Regnase-l-null OT-I cells, compared with Regnase-1 -null cells (Figure 12L). Altogether, BATF is a key target of Regnase-1 to limit CD8+ effector T cell accumulation and mitochondrial metabolism in tumor immunity.
[00313] For the luciferase assay, the full-length 3' UTR constructs of Batf (MmiT031430- MT06), 112 (MmiT092987-MT06) and 114 (MmiT092992-MT06) mRNAs were purchased from GeneCopoeia, each containing two luciferase genes: firefly luciferase gene for 3' UTR of the targeted gene, and Renilla luciferase gene as an internal control. The cDNA of wild-type Regnase-1 (Dharmacon MMM1013-202800061) was cloned into the pMIG-II vector. The D141N mutant Regnase-1 was generated by site-directed mutagenesis using the KOD Hot Start DNA Polymerase (Millipore 71086). HEK293T cells were transfected with 3' UTR construct of interest together with wild-type or D141N mutant Regnase-1 expression plasmid or empty control plasmid. At 48 h after transfection, cells were lysed and luciferase activities in the lysates were determined using the Luc-Pair Duo-Luciferase Assay Kit (GeneCopoeia LF002) according to manufacturer’s instructions.
EXAMPLE 12. Regnase-l-BATF axis shapes mitochondrial metabolism and effector responses
[00314] The results from Example 11 suggest that aberrant BATF expression is, at least in part, responsible for the excessive accumulation of Regnase-1 -null OT-I cells. BATF co deletion also elevated cell death (active caspase-3 staining) of Regnase-1 -null OT-I cells, although not to the same extent as BATF deletion alone (Figure 17E). In contrast,
BATF/Regnase-l-null OT-I cells still had increased TCF-1 expression compared to wild-type OT-I cells (Figure 17F), suggesting that the increased TCF-1 expression in Regnase-l-null OT-I cells is not dependent on aberrant BATF expression. Moreover, consistent with the context-dependent roles of BATF in mediating antiviral CD8+ T cell responses9·85, BATF co deletion blocked the increased IFN-g production in Regnase-l-null OT-I cells (Figure 17G). In pmel-1 -mediated ACT model, BATF co-deletion significantly decreased the therapeutic efficacy of Regnase-l-null cells against melanoma (Figure 17H). Therefore, Regnase-1 targets BATF to impair the accumulation and effector function of CD8+ T cells in tumor immunity, but not TCF-1 expression.
[00315] To examine upstream signals that drive aberrant BATF expression in Regnase-l-null OT-I cells, BATF expression was measured in response to TCR, IL-2 or IL-21 stimulation. Stimulation with aCD3 antibody and IL-2 (to a lesser extent) induced aberrant BATF expression in Regnase-l-null OT-I cells compared to wild-type cells (Figure 18A). Although IL-21 can sustain BATF expression in antiviral T cells86, IL-21 did not affect BATF expression in Regnase-l-null cells (Figure 18A). Given the specific regulation of BATF expression by Regnase-1 and immune signals, it was hypothesized that BATF is an important rheostat in mediating antitumor CD8+ T cell effector responses by serving as a limiting factor in this process. To this end, wild-type OT-I cells were transduced with BATF and transferred them into tumor-bearing mice (Figure 18B). BATF overexpression improved cell accumulation in the spleen (Figures 18C, 18D) and even more profoundly in the tumor (Figure 4K, Figure 18C). Accordingly, BATF-overexpressing OT-I cells in the tumor had increased cell proliferation and modestly reduced active caspase-3 expression (Figure 18E, 18F), and produced more effector molecules, including IFN-g, GzmB and TNF-a but not IL-2 (Figure 18G). In contrast but consistent with the role of BATF in promoting effector cell differentiation, TCF-1 expression was reduced in BATF-overexpressing OT-I cells (Figure 18H). These results indicate that Regnase-1 suppresses TCR and IL-2-induced BATF expression and reveal BATF as an important rheostat in mediating antitumor effector responses in TME.
[00316] For viral transduction to overexpress BATF, the coding sequence of Batf (Addgene # 34575) was subcloned into pMIG-II retroviral vector (Addgene # 52107), which was co transfected into Plat-E cells with the helper plasmid pCL-Eco (Addgene # 12371) for the production of retrovirus.
[00317] BATF is a pioneer factor that controls chromatin accessibility, which allows
subsequent binding by other transcription factors9·75. To directly determine the contribution of aberrant BATF expression to the altered chromatin accessibility in Regnase-l-null cells, ATAC-Seq analysis was performed by comparing wild-type, Regnase-l-null, BATF -null, and BATF/Regnase-l-null cells isolated from TILs. 7,480 genes were identified with significantly increased chromatin accessibility in Regnase-l-null cells as compared to wild-type cells (Figure 19A), and remarkably, BATF co-deletion reversed the upregulated chromatin accessibility for a large proportion of these genes (5,052 in total) (Figure 19A). In addition, 2,527 among these 5,052 genes showed significantly downregulated chromatin accessibility in BATF -null cells as compared to wild-type cells (Figure 19A). These results indicate that aberrant BATF expression drives increased chromatin accessibility in Regnase-l-null tumor- specific T cells.
[00318] To further dissect BATF-dependent and independent pathways associated with Regnase-1 function, transcriptome analysis was performed by comparing wild-type, Regnase- l-null, BATF-null, and BATF/Regnase-l-null cells isolated from TILs. Principal component analysis (PCA) of global expression profiles revealed that compared with Regnase-l-null cells, BATF/Regnase-l-null OT-I cells showed considerably less variance from wild-type cells (Figure 4L), suggesting the partial correction of Regnase-1 -null-induced gene expression programs by BATF co-deletion. To identify unique gene modules regulated by BATF in Regnase-l-null cells, weighted gene correlation network analysis (WGCNA)12 was applied and differentially expressed genes were grouped into nine distinct co-expression clusters (Figure 19B). Remarkably, four clusters (clusters 3, 4, 6 and 7) showed upregulated gene expression in the absence of Regnase-1 that was blocked or partially blocked by BATF co-deletion in BATF/Regnase-l-null cells. Within these 4 clusters, gene expression in cells lacking BATF alone was either largely unaltered (clusters 3 and 6) or reduced (clusters 4 and 7), compared with wild-type controls (Figure 19B). In addition, gene expression in cluster 1 was downregulated in Regnase-l-null cells but partially rectified by BATF co-deletion (Figure 19B). In total, these 5 clusters identified Regnase-1 deletion-induced transcriptional programs with complete or partial dependence on BATF. Functional enrichment analysis using gene modules associated with different functional states of CD8+ T cells in tumor immunity10, as described above, revealed that these clusters were enriched with genes in the activation and/or dysfunction module (Figure 19C), thereby reinforcing the abovementioned role of BATF in mediating the effector function of Regnase-l-null OT-I cells. The remaining four clusters (2, 5, 8 and 9) contained gene profiles that were altered in Regnase-l-null cells but not rescued by BATF co-deletion (Figure 19A). Interestingly, clusters 5 and 8 were enriched with genes in
the naive or memory module (Figure 19C), which, together with the analysis of TCF-1 expression described above (Figures 17F, 18H), support the idea that the increased naive/memory -like gene signatures in Regnase-l-null cells are largely independent of BATF. Altogether, aberrant BATF expression drives effector-associated, but not naive/memory-like, transcriptional programs in Regnase-l-null OT-I cells, further supporting the dual roles of Regnase-1 in coordinating T cell effector function and persistence in antitumor immunity.
[00319] Next the functional pathways underlying Regnase-1 -mediated protective immunity were determined in tumor-specific CD8+ T cells. Of note, functional enrichment of the top- ranking depleted genes of the secondary in vivo genome-scale CRISPR-Cas9 mutagenesis screening revealed that oxidative phosphorylation (OXPHOS) hallmark was the top-ranked pathway (Figure 11B), suggesting a possible role for mitochondrial oxidative metabolism in mediating the excessive accumulation of Regnase-l-null OT-I cells. In support of this notion, increased mitochondrial OXPHOS metabolism has been shown to correlate with improved fitness of effector T cells and their antitumor activity 12·14·83·84, although the negative signals controlling mitochondrial metabolism, especially in the TME, remain elusive. It was also noted that OXPHOS was the top-ranking gene set enriched in tumor-infiltrating Regnase-l-null OT- I cells relative to wild-type cells (Figure 9A and Figure 11C). Therefore mitochondrial profiles and oxidative metabolism were measured in Regnase-l-null OT-I cells, which had increased mitochondrial fitness, as indicated by increased mitochondrial mass, membrane potential (Figure 4B) and volume (Figure 11D). They also had significantly higher basal and maximal oxygen consumption rate (OCR, indicative of OXPHOS activity) (Figure 4C), indicating enhanced oxidative metabolism. Importantly, compared with Regnase-l-null cells, BATF/Regnase-l-null cells had downregulation of OXPHOS and cell cycling-associated hallmarks (Figures 12 J, 12K), consistent with the role of BATF in mediating Regnase-l-null cell accumulation. In further support of a role of BATF in promoting oxidative metabolism of Regnase-l-null OT-I cells, BATF co-deletion largely blocked the increased mitochondrial mass and membrane potential in Regnase-l-null OT-I cells, but not in wild-type cells, at days 5 and 7 after adoptive transfer (Figure 4M). Conversely, BATF overexpression was sufficient to upregulate mitochondrial mass and membrane potential (Figure 4N). These results collectively reveal a role of BATF in linking Regnase-1 function and mitochondrial fitness.
[00320] To understand the molecular basis for Regnase-1 and BATF-mediated regulation of mitochondrial fitness, first the ATAC-Seq data of wild-type, Regnase-l-null, BATF-null, and BATF/Regnase-l-null OT-I cells from TILs were mined for altered chromatin accessibility of mitochondrial genes defined in the MitoCarta 2.0 database11 12. A total of 341 mitochondrial
genes showed significantly upregulated chromatin accessibility in the absence of Regnase-1 (Figure 19D), 214 of which were blocked by BATF co-deletion in BATF/Regnase-l-null cells (Figure 19D). Moreover, 96 among these 214 genes showed significantly downregulated chromatin accessibility in BATF-null cells as compared to wild-type cells (Figure 19D). These results further support a crucial contribution of BATF to the enhanced mitochondrial function in the absence of Regnase-1. Second, the expression of mitochondrial genes was examined in the transcriptome analysis of wild-type, Regnase-1 -null, BATF-null, and BATF/Regnase-l- null cells isolated from TILs. A total of 18 mitochondrial genes were identified in clusters 2-7 of WGCNA that contained upregulated genes in the absence of Regnase-1, including 11 genes in clusters 3, 4, 6 and 7 with complete or partial dependence on BATF (Figure 19B). Thus, the aberrant mitochondrial gene expression in Regnase-1 -null cells is at least partially dependent on BATF. Altogether, these results reveal a Regnase-1 -BATF axis in reprogramming mitochondrial metabolism of CD8+ T cells, and highlight important contributions of increased BATF activity to altered chromatin accessibility and transcript expression of mitochondrial genes in Regnase-1 -null cells.
EXAMPLE 13. Identification of additional targets for adoptive cell transfer (ACT)
[00321] To further explore the therapeutic potential of Regnase-1 -null CD8+ T cells, the top enriched genes were examined in TILs in the genome-scale CRISPR-Cas9 mutagenesis screening. It was reasoned that if a candidate gene could further improve the accumulation of Regnase-1 -null OT-I cells, its sgRNAs should be enriched in TILs. The top candidate genes were chosen for further analysis, including Ptpn2, Socsl and Agps (Figure 11A). The effects of deleting these genes were validated on further enhancing the accumulation of Regnase-1 - null OT-I cells in both the periphery and tumor at 7 days after adoptive transfer (Figures 13A, 40, 20A). Among genes tested, deletion of PTPN2 or SOCS1 showed potent effects on improving the accumulation of Regnase-1 -null OT-I cells in the periphery and tumor (Figures 4H and 41). Deletion of PTPN2, SOCS1 or Roquin-1 (encoded by Rc3hl ) itself also resulted in increased accumulation of OT-I cells in both the tumor and periphery (Figures 13B and 13C). Also, deletion of PTPN2 or SOCS1 alone resulted in a modestly increased accumulation of OT-I cells in the tumor (Figure 40). Next, transcriptome analysis was performed on PTPN2/Regnase-l-null, SOCSl/Regnase-l-null, and control Regnase-1 -null OT-I cells, and GSEA revealed the enrichment of cell cycle and metabolic hallmark pathways in PTPN2/Regnase-l-null and SOCSl/Regnase-l-null cells relative to the Regnase-1 -null controls (Figures 13D and 13E), consistent with the increased accumulation in tumor immunity.
[00322] It was found that expression of PTPN2 and SOCS1 was, unlike BATF, not affected by Regnase-1 deletion (Figure 20B). While Regnase-l-null OT-I cells had markedly elevated mitochondrial fitness, deletion of PTPN2 or SOCS1 alone did not affect or slightly increased mitochondrial mass and membrane potential, respectively (Figures 4P, 4Q). Also, in PTPN2- or SOCSl-null OT-I cells, the additional deletion of Regnase-1 still elevated these mitochondrial profiles (Figures 4P, 4Q). Furthermore, deletion of PTPN2 or SOCS1 did not affect BATF expression in either wild-type or Regnase-l-null OT-I cells (Figure 4R). Interestingly, in contrast to the elevated TCF-1 expression in Regnase-l-null OT-I cells, loss of PTPN2 or SOCS1 alone significantly reduced TCF-1 expression as compared to wild-type cells (Figure 4S), whereas Regnase-1 co-deletion still increased TCF-1 expression in PTPN2- or SOCSl-null cells (Figure 4S). These comparative analyses reveal largely discrete mechanisms exerted by PTPN2 or SOCS1 in comparison to Regnase-1, including mitochondrial fitness and regulation of BATF and TCF-1 expression. In further support of this notion, PCA plot of the transcriptome profiles revealed largely distinct patterns for Regnase- l-null, PTPN2-null and SOCSl-null OT-I cells, which were further segregated from the combined loss of PTPN2 and Regnase-1 or of SOCS1 and Regnase-1 (Figure 4T), thereby highlighting differential gene expression programs.
[00323] Given the increased accumulation of tumor-infiltrating PTPN2/Regnase-l-null and SOCSl/Regnase-l-null CD8+ T cells as compared to Regnase-l-null cells (Figure 40), their therapeutic efficacy was assessed against B16-F10 melanoma using the pmel-1 TCR- transgenic system. As compared to Regnase-1 deletion alone, PTPN2/Regnase-l-null and SOCSl/Regnase-l-null pmel-1 T cells exhibited additional effects to delay tumor growth (Figure 4U).
[00324] Altogether, the CRISPR-Cas9 mutagenesis screening identifies additional potential targets to combine with Regnase-1 deletion for combinatorial cancer immunotherapy.
[00325] As shown in the Examples described above, by integrating focused and genome-scale CRISPR screening, bioinformatic analyses and extensive experimental validation, it is revealed that tumor-specific CD8+ T cells can be reprogrammed in the TME to acquire extensive accumulation and increased naive/memory cell-associated features (more quiescence, better survival and naive/memory cell-associated gene signatures) for long-term persistence, while retaining robust effector function (Figure 14). Regnase-1 is identified unbiasedly by the in vivo pooled CRISPR-Cas9 mutagenesis screening as a major regulator to be targeted to unleash this unique reprogramming in the TME, resulting in marked therapeutic efficacy against both solid and blood cancers in ACT. The specific transcriptional adaptation of Regnase-l-null CD8+ T
cells in the TME highlights a previously unappreciated function of Regnase-1 after initial T cell activation15 16, to enable precise temporal and spatial control of T cell responses.
[00326] The results highlight that Regnase-1 restrains mitochondrial metabolism and effector responses through a key gene target BATF, which is identified through a secondary in vivo genome-scale CRISPR-Cas9 screening in immune cells. The Examples presented above reveal Regnase-1 as a major negative regulator of BATF and a previously unappreciated role of BATF as a limiting factor for programming effective antitumor responses, in part through shaping mitochondrial metabolism, thereby contributing to the understanding of the context-dependent roles of the pioneer factor BATF in adaptive immunity9·76·85. The genome-scale CRISPR-Cas9 screening also reveals PTPN2, SOCS1 and Roquin-1 (encoded by Rc3hl ) as potential targets to be deleted alone or to combine with Regnase-1 deletion to boost antitumor immunity. EXAMPLE 14. Regnase-1 deficient human CAR-T cells have improved survival and function
[00327] Generation of Regenase-1 knockout human CAR-T cells
[00328] First, the gRNAs to knock out Regenase-1 in human CD4 and CD8 CAR-T cells were designed in silico based on selected off-target profiles shown in Table 2. Figure 21 shows a schematic of the gRNA binding sites along Regnase-1.
[00329] In Table 2,“long O” refers to the number of sites in genome that are an exact match to the full-length (“long”) 23nt gRNA target sequence listed in the table, including the target site;“long_l” refers to the number of sites in genome that contain up to 1 mismatch in the 23nt gRNA target sequence listed in the table, including the target site;“long_2” refers to the number of sites in genome that contain up to 2 mismatches in the 23nt gRNA target sequence listed in the table, including the target site; and“short_0” refers to the number of sites in genome that match to the 15nt fragment (“short”) at the 3’ end of the gRNA target sequence listed in the table, including the target site.
Table 2. Details of gRNAs designed for Regnase-1 knockout
[00330] The sequences for gRNAs 1-5 were designed by CAGE while the sequence for gRNA-6 was selected from portals.broadinstitute.org/gpp/public/analysis-tools/sgma-design.
[00331] Knockout of Regenase-1 gene in human CAR-T cells by CRISPR-Cas9
[00332] The following protocol was used to knock out the Regenase-1 gene in human CD8 T cells.
[00333] On Day 0, human naive CD4 or CD8 T cells were isolated by sorting CCR7+ CD45RA+ CD45RO CD4+ T cells or CCR7+ CD45RA+ CD45RO CD8+ T cells. The isolated CD4 and CD8 T cells were activated by plating on CD3/CD28 coated plates.
[00334] On Day 1, CD 19-CAR transduction using a lentiviral vector was used to introduce CD 19-CAR into the activated CD4 or CD8 T cells.
[00335] On Day 2, one of the six candidate gene gRNAs or control non-targeting gRNA in complex with Cas9 protein were electroporated into the T cells collected from the culture plates according to the following protocol.
[00336] Purified Cas9 protein and guide RNA oligonucleotides were combined to form a ribonucleoprotein (RNP) complex. Specifically, the selected single guide RNA (sgRNA) was re-suspended at 100 mM (1.5 nmol in 15 pi water) in approximately 13-14 pL aliquots, and the Cas9 protein was prepared at a concentration of 40 mM (40 pmol/pL) in approximately 10pL aliquots.
[00337] The RNP was prepared by mixing the gRNA and Cas9 protein following these conditions in PCR tubes: 1.8 pL (100 pmol/pl, 180 pmol) gRNA is mixed with 1 pL (40 pmol/pL, 40 pmol) Cas9 protein, for a total volume of 2.8 pi. After briefly mixing, the RNP was incubated at room temperature for 10 minutes before being placed at 4 °C until ready for use.
[00338] The T cells were resuspended in complete RPMI medium and counted. The T cells were centrifuged for 5 min at 1300rpm, aspirated, washed with PBS once, and resuspended at 25M/ml in Lonza electroporation buffer P3 from the Lonza AmaxaTM P3 primary cell 96-well NucleofectorTM Kit (Cat. No. V4SP-3096). The T cells were resuspended at a ratio of 20 pi Lonza electroporation buffer P3 per 0.5 million cells. The T cells were briefly mixed by
pipetting with 2.8 pi RNP mixture. The RNP and cells mixture was transferred to an electroporation cuvette. Immediately after electroporation, 80 mΐ ofpre-warmed media (without cytokine) was added to each cuvette. The cells were allowed to rest for 15 mins at 37°C in the incubator while remaining in the cuvettes. After 15 mins, cells were moved to 24-well tissue culture plate by adding the cell suspension directly to one well containing 500 pL complete RPMI medium with IL-7 and IL-15.
[00339] For optimal editing, 0.5 million T cells were electroporated per well using a Lonza 4D 96-well electroporation system (Lonza 4D Nucleofector™ Core Unit) with pulse code E0115. Electroporation was completed until green crossing was observed on the samples. Alternate cell concentrations from 200,000 up to 2 million cells per well resulted in lower transformation efficiencies.
[00340] On Day 6, the T cell status was checked and the ability of the T cells to be co-cultured with Raji cells, including killing of the Raji cells, was measured for 24 hrs and 48 hrs.
[00341] On Day 10, samples of the T cells were taken for Western blotting and deep sequencing, or used for in vivo study.
[00342] Characterization of the CD4 and CD8 Regnase-l-null CAR-T cells
[00343] The deep sequencing results are shown in Figure 22A. The total indel achieved with gRNA-1, gRNA-2 and gRNA-6 ranged from 89.1% to 99.7%.
[00344] As shown in Figure 22B, the gRNA-6 oligonucleotide led to a knock-out of Regnase- 1 as measured by protein level, while gRNA-1 and gRNA-2 led to a partial knock out of Regenase-1 protein level. As seen in Figure 21, gRNA-1 targets the N141 site of Regnase-1, which is very important to its RNase function. Based on these results, gRNA-1 and gRNA-6 were selected for further analysis.
[00345] The human Regnase-l-null CAR-T cells were tested to see if they could be multi- activated with bulk T cells. The CAR-T cells were stimulated with irradiated Raji cells at a ratio of 2: 1 every 7 days. T cell phenotypes were measured 24 hours after each stimulation. Figures 23A-23B show that human Regnase-l-null CAR-T cells had improved survival ex vivo. Figure 23A shows improved survival of human CD4 Regnase-l-null CAR-T cells with the two selected guide RNAs gRNAl and gRNA6. Figure 23B shows improved survival of human CD8 Regnase-l-null CAR-T cells with the two selected guide RNAs gRNAl and gRNA6.
[00346] The proliferative and apoptotic properties of the human CD4 and CD8 Regnase-l- null CAR-T cells were determined ex vivo. The proliferative capabilities were measured by cell-trace violet (CTV). Before a third round of activation, the CD4 and CD8 Regnase-l-null
CAR-T cells were labeled with CTV. Seventy-two hours after activation, the T cell proliferation was measured. Cell apoptosis was measured 72 hours after a third round of stimulation with irradiated Raji tumor cells. Figures 24A-24B show that human Regnase-1 - null CAR-T cells have improved proliferation (Figure 24A) and reduced apoptosis (Figure 24B) ex vivo.
[00347] The ability of the Regnase-l-null CAR-T cells to generate different types of memory T cells was studied. The differentiation status of CD4 and CD8 Regenase-l-null CAR-T cells was determined after each of three rounds of stimulation with irradiated Raji tumor cells. The differentiated T cells were sorted based on CCR7 and CD45RO expression into the following four groups: (1) naive (CD45RO CCR7+), (2) central memory (CD45RO+CCR7+), (3) effector memory (CD45RO+CCR7 ), and (4) effector (CD45RO CCR7 ). Figures 25A-25B show that human CD4 Regnase-l-null (Figure 25A) and CD8 Regnase-l-null (Figure 25B) CAR-T cells have more memory subsets upon antigen activation ex vivo in comparison to control wildtype CD4 and CD8 CAR-T cells.
[00348] The effect of the Regnase-1 knockout on cytokine production was then measured. The levels of selected cytokines were measured 24 hours after the third stimulation with irradiated Raji tumor cells. Figures 26A-26D show that human CD8 Regnase-l-null CAR-T cells secrete more cytokines ex vivo, specifically IL-2 (Figure 26A), TNFa (Figure 26B), IFN- gamma (Figure 26C), and GrzB (Figure 26D). 27A-27D show that human CD4 Regnase-l- null CAR-T cells secrete more cytokines ex vivo, specifically IL-2 (Figure 27A), TNFa (Figure 27B), IFN-gamma (Figure 27C), and GrzB (Figure 27D).
[00349] The effect of the Regnase-1 knockout on the CD25 activation status of the Regnase- l-null CD8 CAR-T cells was then measured. The CD25 activation status of the cells was measured 24 hours after each of three rounds of stimulation with irradiated Raji tumor cells. Figure 28 shows that CD8 Regnase-l-null CAR-T cells are hyper-active after the third round of stimulation ex vivo.
[00350] The effect of the Regnase-1 knockout on the mitochondrial activity of the Regnase- l-null CD8 CAR-T cells was then measured. The mitochondrial activity of the cells was measured 24 hours after the third stimulation with irradiated Raji tumor cells. Figures 29A- 29B show that CD8 Regnase-l-null CAR-T naive (top panel) and bulk (bottom panel) cells have upregulated mitochondrial activity ex vivo as measured by TMRM (Figure 29 A) and mitotracker (Figure 29B).
[00351] The effect of the Regnase-1 knockout on the activity of certain cell proliferation and mitochondrial-activity related genes was measured in Regnase-l-null CD8 CAR-T cells.
Figure 30 shows upregulation of certain genes related to T cell proliferation and mitochondrial activity in Regnase-l-null CAR-T cells ex vivo upon antigen stimulation by GSEA analysis.
[00352] The effect of the Regnase-1 knockout on the ability of mice to survive tumor transfer with Raji cells was measured in vivo. The Raji cells were engrafted for two weeks in NS G mice and the tumors were observed by Xenogen imaging. Bulk Regnase-l-null CD8 CAR-T cells and wildtype CD8 CAR-T cells were then transferred into the mice at 1 million cells per mouse (approximately 50% CAR+). At the two-week mark, nine mice received the Regnase-l-null CD8 CAR-T cells, five mice received the wildtype CD8 CAR-T cells, and seven mice did not receive any treatment. The tumors were observed and quantified by Xenogen imaging every seven days after the T-cell treatment. Figures 31A-31B show that mice treated with Regnase- l-null CD8 CAR-T cells in vivo had lower tumor burden as indicated by the luciferase activity of each treatment group (Figure 31A) and individual recipient (Figure 31B).
[00353] The effect of the Regnase-1 knockout on the cytotoxicity and survival of CAR-T cells was measured. For the ex vivo cytotoxicity assay, Regnase-l-null cells and wildtype CAR-T cells were incubated with Raji cells at different effector and target ratios. Twenty-four hours later, the number of live tumor cells was measured. For the ex vivo survival assay, naive CD8 T cells were used. The CAR-T cells were stimulated with irradiated Raji cells at a ratio of 2: 1 every seven days. The T cell phenotypes were measured 24 hours after each stimulation. Figures 32A-32B show that human Regnase-l-null CAR-T cells had improved cytotoxicity (Figure 32A) and improved survival (Figure 32B) ex vivo.
[00354] The effect of the Regnase-1 knockout on the expression of certain cell hyper-activity markers was measured in Regnase-l-null CD4 and CD8 CAR-T cells. The expression of exhaustion markers PD-1, LAG3, and TIM-3 was measured 24 hours after a third stimulation with irradiated Raji tumor cells. Figures 33A-33B show hyperactivation of CD8 Regnase-l- null (Figure 33 A) and CD4 Regnase-l-null (Figure 33B) CAR-T cells ex vivo due to higher expression of the three exhaustion markers PD-1, LAG3, and TIM-3 in the Regnase-l-null CD8 and CD4 CAR-T cells.
References
1 Lim, W. A. & June, C. H. The Principles of Engineering Immune Cells to Treat
Cancer. Cell 168, 724-740, doi: 10.1016/j.cell.2017.01.016 (2017).
2 Sadelain, M., Riviere, I. & Riddell, S. Therapeutic T cell engineering. Nature 545,
423-431, doi: 10.1038/nature22395 (2017).
Gattinoni, L. et al. Acquisition of full effector function in vitro paradoxically impairs the in vivo antitumor efficacy of adoptively transferred CD8+ T cells. J Clin Invest 115, 1616-1626, doi: 10.1172/JCI24480 (2005).
Fraietta, J. A. et al. Disruption of TET2 promotes the therapeutic efficacy of CD 19- targeted T cells. Nature 558, 307-312, doi: 10.1038/s41586-018-0178-z (2018).
Schreiber, R. D., Old, L. J. & Smyth, M. J. Cancer immunoediting: integrating immunity's roles in cancer suppression and promotion. Science 331, 1565-1570, doi: 10.1126/science.1203486 (2011 ).
Wei, J. et al. Targeting REGNASE-1 programs long-lived effector T cells for cancer therapy. Nature 576, 471-476, doi: 10.1038/s41586-019-1821-z (2019).
Im, S. J. et al. Defining CD8+ T cells that provide the proliferative burst after PD-1 therapy. Nature 537, 417-421, doi: 10.1038/naturel9330 (2016).
Leong, Y. A. et al. CXCR5(+) follicular cytotoxic T cells control viral infection in B cell follicles. Nat Immunol 17, 1187-1196, doi: 10.1038/ni.3543 (2016).
Kurachi, M. et al. The transcription factor BATF operates as an essential
differentiation checkpoint in early effector CD8+ T cells. Nat Immunol 15, 373-383, doi: 10.1038/ni.2834 (2014).
Singer, M. et al. A Distinct Gene Module for Dysfunction Uncoupled from Activation in Tumor-Infiltrating T Cells. Cell 166, 1500-1511 el509,
doi: 10.1016/j. cell.2016.08.052 (2016).
Calvo, S. E., Clauser, K. R. & Mootha, V. K. MitoCarta2.0: an updated inventory of mammalian mitochondrial proteins. Nucleic Acids Res 44, D1251-1257,
doi: 10.1093/nar/gkvl003 (2016).
Tan, H. et al. Integrative Proteomics and Phosphoproteomics Profiling Reveals Dynamic Signaling Networks and Bioenergetics Pathways Underlying T Cell Activation. Immunity 46, 488-503, doi: 10.1016/j. immuni.2017.02.010 (2017).
Kishton, R. J., Sukumar, M. & Restifo, N. P. Metabolic Regulation of T Cell Longevity and Function in Tumor Immunotherapy. CellMetab 26, 94-109, doi: 10.1016/j. cmet.2017.06.016 (2017).
Buck, M. D., Sowell, R. T., Kaech, S. M. & Pearce, E. L. Metabolic Instruction of Immunity. Cell 169, 570-586, doi: 10.1016/j. cell.2017.04.004 (2017).
Matsushita, K. et al. Zc3hl2a is an RNase essential for controlling immune responses by regulating mRNA decay. Nature 458, 1185-1190, doi: 10.1038/nature07924
(2009).
Uehata, T. el al. Maltl -induced cleavage of regnase-1 in CD4(+) helper T cells regulates immune activation. Cell 153, 1036-1049, doi: 10.1016/j. cell.2013.04.034 (2013).
Zhou, P. et al. In vivo discovery of immunotherapy targets in the tumour microenvironment. Nature 506, 52-57, doi: 10.1038/naturel2988 (2014).
Platt, R. J. et al. CRISPR-Cas9 knockin mice for genome editing and cancer modeling. Cell 159, 440-455, doi: 10.1016/j.cell.2014.09.014 (2014).
Hogquist, K. A. et al. T cell receptor antagonist peptides induce positive selection. Cell 76, 17-27 (1994).
Bellone, M. et al. Relevance of the tumor antigen in the validation of three vaccination strategies for melanoma. J Immunol 165, 2651-2656 (2000).
Birsoy, K. et al. An Essential Role of the Mitochondrial Electron Transport Chain in Cell Proliferation Is to Enable Aspartate Synthesis. Cell 162, 540-551,
doi: 10.1016/j.cell.2015.07.016 (2015).
Muri, J. et al. The thioredoxin-1 system is essential for fueling DNA synthesis during T-cell metabolic reprogramming and proliferation. Nat Commun 9, 1851, doi: 10.1038/s41467-018-04274-w (2018).
Peng, M. et al. Aerobic glycolysis promotes T helper 1 cell differentiation through an epigenetic mechanism. Science 354, 481-484, doi: 10.1126/science.aaf6284 (2016). Vanoaica, L. et al. Conditional deletion of ferritin h in mice reduces B and T lymphocyte populations. PLoS One 9, e89270, doi: 10.1371/joumal.pone.0089270 (2014).
Kerdiles, Y. M. et al. Foxol links homing and survival of naive T cells by regulating L-selectin, CCR7 and interleukin 7 receptor. Nat Immunol 10, 176-184,
doi: 10.1038/ni 1689 (2009).
Ouyang, W., Beckett, O., Flavell, R. A. & Li, M. O. An essential role of the Forkhead-box transcription factor Foxol in control of T cell homeostasis and tolerance. Immunity 30, 358-371, doi: 10.1016/j. immuni.2009.02.003 (2009).
Chen, R. et al. In vivo RNA interference screens identify regulators of antiviral CD4(+) and CD8(+) T cell differentiation. Immunity 41, 325-338,
doi: 10.1016/j. immuni.2014.08.002 (2014).
Sanson, K. R. et al. Optimized libraries for CRISPR-Cas9 genetic screens with multiple modalities. Nat Commun 9, 5416, doi: 10.1038/s41467-018-07901-8 (2018).
Fidler, I. J. Biological behavior of malignant melanoma cells correlated to their survival in vivo. Cancer Res 35, 218-224 (1975).
Overwijk, W. W. et al. Tumor regression and autoimmunity after reversal of a functionally tolerant state of self-reactive CD8+ T cells. J Exp Med 198, 569-580, doi: 10.1084/jem.20030590 (2003).
Churchman, M. L. et al. Synergism of FAK and tyrosine kinase inhibition in Ph(+) B- ALL. JCI Insight 1, doi: 10.1172/jci.insight.86082 (2016).
Wei, J. et al. Autophagy enforces functional integrity of regulatory T cells by coupling environmental cues and metabolic homeostasis. Nat Immunol 17, 277-285, doi: 10.1038/ni.3365 (2016).
Ivanova, N. B. et al. A stem cell molecular signature. Science 298, 601-604, doi : 10.1126/science.1073823 (2002).
Ochsenbein, A. F. et al. CD27 expression promotes long-term survival of functional effector-memory CD8+ cytotoxic T lymphocytes in HIV -infected patients. J Exp Med 200, 1407-1417, doi: 10.1084/jem.20040717 (2004).
Harrington, L. E., Galvan, M., Baum, L. G., Altman, J. D. & Ahmed, R.
Differentiating between memory and effector CD8 T cells by altered expression of cell surface O-glycans. J Exp Med 191, 1241-1246 (2000).
Hurton, L . N. et al. Tethered IL-15 augments antitumor activity and promotes a stem cell memory subset in tumor-specific T cells. Proc Natl Acad Sci USA 113, E7788- E7797, doi: 10.1073/pnas.1610544113 (2016).
Yang, C. Y. et al. The transcriptional regulators Id2 and Id3 control the formation of distinct memory CD8+ T cell subsets. Nat Immunol 12, 1221-1229,
doi: 10.1038/ni.2158 (2011).
Zhou, X. et al. Differentiation and persistence of memory CD8(+) T cells depend on T cell factor 1. Immunity 33, 229-240, doi: 10.1016/j.immuni.2010.08.002 (2010). Roychoudhuri, R. et al. BACH2 regulates CD8(+) T cell differentiation by controlling access of AP-1 factors to enhancers. Nat Immunol 17, 851-860, doi : 10.1038/ni.3441 (2016).
Ichii, H., Sakamoto, A., Kuroda, Y. & Tokuhisa, T. Bcl6 acts as an amplifier for the generation and proliferative capacity of central memory CD8+ T cells. J Immunol 173, 883-891 (2004).
Wherry, E. J. et al. Molecular signature of CD8+ T cell exhaustion during chronic viral infection. Immunity 27, 670-684, doi: 10.1016/j.immuni.2007.09.006 (2007).
Waugh, K. A. et al. Molecular Profile of Tumor-Specific CD8+ T Cell Hypofunction in a Transplantable Murine Cancer Model. J Immunol 197, 1477-1488,
doi : 10.4049/j immunol.1600589 (2016).
Man, K. et al. Transcription Factor IRF4 Promotes CD8(+) T Cell Exhaustion and Limits the Development of Memory -like T Cells during Chronic Infection. Immunity 47, 1129-1141 el l25, doi: 10.1016/j.immuni.2017.11.021 (2017).
Wherry, E. J. & Kurachi, M. Molecular and cellular insights into T cell exhaustion. Nat Rev Immunol 15, 486-499, doi: 10.1038/nri3862 (2015).
Sade-Feldman, M. et al. Defining T Cell States Associated with Response to
Checkpoint Immunotherapy in Melanoma. Cell 175, 998-1013 el020,
doi: 10.1016/j.cell.2018.10.038 (2018).
Buenrostro, J. D., Giresi, P. G., Zaba, L. C., Chang, H. Y. & Greenleaf, W. J.
Transposition of native chromatin for fast and sensitive epigenomic profiling of open chromatin, DNA-binding proteins and nucleosome position. Nat Methods 10, 1213- 1218, doi: 10.1038/nmeth.2688 (2013).
Zeng, H. et al. mTORCl couples immune signals and metabolic programming to establish T(reg)-cell function. Nature 499, 485-490, doi: 10.1038/nature 12297 (2013). He, R. et al. Follicular CXCR5- expressing CD8(+) T cells curtail chronic viral infection. Nature 537, 412-428, doi: 10.1038/naturel9317 (2016).
Zhang, B. & Horvath, S. A general framework for weighted gene co-expression network analysis. StatAppl Genet Mol Biol 4, Articlel7, doi: 10.2202/1544-6115.1128 (2005).
Karmaus, P. W. F. et al. Metabolic heterogeneity underlies reciprocal fates of TH17 cell sternness and plasticity. Nature 565, 101-105, doi: 10.1038/s41586-018-0806-7 (2019).
Li, H. & Durbin, R. Fast and accurate short read alignment with Burrows-Wheeler transform. Bioinformatics 25, 1754-1760, doi: 10.1093/bioinformatics/btp324 (2009). Li, H. et al. The Sequence Alignment/Map format and SAMtools. Bioinformatics 25, 2078-2079, doi: 10.1093/bioinformatics/btp352 (2009).
Robinson, J. T. et al. Integrative genomics viewer. Nat Biotechnol 29, 24-26, doi: 10.1038/nbt.1754 (2011).
Zhang, Y. et al. Model-based analysis of ChIP-Seq (MACS). Genome Biol 9, R137, doi: 10.1186/gb-2008-9-9-rl37 (2008).
Quinlan, A. R. & Hall, I. M. BEDTools: a flexible suite of utilities for comparing
genomic features. Bioinformatics 26, 841-842, doi: 10.1093/bioinformatics/btq033 (2010).
Law, C. W., Chen, Y., Shi, W. & Smyth, G. K. voom: Precision weights unlock linear model analysis tools for RNA-seq read counts. Genome Biol 15, R29, doi: 10.1186/gb- 2014-15-2-r29 (2014).
Bailey, T. L. et al. MEME SUITE: tools for motif discovery and searching. Nucleic Acids Res 37, W202-208, doi: 10.1093/nar/gkp335 (2009).
Ramirez, F., Dundar, F., Diehl, S., Griming, B. A. & Manke, T. deepTools: a flexible platform for exploring deep-sequencing data. Nucleic Acids Res 42, W187- 191, doi: 10.1093/nar/gku365 (2014).
Cuellar-Partida, G. et al. Epigenetic priors for identifying active transcription factor binding sites. Bioinformatics 28, 56-62, doi: 10.1093/bioinformatics/btr614 (2012). Krishnamoorthy, V. et al. The IRF4 Gene Regulatory Module Functions as a Read- Write Integrator to Dynamically Coordinate T Helper Cell Fate. Immunity 47, 481- 497 e487, doi: 10.1016/j.immuni.2017.09.001 (2017).
Sukumar, M. et al. Mitochondrial Membrane Potential Identifies Cells with Enhanced Sternness for Cellular Therapy. CellMetab 23, 63-76, doi: 10.1016/j.cmet.2015.11.002 (2016).
Moroz, A. et al. IL-21 enhances and sustains CD8+ T cell responses to achieve durable tumor immunity: comparative evaluation of IL-2, IL-15, and IL-21. J Immunol 173, 900-909, doi: 10.4049/jimmunol.173.2.900 (2004).
Wang, W. et al. Effector T Cells Abrogate Stroma-Mediated Chemoresistance in Ovarian Cancer. Cell 165, 1092-1105, doi: 10.1016/j.cell.2016.04.009 (2016).
Sarkar, S. et al. Functional and genomic profiling of effector CD8 T cell subsets with distinct memory fates. J Exp Med 205, 625-640, doi: 10.1084/jem.20071641 (2008). Nakamura-Ishizu, A., Takizawa, H. & Suda, T. The analysis, roles and regulation of quiescence in hematopoietic stem cells. Development 141, 4656-4666,
doi: 10.1242/dev.106575 (2014).
Sprent, J. & Surh, C. D. Normal T cell homeostasis: the conversion of naive cells into memory-phenotype cells. Nat Immunol 12, 478-484 (2011).
Chang, J. T., Wherry, E. J. & Goldrath, A. W. Molecular regulation of effector and memory T cell differentiation. Nat Immunol 15, 1104-1115, doi: 10.1038/ni.3031 (2014).
Macosko, E. Z. et al. Highly Parallel Genome-wide Expression Profiling of Individual
Cells Using Nanoliter Droplets. Cell 161, 1202-1214, doi: 10.1016/j.cell.2015.05.002 (2015).
Khan, O. et al. TOX transcriptionally and epigenetically programs CD8(+) T cell exhaustion. Nature 571, 211-218, doi: 10.1038/s41586-019-1325-x (2019).
Yao, C. et al. Single-cell RNA-seq reveals TOX as a key regulator of CD8(+) T cell persistence in chronic infection. Nat Immunol 20, 890-901, doi: 10.1038/s41590-019- 0403-4 (2019).
Alfei, F. et al. TOX reinforces the phenotype and longevity of exhausted T cells in chronic viral infection. Nature 571, 265-269, doi: 10.1038/s41586-019-1326-9 (2019). Scott, A. C. et al. TOX is a critical regulator of tumour-specific T cell differentiation. Nature 571, 270-274, doi: 10.1038/s41586-019-1324-y (2019).
Miller, B. C. et al. Subsets of exhausted CD8(+) T cells differentially mediate tumor control and respond to checkpoint blockade. Nat Immunol 20, 326-336,
doi : 10.1038/s41590-019-0312-6 (2019).
Utzschneider, D. T. et al. T Cell Factor 1-Expressing Memory-like CD8(+) T Cells Sustain the Immune Response to Chronic Viral Infections. Immunity 45, 415-427, doi: 10.1016/j.immuni.2016.07.021 (2016).
Ciofani, M. et al. A validated regulatory network for Thl7 cell specification. Cell 151, 289-303, doi: 10.1016/j.cell.2012.09.016 (2012).
LaFleur, M. W. et al. A CRISPR-Cas9 delivery system for in vivo screening of genes in the immune system. Nat Commun 10, 1668, doi: 10.1038/s41467-019-09656-2 (2019).
Doench, J. G. et al. Optimized sgRNA design to maximize activity and minimize off- target effects of CRISPR-Cas9. Nat Biotechnol 34, 184-191, doi: 10.1038/nbt.3437 (2016).
Sinclair, L. V. et al. Control of amino-acid transport by antigen receptors coordinates the metabolic reprogramming essential for T cell differentiation. Nat Immunol 14, 500-508, doi: 10.1038/ni.2556 (2013).
Atherly, L. O., Brehm, M. A., Welsh, R. M. & Berg, L. J. Tec kinases Itk and Rlk are required for CD8+ T cell responses to virus infection independent of their role in CD4+ T cell help. J Immunol 176, 1571-1581 (2006).
Blagih, J. et al. The energy sensor AMPK regulates T cell metabolic adaptation and effector responses in vivo. Immunity 42, 41-54, doi: 10.1016/j.immuni.2014.12.030 (2015).
D'Souza, W. N., Chang, C. F., Fischer, A. M., Li, M. & Hedrick, S. M. The Erk2 MAPK regulates CD8 T cell proliferation and survival. J Immunol 181, 7617-7629 (2008).
Sullivan, B. M., Juedes, A., Szabo, S. J., von Herrath, M. & Glimcher, L. H. Antigen- driven effector CD8 T cell function regulated by T-bet. Proc Natl Acad Sci USA 100, 15818-15823, doi: 10.1073/pnas.2636938100 (2003).
Geiger, R. et al. L-Arginine Modulates T Cell Metabolism and Enhances Survival and Anti-tumor Activity. Cell 167, 829-842 e813, doi: 10.1016/j.cell.2016.09.031 (2016). Kawalekar, O. U. et al. Distinct Signaling of Coreceptors Regulates Specific
Metabolism Pathways and Impacts Memory Development in CAR T Cells. Immunity 44, 380-390, doi: 10.1016/j.immuni.2016.01.021 (2016).
Quigley, M. et al. Transcriptional analysis of HIV-specific CD8+ T cells shows that PD-1 inhibits T cell function by upregulating BATF. Nat Med 16, 1147-1151, doi: 10.1038/nm.2232 (2010).
Xin, G. et al. A Critical Role of IL-21 -Induced BATF in Sustaining CD8-T-Cell- Mediated Chronic Viral Control. Cell Rep 13, 1118-1124,
doi: 10.1016/j.celrep.2015.09.069 (2015).
Shifrut, E. et al. Genome-wide CRISPR Screens in Primary Human T Cells Reveal Key Regulators of Immune Function. Cell 175, 1958-1971 el915,
doi : 10.1016/j . cell .2018.10.024 (2018).
Manguso, R. T. et al. In vivo CRISPR screening identifies Ptpn2 as a cancer immunotherapy target. Nature 547, 413-418, doi: 10.1038/nature23270 (2017).
LIST OF SEQUENCES
SEQ ID NO: 1 - sgRegnase-1 #1 nucleic acid sequence
AAGGCAGTGGTTTCTTACGA
SEQ ID NO: 2 - sgRegnase-1 #2 nucleic acid sequence
GGAGT GGAAAC GCTTC AT C G
SEQ ID NO: 3 - sgBatf #1 nucleic acid sequence
AGAGATCAAACAGCTCACCG
SEQ ID NO: 4 - sgBatf #2 nucleic acid sequence
AGGACTCATCTGATGATGTG
SEQ ID NO: 5 - sgPtpn2 #1 nucleic acid sequence
AAGAAGTTACATCTTAACAC
SEQ ID NO: 6 - sgPtpn2 #2 nucleic acid sequence
CACTCTATGAGGATAGTCAT
SEQ ID NO: 7 - sgSocsl #1 nucleic acid sequence
TGATGCGCCGGTAATCGGAG
SEQ ID NO: 8 - sgSocsl #2 nucleic acid sequence
TGGTGCGCGACAGTCGCCAA
SEQ ID NO: 9 - sgAgps nucleic acid sequence
GTACCAATGAGTGCAAAGCG
SEQ ID NO: 10 - non-targeting control sgRNA nucleic acid sequence
ATGACACTTACGGTACTCGT
SEQ ID NO: 11 - Nextera NGS-F nucleic acid sequence
TCGTCGGCAGCGTCAGATGTGTATAAGAGACAGttgtggaaaggacgaaacaccg
SEP ID NO: 12 - Nextera NGS-R nucleic acid sequence
GTCTCGTGGGCTCGGAGATGTGTATAAGAGACAGccactttttcaagttgataacgg
SEQ ID NO: 13 - Bcl211-F nucleic acid sequence
GAC AAGGAGAT GC AGGT ATT GG
SEQ ID NO: 14 - Bcl211-R nucleic acid sequence
TCCCGTAGAGATCCACAAAAGT
SEQ ID NO: 15 - Ifhg-F nucleic acid sequence
ACAGCAAGGCGAAAAAGGATG
SEQ ID NO: 16 - Ifhg-R nucleic acid sequence
TGGTGGACCACTCGGATGA
SEQ ID NO: 17 - Irf4-F nucleic acid sequence
TCCGACAGTGGTTGATCGAC
SEQ ID NO: 18 - Irf4-R nucleic acid sequence
CCTCACGATTGTAGTCCTGCTT
SEQ ID NO: 19 - Gzma-F nucleic acid sequence
TGCTGCCCACTGTAACGTG
SEQ ID NO: 20 - Gzma-R nucleic acid sequence
GGTAGGT GAAGGAT AGC C AC AT
SEQ ID NO: 21 - Gzmb-F nucleic acid sequence
CCACTCTCGACCCTACATGG
SEQ ID NO: 22 - Gzmb-R nucleic acid sequence
GGCCCCCAAAGTGACATTTATT
SEQ ID NO: 23 - Actin-F nucleic acid sequence
CGCCACCAGTTCGCCATGGA
SEQ ID NO: 24 - Actin-R nucleic acid sequence
TACAGCCCGGGGAGCATCGT
SEQ ID NO: 25 - human BATF amino acid sequence
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLE
SEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQ
PHVSSPRFQP
SEQ ID NO: 26 - mouse BATF amino acid sequence
MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLE SEDLEKQNAALRKEIKQLTEELKYFTS VL S SHEPLC S VL AS GTP S PPEV V Y S AHAFHQ PHISSPRFQP
SEQ ID NO: 27 - human BATF nucleotide sequence
AAAGCGAGCGACATGTCCCTTTGGGGAGCAGTCCCTCTGCACCCCAGAGTGAGG
AGGACGCAGGGGTCAGAGGTGGCTACAGGGCAGGCAGAGGAGGCACCTGTAGG
GGGTGGTGGGCTGGTGGCCCAGGAGAAGTCAGGAAGGGAGCCCAGCTGGTGAC
AAGAGAGCCCAGAGGTGCCTGGGGCTGAGTGTGAGAGCCCGGAAGATTTCAGCC
ATGCCTCACAGCTCCGACAGCAGTGACTCCAGCTTCAGCCGCTCTCCTCCCCCTG
GCAAACAGGACTCATCTGATGATGTGAGAAGAGTTCAGAGGAGGGAGAAAAATC
GTATTGCCGCCCAGAAGAGCCGACAGAGGCAGACACAGAAGGCCGACACCCTGC
ACCTGGAGAGCGAAGACCTGGAGAAACAGAACGCGGCTCTACGCAAGGAGATC
AAGCAGCTCACAGAGGAACTGAAGTACTTCACGTCGGTGCTGAACAGCCACGAG
CCCCTGTGCTCGGTGCTGGCCGCCAGCACGCCCTCGCCCCCCGAGGTGGTGTACA
GCGCCCACGCATTCCACCAACCTCATGTCAGCTCCCCGCGCTTCCAGCCCTGAGC
TTCCGATGCGGGGAGAGCAGAGCCTCGGGAGGGGCACACAGACTGTGGCAGAGC
TGCGCCCATCCCGCAGAGGCCCCTGTCCACCTGGAGACCCGGAGACAGAGGCCT
GGAC AAGGAGT GAAC AC GGGAACT GT C AC GACT GGAAGGGCGT GAGGC CTC CC A
GCAGTGCCGCAGCGTTTCGAGGGGCGTGTGCTGGACCCCACCACTGTGGGTTGCA
GGCCCAATGCAGAAGAGTATTAAGAAAGATGCTCAAGTCCCATGGCACAGAGCA
AGGCGGGCAGGGAACGGTTATTTTTCTAAATAAATGCTTTAAAAGAAA
SEP ID NO: 28 - mouse BATF nucleotide sequence
GCAGTCCCTCTGCACCCGAGAGAGAGGAGGACGCAGGGGTCTGTCAGAGGTTGC
TGTTGGGCAAGCAGGGGAGGTACCTGTGGAAGGTGGTGTGCTGGTGGCCCCCTA
GCAGTCAAGAAGGGGAGCCAGCTAGTGAGAAGATCGCCCAGAGGCATCTGGGA
CGGTGTGGGAGAGCCCGGAAGATTAGAACCATGCCTCACAGCTCCGACAGCAGT
GACTCCAGCTTCAGCCGCTCTCCTCCCCCTGGCAAACAGGACTCATCTGATGATG
TGAGGAAAGTTCAGAGGAGAGAGAAGAATCGCATCGCTGCCCAGAAGAGCCGA
CAGAGACAGACACAGAAAGCCGACACCCTTCACCTGGAGAGTGAGGACCTGGA
GAAACAGAACGCAGCTCTCCGCAAAGAGATCAAACAGCTCACCGAGGAGCTCAA
GTACTTCACATCAGTGCTGAGCAGCCACGAGCCCCTGTGCTCCGTGCTGGCCAGT
GGCACCCCCTCGCCCCCCGAGGTGGTATACAGTGCCCATGCCTTCCACCAGCCTC
ACATCAGCTCGCCACGCTTCCAGCCCTGACCTTCTGGACAAGAAGGGCGATGCTA
CTCCCGTGATCCCTTGGAGGGGCATGTAAACTGAGGCCGGGCTGCCCTCATACCT
CTACCCAGAGGCCCAGTGGCAGAGGCCTGGACAAGTATTGAACACAAGAACTGT
AGTGGTCAGAGGGACTTAAGGCCTCCCAGGGAAGTATAGTCAATGTACTGGACT
CTCCCAGGGAAGTCGAGCCAATGTACTGGACCCAAAAAATGACAAGTCAACCCT
GGACTGTCATGAATGATGCCCAAAATACACAGCACAGAGGGAGGAGGGCAGGG
GGTGGATAGTTTTCTAAATAAATATTTTCTAAAAAACCA
SEP ID NO: 29 - gRNA-1, N is A, T, C, or G
TTCACACCATCACGACGCGTNGG
SEP ID NO: 30 - gRNA-2, N is A, T, C, or G
TGGGGGCAGCTTGGCCGCTCNGG
SEP ID NO: 31 - g-RNA-3, N is A, T, C, or G
TATGCCCCCTGATGACCCACNGG
SEP ID NO: 32 - gRNA-4, N is A, T, C, or G
AAGGAGGTCTTCTCCTGCCGNGG
SEP ID NO: 33 - gRNA-5, N is A, T, C, or G
GTGATGGGCACGTCGGGCCGNGG
SEP ID NP: 34 - g-RNA-6, N is A, T, C, or G
CAGCTCCCTCTAGTCCCGCGNGG
SEP ID NO: 35 - control gRNA, N is A, T, C, or G
GCUU GU GGAU GUU GC GGA AGN GG
SEP ID NO: 36 - gRNA-1
TTCACACCATCACGACGCGT
SEP ID NO: 37 - gRNA-2
TGGGGGCAGCTTGGCCGCTC
SEP ID NO: 38 - g-RNA-3
TATGCCCCCTGATGACCCAC
SEP ID NO: 39 - gRNA-4
AAGGAGGTCTTCTCCTGCCG
SEP ID NO: 40 - gRNA-5
GTGATGGGCACGTCGGGCCG
SEP ID NO: 41- g-RNA-6
CAGCTCCCTCTAGTCCCGCG
SEP ID NO: 42 - sgRc3hl nucleic acid sequence
GGTAGAGGGTTACTACCCGG
* * *
[00355] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.
[00356] All patents, applications, publications, test methods, literature, and other materials cited herein are hereby incorporated by reference in their entirety as if physically present in this specification.
Claims
1. A method of enhancing expansion and/or persistence and/or an anti -tumor or an anti infection function of a T cell, comprising modifying a Regnase-1 ( REGNASE-1 , Zc3hl2a, MCPIPl) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated.
2. The method of claim 1, wherein the T cell is selected from a CD8+ ab T cell receptor
(TCR) T cell, a CD4+ ab TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a gd T cell.
3. The method of claim 2, wherein the T cell is a CD8+ ab TCR T cell.
4. The method of claim 2, wherein the T cell is a CD4+ ab TCR T cell.
5. The method of any one of claims 1 -4, wherein the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR).
6. The method of claim 5, wherein the CAR targets a tumor antigen or an infectious antigen.
7. The method of any one of claims 1-6, wherein the modifying step comprises disrupting the Regnase-1 gene with a site-specific nuclease.
8. The method of claim 7, wherein the site-specific nuclease comprises a Cas protein and a guide RNA.
9. The method of claim 8, wherein the Cas protein is a Cas9 protein.
10. The method of claim 8 or claim 9, wherein the guide RNA is a single guide RNA (sgRNA).
11. The method of claim 10, wherein the sgRNA targets Regnase-1.
12. The method of claim 11, wherein the sgRNA comprises
TTCACACCATCACGACGCGTNGG (SEQ ID NO: 29),
CAGCTCCCTCTAGTCCCGCGNGG (SEQ ID NO: 34), TTCACACCATCACGACGCGT (SEQ ID NO: 36) or CAGCTCCCTCTAGTCCCGCG (SEQ ID NO: 41), or a nucleotide sequence having at least 80% identity therof.
13. The method of claim 7, wherein the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
14. The method of any one of claims 1-6, wherein the modifying step comprises silencing a Regnase-1 mRNA with an RNA interference (RNAi) molecule or an antisense oligonucleotide.
15. The method of claim 14, wherein the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
16. The method of any one of claims 1-6, wherein the modifying step comprises inhibiting a Regnase-1 protein with one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
17. The method of any one of claims 1-16, wherein the in vivo accumulation of the T cell is improved more than 100-fold as compared an unmodified T cell at day 7 after the Regnase- 1 modification.
18. The method of any one of claims 1-17, further comprising modifying one or more additional genes or gene products in the T cell such that the expression and/or function of said additional gene(s) or gene product(s) in said T cell is reduced or eliminated, wherein said additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, md Rcorl.
19. The method of claim 18, wherein the modifying of one or more additional genes comprises disrupting said gene(s) with a site-specific nuclease.
20. The method of claim 19, wherein the site-specific nuclease comprises a Cas protein
and a guide RNA.
21. The method of claim 20, wherein the Cas protein is a Cas9 protein.
22. The method of claim 20 or claim 21, wherein the guide RNA is a single guide RNA (sgRNA).
23. The method of claim 19, wherein the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
24. The method of claim 18, wherein the modifying of one or more additional gene products comprises administering an RNA interference (RNAi) molecule or an antisense oligonucleotide.
25. The method of claim 24, wherein the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
26. The method of claim 18, wherein the modifying of one or more additional gene products comprises administering one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
27. A modified T cell produced by the method of any one of claims 1-26.
28. The modified T cell of claim 27, wherein the T cell is a CD8+ T cell.
29. The modified T cell of claim 27 or claim 28, wherein the T cell is derived from a blood, marrow, tissue, or tumor sample.
30. The modified T cell of any one of claims 27-29, wherein the T cell is an allogeneic T cell.
31. The modified T cell of any one of claims 27-29, wherein the T cell is an autologous T cell.
32. The modified T cell of any one of claims 27-31, wherein the T cell has been activated and/or expanded ex vivo.
33. A pharmaceutical composition comprising the modified T cell of any one of claims 27- 32 and a pharmaceutically acceptable carrier and/or excipient.
34. A method of treating a disease in a subject in need thereof comprising administering to the subject an effective amount of the modified T cells of any one of claims 27-32 or the pharmaceutical composition of claim 33.
35. The method of claim 34, wherein the modified T cells are autologous cells.
36. The method of claim 34, wherein the modified T cells are allogeneic cells.
37. The method of any one of claims 34-36, wherein the disease is a cancer or an infectious disease.
38. The method of claim 37, wherein the cancer is a solid tumor.
39. The method of claim 37 or 38, wherein the cancer is melanoma, colon cancer, breast cancer, or brain cancer.
40. The method of claim 37, wherein the cancer is a blood cancer.
41. The method of claim 37 or 40, wherein the cancer is a lymphoma, leukemia, or multiple myeloma.
42. The method of any one of claims 34-41, wherein the method comprises:
a) isolating a T cell from the subject or a donor;
b) modifying a Regnase-1 gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated;
c) optionally, activating and/or expanding the T cell before or after step b); and d) administering an effective amount of the modified T cells to the subject.
43. The method of any one of claims 34-42, wherein the subject is a human.
44. A method of enhancing expansion and/or persistence and/or an anti-tumor or an anti infection function of a T cell, comprising increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
45. The method of claim 44, wherein the T cell is selected from a CD8+ ab T cell receptor (TCR) T cell, a CD4+ ab TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a gd T cell.
46. The method of claim 45, wherein the T cell is a CD8+ ab TCR T cell.
47. The method of claim 45, wherein the T cell is a CD4+ ab TCR T cell.
48. The method of any one of claims 44-47, wherein the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR).
49. The method of claim 48, wherein the CAR targets a tumor antigen or an infectious antigen.
50. The method of any one of claims 44-49, wherein the method comprises introducing into the T cell a polynucleotide encoding a BATF protein, or functional fragment or derivative thereof.
51. The method of any one of claim 50, wherein the polynucleotide encoding a BATF protein comprises the nucleotide sequence of
AAAGCGAGCGACATGTCCCTTTGGGGAGCAGTCCCTCTGCACCCCAGAGTGAGG AGGAC GC AGGGGT C AGAGGT GGCT AC AGGGC AGGC AGAGGAGGC AC CT GTAGG GGGTGGTGGGCTGGTGGCCCAGGAGAAGTCAGGAAGGGAGCCCAGCTGGTGAC AAGAGAGCCCAGAGGTGCCTGGGGCTGAGTGTGAGAGCCCGGAAGATTTCAGCC ATGCCTCACAGCTCCGACAGCAGTGACTCCAGCTTCAGCCGCTCTCCTCCCCCTG GCAAACAGGACTCATCTGATGATGTGAGAAGAGTTCAGAGGAGGGAGAAAAAT CGTATTGCCGCCCAGAAGAGCCGACAGAGGCAGACACAGAAGGCCGACACCCTG CACCTGGAGAGCGAAGACCTGGAGAAACAGAACGCGGCTCTACGCAAGGAGAT
CAAGCAGCTCACAGAGGAACTGAAGTACTTCACGTCGGTGCTGAACAGCCACGA
GCCCCTGTGCTCGGTGCTGGCCGCCAGCACGCCCTCGCCCCCCGAGGTGGTGTAC
AGCGCCCACGCATTCCACCAACCTCATGTCAGCTCCCCGCGCTTCCAGCCCTGAG
CTTCCGATGCGGGGAGAGCAGAGCCTCGGGAGGGGCACACAGACTGTGGCAGA
GCTGCGCCCATCCCGCAGAGGCCCCTGTCCACCTGGAGACCCGGAGACAGAGGC
CTGGACAAGGAGTGAACACGGGAACTGTCACGACTGGAAGGGCGTGAGGCCTCC
CAGCAGTGCCGCAGCGTTTCGAGGGGCGTGTGCTGGACCCCACCACTGTGGGTT
GCAGGCCCAATGCAGAAGAGTATTAAGAAAGATGCTCAAGTCCCATGGCACAGA
GCAAGGCGGGCAGGGAACGGTTATTTTTCTAAATAAATGCTTTAAAAGAAA (SEQ
ID NO: 27), or a nucleotide sequence having at least 80% identity therof.
52. The method of any one of claim 50, wherein the BATF protein encoded by the polynucleotide comprises the amino acid sequence of MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLE SEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQ PHVSSPRFQP (SEQ ID NO: 25), or an amino acid sequence having at least 80% identity therof.
53. The method of any one of claims 50-52, wherein the polynucleotide encoding a BATF protein, or functional fragment or derivative thereof, is introduced into the T cell in a recombinant vector.
54. The method of claim 53, wherein the recombinant vector is a viral vector.
55. The method of claim 54, wherein the viral vector is a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated virus vector, an alphaviral vector, a herpes virus vector, or a vaccinia virus vector.
56. The method of claim 55, wherein the viral vector is a retroviral vector.
57. The method of claim 53, wherein the recombinant vector is a non-viral RNA and/or
DNA vector.
58. The method of any one of claims 44-57, further comprising modifying one or more additional genes or gene products in the T cell such that the expression and/or function of said additional gene(s) or gene product(s) in said T cell is reduced or eliminated, wherein said additional gene(s) or gene product(s) are selected from Regnase-1 (REGNASE-1 , Zc3hl2a, MCPIPl), Ptpn2, Socsl , Agps, RcShl, and Rcorl.
59. The method of claim 58, wherein said additional gene(s) or gene product(s) is Regnase- 1 C REGNASE-1 , Zc3hl2a, MCPIPl).
60. The method of claim 58 or claim 59, wherein the modifying of one or more additional genes comprises disrupting said gene(s) with a site-specific nuclease.
61. The method of claim 60, wherein the site-specific nuclease comprises a Cas protein and a guide RNA.
62. The method of claim 61, wherein the Cas protein is a Cas9 protein.
63. The method of claim 61 or claim 62, wherein the guide RNA is a single guide RNA (sgRNA).
64. The method of claim 63, wherein the sgRNA comprises
TTCACACCATCACGACGCGTNGG (SEQ ID NO: 29),
CAGCTCCCTCTAGTCCCGCGNGG (SEQ ID NO: 34), TTCACACCATCACGACGCGT (SEQ ID NO: 36) or CAGCTCCCTCTAGTCCCGCG (SEQ ID NO: 41), or a nucleotide sequence having at least 80% identity therof.
65. The method of claim 60, wherein the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
66. The method of claim 58 or claim 59, wherein the modifying of one or more additional gene products comprises administering an RNA interference (RNAi) molecule or an antisense oligonucleotide.
67. The method of claim 66, wherein the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
68. The method of claim 58 or claim 59, wherein the modifying of one or more additional gene products comprises administering one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
69. The method of any one of claims 7-16, 19-26, and 60-68, wherein the site-specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, small molecule inhibitor, antibody or antibody fragment, or aptamer is introduced into the T cell via a physical means.
70. The method of claims 69, wherein the physical means is electroporation, microinjection, magnetofection, ultrasound, a ballistic or hydrodynamic method, or a combination thereof.
71. The method of claims 69 or 70, wherein the physical means is electroporation.
72. The method of any one of any one of claims 7-16, 19-26, and 60-68, wherein the site- specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, antibody or antibody fragment, or aptamer is introduced into the T cell in a recombinant vector.
73. The method of claim 72, wherein the recombinant vector is a viral vector.
74. The method of claim 73, wherein the viral vector is a retroviral vector, a lentiviral vector, an adenoviral vector, an adeno-associated virus vector, an alphaviral vector, a herpes virus vector, or a vaccinia virus vector.
75. The method of claim 72, wherein the recombinant vector is a non-viral RNA and/or DNA vector.
76. A method of enhancing expansion and/or persistence and/or an anti-tumor or an anti infection function of a T cell, comprising modifying a Regnase-1 ( REGNASE-1 , Zc3hl2a, MCPIPl) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
77. The method of claim 76, further comprising modifying one or more additional genes or gene products in the T cell such that the expression and/or function of said additional gene(s) or gene product(s) in said T cell is reduced or eliminated, wherein said additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
78. A modified T cell produced by the method of any one of claims 44-77.
79. The modified T cell of claim 78, wherein the T cell is a CD8+ T cell.
80. The modified T cell of claim 78 or claim 79, wherein the T cell is derived from a blood, marrow, tissue, or tumor sample.
81. The modified T cell of any one of claims 78-80, wherein the T cell is an allogeneic T cell.
82. The modified T cell of any one of claims 78-80, wherein the T cell is an autologous T cell.
83. The modified T cell of any one of claims 78-82, wherein the T cell has been activated and/or expanded ex vivo.
84. A pharmaceutical composition comprising the modified T cell of any one of claims 78- 83 and a pharmaceutically acceptable carrier and/or excipient.
85. A method of treating a disease in a subject in need thereof comprising administering to the subject an effective amount of the modified T cells of any one of claims 78-83 or the pharmaceutical composition of claim 84.
86. The method of claim 85, wherein the modified T cells are autologous cells.
87. The method of claim 85, wherein the modified T cells are allogeneic cells.
88. The method of any one of claims 85-87, wherein the disease is a cancer or an infectious
disease.
89. The method of claim 88, wherein the cancer is a solid tumor.
90. The method of claim 88 or 89, wherein the cancer is melanoma, colon cancer, breast cancer, or brain cancer.
91. The method of claim 88, wherein the cancer is a blood cancer.
92. The method of claim 88 or 91 , wherein the cancer is a lymphoma, leukemia, or multiple myeloma.
93. The method of any one of claims 85-92, wherein the method comprises:
a) isolating a T cell from the subject or a donor;
b) increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell;
c) optionally, activating and/or expanding the T cell before or after step b); and d) administering an effective amount of the modified T cells to the subject.
94. The method of any one of claims 85-93, wherein the subject is a human.
95. A method of improving mitochondrial biogenesis and/or function in a T cell comprising modifying a Regnase-1 {REGNASE-1 , Zc3hl2a, MCPIPl) gene or gene product in the T cell such that the expression and/or function of Regnase-1 in the T cell is reduced or eliminated and/or increasing the expression of Batf gene and/or enhancing the function of BATF protein in the T cell.
96. The method of claim 95, further comprising modifying one or more additional genes or gene products in the T cell such that the expression and/or function of said additional gene(s) or gene product(s) in said T cell is reduced or eliminated, wherein said additional gene(s) or gene product(s) are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl.
97. An isolated polynucleotide, comprising the nucleotide sequence of any one of SEQ ID NOs: 1-9, 29-34 and 36-42, or a nucleotide sequence having at least 80% identity thereof.
98. The isolated polynucleotide of claim 97, comprising the nucleotide sequence of SEQ ID NO: 1 or 2.
99. The isolated polynucleotide of claim 97, comprising the nucleotide sequence of SEQ ID NO: 29, 34, 36 or 41.
100. The isolated polynucleotide of any one of claims 97-99, wherein the polynucleotide is a guide RNA.
101. The method of claim 100, wherein the guide RNA is a single guide RNA (sgRNA).
102. A method of enhancing expansion and/or persistence and/or an anti-tumor or an anti infection function of a T cell, comprising modifying one or more genes or gene products thereof in the T cell such that the expression and/or function of gene or gene product in the T cell is reduced or eliminated, wherein the one or more genes are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rear I .
103. The method of claim 102, wherein the T cell is selected from a CD8+ ab T cell receptor (TCR) T cell, a CD4+ ab TCR T cell, a regulatory T cell, a natural killer T (NKT) cell, and a gd T cell.
104. The method of claim 103, wherein the T cell is a CD8+ ab TCR T cell.
105. The method of claim 103, wherein the T cell is a CD4+ ab TCR T cell.
106. The method of any one of claims 102-105, wherein the T cell is further engineered to express a T cell receptor or a chimeric antigen receptor (CAR).
107. The method of claim 106, wherein the CAR targets a tumor antigen or an infectious antigen.
108. The method of any one of claims 102-107, wherein the modifying step comprises disrupting said one or more genes with a site-specific nuclease.
109. The method of claim 108, wherein the site-specific nuclease comprises a Cas protein and a guide RNA.
110. The method of claim 109, wherein the Cas protein is a Cas9 protein.
111. The method of claim 109 or claim 110, wherein the guide RNA is a single guide RNA (sgRNA).
112. The method of claim 111, wherein the sgRNA targets said one or more genes.
113. The method of claim 108, wherein the site-specific nuclease comprises a zinc finger nuclease (ZFN), a TALEN nuclease, or a mega-TALEN nuclease.
114. The method of any one of claims 102-107, wherein the modifying step comprises silencing an mRNA produced from said one or more genes with an RNA interference (RNAi) molecule or an antisense oligonucleotide.
115. The method of claim 114, wherein the RNAi molecule is a small interfering RNA (siRNA) or a small hairpin RNA (shRNA).
116. The method of any one of claims 102-107, wherein the modifying step comprises inhibiting a protein produced from said one or more genes with one or more of a small molecule inhibitor, a peptide, an antibody or antibody fragment, and an aptamer.
117. The method of any one of claims 108-116, wherein the site-specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, small molecule inhibitor, antibody or antibody fragment, or aptamer is introduced into the T cell via a physical means.
118. The method of claims 117, wherein the physical means is electroporation, microinjection, magnetofection, ultrasound, a ballistic or hydrodynamic method, or a combination thereof.
119. The method of claims 117 or 118, wherein the physical means is electroporation.
120. The method of any one of any one of claims 108-116, wherein the site-specific nuclease, RNAi molecule, antisense oligonucleotide, peptide, antibody or antibody fragment, or aptamer is introduced into the T cell in a recombinant vector.
121. The method of claim 120, wherein the recombinant vector is a viral vector.
122. The method of claim 121, wherein the viral vector is a retroviral vector, a lenti viral vector, an adenoviral vector, an adeno-associated virus vector, an alphaviral vector, a herpes virus vector, or a vaccinia virus vector.
123. The method of claim 120, wherein the recombinant vector is a non- viral RNA and/or DNA vector.
124. A modified T cell produced by the method of any one of claims 1-123.
125. The modified T cell of claim 124, wherein the T cell is a CD8+ T cell.
126. The modified T cell of claim 124 or claim 125, wherein the T cell is derived from a blood, marrow, tissue, or tumor sample.
127. The modified T cell of any one of claims 124-126, wherein the T cell is an allogeneic T cell.
128. The modified T cell of any one of claims 124-126, wherein the T cell is an autologous T cell.
129. The modified T cell of any one of claims 124-126, wherein the T cell has been activated and/or expanded ex vivo.
130. A pharmaceutical composition comprising the modified T cell of any one of claims 124-129 and a pharmaceutically acceptable carrier and/or excipient.
131. A method of treating a disease in a subj ect in need thereof comprising administering to
the subject an effective amount of the modified T cells of any one of claims 124-129 or the pharmaceutical composition of claim 130.
132. The method of claim 131, wherein the modified T cells are autologous cells.
133. The method of claim 131, wherein the modified T cells are allogeneic cells.
134. The method of any one of claims 131-133, wherein the disease is a cancer or an infectious disease.
135. The method of claim 134, wherein the cancer is a solid tumor.
136. The method of claim 134 or 135, wherein the cancer is melanoma, colon cancer, breast cancer, or brain cancer.
137. The method of claim 134, wherein the cancer is a blood cancer.
138. The method of claim 134 or 137, wherein the cancer is a lymphoma, leukemia, or multiple myeloma.
139. The method of any one of claims 131-138, wherein the method comprises:
a) isolating a T cell from the subject or a donor;
b) modifying one or more genes or gene products thereof in the T cell such that the expression and/or function of the gene or gene product in the T cell is reduced or eliminated, wheren the one or more genes are selected from Ptpn2, Socsl, Agps, Rc3hl, and Rcorl
c) optionally, activating and/or expanding the T cell before or after step b); and d) administering an effective amount of the modified T cells to the subject.
140. The method of any one of claims 131-139, wherein the subject is a human.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/605,639 US20220226380A1 (en) | 2019-04-24 | 2020-04-23 | Gene knock-outs to improve t cell function |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962838060P | 2019-04-24 | 2019-04-24 | |
| US62/838,060 | 2019-04-24 | ||
| US201962912231P | 2019-10-08 | 2019-10-08 | |
| US62/912,231 | 2019-10-08 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2020219682A2 true WO2020219682A2 (en) | 2020-10-29 |
| WO2020219682A3 WO2020219682A3 (en) | 2021-02-04 |
Family
ID=72941283
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/029533 Ceased WO2020219682A2 (en) | 2019-04-24 | 2020-04-23 | Gene knock-outs to improve t cell function |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US20220226380A1 (en) |
| WO (1) | WO2020219682A2 (en) |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021097521A1 (en) * | 2019-11-20 | 2021-05-27 | Cartherics Pty. Ltd. | Method for providing immune cells with enhanced function |
| WO2022189967A1 (en) * | 2021-03-09 | 2022-09-15 | Crispr Therapeutics Ag | Genetically engineered t cells with ptpn2 knockout have improved functionality and anti-tumor activity |
| WO2023010073A1 (en) * | 2021-07-28 | 2023-02-02 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods for improving t cell persistence and function |
| WO2023015210A1 (en) * | 2021-08-03 | 2023-02-09 | Spotlight Therapeutics | Zc3h12a (regnase-1) specific guide rnas and uses thereof |
| WO2023070080A1 (en) * | 2021-10-22 | 2023-04-27 | The Trustees Of The University Of Pennsylvania | Knockout of regnase-1 and or roquin-1 to enhance car-t cell activity |
| WO2023070041A1 (en) * | 2021-10-21 | 2023-04-27 | Lyell Immunopharma, Inc. | Enhanced immune cell therapy |
| WO2023081813A1 (en) | 2021-11-05 | 2023-05-11 | St. Jude Children's Research Hospital, Inc. | Zip cytokine receptors |
| WO2023111913A1 (en) * | 2021-12-15 | 2023-06-22 | Crispr Therapeutics Ag | Engineered anti-liv1 cell with regnase-1 and/or tgfbrii disruption |
| WO2023230440A1 (en) * | 2022-05-23 | 2023-11-30 | Baylor College Of Medicine | Batf3 overexpression in lymphocytes |
| WO2023154968A3 (en) * | 2022-02-14 | 2023-12-28 | The Regents Of The University Of California | Dna constructs for improved t cell immunotherapy |
| US12037407B2 (en) | 2021-10-14 | 2024-07-16 | Arsenal Biosciences, Inc. | Immune cells having co-expressed shRNAS and logic gate systems |
| WO2024249342A1 (en) * | 2023-05-26 | 2024-12-05 | Editas Medicine, Inc. | Crispr-related methods and compositions targeting ptpn2 expression |
| US12257304B2 (en) | 2023-03-03 | 2025-03-25 | Arsenal Biosciences, Inc. | Systems targeting PSMA and CA9 |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11583555B2 (en) * | 2016-06-24 | 2023-02-21 | University of Pittsburgh—of the Commonwealth System of Higher Education | Genetic re-engineering of immune cells to improve metabolic fitness for immunotherapy |
| US20190284553A1 (en) * | 2018-03-15 | 2019-09-19 | KSQ Therapeutics, Inc. | Gene-regulating compositions and methods for improved immunotherapy |
-
2020
- 2020-04-23 US US17/605,639 patent/US20220226380A1/en active Pending
- 2020-04-23 WO PCT/US2020/029533 patent/WO2020219682A2/en not_active Ceased
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021097521A1 (en) * | 2019-11-20 | 2021-05-27 | Cartherics Pty. Ltd. | Method for providing immune cells with enhanced function |
| WO2022189967A1 (en) * | 2021-03-09 | 2022-09-15 | Crispr Therapeutics Ag | Genetically engineered t cells with ptpn2 knockout have improved functionality and anti-tumor activity |
| US12553030B2 (en) | 2021-03-09 | 2026-02-17 | Crispr Therapeutics Ag | Genetically engineered T cells with PTPN2 knockout have improved functionality and anti-tumor activity |
| WO2023010073A1 (en) * | 2021-07-28 | 2023-02-02 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods for improving t cell persistence and function |
| WO2023015210A1 (en) * | 2021-08-03 | 2023-02-09 | Spotlight Therapeutics | Zc3h12a (regnase-1) specific guide rnas and uses thereof |
| US12037407B2 (en) | 2021-10-14 | 2024-07-16 | Arsenal Biosciences, Inc. | Immune cells having co-expressed shRNAS and logic gate systems |
| WO2023070041A1 (en) * | 2021-10-21 | 2023-04-27 | Lyell Immunopharma, Inc. | Enhanced immune cell therapy |
| WO2023070080A1 (en) * | 2021-10-22 | 2023-04-27 | The Trustees Of The University Of Pennsylvania | Knockout of regnase-1 and or roquin-1 to enhance car-t cell activity |
| WO2023081813A1 (en) | 2021-11-05 | 2023-05-11 | St. Jude Children's Research Hospital, Inc. | Zip cytokine receptors |
| WO2023111913A1 (en) * | 2021-12-15 | 2023-06-22 | Crispr Therapeutics Ag | Engineered anti-liv1 cell with regnase-1 and/or tgfbrii disruption |
| WO2023154968A3 (en) * | 2022-02-14 | 2023-12-28 | The Regents Of The University Of California | Dna constructs for improved t cell immunotherapy |
| WO2023230440A1 (en) * | 2022-05-23 | 2023-11-30 | Baylor College Of Medicine | Batf3 overexpression in lymphocytes |
| US12257304B2 (en) | 2023-03-03 | 2025-03-25 | Arsenal Biosciences, Inc. | Systems targeting PSMA and CA9 |
| WO2024249342A1 (en) * | 2023-05-26 | 2024-12-05 | Editas Medicine, Inc. | Crispr-related methods and compositions targeting ptpn2 expression |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2020219682A3 (en) | 2021-02-04 |
| US20220226380A1 (en) | 2022-07-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220226380A1 (en) | Gene knock-outs to improve t cell function | |
| US12383601B2 (en) | Chimeric antigen receptors and uses thereof | |
| AU2019331496B2 (en) | Methods of making chimeric antigen receptor-expressing cells | |
| US11141471B2 (en) | Universal donor checkpoint inhibitor silenced/gene edited cord blood killer cells | |
| US20190167720A1 (en) | Gene editing for immunological destruction of neoplasia | |
| US20260055162A1 (en) | Cellular therapeutics engineered with signal modulators and methods of use thereof | |
| US20210214723A1 (en) | Materials and methods for treating cancer | |
| US20220226379A1 (en) | Dnmt3a knock-out stat5 activated genetically engineered t-cells | |
| US20210015866A1 (en) | Tissue resident memory cell profiles, and uses thereof | |
| CA3150095A1 (en) | IMMUNE CELL ENGINEERING FOR EX VIVO CELLULAR THERAPY APPLICATIONS | |
| US20240384231A1 (en) | Materials and methods for enhanced stem-cell like memory t cell engineering | |
| US20250041344A1 (en) | Gene editing methods for modulating expression of id-3, an inhibitor of dna-binding transcription factors, thereby affecting t-cell function | |
| US20250059591A1 (en) | Pct/us22/79410 | |
| US20230340067A1 (en) | Methods of generating an activation inducible expression system in immune cells | |
| RU2841244C2 (en) | Chimeric antigen receptors and ways of use thereof | |
| Fujino et al. | Development of CAR T cells Targeting a Surface RNA Binding Protein for the Treatment of Acute Leukemias | |
| CN120843605A (en) | A PD-1 genome knockout allogeneic double-negative T cell and its preparation method and application | |
| HK40048881A (en) | Methods of making chimeric antigen receptor-expressing cells | |
| HK40048881B (en) | Methods of making chimeric antigen receptor-expressing cells | |
| HK40121178A (en) | Enhancing effector cell durability and efficacy in adoptive cell therapies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20796147 Country of ref document: EP Kind code of ref document: A2 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 20796147 Country of ref document: EP Kind code of ref document: A2 |



