WO2020160192A1 - Compounds and uses thereof - Google Patents

Compounds and uses thereof Download PDF

Info

Publication number
WO2020160192A1
WO2020160192A1 PCT/US2020/015740 US2020015740W WO2020160192A1 WO 2020160192 A1 WO2020160192 A1 WO 2020160192A1 US 2020015740 W US2020015740 W US 2020015740W WO 2020160192 A1 WO2020160192 A1 WO 2020160192A1
Authority
WO
WIPO (PCT)
Prior art keywords
optionally substituted
compound
alkyl
formula
carbocyclyl
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/015740
Other languages
French (fr)
Inventor
Sabine K. RUPPEL
Zhaoxia Yang
Jason T. LOWE
Johannes H. Voigt
Matthew Netherton
Francois BRUCELLE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Foghorn Therapeutics Inc
Original Assignee
Foghorn Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Foghorn Therapeutics Inc filed Critical Foghorn Therapeutics Inc
Priority to EP20749033.5A priority Critical patent/EP3917526A4/en
Priority to EA202192106A priority patent/EA202192106A1/en
Priority to JP2021544150A priority patent/JP2022523073A/en
Priority to US17/425,132 priority patent/US12391686B2/en
Priority to AU2020214802A priority patent/AU2020214802A1/en
Priority to CN202080025205.9A priority patent/CN113874016A/en
Publication of WO2020160192A1 publication Critical patent/WO2020160192A1/en
Priority to IL285178A priority patent/IL285178A/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D471/00Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00
    • C07D471/02Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00 in which the condensed system contains two hetero rings
    • C07D471/04Ortho-condensed systems
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/14Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D519/00Heterocyclic compounds containing more than one system of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring system not provided for in groups C07D453/00 or C07D455/00

Definitions

  • BRD9 is a component of the BAF complex.
  • the present invention relates to useful compositions and methods for the treatment of BAF complex-related disorders, such as cancer and infection. Summary
  • Bromodomain-containing protein 9 is a protein encoded by the BRD9 gene on chromosome 5.
  • BRD9 is a component of the BAF (BRG1- or BRM-associated factors) complex, a SWI/SNF ATPase chromatin remodeling complex, and belongs to family IV of the bromodomain- containing proteins.
  • BRD9 is present in several SWI/SNF ATPase chromatin remodeling complexes and is upregulated in multiple cancer cell lines. Accordingly, agents that reduce the levels and/or activity of BRD9 may provide new methods for the treatment of disease and disorders, such as cancer and infection.
  • the inventors have found that depleting BRD9 in cells results in the depletion of the SS18-SSX fusion protein in those cells.
  • the SS18-SSX fusion protein has been detected in more than 95% of synovial sarcoma tumors and is often the only cytogenetic abnormality in synovial sarcoma. Additionally, evidence suggests that the BAF complex is involved in cellular antiviral activities.
  • agents that degrade BRD9 e.g., compounds
  • the present disclosure features compounds and methods useful for treating BAF-related disorders (e.g., cancer or infection).
  • BAF-related disorders e.g., cancer or infection.
  • the disclosure features a compound having the structure Formula I:
  • R 1 is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 1 -C 6 heteroalkyl, or optionally substituted C 3 -C 10 carbocyclyl;
  • Z 1 is CR 2 or N
  • R 2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, or optionally substituted C 2 -C 9 heteroaryl;
  • X 1 is N or CH, and X 2 is C-R 7 ; or X 1 is C-R 7 , and X 2 is N or CH;
  • R 7 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C 1 -C 6 alkoxy, optionally substituted amino, optionally substituted sulfone, optionally substituted sulfonamide, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms;
  • X 3 is N or CH;
  • X 4 is N or CH
  • G is optionally substituted C3-C10 carbocyclyl, C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C 2 -C 9 heteroaryl, or a pharmaceutically acceptable salt thereof.
  • R 1 is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, or optionally substituted C3-C10 carbocyclyl. In some embodiments, R 1 is H, optionally substituted C1-C6 alkyl, optionally substituted C2-C6 alkenyl, or optionally substituted C3-C10 carbocyclyl. In some embodiments, R 1 is H, optionally substituted C 1 -C 6 alkyl, or optionally substituted C 3 -C 10 carbocyclyl.
  • R 1 is H. In some embodiments, R 1 is optionally substituted C1-C6 alkyl. In some embodiments, R 1 is optionally substituted C2-C6 alkenyl. In some embodiments, R 1 is optionally substituted C 3 -C 10 carbocyclyl.
  • optionally substituted C 1 -C 6 alkyl is C 1 -C 6 perfluoroalkyl.
  • R 1 is , , , , , , , , , o In some embodiments, R 1 is In some embodiments, R 1 is In some embodiments, R 1 is In some embodiments, R 1 is In some embodiments, R 1 is H, , , , , , some embodiments, R 1 is
  • R 1 is H
  • R 1 is H
  • R 1 is H, In some embodiments, R 1 is H o In some embodiments, R 1 is H. In some embodiments, R 1 is
  • Z 1 is CR 2 . In some embodiments, Z 1 is N.
  • R 2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C 3 -C 10 carbocyclyl, or optionally substituted C 6 -C 10 aryl.
  • R 2 is H, halogen, or optionally substituted C1-C6 alkyl. In some embodiments, R 2 is H, F, or
  • R 2 is H. In some embodiments, R 2 is F. In some embodiments, R 2 is CH 3
  • R 7 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C1-C6 alkoxy, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms.
  • R 7 is optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms.
  • R 7 is optionally substituted C1-C6 alkoxy or optionally substituted amino.
  • R 7 is optionally substituted sulfone or optionally substituted sulfonamide.
  • R 7 is optionally substituted C 1 -C 6 alkyl or optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R 7 is optionally substituted C1-C6 heteroalkyl or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R 7 is optionally substituted C1-C6 alkyl or optionally substituted C 1 -C 6 heteroalkyl.
  • R 7 is optionally substituted C 1 -C 6 alkyl. In some embodiments, R 7 is optionally substituted C1-C6 heteroalkyl. In some embodiments, R 7 is optionally substituted C1-C6 alkoxy. In some embodiments, R 7 is optionally substituted amino. In some embodiments, R 7 is optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R 7 is optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R 7 is optionally substituted sulfone. In some embodiments, R 7 is optionally substituted sulfonamide.
  • R 7 is optionally substituted C1-C3 alkyl. In some embodiments, R 7 is optionally substituted C 1 -C 3 heteroalkyl. In some embodiments, R 7 is–NR 3 R 4 or–OR 4 , where R 3 is H or optionally substituted C 1 -C 6 alkyl, and R 4 is optionally substituted C1-C6 alkyl.
  • R 7 is–NR 3 R 4 . In some embodiments, R 7 is–OR 4 .
  • R 3 is H. In some embodiments, R 3 is optionally substituted C 1 -C 6 alkyl. In some embodiments, R 3 is H and R 4 is methyl. In some embodiments, R 3 is methyl and R 4 is methyl. In some embodiments, R 7 is In some embodiments, R 7 is
  • R 7 is optionally substituted carbocyclyl having 3 to 6 atoms or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R 7 is optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R 7 is optionally substituted heterocyclyl having 3 to 6 atoms.
  • R 7 is carbocyclyl having 3 to 6 atoms or heterocyclyl having 3 to 6 atoms. In some embodiments, R 7 is carbocyclyl having 3 to 6 atoms. In some embodiments, R 7 is heterocyclyl having 3 to 6 atoms.
  • R 7 is
  • R 7 is In some embodiments, R 7 is
  • R 7 is , , , , , ,
  • R 7 is , , , , In some embodiments,
  • R 7 is .
  • R 7 is
  • R 7 is
  • R 7 is
  • X 1 is N and X 2 is C-R 7 . In some embodiments, X 1 is CH and X 2 is C-R 7 . In some embodiments, X 1 is C-R 7 and X 2 is N. In some embodiments, X 1 is C-R 7 and X 2 is CH.
  • X 1 is N or CH
  • X 2 is C-NR 3 R 4 , C-OR 4 ,
  • X 1 is C-NR 3 R 4 , C-OR 4 , and X 2 is N
  • X 1 is N or CH
  • X 2 is C-NR 3 R 4 , , or or X 1 is C-NR 3 R 4 , and X 2 is N or CH.
  • X 1 is N or CH, and X 2 is C-NR 3 R 4 or ; or X 1 is C-NR 3 R 4 or ,
  • X 1 is N or CH, and X 2 is C-NR 3 R 4 or ; or X 1 is
  • X 1 is N or CH
  • X 2 is C-NR 3 R 4 or
  • X 1 is C-NR 3 R 4 or and X 2 is N or CH.
  • R 7 is -NR 3 R 4 , -OR 4 , or optionally substituted heterocyclyl having 3 to 6 atoms.
  • X 1 is N and X 2 is C-NR 3 R 4 . In some embodiments, X 1 is C-NR 3 R 4 and X 2 is N. In some embodiments, X 1 is N and X 2 is C-OR 4 . In some embodiments, X 1 is C-OR 4 and X 2 is N.
  • R 3 is H. In some embodiments, R 3 is optionally substituted C1-C6 alkyl.
  • R 3 is , , , , , o In some embodiments, R 3 is In some embodiments, R 3 is , , or
  • R 3 is methyl, ethyl, , , o
  • R 4 is
  • R 4 is In some embodiments, R 4 is , or . In some embodiments, R 4 is methyl, ethyl,
  • X 3 is N. In some embodiments, X 3 is CH. In some embodiments, X 4 is N. In some embodiments, X 4 is CH.
  • X 3 is N and X 4 is N.
  • X 3 is N and X 4 is CH.
  • X 3 is CH and X 4 is N.
  • X 3 is CH and X 4 is CH.
  • G is optionally substituted C3-C10 carbocyclyl or optionally substituted C2- C9 heterocyclyl. In some embodiments, G is optionally substituted C6-C10 aryl or optionally substituted C2- C 9 heteroaryl.
  • G is optionally substituted C 3 -C 10 carbocyclyl. In some embodiments, G is optionally substituted C6-C10 aryl. In some embodiments, G is optionally substituted C2-C9 heterocyclyl. In some embodiments, G is optionally substituted C2-C9 heteroaryl.
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
  • substituted -O-C3-C6 carbocyclyl optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 , together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C 3 -C 6 carbocyclyl, optionally substituted -C 1 -C 3 alkyl-C 3 -C 6 carbocyclyl, optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or R G1 and R G2 , R G2
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl; or R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 , together with the carbon atoms to which each is attached, combine to form optionally substituted C 2 -C 9 heteroaryl or optionally substituted C 2 -C 9 heterocyclyl.
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, F, Cl, ,
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, F,
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, F, Cl, , CH , , , ,
  • R G1 is H;
  • R G2 is ;
  • R is ;
  • R is ; and
  • R G5 is H.
  • R G1 is H
  • R G2 is R G4 is H
  • R G5 is H.
  • R G1 is H; R G2 is ; R G4 is Cl or F; and R G5 is H.
  • R G5 is H.
  • R G1 is H;
  • R G2 is R G4 is R G1;
  • R G5 is H.
  • R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl or optionally substituted C2-C9 heterocyclyl.
  • R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 together with the carbon atoms to which each is attached, combine to form optionally substituted C 2 -C 9 heterocyclyl.
  • R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl.
  • G is , where R G6 is H or optionally
  • G is
  • R G6 is H or optionally substituted C 1 -C 6 alkyl.
  • R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heterocyclyl or optionally substituted C 2 -C 9 heteroaryl.
  • G is , , , ,
  • R G6 is H or optionally
  • R G6 is H, In some embodiments, R G6 is H or
  • R G6 is H. In some embodiments, R G1 is H, F
  • R G1 is H.
  • R G2 is H, F,
  • R G2 is H.
  • R G3 is H, F,
  • R G3 is H.
  • R G4 is H, F, , , , , In some embodiments, R G4 is H.
  • R G5 is H, F, , , , , . In some embodiments, R G5 is H.
  • one or more of R G1 , R G2 , R G3 , R G4 , and R G5 is H. In some embodiments, two or more of R G1 , R G2 , R G3 , R G4 , and R G5 is H. In some embodiments, three or more of R G1 , R G2 , R G3 , R G4 , and R G5 is H. In some embodiments, each of R G1 , R G2 , R G3 , R G4 , and R G5 is H.
  • G is N
  • each of R G7 , R G8 , R G9 , R G10 , and R G11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, optionally
  • substituted -O-C3-C6 carbocyclyl optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or R G7 and R G8 , R G8 and R G9 , R G9 and R G10 , and/or R G10 and R G11 , together with the carbon atoms to which each is attached, combine to form optionally substituted C 6 -C 10 aryl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl.
  • each of R G7 , R G8 , R G9 , R G10 , and R G11 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; or R G7 and R G8 , R G8 and R G9 , R G9 and R G10 , and/or R G10 and R G11 , together with the carbon atoms to which each is attached, combine to form optionally substituted C 6 -C 10 aryl, optionally substituted C 3 -C
  • each of R G7 , R G8 , R G9 , R G10 , and R G11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl; or R G7 and R G8 , R G8 and R G9 , R G9 and R G10 , and/or R G10 and R G11 , together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2- C9 heteroaryl, or C2-C9 heterocyclyl.
  • each of R G7 , R G8 , R G9 , R G10 , and R G11 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted -O-C 3 -C 6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
  • each of R G7 , R G8 , R G9 , R G10 , and R G11 is, independently, H, F, Cl, ,
  • R 8 is 3 .
  • G is N
  • each of R G12 , R G13 , and R G14 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C 1 -C 3 alkyl-C 3 -C 6 carbocyclyl, optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or R G12 and R G14 , together with the carbon atoms to which each is attached, combine to form optionally
  • each of R G12 , R G13 , and R G14 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; or R G12 and R G14 , together with the carbon atoms to which each is attached, combine to form optionally substituted C 6 -C 10 aryl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
  • the compound of Formula I has the structure of Formula Ia:
  • the compound of Formula I has the structure of Formula Ib:
  • the compound of Formula I has the structure of Formula Ic:
  • the compound of Formula I has the structure of Formula Id:
  • the compound of Formula I has the structure of Formula Ie:
  • each of R 5 and R 6 is, independently, H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 - C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, or optionally substituted C2-C9 heterocyclyl; or R 5 and R 6 , together with the nitrogen to which each is attached, combine to form an optionally substituted C 2 -C 9 heterocyclyl, or a pharmaceutically acceptable salt thereof.
  • the compound of Formula I has the structure of Formula If:
  • each of R 5 and R 6 is, independently, H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 - C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, or optionally substituted C 2 -C 9 heterocyclyl; or R 5 and R 6 , together with the nitrogen to which each is attached, combine to form an optionally substituted C2-C9 heterocyclyl, or a pharmaceutically acceptable salt thereof.
  • the compound of Formula I has the structure of Formula Ig:
  • each of R 5 and R 6 is, independently, H, optionally substituted C1-C6 alkyl, optionally substituted C1- C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, or optionally substituted C 2 -C 9 heterocyclyl; or R 5 and R 6 , together with the nitrogen to which each is attached, combine to form an optionally substituted C2-C9 heterocyclyl, or a pharmaceutically acceptable salt thereof.
  • the compound of Formula I has the structure of Formula Ih:
  • the compound of Formula I has the structure of Formula Ii:
  • the compound of Formula I has the structure of Formula Ij:
  • the compound of Formula I has the structure of Formula Ik:
  • the compound of Formula I has the structure of Formula Im:
  • the compound of Formula I has the structure of Formula In:
  • the compound of Formula I has the structure of Formula Io:
  • the compound of Formula I has the structure of Formula Ip:
  • the compound of Formula I has the structure of Formula Iq:
  • the compound of Formula I has the structure of Formula Ir:
  • the compound has the structure of any one of compounds B1-B6 in Table 1, or a pharmaceutically acceptable salt thereof. In some embodiments, the compound has the structure of any one of compounds B1-B3 and B6 in Table 1, or a pharmaceutically acceptable salt thereof.
  • the disclosure features a compound having the structure of any one of compounds B1-B6 in Table 1, or a pharmaceutically acceptable salt thereof.
  • the disclosure features a compound having the structure of any one of compounds B1-B3 and B6 in Table 1, or a pharmaceutically acceptable salt thereof.
  • the disclosure features a compound having the structure of any one of compounds B4 and B5 in Table 1, or a pharmaceutically acceptable salt thereof.
  • Table 1 Compounds B1-B6 of the Disclosure
  • the disclosure features a compound having the structure of Formula II:
  • L is a linker
  • B is a degradation moiety
  • A has the structure of Formula III:
  • R 1 is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 1 -C 6 heteroalkyl, or optionally substituted C 3 -C 10 carbocyclyl;
  • Z 1 is CR 2 or N
  • R 2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, or optionally substituted C 2 -C 9 heteroaryl;
  • X 1 is N or CH, and X 2 is C-R 7 ⁇ ; or X 1 is C-R 7 ⁇ , and X 2 is N or CH; , optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C 1 -C 6 alkoxy, optionally substituted amino, optionally substituted sulfone, optionally substituted sulfonamide, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms;
  • R 7 ⁇ is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C 3 -C 10 carbocycylyl;
  • X 3 is N or CH
  • X 4 is N or CH; , optionally substituted C 3 -C 10 carbocyclyl, C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, or optionally substituted C 2 -C 9 heteroaryl;
  • G ⁇ is optionally substituted C3-C10 carbocyclylene, C2-C9 heterocyclylene, optionally substituted C6-C10 arylene, or optionally substituted C2-C9 heteroarylene;
  • a 1 is a bond between A and the linker, , or a pharmaceutically acceptable salt thereof.
  • R 1 is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, or optionally substituted C3-C10 carbocyclyl. In some embodiments, R 1 is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 2 -C 6 alkenyl, or optionally substituted C 3 -C 10 carbocyclyl. In some embodiments, R 1 is H, optionally substituted C 1 -C 6 alkyl, or optionally substituted C 3 -C 10 carbocyclyl.
  • R 1 is H. In some embodiments, R 1 is optionally substituted C1-C6 alkyl. In some embodiments, R 1 is optionally substituted C 2 -C 6 alkenyl. In some embodiments, R 1 is optionally substituted C 3 -C 10 carbocyclyl. In some embodiments, optionally substituted C 1 -C 6 alkyl is C 1 -C 6 perfluoroalkyl.
  • R 1 is , , , , , , F F F , , , or . In some embodiments, R 1 is In some embodiments, R 1 is
  • R 1 is H , , , , , , , In some embodiments, R 1 is
  • R 1 is H
  • R 1 is H In some embodiments, R 1 is H, In some embodiments, R 1 is H or . In some embodiments, R 1 is H. In some embodiments, R 1 is H. In some embodiments, R 1 is
  • Z 1 is CR 2 . In some embodiments, Z 1 is N.
  • R 2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, or optionally substituted C6-C10 aryl.
  • R 2 is H, halogen, or optionally substituted C 1 -C 6 alkyl. In some embodiments,
  • R 2 is H. In some embodiments, R 2 is F. In some embodiments, R 2 is .
  • R 7 ⁇ is optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C1-C6 alkoxy, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms.
  • R 7 ⁇ is optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms.
  • R 7 ⁇ is optionally substituted C1-C6 alkoxy or optionally substituted amino.
  • R 7 ⁇ is optionally substituted sulfone or optionally substituted sulfonamide.
  • R 7 ⁇ is optionally substituted C 1 -C 6 alkyl or optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R 7 ⁇ is optionally substituted C 1 -C 6 heteroalkyl or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R 7 ⁇ is optionally substituted C1-C6 alkyl or optionally substituted C1-C6 heteroalkyl.
  • R 7 ⁇ is optionally substituted C 1 -C 6 alkyl. In some embodiments, R 7 ⁇ is optionally substituted C 1 -C 6 heteroalkyl. In some embodiments, R 7 ⁇ is optionally substituted C 1 -C 6 alkoxy. In some embodiments, R 7 ⁇ is optionally substituted amino. In some embodiments, R 7 ⁇ is optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R 7 ⁇ is optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R 7 ⁇ is optionally substituted sulfone. In some embodiments, R 7 ⁇ is optionally substituted sulfonamide.
  • R 7 ⁇ is optionally substituted C1-C3 alkyl. In some embodiments, R 7 ⁇ is optionally substituted C1-C3 heteroalkyl. In some embodiments
  • R 7 ⁇ is–NR 3 R 4 or–OR 4 , where R 3 is H or optionally substituted C1-C6 alkyl, and R 4 is optionally substituted C 1 -C 6 alkyl.
  • R 7 ⁇ is–NR 3 R 4 . In some embodiments, R 7 ⁇ is–OR 4 .
  • R 3 is H. In some embodiments, R 3 is optionally substituted C1-C6 alkyl. In some embodiments, R 3 is H and R 4 is methyl. In some embodiments, R 3 is methyl and R 4 is methyl. In some embodiments, R 7 ⁇ is In some embodiments, R 7 ⁇ is
  • R 7 ⁇ is optionally substituted carbocyclyl having 3 to 6 atoms or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R 7 ⁇ is optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R 7 ⁇ is optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R 7 ⁇ is carbocyclyl having 3 to 6 atoms or heterocyclyl having 3 to 6 atoms. In some embodiments, R 7 ⁇ is carbocyclyl having 3 to 6 atoms. In some embodiments, R 7 ⁇ is heterocyclyl having 3 to 6 atoms.
  • R 7 ⁇ is
  • R 7 ⁇ is
  • R 7 ⁇ is
  • R 7 ⁇ is
  • R 7 In some embodiments, R 7 ⁇ In some embodiments,
  • R 7 ⁇ is , , , , , , In
  • R 7 ⁇ is
  • R 7 ⁇ is , , , , or . In some embodiments, R 7 ⁇ is
  • X 1 is N and X 2 is C-R 7 ⁇ . In some embodiments, X 1 is CH and X 2 is C-R 7 ⁇ . In some embodiments, X 1 is C-R 7 ⁇ and X 2 is N. In some embodiments, X 1 is C-R 7 ⁇ and X 2 is CH.
  • X 1 is N or CH
  • X 2 is C-NR 3 R 4 , C-OR 4 ,
  • X 1 is C-NR 3 R 4 , C-OR 4 , , , or , and X 2 is N
  • X 1 is N or CH
  • X 2 is C-NR 3 R 4 , or
  • X 1 is C-NR 3 R 4
  • X 2 is N or CH.
  • X 1 is N or CH
  • X 2 is C-NR 3 R 4 or or X 1 is C-NR 3 R 4 or ,
  • X 1 is N or CH
  • X 2 is C-NR 3 R 4 or r
  • X 1 is C-NR 3 R 4 or
  • X 2 is N or CH.
  • X 1 is N or CH
  • X 2 is C-
  • NR 3 R 4 or or X 1 is C-NR 3 R 4 or , and X 2 is N or CH.
  • R 7 ⁇ is -NR 3 R 4 , -OR 4 , or optionally substituted heterocyclyl having 3 to 6 atoms.
  • X 1 is N and X 2 is C-NR 3 R 4 . In some embodiments, X 1 is C-NR 3 R 4 and X 2 is N.
  • R 3 is H. In some embodiments, R 3 is optionally substituted C1-C6 alkyl.
  • R 3 is In some embodiments, R 3 is or
  • R is methyl, ethyl, , , or .
  • R 4 i In some embodiments, R 4 is or
  • R 4 is methyl, ethyl
  • X 3 is N. In some embodimen ts, X 3 is CH.
  • X 4 is N. In some embodiments, X 4 is CH.
  • X 3 is N and X 4 is N.
  • X 3 is N and X 4 is CH.
  • X 3 is CH and X 4 is N.
  • X 3 is CH and X 4 is CH.
  • G ⁇ is
  • G ⁇ is optionally substituted C 3 -C 10 carbocyclylene or optionally substituted C2-C9 heterocyclylene. In some embodiments, G ⁇ is optionally substituted C6-C10 arylene or optionally substituted C2-C9 heteroarylene. In some embodiments, G ⁇ is optionally substituted C 3 -C 10 carbocyclylene. In some embodiments, G ⁇ is optionally substituted C6-C10 arylene. In some embodiments, G ⁇ is optionally substituted C2-C9 heterocyclylene. In some embodiments, G ⁇ is optionally substituted C2-C9 heteroarylene.
  • each of R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is, independently, H, A 1 , halogen, optionally substituted C1- C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
  • any of which is optionally substituted with A 1 , where one of R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is A 1 , or is substituted with A 1 .
  • each of R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is, independently, H, A 1 , halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or R G
  • M R G5 ⁇ is A 1 , or is substituted with A 1 .
  • each of R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is, independently, H, A 1 , halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted -O-C 3 -C 6 carbocyclyl, or optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl; or R G1 ⁇ and R G2 ⁇ , R G2 ⁇ and R G3 ⁇ , R G3 ⁇ and R G4 ⁇ , and/or R G4 ⁇ and R G5 ⁇ , together with the carbon atoms to which each is attached, combine to form
  • R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is A 1 , or is substituted with A 1 .
  • each of R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is, independently, H, A 1 , halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted -O-C 3 -C 6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
  • each of R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is, independently, H, A 1 , F, Cl,
  • each of R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is, independently, H, A 1 , F, ,
  • R G1 ⁇ is H; R G2 ⁇ is 3 CH
  • R G3 ⁇ is A 1 ; R G4 ⁇ is 3 ; and R G5 ⁇ is H. O O CH
  • R G1 ⁇ is H; R G2 ⁇ is 3 CH
  • R G1 ⁇ is H; R G2 ⁇ is 3 ; R G3 ⁇ is A 1 ; R G4 ⁇ is Cl or F; and R G5 ⁇ is H.
  • R G1 ⁇ is H; R G2 ⁇ is 3 ; R G3 ⁇ is A 1 ; R G4 ⁇ is H; and R G5 ⁇ is H.
  • R G1 ⁇ is H; R G2 ⁇ is 3 ; R G3 ⁇ is A 1 ; R G4 ⁇ is H; and R G5 ⁇ is H.
  • R G1 ⁇ is H; R G2 ⁇ is 3 C
  • R G3 ⁇ is A 1 ; R G4 ⁇ is ; and R G5 ⁇ is H.
  • r optionally substituted C 1 -C 6 alkyl.
  • R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is A 1 , or is substituted with A 1 .
  • R G6 ⁇ is H. In some embodiments, R G6 ⁇ is A 1 .
  • R G3 ⁇ is H, A 1 , F, , , , , ,
  • R G3 ⁇ is H.
  • R G4 ⁇ is H, A 1 , F, , , , , , ,
  • R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is H.
  • two or more of R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is H. In some embodiments, three or more of R G1 ⁇ , R G2 ⁇ , R G3 ⁇ , R G4 ⁇ , and R G5 ⁇ is H.
  • R G1 ⁇ is A 1 . In some embodiments, R G2 ⁇ is A 1 . In some embodiments, R G3 ⁇ is A 1 . In some embodiments, R G4 ⁇ is A 1 . In some embodiments, R G5 ⁇ is A 1 . In some embodiments, is substituted with A 1 .
  • each of R G7 ⁇ , R G8 ⁇ , R G9 ⁇ , R G10 ⁇ , and R G11 ⁇ is, independently, H, A 1 , halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, optionally
  • R G7 ⁇ , R G8 ⁇ , R G9 ⁇ , R G10 ⁇ , and R G11 ⁇ is A 1 ; or is substituted with A 1 .
  • each of R G7 ⁇ , R G8 ⁇ , R G9 ⁇ , R G10 ⁇ , and R G11 ⁇ is, independently, H, A 1 , halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or R G
  • each of R G7 ⁇ , R G8 ⁇ , R G9 ⁇ , R G10 ⁇ , and R G11 ⁇ is, independently, H, A 1 , halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl; or R G7 ⁇ and R G8 ⁇ , R G8 ⁇ and R G9 ⁇ , R G9 ⁇ and R G10 ⁇ , and/or R G10 ⁇ and R G11 ⁇ , together with the carbon atoms to which each is attached, combine to M M M
  • each of R G7 ⁇ , R G8 ⁇ , R G9 ⁇ , R G10 ⁇ , and R G11 ⁇ is, independently, H, A 1 , halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl.
  • each of R G7 ⁇ , R G8 ⁇ , R G9 ⁇ , R G10 ⁇ , and R G11 ⁇ is, independently, H, A 1 , F, Cl,
  • R G7 ⁇ is H; R G8 ⁇ is 3 ; R G9 ⁇ is A 1 ; and R G11 ⁇ is H.
  • each of R G12 ⁇ , R G13 ⁇ , and R G14 ⁇ is, independently, H, A 1 , halogen, optionally substituted C1-C6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or R G12 ⁇ and R G14 ⁇ , together with the carbon
  • each of R G12 ⁇ , R G13 ⁇ , and R G14 ⁇ is, independently, H, A 1 , halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or R G12 ⁇ and R G14 ⁇ , together with
  • R G12 ⁇ , R G13 ⁇ , and R G14 ⁇ is A 1 ; or is substituted with A 1 .
  • R 7 ⁇ is .
  • R 7 ⁇ is H, optionally substituted C1-C6 alkyl, or optionally substituted C3-C10 carbocycylyl. In some embodiments, R 7 ⁇ is H or optionally substituted C 1 -C 6 alkyl. In some embodiments,
  • R 7 ⁇ is H or .
  • R 7 ⁇ is H. In some embodiments, R 7 ⁇ is .
  • G ⁇ is optionally substituted C3-C10 carbocyclyl or optionally substituted C2- C9 heterocyclyl. In some embodiments, G ⁇ is optionally substituted C6-C10 aryl or optionally substituted C 2 -C 9 heteroaryl.
  • G ⁇ is optionally substituted C 3 -C 10 carbocyclyl. In some embodiments, G is optionally substituted C6-C10 aryl. In some embodiments, G is optionally substituted C2-C9 heterocyclyl. In some embodiments, G ⁇ is optionally substituted C2-C9 heteroaryl.
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
  • R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or R G1 and R G2 , R G2 and R G
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted -O-C 3 -C 6 carbocyclyl, or optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl; or R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 , together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl or optionally substituted C2-C9 heterocyclyl.
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted -O-C 3 -C 6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, F, Cl, ,
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, F, ,
  • each of R G1 , R G2 , R G3 , R G4 , and R G5 is, independently, H, ,
  • R G5 is H.
  • R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl or optionally substituted C2-C9 heterocyclyl.
  • R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 together with the carbon atoms to which each is attached, combine to form optionally substituted C 2 -C 9 heterocyclyl.
  • R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl.
  • R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 together with the carbon atoms to which each is attached, combine to form optionally substituted C 2 -C 9 heterocyclyl.
  • R G1 and R G2 , R G2 and R G3 , R G3 and R G4 , and/or R G4 and R G5 together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl.
  • r optionally
  • R G6 is H.
  • R G3 is H, F, , , , , ,
  • R G3 is H.
  • R G4 is H.
  • R G5 is H, F, , , , , ,
  • R G5 is H.
  • one or more of R G1 , R G2 , R G3 , R G4 , and R G5 is H. In some embodiments, two or more of R G1 , R G2 , R G3 , R G4 , and R G5 is H. In some embodiments, three or more of R G1 , R G2 , R G3 , R G4 , and R G5 is H. In some embodiments, each of R G1 , R G2 , R G3 , R G4 , and R G5 is H.
  • each of R G7 , R G8 , R G9 , R G10 , and R G11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
  • substituted -O-C3-C6 carbocyclyl optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or R G7 and R G8 , R G8 and R G9 , R G9 and R G10 , and/or R G10 and R G11 , together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl.
  • each of R G7 , R G8 , R G9 , R G10 , and R G11 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; or R G7 and R G8 , R G8 and R G9 , R G9 and R G10 , and/or R G10 and R G11 , together with the carbon atoms to which each is attached, combine to form optionally substituted C 6 -C 10 aryl, optionally substituted C 3 -C 10 carbocyclyl
  • each of R G7 , R G8 , R G9 , R G10 , and R G11 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted -O-C 3 -C 6 carbocyclyl, or optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl; or R G7 and R G8 , R G8 and R G9 , R G9 and R G10 , and/or R G10 and R G11 , together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2- C 9 heteroaryl, or C 2 -C 9 heterocyclyl.
  • each of R G7 , R G8 , R G9 , R G10 , and R G11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
  • each of R G7 , R G8 , R G9 , R G10 , and R G11 is, independently, H, F, Cl, ,
  • R G8 is 3 .
  • G ⁇ is R G13
  • each of R G12 , R G13 , and R G14 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, optionally substituted -O-C 3 -C 6 carbocyclyl, optionally substituted -C 1 -C 3 alkyl-C 3 -C 6 carbocyclyl, optionally substituted -C 1 -C 3 alkyl-C 2 -C 5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or R G12 and R G14 , together with the carbon atoms to which each is attached, combine to
  • each of R G12 , R G13 , and R G14 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; or R G12 and R G14 , together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
  • A has the structure of Formula IIIa:
  • A has the structure of Formula IIIb:
  • A has the structure of Formula IIIc:
  • A has the structure of Formula IIId:
  • A has the structure of Formula IIIe:
  • A has the structure of Formula IIIf:
  • A has the structure of Formula IIIg:
  • A has the structure of Formula IIIh:
  • A has the structure of Formula IIIi:
  • A has the structure of Formula IIIj:
  • A has the structure of Formula IIIk:
  • A has the structure of Formula IIIm:
  • A has the structure of Formula IIIn:
  • A has the structure of Formula IIIo:
  • A has the structure of Formula IIIp:
  • A has the structure of Formula IIIq:
  • A has the structure of Formula IIIr:
  • A has the structure of Formula IIIs:
  • A has the structure of Formula IIIt:
  • A has the structure of Formula IIIu:
  • A has the structure of Formula IIIv:
  • the degradation moiety is a ubiquitin ligase binding moiety.
  • the ubiquitin ligase binding moiety comprises Cereblon ligands, IAP (Inhibitors of Apoptosis) ligands, mouse double minute 2 homolog (MDM2), or von Hippel-Lindau (VHL) ligands, or derivatives or analogs thereof.
  • the degradation moiety is a ubiquitin ligase binding moiety.
  • the ubiquitin ligase binding moiety comprises Cereblon ligands, IAP (Inhibitors of Apoptosis) ligands, mouse double minute 2 homolog (MDM2), or von Hippel-Lindau (VHL) ligands, or derivatives or analogs thereof.
  • the degradation moiety includes the structure of Formula Y:
  • a 2 is a bond between the degradation moiety and the linker
  • v1 is 0, 1, 2, 3, 4, or 5;
  • u1 is 1, 2, or 3;
  • R 5A is H, optionally substituted C 1 -C 6 alkyl, or optionally substituted C 1 -C 6 heteroalkyl;
  • each R J1 is, independently, halogen, optionally substituted C 1 -C 6 alkyl, or optionally substituted C1-C6 heteroalkyl;
  • J A is absent, O, optionally substituted amino, optionally substituted C1-C6 alkyl, or optionally substituted C 1 -C 6 heteroalkyl;
  • J is absent, optionally substituted C 3 -C 10 carbocyclylene, optionally substituted C 6 -C 10 arylene, optionally substituted C2-C9 heterocyclylene, or optionally substituted C2-C9 heteroarylene, or a pharmaceutically acceptable salt thereof.
  • T 2 is . In some embodiments, T 2 is or . , . In some embodiments, T 2 is .
  • the structure of Formula Y has the structure of Formula Y1:
  • T 1 is a bond. In some embodiments, T 1 is .
  • the structure of Formula Y has the structure of Formula Y2:
  • the structure of Formula Y has the structure of Formula Z:
  • u1 is 1. In some embodiments, u1 is 2. In some embodiments u1 is 3. In some embodiments, the structure of Formula Z has the structure of Formula AA0:
  • the structure of Formula Z has the structure of Formula AB:
  • the structure of Formula Z has the structure of Formula AC:
  • J A is absent. In some embodiments, J A is optionally substituted C 1 -C 6 alkyl. In some embodiments, J A is optionally substituted C 1 -C 6 heteroalkyl. In some embodiments, J A is O or optionally substituted amino. In some embodiments,
  • the structure of Formula AA0 has the structure of Formula AA0:
  • v1 is 0, 1, 2, or 3. In some embodiments, v1 is 0. In some embodiments, v1 is 1. In some embodiments, v1 is 2. In some embodiments, v1 is 3.
  • the structure of Formula AA has the structure of Formula AA1:
  • the structure of Formula AB has the structure of Formula AB1:
  • the structure of Formula AC has the structure of Formula AC1:
  • J is absent. In some embodiments, J is optionally substituted C 3 -C 10 carbocyclylene or optionally substituted C 6 -C 10 arylene. In some embodiments, J is optionally substituted C 2 -C 9 heterocyclylene or optionally substituted C 2 -C 9 heteroarylene.
  • J is optionally substituted heterocyclylene. In some embodiments, J is optionally substituted C 6 -C 10 arylene.
  • the structure of Formula AA has the structure of Formula AA2:
  • the structure of Formula AA has the structure of Formula AA3:
  • the structure of Formula AA has the structure of Formula AA4:
  • R A5 is H or optionally substituted C1-C6 alkyl. In some embodiments, R A5 is optionally substituted C1-C6 heteroalkyl.
  • R A5 is H or methyl. In some embodiments, R A5 is H. In some embodiments,
  • R A5 is methyl. In some embodiments,
  • the structure of Formula AA has the structure of Formula A:
  • R A5 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
  • R A6 is H or optionally substituted C1-C6 alkyl
  • R A7 is H or optionally substituted C1-C6 alkyl
  • R A6 and R A7 together with the carbon atom to which each is bound, combine to form optionally substituted C 3 -C 6 carbocyclyl or optionally substituted C 2 -C 5 heterocyclyl
  • R A6 and R A7 together with the carbon atom to which each is bound, combine to form optionally substituted C3-C6 carbocyclyl or optionally substituted C2-C5 heterocyclyl
  • R A8 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
  • each of R A1 , R A2 , R A3 , and R A4 is, independently, H, A 2 , halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, hydroxyl, thiol, or optionally substituted amino; or R A1 and R A2 , R A2 and R A3 , and/or R A3 and R A4 , together with the carbon atoms to which each is attached, combine to form is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl,
  • each of R A1 , R A2 , R A3 , and R A4 is, independently, H, A 2 , halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; or R A1 and R A2 , R A2 and R A3 , and/or R A3 and R A4 , together with the carbon atoms to which each is attached, combine to form is optionally substituted C 6 -C 10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C
  • each of R A1 , R A2 , R A3 , and R A4 is, H, A 2 , halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, hydroxyl, optionally substituted amino; or R A1 and R A2 , R A2 and R A3 , or R A3 and R A4 , together with the carbon atoms to which each is attached, combine to form is optionally substituted C 2 -C 9 heterocyclyl, which is optionally substituted with A 2 , where one of R A1 , R A2 , R A3 , and is substituted with A 2 .
  • each of R A1 , R A2 , R A3 , and R A4 is, independently, H, A 2 , F, , together with the carbon atoms to which each is attached, combine to form is optionally substituted C2- C9 heterocyclyl, which is optionally substituted with A 2 , where one of R A1 , R A2 , R A3 , and R A4 is A 2 , or substituted with A 2 .
  • R A1 is A 2 . In some embodiments, R A2 is A 2 . In some embodiments, R A3 is A 2 . In some embodiments, R A4 is A 2 . In some embodiments, R A5 is A 2 .
  • R A5 is H or optionally substituted C1-C6 alkyl.
  • R A5 is H or . In some embodiments, R A5 is H. In some embodiments,
  • R A6 R A7 O
  • Y 1 is .
  • Y 1 is .
  • each of R A6 and R A7 is, independently, H, F, , , or
  • the structure of Formula A has the structure of Formula A1:
  • the structure of Formula A has the structure of Formula A2:
  • the structure of Formula A has the structure of Formula A3: ,
  • the structure of Formula A has the structure of Formula A4:
  • the structure of Formula A has the structure of Formula A5:
  • the structure of Formula A has the structure of Formula A6:
  • the structure of Formula A has the structure of Formula A7:
  • the structure of Formula A has the structure of Formula A8: ,
  • the structure of Formula A has the structure of Formula A9:
  • the structure of Formula A has the structure of Formula A10:
  • optionally substituted C1-C6 alkyl or optionally substituted C1-C6 heteroalkyl.
  • R A9 is H, A 2 , or optionally substituted C1-C6 alkyl. In some embodiments, R A9 is H, A 2 , or methyl. In some embodiments, R 9A is H. In some embodiments, R 9A is methyl. In some embodiments, R A9 is A 2 .
  • the structure of Formula AA has the structure of Formula B:
  • R A5 is H, optionally substituted C 1 -C 6 alkyl, or optionally substituted C 1 -C 6 heteroalkyl;
  • each of R A1 , R A2 , R A3 , and R A4 is, independently, H, A 2 , halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, optionally substituted -O-C 3 -C 6 carbocyclyl, hydroxyl, thiol, or optionally substituted amino; or R A1 and R A2 , R A2 and R A3 , and/or R A3 and R A4 , together with the carbon atoms to which each is attached, combine to form is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carb
  • each of R A1 , R A2 , R A3 , and R A4 is, H, A 2 , halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, hydroxyl, optionally substituted amino; or R A1 and R A2 , R A2 and R A3 , or R A3 and R A4 , together with the carbon atoms to which each is attached, combine to form is optionally substituted C2-C9 heterocyclyl, which is optionally substituted with A 2 , where one of R A1 , R A2 , R A3 , and R A4 is A 2 , is substituted with A 2 .
  • each of R A1 , R A2 , R A3 , and R A4 is, independently, H, A 2 , F, , together with the carbon atoms to which each is attached, combine to form is optionally substituted C 2 - C 9 heterocyclyl, which is optionally substituted with A 2 , where one of R A1 , R A2 , R A3 , and R A4 is A 2 , or substituted with A 2 .
  • R A1 is A 2 . In some embodiments, R A2 is A 2 . In some embodiments, R A3 is A 2 . In some embodiments, R A4 is A 2 . In some embodiments, R A5 is A 2 .
  • R A5 is H or optionally substituted C 1 -C 6 alkyl. In some embodiments, . In some embodiments, R A5 is H. In some
  • R A5 is .
  • the structure of Formula B has the structure of Formula B1:
  • the structure of Formula B has the structure of Formula B2: ,
  • the structure of Formula B has the structure of Formula B3:
  • the structure of Formula B has the structure of Formula B4:
  • the ubiquitin ligase binding moiety comprises a von Hippel-Lindau ligand.
  • the von Hippel-Lindau ligand has the structure
  • the degradation moiety includes the structure of Formula C:
  • R B1 is H, A 2 , optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
  • R B2 is H, optionally substituted C 1 -C 6 alkyl, or optionally substituted C 1 -C 6 heteroalkyl;
  • R B3 is A 2 , optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1-C6 alkyl C6-C10 aryl;
  • R B4 is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 1 -C 6 alkyl C 3 -C 10 carbocyclyl, or optionally substituted C 1 - C6 alkyl C6-C10 aryl;
  • R B5 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
  • v2 is 0, 1, 2, 3, or 4;
  • each R B6 is, independently, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 - C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino; and each of R B7 and R B8 is, independently, H, halogen, optionally substituted C 1 -C 6 alkyl, or optionally substituted C6-C10 aryl,
  • R B1 and R B3 are A 2 , or a pharmaceutically acceptable salt thereof.
  • the structure of Formula 1 is A 2 , or a pharmaceutically acceptable salt thereof.
  • the degrader moiety includes the structure of Formula D:
  • a 2 is a bond between B and the linker
  • each of R C1 , R C2 , and R C7 is, independently, H, optionally substituted C1-C6 alkyl, or optionally substituted C 1 -C 6 heteroalkyl;
  • R C3 is optionally substituted C 1 -C 6 alkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1- C6 alkyl C6-C10 aryl;
  • R C5 is optionally substituted C 1 -C 6 alkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1- C6 alkyl C6-C10 aryl;
  • v3 is 0, 1, 2, 3, or 4;
  • each R C8 is, independently, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 - C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino;
  • v4 is 0, 1, 2, 3, or 4;
  • each R C9 is, independently, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino, or a pharmaceutically acceptable salt thereof.
  • the degrader moiety includes the structure of Formula E:
  • a 2 is a bond between B and the linker
  • each of R C10 and R C11 is, independently, H, optionally substituted C 1 -C 6 alkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1-C6 alkyl C6-C10 aryl;
  • v5 is 0, 1, 2, 3, or 4;
  • each R C12 is, independently, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 - C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C 6 -C 10 aryl, optionally substituted C 2 -C 9 heteroaryl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino;
  • v6 is 0, 1, 2, 3, or 4;
  • each R 21 is, independently, halogen, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 - C 6 heteroalkyl, optionally substituted C 3 -C 10 carbocyclyl, optionally substituted C 2 -C 9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino, or a pharmaceutically acceptable salt thereof.
  • the degradation moiety includes the structure of Formula FA:
  • bicyclic moiety which is substituted with A 2 and substituted with one or more groups independently selected from H, R FF1 , and oxo;
  • u2 is 0, 1, 2, or 3;
  • a 2 is a bond between the degrader and the linker
  • Y Fa is CR Fb R Fc , C ⁇ O, C ⁇ S, C ⁇ CH 2 , SO 2 , S(O), P(O)Oalkyl, P(O)NHalkyl, P(O)N(alkyl) 2 , P(O)alkyl, P(O)OH, P(O)NH2;
  • Y Fb is NH, NR FF1 , CH2, CHR FF1 , C(R FF1 )2, O, or S;
  • Y Fc is CR Fd R Fe , C ⁇ O, C ⁇ S, C ⁇ CH 2 , SO 2 , S(O), P(O)Oalkyl, P(O)NHalkyl, P(O)N(alkyl) 2 , P(O)alkyl, P(O)OH, P(O)NH 2 ;
  • each of R Fb , R Fc , R Fd , and R Fe is, independently, H, alkyl, aliphatic, heteroaliphatic, aryl, heteroaryl, carbocyclyl, hydroxyl, alkoxy, amino,—NHalkyl, or—Nalkyl2; or R Fb and R Fc , together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
  • R Fd and R Fe together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O; and
  • R Fd and R Fb together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
  • each of Y Fd and Y Ff is, independently, CH 2 , CHR FF2 , C(R FF2 ) 2 , C(O), N, NH, NR FF3 , O, S, or S(O);
  • Y Fe is a bond or a divalent moiety attached to Y Fd and Y Ff that contains 1 to 5 contiguous carbon atoms that form a 3 to 8-membered ring,
  • each R FF1 is, independently, H, alkyl, alkenyl, alkynyl, aliphatic, heteroaliphatic, carbocyclyl, halogen, hydroxyl, amino, cyano, alkoxy, aryl, heteroaryl, heterocyclyl, alkylamino, alkylhydroxyl, or haloalkyl;
  • each R FF2 is, independently, alkyl, alkene, alkyne, halogen, hydroxyl, alkoxy, azide, amino, —C(O)H,—C(O)OH,—C(O)(aliphatic, including alkyl),—C(O)O(aliphatic, including alkyl),
  • R FF3 is alkyl, alkenyl, alkynyl,—C(O)H,—C(O)OH,—C(O)alkyl, or—C(O)Oalkyl,
  • the compound of Formula FA has the structure of Formula FA1:
  • the degradation moiety includes the structure of Formula FB:
  • bicyclic moiety which is substituted with A 2 and substituted with one or more groups independently selected from H, R FF1 , and oxo;
  • a 2 is a bond between the degrader and the linker
  • Y Fa is CR Fb R Fc , C ⁇ O, C ⁇ S, C ⁇ CH 2 , SO 2 , S(O), P(O)Oalkyl, P(O)NHalkyl, P(O)N(alkyl) 2 , P(O)alkyl, P(O)OH, P(O)NH2;
  • each of Y Fb and Y Fg is, independently, NH, NR FF1 , CH2, CHR FF1 , C(R FF1 )2, O, or S;
  • each of R Fb , R Fc , R Fd , R Fe , R Ff , and R Fg is, independently, H, alkyl, aliphatic, heteroaliphatic, aryl, heteroaryl, carbocyclyl, hydroxyl, alkoxy, amino,—NHalkyl, or—Nalkyl2;
  • R Fb and R Fc together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
  • R Fd and R Fe together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
  • R Ff and R Fg together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
  • R Fd and R Fb together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
  • R Fd and R Ff together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
  • R Fb and R Fg together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
  • each of Y Fd and Y Ff is, independently, CH2, CHR FF2 , C(R FF2 )2, C(O), N, NH, NR FF3 , O, S, or S(O);
  • Y Fe is a bond or a divalent moiety attached to Y Fd and Y Ff that contains 1 to 5 contiguous carbon atoms that form a 3 to 8-membered ring,
  • each R FF1 is, independently, H, alkyl, alkenyl, alkynyl, aliphatic, heteroaliphatic, carbocyclyl, halogen, hydroxyl, amino, cyano, alkoxy, aryl, heteroaryl, heterocyclyl, alkylamino, alkylhydroxyl, or haloalkyl;
  • each R FF2 is, independently, alkyl, alkene, alkyne, halogen, hydroxyl, alkoxy, azide, amino, —C(O)H,—C(O)OH,—C(O)(aliphatic, including alkyl),—C(O)O(aliphatic, including alkyl),
  • R FF3 is alkyl, alkenyl, alkynyl,—C(O)H,—C(O)OH,—C(O)alkyl, or—C(O)Oalkyl,
  • the compound of Formula FB has the structure of Formula FB1:
  • the degradation moiety includes the structure of Formula F1:
  • a 2 is a bond between the degrader and the linker; and R F1 is absent or O, or a pharmaceutically acceptable salt thereof.
  • R F1 is absent. In some embodiments, R F1 is O.
  • the degradation moiety includes the structure Formula F2:
  • a 2 is a bond between the degrader and the linker; and Y 2 is CH2 or NH, or a pharmaceutically acceptable salt thereof.
  • Y 2 is NH. In some embodiments, Y 2 is CH 2 .
  • the degradation moiety includes the structure Formula G:
  • a 2 is a bond between the degrader and the linker; and Y 3 is CH 2 or NH, or a pharmaceutically acceptable salt thereof.
  • Y 3 is NH. In some embodiments, Y 3 is CH2.
  • the degradation moiety may also include structures found in, e.g., WO2017/197036;
  • the linker has the structure of Formula IV:
  • a 1 is a bond between the linker and A;
  • a 2 is a bond between B and the linker
  • each of B 1 , B 2 , B 3 , and B 4 is, independently, optionally substituted C 1 -C 2 alkylene, optionally substituted C 1 -C 3 heteroalkylene, O, S, S(O) 2 , or NR N ;
  • each R N is, independently, H, optionally substituted C1–4 alkyl, optionally substituted C2–4 alkenyl, optionally substituted C2–4 alkynyl, optionally substituted C2–6 heterocyclyl, optionally substituted C6–12 aryl, or optionally substituted C 1–7 heteroalkyl; each of C 1 and C 2 is, independently, carbonyl, thiocarbonyl, sulphonyl, or phosphoryl;
  • each of f, g, h, i, j, and k is, independently, 0 or 1;
  • D is optionally substituted C1–10 alkylene, optionally substituted C2–10 alkenylene, optionally substituted C 2–10 alkynylene, optionally substituted C 2–6 heterocyclylene, optionally substituted C 6–12 arylene, optionally substituted C 2 -C 10 polyethylene glycol, or optionally substituted C 1–10 heteroalkylene, or a chemical bond linking A 1 -(B 1 )f-(C 1 )g-(B 2 )h- to -(B 3 )i-(C 2 )j-(B 4 )k–A 2 .
  • each of B 1 , B 2 , B 3 , and B 4 is, independently, optionally substituted C1-C4 alkylene, optionally substituted C 1 -C 4 heteroalkylene, or NR N .
  • each R N is, independently, H or optionally substituted C 1 -C 4 alkylene. In some embodiments, each R N is, independently, H or methyl.
  • each of B 1 and B 4 is, independently, , , In some embodiments,
  • B 2 is NR N . In some embodiments, B 2 is optionally substituted C 1 -C 4 alkylene.
  • f is 0. In some embodiments, f is 1. In some embodiments, g is 1. In some embodiments, h is 0. In some embodiments, h is 1. In some embodiments, i is 0. In some embodiments, j is 0. In some embodiments, k is 0.
  • the linker has the structure
  • x is 1, 2, 3, 4, 5, 6, 7, or 8;
  • R x is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
  • R y is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C 3 -C 6 carbocyclyl;
  • W is O or NR w , wherein R w is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl.
  • R x is H or me optionally substituted C1-C6 alkyl.
  • R y is H or optionally substituted C1-C6 alkyl.
  • R w is H or optionally substituted C1- C 6 alkyl.
  • R x is H or methyl. In some embodiments, R y is H or methyl. In some embodiments, R w is H or methyl.
  • the linker has the structure of
  • the linker has the structure .
  • the linker has the structure of Formula V:
  • a 1 is a bond between the linker and A;
  • a 2 is a bond between B and the linker
  • each of m, n, o1, o2, and p is, independently, 0 or 1; each of E 1 and E 2 is, independently, O, S, NR N , optionally substituted C 1–10 alkylene, optionally substituted C2–10 alkenylene, optionally substituted C2–10 alkynylene, optionally substituted C2-C10 polyethylene glycol, or optionally substituted C1–10 heteroalkylene;
  • E 3 is optionally substituted C 1 -C 6 alkylene, optionally substituted C 1 -C 6 heteroalkylene, O, S, or NR N ;
  • each R N is, independently, H, optionally substituted C1–4 alkyl, optionally substituted C2–4 alkenyl, optionally substituted C2–4 alkynyl, optionally substituted C2–6 heterocyclyl, optionally substituted C6–12 aryl, or optionally substituted C 1–7 heteroalkyl;
  • C 3 is carbonyl, thiocarbonyl, sulphonyl, or phosphoryl
  • each of F 1 , F 2 , and F 3 is, independently, optionally substituted C3-C10 carbocyclylene, optionally substituted C2–10 heterocyclylene, optionally substituted C6-C10 arylene, or optionally substituted C2-C9 heteroarylene.
  • the linker has the structure of Formula Va:
  • the linker has the structure of Formula Vb:
  • the linker has the structure of Formula Vc:
  • the linker has the structure of Formula Vd:
  • the linker has the structure of Formula Ve:
  • the linker has the structure of Formula Vf:
  • the linker has the structure of Formula Vg:
  • each of E 1 and E 2 is, independently, NR N , optionally substituted C1–10 alkylene, optionally substituted C2-C10 polyethylene glycolene, or optionally substituted C1–10 heteroalkylene.
  • E 3 is optionally substituted C 1 -C 6 alkylene, O, S, or NR N ;
  • E 3 is optionally substituted C1-C6 alkylene. In some embodiments, E 3 is optionally substituted C1-C3 alkylene. In some embodiments, E 3 is O, S, or NR N .
  • E 3 is C 1 -C 6 alkylene. In some embodiments, E 3 is C 1 -C 3 alkylene. In some embodiments, E 3 is O.
  • each R N is, independently, H or optionally substituted C1–4 alkyl. In some embodiments, each R N is, independently, H or methyl. In some embodiments,
  • b 0, 1, 2, 3, 4, 5, or 6;
  • R a is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
  • R b is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
  • R c is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl.
  • R a is H or optionally substituted C 1 -C 6 alkyl.
  • R b is H or optionally substituted C 1 -C 6 alkyl.
  • R c is H or optionally substituted C 1 -C 6 alkyl.
  • R a is H or methyl. In some embodiments, R b is H or methyl. In some embodiments, R c is H or methyl.
  • b is 0, 1, 2, or 3. In some embodiments, b is 0. In some embodiments, b is 1. In some embodiments, b is 2. In some embodiments, b is 3.
  • c 0, 1, 2, 3, 4, 5, 6, 7, or 8;
  • d 0, 1, 2, or 3;
  • e 0, 1, 2, 3, 4, 5, or 6;
  • f 0, 1, 2, 3, or 4;
  • R d is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C 3 -C 6 carbocyclyl;
  • R e is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl
  • R f is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl
  • R g is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C 3 -C 6 carbocyclyl;
  • W is O or NR w , wherein R w is H or optionally substituted C 1 -C 6 alkyl.
  • R d is H or optionally substituted C 1 -C 6 alkyl.
  • R e is H or optionally substituted C1-C6 alkyl.
  • R f is H or optionally substituted C1-C6 alkyl.
  • R g is H or optionally substituted C1-C6 alkyl.
  • R w is H or optionally substituted C 1 -C 6 alkyl.
  • R d is H or methyl. In some embodiments, R e is H or methyl. In some embodiments, R f is H or methyl. In some embodiments, R g is H or methyl. In some embodiments, R w is H or methyl.
  • each of F 1 , F 2 , or F 3 is, independently, optionally substituted C 3 -C 10 carbocyclylene.
  • the C 3 -C 10 carbocyclylene is monocyclic.
  • the C 3 - C10 carbocyclylene is polycyclic.
  • the C3-C10 carbocyclylene is bicyclic.
  • the C 3 -C 10 carbocyclylene is bridged. In some embodiments, the C 3 -C 10 carbocyclylene is fused. In some embodiments, the C 3 -C 10 carbocyclylene is spirocyclic.
  • the C3-C10 carbocyclylene is , , , or
  • each of F 1 , F 2 , or F 3 is, independently, optionally substituted C 2– C 9 heterocyclylene.
  • the C2–C9 heterocyclylene is monocyclic. In some embodiments, the C2– C9 heterocyclylene is polycyclic.
  • the C 2– C 9 heterocyclylene is bicyclic.
  • the C2–C9 heterocyclylene is bridged. In some embodiments, the C2–C9 heterocyclylene is fused. In some embodiments, the C2–C9 heterocyclylene is spirocyclic.
  • the C2–C9 heterocyclylene includes a quaternary amine.
  • q1 is 0, 1, 2, 3, or 4;
  • q2 is 0, 1, 2, 3, 4, 5, or 6;
  • q3 is 0, 1, 2, 3, 4, 5, 6, 7, or 8;
  • each R h is, independently, 2 H, halogen, optionally substituted C1-C6 alkyl, OR i2 , or NR i3 R i4 ; or two R h groups, together with the carbon atom to which each is attached, combine to form optionally substituted C 3 -C 10 carbocyclyl or optionally substituted C 2 -C 9 heterocyclyl; or two R h groups, together with the carbon atoms to which each is attached, combine to form optionally substituted C3-C10 carbocyclyl or optionally substituted C2-C9 heterocyclyl;
  • R i1 is H or optionally substituted C 1 -C 6 alkyl
  • R i2 is H, optionally substituted C 1 -C 6 alkyl, optionally substituted C 1 -C 6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
  • R i3 is H or optionally substituted C1-C6 alkyl
  • R i4 is H or optionally substituted C 1 -C 6 alkyl.
  • each R h is, independently, halogen, optionally substituted C 1 -C 6 alkyl, OR i2 , or NR i3 R i4 .
  • R i1 is H or optionally substituted C1-C6 alkyl.
  • R i2 is H or optionally substituted C1-C6 alkyl.
  • R i3 is H or optionally substituted C 1 -C 6 alkyl.
  • R i4 is H or optionally substituted C 1 -C 6 alkyl.
  • the C2–C9 heterocyclylene is C2–C9 heterocyclylene
  • each R h is, independently, halogen, optionally substituted C 1 -C 6 alkyl, OR i2 , or NR i3 R i4 . In some embodiments, each R h is, independently, halogen, optionally substituted C1-C6 alkyl, or NR i3 R i4 .
  • each R h is, independently, 2 H, halogen, cyano, optionally substituted C 1 - C 6 alkyl, OR i2 , or NR i3 R i4 .
  • two R h groups, together with the carbon atom to which each is attached combine to form optionally substituted C3-C10 carbocyclyl or optionally substituted C2-C9 heterocyclyl.
  • two R h groups, together with the carbon atoms to which each is attached combine to form optionally substituted C 3 -C 10 carbocyclyl or optionally substituted C 2 -C 9 heterocyclyl.
  • each R h is, independently, 2 H, F, methyl, , , , ,
  • each R h is, independently, F, methyl, or NR i3 R i4 .
  • q1 is 0, 1, or 2. In some embodiments, q1 is 0. In some embodiments, q1 is 1. In some embodiments, q1 is 2.
  • q2 is 0, 1, or 2. In some embodiments, q2 is 0. In some embodiments, q2 is 1. In some embodiments, q2 is 2.
  • R i1 is H or methyl. In some embodiments, R i2 is H or methyl. In some embodiments, R i3 is H or methyl. In some embodiments, R i4 is H or methyl. In some embodiments, the C2–C9 heterocyclylene i
  • the C 2– C 9 heterocyclylene is C 2– C 9 heterocyclylene
  • the C 2– C 9 heterocyclylene is , , N N N N N N N N N N N N N
  • the C 2– C 9 heterocyclyl is , , N N N N N N N N
  • the C2–C9 heterocyclyl is , ,
  • each of F 1 , F 2 , or F 3 is, independently, optionally substituted C 6 -C 10 arylene.
  • each of F 1 , F 2 , or F 3 is, independently, optionally substituted C2-C9 heteroarylene.
  • C 3 is .
  • m is 1. In some embodiments, p is 1.
  • the linker has the structure of: , ,
  • the linker is optionally substituted C3-C10 carbocyclylene, optionally substituted C2–10 heterocyclylene, optionally substituted C6-C10 arylene, or optionally substituted C2-C9 heteroarylene.
  • the linker is optionally substituted C 3 -C 10 carbocyclylene or optionally substituted C2–10 heterocyclylene. In some embodiments, the linker is optionally substituted C6-C10 arylene or optionally substituted C2-C9 heteroarylene.
  • the linker is optionally substituted C 2–10 heterocyclylene.
  • the C 2– C 9 heterocyclylene is monocyclic. In some embodiments, the C 2– C9 heterocyclylene is polycyclic.
  • the C2–C9 heterocyclylene is bicyclic.
  • the C 2– C 9 heterocyclylene is bridged. In some embodiments, the C 2– C 9 heterocyclylene is fused. In some embodiments, the C 2– C 9 heterocyclylene is spirocyclic. In some embodiments, the linker has the structure of , , , In some embodiments, the linker has the structure of , ,
  • the compound has the structure of any one of compounds D1-D31 in Table 2A, or a pharmaceutically acceptable salt thereof. In some embodiments, the compound has the structure of compounds D32-D184 in Table 2B, or a pharmaceutically acceptable salt thereof. In some embodiments, the compound has the structure of any one of compounds D185-D316 in Table 2C, or a pharmaceutically acceptable salt thereof.
  • the compound has the structure of any one of compounds D1, D7, D15- D21, D23, and D27-D30 in Table 2A, or a pharmaceutically acceptable salt thereof.
  • the compound has the structure of any one of compounds D32-D42, D46, D48-D63, D65- D73, D75-D83, D85-D87, D89-D93, D95-D116, D118, D120-D164, D166-D168, D170, D171, D173, D174, D176-D178, D180, D182, and D184 in Table 2B, or a pharmaceutically acceptable salt thereof.
  • the compound has the structure of any one of compounds D185-D190, D192-D204, D248, D254-D258, D260, D262-D269, D271-D280, D284, D286-D291, and D293-D316 in Table 2C, or a pharmaceutically acceptable salt thereof.
  • the disclosure features compounds D1-D31 in Table 2A, or a pharmaceutically acceptable salt thereof.
  • the disclosure features compounds D32-D184 in Table 2B, or a pharmaceutically acceptable salt thereof.
  • the disclosure features compounds D185-D316 in Table 2C, or a pharmaceutically acceptable salt thereof.
  • Table 2A Compounds D1-D31 of the Disclosure
  • the disclosure features a pharmaceutical composition including any of the foregoing compounds, or pharmaceutically acceptable salts thereof, and a pharmaceutically acceptable excipient.
  • the disclosure features a method of inhibiting the level and/or activity of BRD9 in a cell, the method involving contacting the cell with an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or a pharmaceutical composition thereof.
  • the disclosure features a method of reducing the level and/or activity of BRD9 in a cell, the method involving contacting the cell with an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or a pharmaceutical composition thereof.
  • the cell is a cancer cell.
  • the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, colorectal cancer, a sarcoma (e.g., a soft tissue sarcoma, synovial sarcoma, Ewing’s sarcoma, osteosarcoma, rhabdomyosarcoma, adult fibrosarcoma, alveolar soft-part sarcoma, angiosarcoma, clear cell sarcoma, desmoplastic small round cell tumor, epithelioid sarcoma, fibromyxoid sarcoma, gastrointestinal stromal tumor, Kaposi sarcoma, liposarcoma, leiomyosarcoma, malignant mesenchymoma malignant peripheral nerve
  • the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, or colorectal cancer.
  • the cancer is a sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma), non-small cell lung cancer (e.g., squamous or adenocarcinoma), stomach cancer, or breast cancer.
  • the cancer is sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma).
  • the sarcoma is synovial sarcoma.
  • the disclosure features a method of treating a BAF complex-related disorder in a subject in need thereof, the method involving administering to the subject an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or a pharmaceutical composition thereof.
  • the BAF complex-related disorder is cancer.
  • the BAF complex-related disorder is infection.
  • the disclosure features a method of treating an SS18-SSX fusion protein- related disorder in a subject in need thereof, the method involving administering to the subject an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or a pharmaceutical composition thereof.
  • the SS18-SSX fusion protein-related disorder is cancer.
  • the SS18-SSX fusion protein-related disorder is infection.
  • the SS18-SSX fusion protein is a
  • SS18-SSX1 fusion protein a SS18-SSX2 fusion protein, or a SS18-SSX4 fusion protein.
  • the disclosure features a method of treating a BRD9-related disorder in a subject in need thereof, the method involving administering to the subject an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or a pharmaceutical composition thereof.
  • the BRD9-related disorder is cancer.
  • the BRD9- related disorder is infection.
  • the cancer is squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, hepatocellular carcinomas, and renal cell carcinomas, cancer of the bladder, bowel, breast, cervix, colon, esophagus, head, kidney, liver, lung, neck, ovary, pancreas, prostate, and stomach; leukemias; benign and malignant lymphomas, particularly Burkitt's lymphoma and Non-Hodgkin's lymphoma; benign and malignant melanomas; myeloproliferative diseases; sarcomas, including Ewing's sarcoma, hemangiosarcoma, Kaposi's sarcoma, liposarcoma, myosarcomas, peripheral
  • neuroepithelioma synovial sarcoma, gliomas, astrocytomas, oligodendrogliomas, ependymomas, gliobastomas, neuroblastomas, ganglioneuromas, gangliogliomas, medulloblastomas, pineal cell tumors, meningiomas, meningeal sarcomas, neurofibromas, and Schwannomas; bowel cancer, breast cancer, prostate cancer, cervical cancer, uterine cancer, lung cancer, ovarian cancer, testicular cancer, thyroid cancer, astrocytoma, esophageal cancer, pancreatic cancer, stomach cancer, liver cancer, colon cancer, melanoma; carcinosarcoma, Hodgkin's disease, Wilms' tumor and teratocarcinomas.
  • Additional cancers which may be treated using the disclosed compounds according to the present invention include, for example, acute granulocytic leukemia, acute lymphocytic leukemia (ALL), acute myelogenous leukemia (AML), adenocarcinoma, adenosarcoma, adrenal cancer, adrenocortical carcinoma, anal cancer, anaplastic astrocytoma, angiosarcoma, appendix cancer, astrocytoma, Basal cell carcinoma, B-Cell lymphoma, bile duct cancer, bladder cancer, bone cancer, bone marrow cancer, bowel cancer, brain cancer, brain stem glioma, breast cancer, triple (estrogen, progesterone and HER-2) negative breast cancer, double negative breast cancer (two of estrogen, progesterone and HER-2 are negative), single negative (one of estrogen, progesterone and HER-2 is negative), estrogen-receptor positive, HER2- negative breast cancer, estrogen receptor-negative breast cancer, estrogen receptor positive breast
  • astrocytoma pineal region tumor, pineoblastoma, pituitary gland cancer, primary central nervous system (CNS) lymphoma, prostate cancer, rectal cancer, renal cell carcinoma, renal pelvis cancer,
  • CNS central nervous system
  • the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, colorectal cancer, a sarcoma (e.g., a soft tissue sarcoma, synovial sarcoma, Ewing’s sarcoma, osteosarcoma, rhabdomyosarcoma, adult fibrosarcoma, alveolar soft-part sarcoma, angiosarcoma, clear cell sarcoma, desmoplastic small round cell tumor, epithelioid sarcoma, fibromyxoid sarcoma, gastrointestinal stromal tumor, Kaposi sarcoma, liposarcoma, leiomyosarcoma, malignant mesenchymoma malignant peripheral nerve
  • the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, or colorectal cancer.
  • the cancer is a sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma), non-small cell lung cancer (e.g., squamous or adenocarcinoma), stomach cancer, or breast cancer.
  • the cancer is sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma).
  • the sarcoma is synovial sarcoma.
  • the infection is viral infection (e.g., an infection with a virus of the
  • Retroviridae family such as the lentiviruses (e.g. Human immunodeficiency virus (HIV) and HIV.
  • HIV Human immunodeficiency virus
  • deltaretroviruses e.g., human T cell leukemia virus I (HTLV-I), human T cell leukemia virus II (HTLV-II)); Hepadnaviridae family (e.g. hepatitis B virus (HBV)); Flaviviridae family (e.g. hepatitis C virus (HCV)); Adenoviridae family (e.g. Human Adenovirus); Herpesviridae family (e.g.
  • HCMV Human cytomegalovirus
  • HSV-1 herpes simplex virus 1
  • HSV-2 herpes simplex virus 2
  • HHV-6 human herpesvirus 6
  • Herpesvitus K* Herpesvitus K*, CMV, varicella-zoster virus
  • Papillomaviridae family e.g. Human Papillomavirus (HPV, HPV E1)
  • Parvoviridae family e.g. Parvovirus B19
  • Polyomaviridae family e.g. JC virus and BK virus
  • Paramyxoviridae family e.g. Measles virus
  • Togaviridae family e.g. Rubella virus
  • the disorder is Coffin Siris, Neurofibromatosis (e.g., NF-1, NF-2, or Schwannomatosis), or Multiple Meningioma.
  • the disclosure features a method of treating a cancer in a subject in need thereof, the method including administering to the subject an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or any of the foregoing pharmaceutical compositions.
  • the cancer is squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, hepatocellular carcinomas, and renal cell carcinomas, cancer of the bladder, bowel, breast, cervix, colon, esophagus, head, kidney, liver, lung, neck, ovary, pancreas, prostate, and stomach; leukemias; benign and malignant lymphomas, particularly Burkitt's lymphoma and Non-Hodgkin's lymphoma; benign and malignant melanomas; myeloproliferative diseases; sarcomas, including Ewing's sarcoma, hemangiosarcoma, Kaposi's sarcoma, liposarcoma, myosarcomas, peripheral
  • neuroepithelioma synovial sarcoma, gliomas, astrocytomas, oligodendrogliomas, ependymomas, gliobastomas, neuroblastomas, ganglioneuromas, gangliogliomas, medulloblastomas, pineal cell tumors, meningiomas, meningeal sarcomas, neurofibromas, and Schwannomas; bowel cancer, breast cancer, prostate cancer, cervical cancer, uterine cancer, lung cancer, ovarian cancer, testicular cancer, thyroid cancer, astrocytoma, esophageal cancer, pancreatic cancer, stomach cancer, liver cancer, colon cancer, melanoma; carcinosarcoma, Hodgkin's disease, Wilms' tumor and teratocarcinomas.
  • Additional cancers which may be treated using the disclosed compounds according to the present invention include, for example, acute granulocytic leukemia, acute lymphocytic leukemia (ALL), acute myelogenous leukemia (AML), adenocarcinoma, adenosarcoma, adrenal cancer, adrenocortical carcinoma, anal cancer, anaplastic astrocytoma, angiosarcoma, appendix cancer, astrocytoma, Basal cell carcinoma, B-Cell lymphoma, bile duct cancer, bladder cancer, bone cancer, bone marrow cancer, bowel cancer, brain cancer, brain stem glioma, breast cancer, triple (estrogen, progesterone and HER-2) negative breast cancer, double negative breast cancer (two of estrogen, progesterone and HER-2 are negative), single negative (one of estrogen, progesterone and HER-2 is negative), estrogen-receptor positive, HER2- negative breast cancer, estrogen receptor-negative breast cancer, estrogen receptor positive breast
  • astrocytoma pineal region tumor, pineoblastoma, pituitary gland cancer, primary central nervous system (CNS) lymphoma, prostate cancer, rectal cancer, renal cell carcinoma, renal pelvis cancer,
  • CNS central nervous system
  • the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, colorectal cancer, a sarcoma (e.g., a soft tissue sarcoma, synovial sarcoma, Ewing’s sarcoma, osteosarcoma, rhabdomyosarcoma, adult fibrosarcoma, alveolar soft-part sarcoma, angiosarcoma, clear cell sarcoma, desmoplastic small round cell tumor, epithelioid sarcoma, fibromyxoid sarcoma, gastrointestinal stromal tumor, Kaposi sarcoma, liposarcoma, leiomyosarcoma, malignant mesenchymoma malignant peripheral nerve
  • the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, or colorectal cancer.
  • the cancer is a sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma), non-small cell lung cancer (e.g., squamous or adenocarcinoma), stomach cancer, or breast cancer.
  • the cancer is sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma).
  • the sarcoma is synovial sarcoma.
  • the disclosure features a method for treating a viral infection in a subject in need thereof.
  • This method includes administering to the subject an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or any of the foregoing

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Nitrogen Condensed Heterocyclic Rings (AREA)
  • Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)

Abstract

The present invention relates to methods and compositions for the treatment of BAF-related disorders such as cancers and viral infections.

Description

COMPOUNDS AND USES THEREOF Background
Disorders can be affected by the BAF complex. BRD9 is a component of the BAF complex. The present invention relates to useful compositions and methods for the treatment of BAF complex-related disorders, such as cancer and infection. Summary
Bromodomain-containing protein 9 (BRD9) is a protein encoded by the BRD9 gene on chromosome 5. BRD9 is a component of the BAF (BRG1- or BRM-associated factors) complex, a SWI/SNF ATPase chromatin remodeling complex, and belongs to family IV of the bromodomain- containing proteins. BRD9 is present in several SWI/SNF ATPase chromatin remodeling complexes and is upregulated in multiple cancer cell lines. Accordingly, agents that reduce the levels and/or activity of BRD9 may provide new methods for the treatment of disease and disorders, such as cancer and infection. The inventors have found that depleting BRD9 in cells results in the depletion of the SS18-SSX fusion protein in those cells. The SS18-SSX fusion protein has been detected in more than 95% of synovial sarcoma tumors and is often the only cytogenetic abnormality in synovial sarcoma. Additionally, evidence suggests that the BAF complex is involved in cellular antiviral activities. Thus, agents that degrade BRD9 (e.g., compounds) are useful in the treatment of disorders (e.g., cancers or infections) related to BAF, BRD9, and/or SS18-SSX.
The present disclosure features compounds and methods useful for treating BAF-related disorders (e.g., cancer or infection).
In an aspect, the disclosure features a compound having the structure Formula I:
where
Figure imgf000002_0001
R1 is H, optionally substituted C1-C6 alkyl, optionally substituted C2-C6 alkenyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C10 carbocyclyl;
Z1 is CR2 or N;
R2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl;
X1 is N or CH, and X2 is C-R7; or X1 is C-R7, and X2 is N or CH;
R7 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C1-C6 alkoxy, optionally substituted amino, optionally substituted sulfone, optionally substituted sulfonamide, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms; X3 is N or CH;
X4 is N or CH;
G is optionally substituted C3-C10 carbocyclyl, C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl, or a pharmaceutically acceptable salt thereof.
In some embodiments, R1 is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C10 carbocyclyl. In some embodiments, R1 is H, optionally substituted C1-C6 alkyl, optionally substituted C2-C6 alkenyl, or optionally substituted C3-C10 carbocyclyl. In some embodiments, R1 is H, optionally substituted C1-C6 alkyl, or optionally substituted C3-C10 carbocyclyl.
In some embodiments, R1 is H. In some embodiments, R1 is optionally substituted C1-C6 alkyl. In some embodiments, R1 is optionally substituted C2-C6 alkenyl. In some embodiments, R1 is optionally substituted C3-C10 carbocyclyl.
In some embodiments, optionally substituted C1-C6 alkyl is C1-C6 perfluoroalkyl.
In some embodiments, R1 is
Figure imgf000003_0008
, , , , , ,
Figure imgf000003_0004
, , , o In some embodiments, R1 is
Figure imgf000003_0005
In some embodiments, R1 is
Figure imgf000003_0006
In some embodiments, R1 is H,
Figure imgf000003_0007
, , , , , ,
Figure imgf000003_0001
some embodiments, R1 is
2H n some embodiments, R1 is H
Figure imgf000003_0002
Figure imgf000003_0003
In some embodiments, R1 is H,
Figure imgf000004_0006
Figure imgf000004_0002
In some embodiments, R1 is H, In some embodiments, R1 is H o
Figure imgf000004_0003
In some embodiments, R1 is H. In some embodiments, R1 is
Figure imgf000004_0004
In some embodiments, Z1 is CR2. In some embodiments, Z1 is N.
In some embodiments, R2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, or optionally substituted C6-C10 aryl.
In some embodiments, R2 is H, halogen, or optionally substituted C1-C6 alkyl. In some embodiments, R2 is H, F, or
Figure imgf000004_0005
In some embodiments, R2 is H. In some embodiments, R2 is F. In some embodiments, R2 is CH3
.
In some embodiments, R7 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C1-C6 alkoxy, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R7 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R7 is optionally substituted C1-C6 alkoxy or optionally substituted amino. In some embodiments, R7 is optionally substituted sulfone or optionally substituted sulfonamide.
In some embodiments, R7 is optionally substituted C1-C6 alkyl or optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R7 is optionally substituted C1-C6 heteroalkyl or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R7 is optionally substituted C1-C6 alkyl or optionally substituted C1-C6 heteroalkyl.
In some embodiments, R7 is optionally substituted C1-C6 alkyl. In some embodiments, R7 is optionally substituted C1-C6 heteroalkyl. In some embodiments, R7 is optionally substituted C1-C6 alkoxy. In some embodiments, R7 is optionally substituted amino. In some embodiments, R7 is optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R7 is optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R7 is optionally substituted sulfone. In some embodiments, R7 is optionally substituted sulfonamide.
In some embodiments, R7 is optionally substituted C1-C3 alkyl. In some embodiments, R7 is optionally substituted C1-C3 heteroalkyl. In some embodiments,
Figure imgf000004_0001
In some embodiments, R7 is–NR3R4 or–OR4, where R3 is H or optionally substituted C1-C6 alkyl, and R4 is optionally substituted C1-C6 alkyl.
In some embodiments, R7 is–NR3R4. In some embodiments, R7 is–OR4.
In some embodiments, R3 is H. In some embodiments, R3 is optionally substituted C1-C6 alkyl. In some embodiments, R3 is H and R4 is methyl. In some embodiments, R3 is methyl and R4 is methyl. In some embodiments, R7 is In some embodiments, R 7 is
Figure imgf000005_0007
Figure imgf000005_0008
In some embodiments, R7 is optionally substituted carbocyclyl having 3 to 6 atoms or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R7 is optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R7 is optionally substituted heterocyclyl having 3 to 6 atoms.
In some embodiments, R7 is carbocyclyl having 3 to 6 atoms or heterocyclyl having 3 to 6 atoms. In some embodiments, R7 is carbocyclyl having 3 to 6 atoms. In some embodiments, R7 is heterocyclyl having 3 to 6 atoms.
In some embodiments, R7 is
O
Figure imgf000005_0005
or
Figure imgf000005_0006
In some embodiments, R7 is
Figure imgf000005_0004
Figure imgf000005_0002
In some embodiments, R7 is
In some embodiments, R7 is
Figure imgf000005_0003
, , , , , ,
Figure imgf000005_0001
Figure imgf000006_0001
In some embodiments, R7 is
Figure imgf000006_0002
, , , , In some
embodiments, R7 is
Figure imgf000006_0003
. In
some embodiments, R7 is
Figure imgf000006_0004
F
. In some embodiments, R7 is
Figure imgf000006_0005
F O In some embodiments, R7 is
Figure imgf000006_0006
Figure imgf000006_0007
In some embodiments, X1 is N and X2 is C-R7. In some embodiments, X1 is CH and X2 is C-R7. In some embodiments, X1 is C-R7 and X2 is N. In some embodiments, X1 is C-R7 and X2 is CH.
In some embodiments, X1 is N or CH, and X2 is C-NR3R4, C-OR4,
Figure imgf000006_0008
F
or or X1 is C-NR3R4, C-OR4, and X2 is N
Figure imgf000006_0011
Figure imgf000006_0009
F
F or CH. In some embodiments, X1 is N or CH, and X2 is C-NR3R4, , or
Figure imgf000006_0010
or X1 is C-NR3R4, and X2 is N or CH. In
Figure imgf000007_0002
Figure imgf000007_0001
some embodiments, X1 is N or CH, and X2 is C-NR3R4 or ; or X1 is C-NR3R4 or
Figure imgf000007_0004
,
Figure imgf000007_0003
and X2 is N or CH. In some embodiments, X1 is N or CH, and X2 is C-NR3R4 or ; or X1 is
Figure imgf000007_0005
F
C-NR3R4 or
Figure imgf000007_0006
, and X2 is N or CH. In some embodiments, X1 is N or CH, and X2 is C-
NR3R4 or
Figure imgf000007_0007
; or X1 is C-NR3R4 or and X2 is N or CH.
Figure imgf000007_0008
In some embodiments, R7 is -NR3R4, -OR4, or optionally substituted heterocyclyl having 3 to 6 atoms.
In some embodiments, X1 is N and X2 is C-NR3R4. In some embodiments, X1 is C-NR3R4 and X2 is N. In some embodiments, X1 is N and X2 is C-OR4. In some embodiments, X1 is C-OR4 and X2 is N.
In some embodiments, R3 is H. In some embodiments, R3 is optionally substituted C1-C6 alkyl.
In some embodiments, R3 is
Figure imgf000007_0009
, , , , , o In some embodiments, R3 is In some embodiments, R3 is , , or
Figure imgf000007_0010
Figure imgf000007_0011
In some embodiments, R3 is methyl, ethyl,
Figure imgf000007_0012
, , o
Figure imgf000007_0013
In some embodiments, R4 is
Figure imgf000007_0014
F In some embodiments, R4 is In some embodiments, R4 is , or
Figure imgf000007_0015
Figure imgf000007_0016
Figure imgf000007_0018
. In some embodiments, R4 is methyl, ethyl,
Figure imgf000007_0017
In some embodiments, X3 is N. In some embodiments, X3 is CH. In some embodiments, X4 is N. In some embodiments, X4 is CH.
In some embodiments, X3 is N and X4 is N.
In some embodiments, X3 is N and X4 is CH.
In some embodiments, X3 is CH and X4 is N.
In some embodiments, X3 is CH and X4 is CH.
In some embodiments, G is optionally substituted C3-C10 carbocyclyl or optionally substituted C2- C9 heterocyclyl. In some embodiments, G is optionally substituted C6-C10 aryl or optionally substituted C2- C9 heteroaryl.
In some embodiments, G is optionally substituted C3-C10 carbocyclyl. In some embodiments, G is optionally substituted C6-C10 aryl. In some embodiments, G is optionally substituted C2-C9 heterocyclyl. In some embodiments, G is optionally substituted C2-C9 heteroaryl.
In some embodiments,
Figure imgf000008_0001
where
each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl; or RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl or optionally substituted C2-C9 heterocyclyl. In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl. In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, F, Cl,
Figure imgf000009_0001
,
Figure imgf000009_0002
CH
In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, F,
Figure imgf000009_0003
Figure imgf000009_0004
CH3 In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, F, Cl, ,
Figure imgf000009_0005
CH
Figure imgf000009_0006
, , , , In some embodiments, RG1 is H; RG2 is
Figure imgf000009_0007
; R is ; R is ; and
CH RG5 is H. In some embodiments, RG1 is H; RG2 is RG4 is H; and RG5 is
Figure imgf000009_0008
CH O CH3. In some embodiments, RG1 is H; RG2 is ; RG4 is Cl or F; and RG5 is H. In some embodiments, RG1 is H; RG2 is
Figure imgf000009_0009
; RG4 is H; and
CH RG5 is H. In some embodiments, RG1 is H; RG2 is RG4 is
and RG5 is H.
Figure imgf000009_0011
Figure imgf000009_0010
In some embodiments, RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl or optionally substituted C2-C9 heterocyclyl.
In some embodiments, RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heterocyclyl. In some embodiments, RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl.
In some embodiments, G is
Figure imgf000010_0004
Figure imgf000010_0003
, where RG6 is H or optionally
R
substituted C1-C6 alkyl. In some embodiments, G is
G6
Figure imgf000010_0002
Figure imgf000010_0001
, where RG6 is H or optionally substituted C1-C6 alkyl.
In some embodiments, RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heterocyclyl or optionally substituted C2-C9 heteroaryl. R
In some embodiments, G is
Figure imgf000011_0001
, , ,
Figure imgf000011_0002
, , , ,
Figure imgf000011_0003
where RG6 is H or optionally
substituted C1-C6 alkyl. In some embodiments, RG6 is H, In some embodiments, RG6 is H or
Figure imgf000011_0004
In some embodiments, RG6 is H. In some embodiments, RG1 is H, F
Figure imgf000011_0006
Figure imgf000011_0005
O C O C O O
Figure imgf000011_0007
In some embodiments, RG1 is H. In some embodiments, RG2 is H, F,
Figure imgf000011_0008
O CH O CH
Figure imgf000011_0009
In some embodiments, RG2 is H.
Figure imgf000011_0010
In some embodiments, RG3 is H, F,
Figure imgf000012_0010
O CH O CH O F O F
Figure imgf000012_0009
, , , , , , ,
Figure imgf000012_0008
, , , or . In some embodiments, RG3 is H.
CH CH
In some embodiments, RG4 is H, F,
Figure imgf000012_0007
, , , ,
Figure imgf000012_0006
Figure imgf000012_0005
In some embodiments, RG4 is H.
C CH
In some embodiments, RG5 is H, F,
Figure imgf000012_0004
, , , ,
Figure imgf000012_0003
. In some embodiments, RG5 is H.
Figure imgf000012_0002
In some embodiments, one or more of RG1, RG2, RG3, RG4, and RG5 is H. In some embodiments, two or more of RG1, RG2, RG3, RG4, and RG5 is H. In some embodiments, three or more of RG1, RG2, RG3, RG4, and RG5 is H. In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is H.
R
In some embodiments, G is
where
Figure imgf000012_0001
each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG7 and RG8, RG8 and RG9, RG9 and RG10, and/or RG10 and RG11, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl.
In some embodiments, each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; or RG7 and RG8, RG8 and RG9, RG9 and RG10, and/or RG10 and RG11, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl.
In some embodiments, each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl; or RG7 and RG8, RG8 and RG9, RG9 and RG10, and/or RG10 and RG11, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2- C9 heteroaryl, or C2-C9 heterocyclyl.
In some embodiments, each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
CH3 In some embodiments, each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, F, Cl, ,
Figure imgf000013_0001
O G CH
embodiments, R 8 is 3.
In some embodiments,
Figure imgf000013_0002
In some embodiments, RG7 is H; RG8 is
Figure imgf000013_0003
; RG9 is H; and RG11 is H.
In some embodiments, G is
Figure imgf000013_0004
where
each of RG12, RG13, and RG14 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG12 and RG14, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
In some embodiments, each of RG12, RG13, and RG14 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; or RG12 and RG14, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
In some embodiments, the compound of Formula I has the structure of Formula Ia:
Figure imgf000014_0001
Formula Ia,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Ib:
Figure imgf000014_0002
Formula Ib,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Ic:
Figure imgf000015_0002
Formula Ic,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Id:
Figure imgf000015_0003
Formula Id,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Ie:
Figure imgf000015_0001
Formula Ie,
where each of R5 and R6 is, independently, H, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, or optionally substituted C2-C9 heterocyclyl; or R5 and R6, together with the nitrogen to which each is attached, combine to form an optionally substituted C2-C9 heterocyclyl, or a pharmaceutically acceptable salt thereof. In some embodiments, the compound of Formula I has the structure of Formula If:
Figure imgf000016_0001
Formula If,
where each of R5 and R6 is, independently, H, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, or optionally substituted C2-C9 heterocyclyl; or R5 and R6, together with the nitrogen to which each is attached, combine to form an optionally substituted C2-C9 heterocyclyl, or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Ig:
Figure imgf000016_0002
Formula Ig,
where each of R5 and R6 is, independently, H, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, or optionally substituted C2-C9 heterocyclyl; or R5 and R6, together with the nitrogen to which each is attached, combine to form an optionally substituted C2-C9 heterocyclyl, or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Ih:
Figure imgf000016_0003
Formula Ih,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Ii:
Figure imgf000017_0001
Formula Ii,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Ij:
Figure imgf000017_0002
Formula Ij,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Ik:
Figure imgf000017_0003
Formula Ik,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Im:
Figure imgf000017_0004
Formula Im, or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula In:
Figure imgf000018_0001
Formula In,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Io:
Figure imgf000018_0003
Formula Io,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Ip:
Figure imgf000018_0002
Formula Ip,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Iq:
Figure imgf000019_0001
Formula Iq,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula I has the structure of Formula Ir:
Figure imgf000019_0002
Formula Ir,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound has the structure of any one of compounds B1-B6 in Table 1, or a pharmaceutically acceptable salt thereof. In some embodiments, the compound has the structure of any one of compounds B1-B3 and B6 in Table 1, or a pharmaceutically acceptable salt thereof.
In an aspect, the disclosure features a compound having the structure of any one of compounds B1-B6 in Table 1, or a pharmaceutically acceptable salt thereof.
In an aspect, the disclosure features a compound having the structure of any one of compounds B1-B3 and B6 in Table 1, or a pharmaceutically acceptable salt thereof.
In an aspect, the disclosure features a compound having the structure of any one of compounds B4 and B5 in Table 1, or a pharmaceutically acceptable salt thereof. Table 1. Compounds B1-B6 of the Disclosure
Figure imgf000019_0003
Figure imgf000020_0001
In an aspect, the disclosure features a compound having the structure of Formula II:
A-L-B
Formula II,
where
L is a linker;
B is a degradation moiety; and
A has the structure of Formula III:
Figure imgf000021_0001
Formula III,
where
R1 is H, optionally substituted C1-C6 alkyl, optionally substituted C2-C6 alkenyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C10 carbocyclyl;
Z1 is CR2 or N;
R2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl;
X1 is N or CH, and X2 is C-R7ʹʹ; or X1 is C-R7ʹʹ, and X2 is N or CH;
Figure imgf000021_0002
, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C1-C6 alkoxy, optionally substituted amino, optionally substituted sulfone, optionally substituted sulfonamide, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms;
R7ʹ is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C10 carbocycylyl;
X3 is N or CH;
X4 is N or CH;
Figure imgf000021_0003
, optionally substituted C3-C10 carbocyclyl, C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl;
Gʹ is optionally substituted C3-C10 carbocyclylene, C2-C9 heterocyclylene, optionally substituted C6-C10 arylene, or optionally substituted C2-C9 heteroarylene; and
A1 is a bond between A and the linker,
Figure imgf000021_0004
, or a pharmaceutically acceptable salt thereof.
In some embodiments, R1 is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C10 carbocyclyl. In some embodiments, R1 is H, optionally substituted C1-C6 alkyl, optionally substituted C2-C6 alkenyl, or optionally substituted C3-C10 carbocyclyl. In some embodiments, R1 is H, optionally substituted C1-C6 alkyl, or optionally substituted C3-C10 carbocyclyl.
In some embodiments, R1 is H. In some embodiments, R1 is optionally substituted C1-C6 alkyl. In some embodiments, R1 is optionally substituted C2-C6 alkenyl. In some embodiments, R1 is optionally substituted C3-C10 carbocyclyl. In some embodiments, optionally substituted C1-C6 alkyl is C1-C6 perfluoroalkyl.
In some embodiments, R1 is
Figure imgf000022_0011
, , , , , , F F F
Figure imgf000022_0010
, , , or . In some embodiments, R1 is In some embodiments, R1 is
Figure imgf000022_0009
In some embodiments, R1 is H
Figure imgf000022_0008
, , , , , , ,
Figure imgf000022_0007
In some embodiments, R1 is
In some embodiments, R1 is H
Figure imgf000022_0006
Figure imgf000022_0003
F In some embodiments, R1 is H
Figure imgf000022_0005
Figure imgf000022_0004
In some embodiments, R1 is H, In some embodiments, R1 is H or
Figure imgf000022_0001
. In some embodiments, R1 is H. In some embodiments, R1 is
Figure imgf000022_0002
In some embodiments, Z1 is CR2. In some embodiments, Z1 is N.
In some embodiments, R2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, or optionally substituted C6-C10 aryl.
In some embodiments, R2 is H, halogen, or optionally substituted C1-C6 alkyl. In some embodiments,
Figure imgf000023_0001
In some embodiments, R2 is H. In some embodiments, R2 is F. In some embodiments, R2 is .
In some embodiments, R7ʹʹ is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C1-C6 alkoxy, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R7ʹʹ is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R7ʹʹ is optionally substituted C1-C6 alkoxy or optionally substituted amino. In some embodiments, R7ʹʹ is optionally substituted sulfone or optionally substituted sulfonamide.
In some embodiments, R7ʹʹ is optionally substituted C1-C6 alkyl or optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R7ʹʹ is optionally substituted C1-C6 heteroalkyl or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R7ʹʹ is optionally substituted C1-C6 alkyl or optionally substituted C1-C6 heteroalkyl.
In some embodiments, R7ʹʹ is optionally substituted C1-C6 alkyl. In some embodiments, R7ʹʹ is optionally substituted C1-C6 heteroalkyl. In some embodiments, R7ʹʹ is optionally substituted C1-C6 alkoxy. In some embodiments, R7ʹʹ is optionally substituted amino. In some embodiments, R7ʹʹ is optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R7ʹʹ is optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R7ʹʹ is optionally substituted sulfone. In some embodiments, R7ʹʹ is optionally substituted sulfonamide.
In some embodiments, R7ʹʹ is optionally substituted C1-C3 alkyl. In some embodiments, R7ʹʹ is optionally substituted C1-C3 heteroalkyl. In some embodiments
Figure imgf000023_0002
In some embodiments, R7ʹʹ is–NR3R4 or–OR4, where R3 is H or optionally substituted C1-C6 alkyl, and R4 is optionally substituted C1-C6 alkyl.
In some embodiments, R7ʹʹ is–NR3R4. In some embodiments, R7ʹʹ is–OR4.
In some embodiments, R3 is H. In some embodiments, R3 is optionally substituted C1-C6 alkyl. In some embodiments, R3 is H and R4 is methyl. In some embodiments, R3 is methyl and R4 is methyl. In some embodiments, R7ʹʹ is In some embodiments, R 7 ʹʹ is
O
Figure imgf000023_0003
Figure imgf000023_0004
In some embodiments, R7ʹʹ is optionally substituted carbocyclyl having 3 to 6 atoms or optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R7ʹʹ is optionally substituted carbocyclyl having 3 to 6 atoms. In some embodiments, R7ʹʹ is optionally substituted heterocyclyl having 3 to 6 atoms. In some embodiments, R7ʹʹ is carbocyclyl having 3 to 6 atoms or heterocyclyl having 3 to 6 atoms. In some embodiments, R7ʹʹ is carbocyclyl having 3 to 6 atoms. In some embodiments, R7ʹʹ is heterocyclyl having 3 to 6 atoms.
In some embodiments, R7ʹʹ is
O
Figure imgf000024_0003
In some embodiments, R7ʹʹ is
Figure imgf000024_0002
In some embodiments, R7ʹʹ is
Figure imgf000024_0001
In some embodiments, R7ʹʹ is
Figure imgf000024_0004
Figure imgf000024_0005
In some embodiments, R7ʹʹ
Figure imgf000024_0006
In some
O embodiments, R7ʹʹ is
Figure imgf000024_0007
, , , , , , In
some embodiments, R7ʹʹ is
Figure imgf000024_0008
Figure imgf000025_0003
NH2. In some embodiments, R7ʹʹ is
Figure imgf000025_0004
, , , , or . In some embodiments, R7ʹʹ is
F
Figure imgf000025_0002
Figure imgf000025_0001
In some embodiments, X1 is N and X2 is C-R7ʹʹ. In some embodiments, X1 is CH and X2 is C-R7ʹʹ. In some embodiments, X1 is C-R7ʹʹ and X2 is N. In some embodiments, X1 is C-R7ʹʹ and X2 is CH.
In some embodiments, X1 is N or CH, and X2 is C-NR3R4, C-OR4,
Figure imgf000025_0005
F
; or X1 is C-NR3R4, C-OR4
Figure imgf000025_0007
, , , or , and X2 is N
Figure imgf000025_0006
or CH. In some embodiments, X1 is N or CH, and X2 is C-NR3R4, or
Figure imgf000025_0008
F
; or X1 is C-NR3R4, and X2 is N or CH. In
Figure imgf000025_0010
Figure imgf000025_0009
some embodiments, X1 is N or CH, and X2 is C-NR3R4 or or X1 is C-NR3R4 or
Figure imgf000025_0012
,
Figure imgf000025_0013
F
and X2 is N or CH. In some embodiments, X1 is N or CH, and X2 is C-NR3R4 or r X1 is
Figure imgf000025_0011
C-NR3R4 or
Figure imgf000026_0001
, and X2 is N or CH. In some embodiments, X1 is N or CH, and X2 is C-
NR3R4 or
Figure imgf000026_0002
or X1 is C-NR3R4 or
Figure imgf000026_0003
, and X2 is N or CH.
In some embodiments, R7ʹʹ is -NR3R4, -OR4, or optionally substituted heterocyclyl having 3 to 6 atoms.
In some embodiments, X1 is N and X2 is C-NR3R4. In some embodiments, X1 is C-NR3R4 and X2 is N.
In some embodiments, R3 is H. In some embodiments, R3 is optionally substituted C1-C6 alkyl.
In some embodiments, R
Figure imgf000026_0013
, , , , ,
F In some embodiments, R3 is In some embodiments, R3 is or
Figure imgf000026_0011
Figure imgf000026_0012
2H2 H F
2 CF
H 3
n s me e b 3 F
o m odiments, R is methyl, ethyl, , , or .
Figure imgf000026_0004
In some embodiments, R4 i
Figure imgf000026_0009
F In some embodiments, R4 i In some embodiments, R4 is or
Figure imgf000026_0008
Figure imgf000026_0010
Figure imgf000026_0005
. In some embodiments, R4 is methyl, ethyl,
In some embodiments, X3 is N. In some embodimen
Figure imgf000026_0007
ts, X3 is CH.
In some embodiments, X4 is N. In some embodiments, X4 is CH.
In some embodiments, X3 is N and X4 is N.
In some embodiments, X3 is N and X4 is CH.
In some embodiments, X3 is CH and X4 is N.
In some embodiments, X3 is CH and X4 is CH. In some embodiments, Gʹʹ is
Figure imgf000026_0006
In some embodiments, Gʹ is optionally substituted C3-C10 carbocyclylene or optionally substituted C2-C9 heterocyclylene. In some embodiments, Gʹ is optionally substituted C6-C10 arylene or optionally substituted C2-C9 heteroarylene. In some embodiments, Gʹ is optionally substituted C3-C10 carbocyclylene. In some embodiments, Gʹ is optionally substituted C6-C10 arylene. In some embodiments, Gʹ is optionally substituted C2-C9 heterocyclylene. In some embodiments, Gʹ is optionally substituted C2-C9 heteroarylene.
In some embodiments,
Figure imgf000027_0001
where
each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is, independently, H, A1, halogen, optionally substituted C1- C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG1ʹ and RG2ʹ, RG2ʹ and RG3ʹ, RG3ʹ and RG4ʹ, and/or RG4ʹ and RG5ʹ, together with the carbon atoms to which each is attached, combine to form
Figure imgf000027_0002
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl,
M
any of which is optionally substituted with A1, where one of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is A1, or is substituted with A1.
In some embodiments, each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG1ʹ and RG2ʹ, RG2ʹ and RG3ʹ, RG3ʹ and RG4ʹ, and/or RG4ʹ and RG5ʹ, together with the carbon atoms to which each is attached, combine to form
Figure imgf000027_0003
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl, any of which is optionally substituted with A1, where one of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and
M RG5ʹ is A1, or is substituted with A1.
In some embodiments, each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl; or RG1ʹ and RG2ʹ, RG2ʹ and RG3ʹ, RG3ʹ and RG4ʹ, and/or RG4ʹ and RG5ʹ, together with the carbon atoms to which each is attached, combine to form
M
Figure imgf000027_0004
; and is optionally substituted C2-C9 heteroaryl or optionally substituted C2-C9 heterocyclyl, any of which is optionally substituted with A1, where one of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is A1, or
Figure imgf000028_0001
is substituted with A1.
In some embodiments, each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
In some embodiments, each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is, independently, H, A1, F, Cl,
Figure imgf000028_0002
CH3 In some embodiments, each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is, independently, H, A1, F, ,
Figure imgf000028_0003
ndently, H, A1, F, Cl, .
Figure imgf000028_0005
O O CH
In some embodiments, RG1ʹ is H; RG2ʹ is 3 CH
; RG3ʹ is A1; RG4ʹ is 3 ; and RG5ʹ is H. O O CH
In some embodiments, RG1ʹ is H; RG2ʹ is 3 CH
; RG3ʹ is A1; RG4ʹ is H; and RG5ʹ is 3. In some O CH
embodiments, RG1ʹ is H; RG2ʹ is 3 ; RG3ʹ is A1; RG4ʹ is Cl or F; and RG5ʹ is H. In some
O CH
embodiments, RG1ʹ is H; RG2ʹ is 3 ; RG3ʹ is A1; RG4ʹ is H; and RG5ʹ is H. In some embodiments,
O CH H 3
RG1ʹ is H; RG2ʹ is 3 C
; RG3ʹ is A1; RG4ʹ is ; and RG5ʹ is H.
In some embodiments, RG1ʹ and RG2ʹ, RG2ʹ and RG3ʹ, RG3ʹ and RG4ʹ, and/or RG4ʹ and RG5ʹ, together
M
with the carbon atoms to which each is attached, combine to form
Figure imgf000028_0004
and is optionally substituted C2-C9 heterocyclyl, which is optionally substituted with A1, where one of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, is substituted with A1. In some embodiments, RG1ʹ and RG2ʹ, RG2ʹ and RG3ʹ, RG3ʹ d RG5ʹ, together with the carbon atoms to which each is attached, combine to form
Figure imgf000029_0001
tionally substituted C2-C9 heteroaryl, which is optionally substituted with A1, where one
Figure imgf000029_0002
substituted with A1.
In some embodiments,
Figure imgf000029_0003
Figure imgf000029_0004
optionally substituted C1-C6
alkyl. In some embodiments,
Figure imgf000029_0005
Figure imgf000029_0006
r optionally substituted C1-C6 alkyl.
In some embodiments, RG1ʹ and RG2ʹ, RG2ʹ and RG3ʹ, RG3ʹ and RG4ʹ, and/or RG4ʹ and RG5ʹ, together
M
with the carbon atoms to which each is attached, combine to form
Figure imgf000029_0007
; and is optionally substituted C2-C9 heterocyclyl or optionally substituted C2-C9 heteroaryl, any of which is optionally
M
substituted with A1, where one of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is A1, or is substituted with A1.
Figure imgf000030_0001
,
Figure imgf000030_0002
r optionally substituted C1-C6 alkyl. I I
I
Figure imgf000030_0004
In some embodiments, RG6ʹ is H. In some embodiments, RG6ʹ is A1.
Figure imgf000030_0003
CH3 CH CH3
3 CH3 In some embodiments, RG3ʹ is H, A1, F, , , , ,
O CH3 O CH3 O F O F O O CH CH 3 O CH
3 CH
, , 3 , CH F
3 , H 3
3C , F , F , O CF3 O CF3 O O
S CF F S
3 , F CH
, 3 CH
, or 3. In some embodiments, RG3ʹ is H.
CH3 CH CH3
3 CH3 In some embodiments, RG4ʹ is H, A1, F, , , , , ,
, ,
Figure imgf000031_0003
In some embodiments, one or more of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is H. In some
embodiments, two or more of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is H. In some embodiments, three or more of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is H.
In some embodiments, RG1ʹ is A1. In some embodiments, RG2ʹ is A1. In some embodiments, RG3ʹ is A1. In some embodiments, RG4ʹ is A1. In some embodiments, RG5ʹ is A1. In some embodiments,
Figure imgf000031_0001
is substituted with A1.
In some embodiments,
Figure imgf000031_0002
where
each of RG7ʹ, RG8ʹ, RG9ʹ, RG10ʹ, and RG11ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG7ʹ and RG8ʹ, RG8ʹ and RG9ʹ, RG9ʹ and RG10ʹ, and/or RG10ʹ and RG11ʹ, together with the carbon atoms to which each is M
attached, combine to form
Figure imgf000032_0001
; and is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl, any of which is
M
optionally substituted with A1, where one of RG7ʹ, RG8ʹ, RG9ʹ, RG10ʹ, and RG11ʹ is A1; or is substituted with A1.
In some embodiments, each of RG7ʹ, RG8ʹ, RG9ʹ, RG10ʹ, and RG11ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG7ʹ and RG8ʹ, RG8ʹ and RG9ʹ, RG9ʹ and RG10ʹ, and/or RG10ʹ and RG11ʹ, together with the carbon
M M
atoms to which each is attached, combine to form ; and is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl, any of which is optionally substituted with A1, where one of RG7ʹ, RG8ʹ, RG9ʹ, RG10ʹ, and RG11ʹ is A1;
Figure imgf000032_0002
is substituted with A1.
In some embodiments, each of RG7ʹ, RG8ʹ, RG9ʹ, RG10ʹ, and RG11ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl; or RG7ʹ and RG8ʹ, RG8ʹ and RG9ʹ, RG9ʹ and RG10ʹ, and/or RG10ʹ and RG11ʹ, together with the carbon atoms to which each is attached, combine to M M
form ; and is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl, any of which is optionally substituted with A1, where one of RG7ʹ, RG8ʹ, RG9ʹ, RG10ʹ, and RG11ʹ is A1; or
Figure imgf000032_0003
is substituted with A1.
In some embodiments, each of RG7ʹ, RG8ʹ, RG9ʹ, RG10ʹ, and RG11ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
In some embodiments, each of RG7ʹ, RG8ʹ, RG9ʹ, RG10ʹ, and RG11ʹ is, independently, H, A1, F, Cl,
Figure imgf000032_0004
Figure imgf000033_0001
In some embodiments,
Figure imgf000033_0002
O CH
In some embodiments, RG7ʹ is H; RG8ʹ is 3 ; RG9ʹ is A1; and RG11ʹ is H.
In some embodiments,
Figure imgf000033_0003
where
each of RG12ʹ, RG13ʹ, and RG14ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG12ʹ and RG14ʹ, together with the carbon
M M
atoms to which each is attached, combine to form ; and is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl, any of which is optionally substituted with A1, where one of RG12ʹ, RG13ʹ, and RG14ʹ is
Figure imgf000033_0004
substituted with A1.
In some embodiments, each of RG12ʹ, RG13ʹ, and RG14ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG12ʹ and RG14ʹ, together with the carbon atoms to which each is attached, combine to form
Figure imgf000033_0005
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl, any of which is optionally substituted with A1,
M
where one of RG12ʹ, RG13ʹ, and RG14ʹ is A1; or is substituted with A1. R7'
N
A1
In some embodiments, R7ʹʹ is .
In some embodiments, R7ʹ is H, optionally substituted C1-C6 alkyl, or optionally substituted C3-C10 carbocycylyl. In some embodiments, R7ʹ is H or optionally substituted C1-C6 alkyl. In some embodiments,
Figure imgf000034_0001
Figure imgf000034_0002
, , , . In some embodiments, R7ʹ is H or
Figure imgf000034_0003
. In some
CH3
embodiments, R7ʹ is H. In some embodiments, R7ʹ is .
In some embodiments, Gʹʹ is optionally substituted C3-C10 carbocyclyl or optionally substituted C2- C9 heterocyclyl. In some embodiments, Gʹʹ is optionally substituted C6-C10 aryl or optionally substituted C2-C9 heteroaryl.
In some embodiments, Gʹʹ is optionally substituted C3-C10 carbocyclyl. In some embodiments, G is optionally substituted C6-C10 aryl. In some embodiments, G is optionally substituted C2-C9 heterocyclyl. In some embodiments, Gʹʹ is optionally substituted C2-C9 heteroaryl.
In some embodiments,
Figure imgf000034_0004
where
each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl; or RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl or optionally substituted C2-C9 heterocyclyl.
In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl. In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, F, Cl,
Figure imgf000035_0001
,
Figure imgf000035_0002
CH3 In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, F, ,
Figure imgf000035_0003
. In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is, independently, H,
Figure imgf000035_0004
,
Figure imgf000035_0005
Figure imgf000036_0005
and RG5 is H.
In some embodiments, RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl or optionally substituted C2-C9 heterocyclyl.
In some embodiments, RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heterocyclyl. In some embodiments, RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl.
In some embodiments, RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heterocyclyl. In some embodiments, RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl.
In some embodiments,
Figure imgf000036_0001
Figure imgf000036_0002
r optionally
substituted C1-C6 alkyl. In some embodiments,
Figure imgf000036_0003
,
Figure imgf000036_0004
r optionally substituted C1-C6 alkyl.
Figure imgf000037_0001
substituted C1-C6 alkyl. I I
Figure imgf000037_0004
In some embodiments, RG6 is H.
Figure imgf000037_0002
Figure imgf000037_0003
CH3 CH CH3
3 CH3 In some embodiments, RG3 is H, F, , , , ,
O CH3 O CH3 O F O F O O CH CH 3 O
3 CH CH
, , 3 , CH F
3 , H 3
3C , F , F , O CF3 O CF3 O O
CF F S S
3 , F CH
, 3 CH
, or 3. In some embodiments, RG3 is H.
Figure imgf000038_0002
O CF3 O CF3 O O
F S S CF3 , F CH
, 3 CH
, or 3. In some embodiments, RG4 is H.
CH3 CH CH3
3 CH3 In some embodiments, RG5 is H, F, , , , ,
O CH3 O CH3 O F O F O CH O CH 3 O CH
3 CH
, , 3 , CH F
3 , H3C 3
, F , F , O CF3 O CF3 O O
F S S CF3 , F CH
, 3 CH
, or 3. In some embodiments, RG5 is H.
In some embodiments, one or more of RG1, RG2, RG3, RG4, and RG5 is H. In some embodiments, two or more of RG1, RG2, RG3, RG4, and RG5 is H. In some embodiments, three or more of RG1, RG2, RG3, RG4, and RG5 is H. In some embodiments, each of RG1, RG2, RG3, RG4, and RG5 is H.
In some embodiments,
Figure imgf000038_0001
where
each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG7 and RG8, RG8 and RG9, RG9 and RG10, and/or RG10 and RG11, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl.
In some embodiments, each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; or RG7 and RG8, RG8 and RG9, RG9 and RG10, and/or RG10 and RG11, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl.
In some embodiments, each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl; or RG7 and RG8, RG8 and RG9, RG9 and RG10, and/or RG10 and RG11, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2- C9 heteroaryl, or C2-C9 heterocyclyl.
In some embodiments, each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
CH3 In some embodiments, each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, F, Cl, ,
Figure imgf000039_0001
O CH
embodiments, RG8 is 3.
In some embodiments,
Figure imgf000039_0002
O CH
In some embodiments, RG7 is H; RG8 is 3 ; RG9 is H; and RG11 is H. RG12
S N RG14
N S N S
In some embodiments, Gʹʹ is RG13
, RG13
, or R G12 RG14
,
where
each of RG12, RG13, and RG14 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG12 and RG14, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
In some embodiments, each of RG12, RG13, and RG14 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; or RG12 and RG14, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl.
In some embodiments, A has the structure of Formula IIIa:
Figure imgf000040_0001
Formula IIIa,
or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIb:
Figure imgf000040_0002
Formula IIIb,
or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIc:
Figure imgf000041_0004
Formula IIIc, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIId:
Figure imgf000041_0001
Formula IIId, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIe:
Figure imgf000041_0002
Formula IIIe, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIf:
Figure imgf000041_0003
Formula IIIf, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIg:
Figure imgf000042_0001
Formula IIIg, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIh:
Figure imgf000042_0002
Formula IIIh, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIi:
Figure imgf000042_0003
Formula IIIi, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIj:
Figure imgf000043_0001
Formula IIIj, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIk:
Figure imgf000043_0002
Formula IIIk, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIm:
Figure imgf000043_0003
Formula IIIm, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIn:
Figure imgf000043_0004
Formula IIIn, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIo:
Figure imgf000044_0001
Formula IIIo, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIp:
Figure imgf000044_0002
Formula IIIp, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIq:
Figure imgf000044_0003
Formula IIIq, or a pharmaceutically acceptable salt thereof. In some embodiments, A has the structure of Formula IIIr:
Figure imgf000045_0001
Formula IIIr, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIs:
Figure imgf000045_0002
Formula IIIs, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIt:
Figure imgf000045_0003
Formula IIIt, or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIu:
Figure imgf000046_0001
Formula IIIu,
or a pharmaceutically acceptable salt thereof.
In some embodiments, A has the structure of Formula IIIv:
Figure imgf000046_0002
Formula IIIv,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the degradation moiety is a ubiquitin ligase binding moiety.
In some embodiments, the ubiquitin ligase binding moiety comprises Cereblon ligands, IAP (Inhibitors of Apoptosis) ligands, mouse double minute 2 homolog (MDM2), or von Hippel-Lindau (VHL) ligands, or derivatives or analogs thereof.
In some embodiments, the degradation moiety is a ubiquitin ligase binding moiety.
In some embodiments, the ubiquitin ligase binding moiety comprises Cereblon ligands, IAP (Inhibitors of Apoptosis) ligands, mouse double minute 2 homolog (MDM2), or von Hippel-Lindau (VHL) ligands, or derivatives or analogs thereof.
In some embodiments, the degradation moiety includes the structure of Formula Y:
Figure imgf000046_0003
Formula Y,
where
A2 is a bond between the degradation moiety and the linker;
v1 is 0, 1, 2, 3, 4, or 5;
u1 is 1, 2, or 3;
Figure imgf000047_0001
R5A is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
each RJ1 is, independently, halogen, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
JA is absent, O, optionally substituted amino, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl; and
J is absent, optionally substituted C3-C10 carbocyclylene, optionally substituted C6-C10 arylene, optionally substituted C2-C9 heterocyclylene, or optionally substituted C2-C9 heteroarylene, or a pharmaceutically acceptable salt thereof.
In some embodiments, T2 is
Figure imgf000047_0003
. In some embodiments, T2 is
Figure imgf000047_0002
or
Figure imgf000047_0004
. , . In some embodiments, T2 is
Figure imgf000047_0005
.
In some embodiments, the structure of Formula Y has the structure of Formula Y1:
Figure imgf000047_0006
Formula Y1,
or a pharmaceutically acceptable salt thereof.
A2
J JA N
In some embodiments, T1 is a bond. In some embodiments, T1 is .
In some embodiments, the structure of Formula Y has the structure of Formula Y2:
A2
Figure imgf000047_0007
Formula Y2, or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula Y has the structure of Formula Z:
Figure imgf000048_0001
Formula Z,
or a pharmaceutically acceptable salt thereof.
In some embodiments, u1 is 1. In some embodiments, u1 is 2. In some embodiments u1 is 3. In some embodiments, the structure of Formula Z has the structure of Formula AA0:
Figure imgf000048_0002
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula Z has the structure of Formula AB:
Figure imgf000048_0003
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula Z has the structure of Formula AC:
Figure imgf000048_0004
Formula AC,
or a pharmaceutically acceptable salt thereof.
In some embodiments, JA is absent. In some embodiments, JA is optionally substituted C1-C6 alkyl. In some embodiments, JA is optionally substituted C1-C6 heteroalkyl. In some embodiments, JA is O or optionally substituted amino. In some embodiments,
Figure imgf000048_0005
In some embodiments, the structure of Formula AA0 has the structure of Formula AA0:
Figure imgf000049_0001
or a pharmaceutically acceptable salt thereof.
In some embodiments, v1 is 0, 1, 2, or 3. In some embodiments, v1 is 0. In some embodiments, v1 is 1. In some embodiments, v1 is 2. In some embodiments, v1 is 3.
In some embodiments, the structure of Formula AA has the structure of Formula AA1:
Figure imgf000049_0002
Formula AA1,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula AB has the structure of Formula AB1:
Figure imgf000049_0003
Formula AB1,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula AC has the structure of Formula AC1:
Figure imgf000049_0004
Formula AC1,
or a pharmaceutically acceptable salt thereof.
In some embodiments, J is absent. In some embodiments, J is optionally substituted C3-C10 carbocyclylene or optionally substituted C6-C10 arylene. In some embodiments, J is optionally substituted C2-C9 heterocyclylene or optionally substituted C2-C9 heteroarylene.
In some embodiments, J is optionally substituted heterocyclylene. In some embodiments, J is optionally substituted C6-C10 arylene.
In some embodiments,
Figure imgf000049_0005
In some embodiments, the structure of Formula AA has the structure of Formula AA2:
Figure imgf000049_0006
Formula AA2,
or a pharmaceutically acceptable salt thereof. In some embodiments, the structure of Formula AA has the structure of Formula AA3:
Figure imgf000050_0001
Formula AA3,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula AA has the structure of Formula AA4:
Figure imgf000050_0002
Formula AA4,
or a pharmaceutically acceptable salt thereof.
In some embodiments, RA5 is H or optionally substituted C1-C6 alkyl. In some embodiments, RA5 is optionally substituted C1-C6 heteroalkyl.
In some embodiments, RA5 is H or methyl. In some embodiments, RA5 is H. In some
embodiments, RA5 is methyl. In some embodiments,
Figure imgf000050_0003
In some embodiments, the structure of Formula AA has the structure of Formula A:
,
Figure imgf000050_0004
RA5 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
RA6 is H or optionally substituted C1-C6 alkyl; and RA7 is H or optionally substituted C1-C6 alkyl; or RA6 and RA7, together with the carbon atom to which each is bound, combine to form optionally substituted C3-C6 carbocyclyl or optionally substituted C2-C5 heterocyclyl; or RA6 and RA7, together with the carbon atom to which each is bound, combine to form optionally substituted C3-C6 carbocyclyl or optionally substituted C2-C5 heterocyclyl;
RA8 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
each of RA1, RA2, RA3, and RA4 is, independently, H, A2, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, hydroxyl, thiol, or optionally substituted amino; or RA1 and RA2, RA2 and RA3, and/or RA3 and RA4, together with the carbon atoms to which each is attached, combine to form
Figure imgf000051_0001
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl, any of which is optionally substituted with A2, where one of RA1, RA2, RA3, and
Figure imgf000051_0002
is substituted with A2, or a pharmaceutically acceptable salt thereof.
In some embodiments, each of RA1, RA2, RA3, and RA4 is, independently, H, A2, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; or RA1 and RA2, RA2 and RA3, and/or RA3 and RA4, together with the carbon atoms to which each is attached, combine to form
Figure imgf000051_0003
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl, any of which is optionally substituted with A2, where one of RA1, RA2,
Figure imgf000051_0004
is substituted with A2, or a pharmaceutically acceptable salt thereof.
In some embodiments, each of RA1, RA2, RA3, and RA4 is, H, A2, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, hydroxyl, optionally substituted amino; or RA1 and RA2, RA2 and RA3, or RA3 and RA4, together with the carbon atoms to which each is attached, combine to form
Figure imgf000051_0005
is optionally substituted C2-C9 heterocyclyl, which is optionally substituted with A2, where one of RA1, RA2, RA3, and
Figure imgf000051_0006
is substituted with A2. In some embodiments, each of RA1, RA2, RA3, and RA4 is, independently, H, A2, F,
Figure imgf000051_0007
,
Figure imgf000051_0008
together with the carbon atoms to which each is attached, combine to form
Figure imgf000051_0009
is optionally substituted C2- C9 heterocyclyl, which is optionally substituted with A2, where one of RA1, RA2, RA3, and RA4 is A2, or
Figure imgf000051_0010
substituted with A2.
In some embodiments, RA1 is A2. In some embodiments, RA2 is A2. In some embodiments, RA3 is A2. In some embodiments, RA4 is A2. In some embodiments, RA5 is A2.
In some embodiments, RA5 is H or optionally substituted C1-C6 alkyl. CH3
In some embodiments, RA5 is H or . In some embodiments, RA5 is H. In some embodiments,
Figure imgf000052_0001
O R A6 R A7 O In some embodiments, Y1 is
Figure imgf000052_0003
. In some embodiments, Y1 is
Figure imgf000052_0002
. In some embodiments,
Figure imgf000052_0004
In some embodiments, each of RA6 and RA7 is, independently, H, F,
Figure imgf000052_0005
, , or
Figure imgf000052_0009
Figure imgf000052_0006
In some embodiments, the structure of Formula A has the structure of Formula A1:
Figure imgf000052_0007
,
Formula A1
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula A has the structure of Formula A2:
Figure imgf000052_0008
,
Formula A2
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula A has the structure of Formula A3:
Figure imgf000053_0001
,
Formula A3
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula A has the structure of Formula A4:
Figure imgf000053_0002
,
Formula A4
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula A has the structure of Formula A5:
Figure imgf000053_0003
,
Formula A5
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula A has the structure of Formula A6:
Figure imgf000053_0004
,
Formula A6
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula A has the structure of Formula A7:
Figure imgf000053_0005
,
Formula A7
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula A has the structure of Formula A8:
Figure imgf000054_0001
,
Formula A8
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula A has the structure of Formula A9:
Figure imgf000054_0002
,
Formula A9
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula A has the structure of Formula A10:
Figure imgf000054_0003
,
Formula A10
or a pharmaceutically acceptable salt thereof.
In some embodiments, wherein the structure of Formula
Figure imgf000054_0004
Figure imgf000054_0005
Figure imgf000055_0001
Figure imgf000055_0002
r derivative or analog thereof.
In some embodiments,
Figure imgf000055_0003
optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl.
Figure imgf000056_0001
In some embodiments, RA9 is H, A2, or optionally substituted C1-C6 alkyl. In some embodiments, RA9 is H, A2, or methyl. In some embodiments, R9A is H. In some embodiments, R9A is methyl. In some embodiments, RA9 is A2.
Figure imgf000056_0002
.
In some embodiments, the structure of Formula AA has the structure of Formula B:
,
Figure imgf000056_0003
where
RA5 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
each of RA1, RA2, RA3, and RA4 is, independently, H, A2, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, hydroxyl, thiol, or optionally substituted amino; or RA1 and RA2, RA2 and RA3, and/or RA3 and RA4, together with the carbon atoms to which each is attached, combine to form
Figure imgf000057_0001
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl, any of which is optionally substituted with A2, where one of RA1, RA2, RA3, and RA4 is A2, or
Figure imgf000057_0002
is substituted with A2, or a pharmaceutically acceptable salt thereof.
In some embodiments, each of RA1, RA2, RA3, and RA4 is, H, A2, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, hydroxyl, optionally substituted amino; or RA1 and RA2, RA2 and RA3, or RA3 and RA4, together with the carbon atoms to which each is attached, combine to form
Figure imgf000057_0003
is optionally substituted C2-C9 heterocyclyl, which is optionally substituted with A2, where one of RA1, RA2, RA3, and RA4 is A2,
Figure imgf000057_0004
is substituted with A2. In some embodiments, each of RA1, RA2, RA3, and RA4 is, independently, H, A2, F,
Figure imgf000057_0005
,
Figure imgf000057_0006
together with the carbon atoms to which each is attached, combine to form
Figure imgf000057_0007
is optionally substituted C2- C9 heterocyclyl, which is optionally substituted with A2, where one of RA1, RA2, RA3, and RA4 is A2, or
Figure imgf000057_0008
substituted with A2.
In some embodiments, RA1 is A2. In some embodiments, RA2 is A2. In some embodiments, RA3 is A2. In some embodiments, RA4 is A2. In some embodiments, RA5 is A2.
In some embodiments, RA5 is H or optionally substituted C1-C6 alkyl. In some embodiments,
Figure imgf000057_0009
. In some embodiments, RA5 is H. In some
CH3
embodiments, RA5 is .
In some embodiments, the structure of Formula B has the structure of Formula B1:
,
Figure imgf000057_0010
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula B has the structure of Formula B2: ,
Figure imgf000058_0001
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula B has the structure of Formula B3:
,
Figure imgf000058_0002
or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula B has the structure of Formula B4:
Figure imgf000058_0003
,
Formula B4
or a pharmaceutically acceptable salt thereof.
Figure imgf000058_0004
Figure imgf000058_0005
.
In some embodiments, the ubiquitin ligase binding moiety comprises a von Hippel-Lindau ligand. In some embodiments, the von Hippel-Lindau ligand has the structure
Figure imgf000059_0001
or derivative or analog thereof.
In some embodiments, the degradation moiety includes the structure of Formula C:
Figure imgf000059_0002
where
RB1 is H, A2, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
RB2 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
RB3 is A2, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1-C6 alkyl C6-C10 aryl;
RB4 is H, optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1- C6 alkyl C6-C10 aryl;
RB5 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
v2 is 0, 1, 2, 3, or 4;
each RB6 is, independently, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino; and each of RB7 and RB8 is, independently, H, halogen, optionally substituted C1-C6 alkyl, or optionally substituted C6-C10 aryl,
where one of RB1 and RB3 is A2, or a pharmaceutically acceptable salt thereof. In some embodiments, the structure of Formula
Figure imgf000060_0001
Figure imgf000060_0002
In some embodiments, the degrader moiety includes the structure of Formula D:
Figure imgf000060_0003
where
A2 is a bond between B and the linker;
each of RC1, RC2, and RC7 is, independently, H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
RC3 is optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1- C6 alkyl C6-C10 aryl; RC5 is optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1- C6 alkyl C6-C10 aryl;
v3 is 0, 1, 2, 3, or 4;
each RC8 is, independently, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino;
v4 is 0, 1, 2, 3, or 4; and
each RC9 is, independently, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino, or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula
Figure imgf000061_0001
derivative or analog thereof.
In some embodiments, the degrader moiety includes the structure of Formula E:
Figure imgf000061_0002
where
A2 is a bond between B and the linker;
each of RC10 and RC11 is, independently, H, optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1-C6 alkyl C6-C10 aryl;
v5 is 0, 1, 2, 3, or 4;
each RC12 is, independently, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino;
v6 is 0, 1, 2, 3, or 4; and
each R21 is, independently, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino, or a pharmaceutically acceptable salt thereof.
In some embodiments, the structure of Formula E is
Figure imgf000062_0001
In some embodiments, the degradation moiety includes the structure of Formula FA:
Figure imgf000062_0002
where
Figure imgf000062_0003
bicyclic moiety which is substituted with A 2 and substituted with one or more groups independently selected from H, RFF1, and oxo;
is a single bond or a double bond;
u2 is 0, 1, 2, or 3;
A2 is a bond between the degrader and the linker;
YFa is CRFbRFc, C═O, C═S, C═CH2, SO2, S(O), P(O)Oalkyl, P(O)NHalkyl, P(O)N(alkyl)2, P(O)alkyl, P(O)OH, P(O)NH2;
YFb is NH, NRFF1, CH2, CHRFF1, C(RFF1)2, O, or S;
YFc is CRFdRFe, C═O, C═S, C═CH2, SO2, S(O), P(O)Oalkyl, P(O)NHalkyl, P(O)N(alkyl)2, P(O)alkyl, P(O)OH, P(O)NH2;
each of RFb, RFc, RFd, and RFe is, independently, H, alkyl, aliphatic, heteroaliphatic, aryl, heteroaryl, carbocyclyl, hydroxyl, alkoxy, amino,—NHalkyl, or—Nalkyl2; or RFb and RFc, together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
or RFd and RFe, together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O; and
or RFd and RFb, together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
each of YFd and YFf is, independently, CH2, CHRFF2, C(RFF2)2, C(O), N, NH, NRFF3, O, S, or S(O); YFe is a bond or a divalent moiety attached to YFd and YFf that contains 1 to 5 contiguous carbon atoms that form a 3 to 8-membered ring,
wherein 1, 2, or 3 carbon atoms can be replaced with a nitrogen, oxygen, or sulfur atom; wherein one of the ring atoms is substituted with A2 and the others are substituted with one or more groups independently selected from H and RFF1; and
wherein the contiguous atoms of YFe can be attached through a single or double bond; each RFF1 is, independently, H, alkyl, alkenyl, alkynyl, aliphatic, heteroaliphatic, carbocyclyl, halogen, hydroxyl, amino, cyano, alkoxy, aryl, heteroaryl, heterocyclyl, alkylamino, alkylhydroxyl, or haloalkyl;
each RFF2 is, independently, alkyl, alkene, alkyne, halogen, hydroxyl, alkoxy, azide, amino, —C(O)H,—C(O)OH,—C(O)(aliphatic, including alkyl),—C(O)O(aliphatic, including alkyl),
—NH(aliphatic, including alkyl),—N(aliphatic including alkyl)(aliphatic including alkyl),—NHSO2alkyl, —N(alkyl)SO2alkyl,—NHSO2aryl,—N(alkyl)SO2aryl,—NHSO2alkenyl,—N(alkyl)SO2alkenyl, —NHSO2alkynyl,—N(alkyl)SO2alkynyl, aliphatic, heteroaliphatic, aryl, heteroaryl, hetercyclic, carbocyclic, cyano, nitro, nitroso,—SH,—Salkyl, or haloalkyl; and
RFF3 is alkyl, alkenyl, alkynyl,—C(O)H,—C(O)OH,—C(O)alkyl, or—C(O)Oalkyl,
wherein if YFd or YFf is substituted with A2, then YFe is a bond, or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula FA has the structure of Formula FA1:
Figure imgf000063_0001
Formula FA1,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the degradation moiety includes the structure of Formula FB:
Figure imgf000064_0001
where
Figure imgf000064_0002
bicyclic moiety which is substituted with A 2 and substituted with one or more groups independently selected from H, RFF1, and oxo;
A2 is a bond between the degrader and the linker;
YFa is CRFbRFc, C═O, C═S, C═CH2, SO2, S(O), P(O)Oalkyl, P(O)NHalkyl, P(O)N(alkyl)2, P(O)alkyl, P(O)OH, P(O)NH2;
each of YFb and YFg is, independently, NH, NRFF1, CH2, CHRFF1, C(RFF1)2, O, or S;
YF
P(O)alkyl,
Figure imgf000064_0003
each of RFb, RFc, RFd, RFe, RFf, and RFg is, independently, H, alkyl, aliphatic, heteroaliphatic, aryl, heteroaryl, carbocyclyl, hydroxyl, alkoxy, amino,—NHalkyl, or—Nalkyl2;
or RFb and RFc, together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
or RFd and RFe, together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
or RFf and RFg, together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
or RFd and RFb, together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
or RFd and RFf, together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
or RFb and RFg, together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
each of YFd and YFf is, independently, CH2, CHRFF2, C(RFF2)2, C(O), N, NH, NRFF3, O, S, or S(O); YFe is a bond or a divalent moiety attached to YFd and YFf that contains 1 to 5 contiguous carbon atoms that form a 3 to 8-membered ring,
wherein 1, 2, or 3 carbon atoms can be replaced with a nitrogen, oxygen, or sulfur atom; wherein one of the ring atoms is substituted with A2 and the others are substituted with one or more groups independently selected from H and RFF1; and
wherein the contiguous atoms of YFe can be attached through a single or double bond; each RFF1 is, independently, H, alkyl, alkenyl, alkynyl, aliphatic, heteroaliphatic, carbocyclyl, halogen, hydroxyl, amino, cyano, alkoxy, aryl, heteroaryl, heterocyclyl, alkylamino, alkylhydroxyl, or haloalkyl;
each RFF2 is, independently, alkyl, alkene, alkyne, halogen, hydroxyl, alkoxy, azide, amino, —C(O)H,—C(O)OH,—C(O)(aliphatic, including alkyl),—C(O)O(aliphatic, including alkyl),
—NH(aliphatic, including alkyl),—N(aliphatic including alkyl)(aliphatic including alkyl),—NHSO2alkyl, —N(alkyl)SO2alkyl,—NHSO2aryl,—N(alkyl)SO2aryl,—NHSO2alkenyl,—N(alkyl)SO2alkenyl, —NHSO2alkynyl,—N(alkyl)SO2alkynyl, aliphatic, heteroaliphatic, aryl, heteroaryl, hetercyclic, carbocyclic, cyano, nitro, nitroso,—SH,—Salkyl, or haloalkyl; and
RFF3 is alkyl, alkenyl, alkynyl,—C(O)H,—C(O)OH,—C(O)alkyl, or—C(O)Oalkyl,
wherein if YFd or YFf is substituted with A2, then YFe is a bond, or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound of Formula FB has the structure of Formula FB1:
Figure imgf000065_0001
Formula FB1,
or a pharmaceutically acceptable salt thereof.
In some embodiments, the degradation moiety includes the structure of Formula F1:
Figure imgf000065_0002
Formula F1,
where A2 is a bond between the degrader and the linker; and RF1 is absent or O, or a pharmaceutically acceptable salt thereof.
In some embodiments, RF1 is absent. In some embodiments, RF1 is O.
Figure imgf000065_0003
In some embodiments, the degradation moiety includes the structure Formula F2:
Figure imgf000066_0001
Formula F2,
where A2 is a bond between the degrader and the linker; and Y2 is CH2 or NH, or a pharmaceutically acceptable salt thereof.
In some embodiments, Y2 is NH. In some embodiments, Y2 is CH2.
In some embodiments, structure of Formula
Figure imgf000066_0002
In some embodiments, the degradation moiety includes the structure Formula G:
Figure imgf000066_0003
Formula G,
where A2 is a bond between the degrader and the linker; and Y3 is CH2 or NH, or a pharmaceutically acceptable salt thereof.
In some embodiments, Y3 is NH. In some embodiments, Y3 is CH2.
In some embodiments, structure of Formula
Figure imgf000066_0004
The degradation moiety may also include structures found in, e.g., WO2017/197036;
WO2019/204354, WO2019/236483, WO2020/010177; and WO2020/010227, the structures of which are herein incorporated by reference.
In some embodiments, the linker has the structure of Formula IV:
A1-(B1)f-(C1)g-(B2)h-(D)-(B3)i-(C2)j-(B4)k–A2
Formula IV
where
A1 is a bond between the linker and A;
A2 is a bond between B and the linker;
each of B1, B2, B3, and B4 is, independently, optionally substituted C1-C2 alkylene, optionally substituted C1-C3 heteroalkylene, O, S, S(O)2, or NRN;
each RN is, independently, H, optionally substituted C1–4 alkyl, optionally substituted C2–4 alkenyl, optionally substituted C2–4 alkynyl, optionally substituted C2–6 heterocyclyl, optionally substituted C6–12 aryl, or optionally substituted C1–7 heteroalkyl; each of C1 and C2 is, independently, carbonyl, thiocarbonyl, sulphonyl, or phosphoryl;
each of f, g, h, i, j, and k is, independently, 0 or 1; and
D is optionally substituted C1–10 alkylene, optionally substituted C2–10 alkenylene, optionally substituted C2–10 alkynylene, optionally substituted C2–6 heterocyclylene, optionally substituted C6–12 arylene, optionally substituted C2-C10 polyethylene glycol, or optionally substituted C1–10 heteroalkylene, or a chemical bond linking A1-(B1)f-(C1)g-(B2)h- to -(B3)i-(C2)j-(B4)k–A2.
In some embodiments, each of B1, B2, B3, and B4 is, independently, optionally substituted C1-C4 alkylene, optionally substituted C1-C4 heteroalkylene, or NRN.
In some embodiments, each RN is, independently, H or optionally substituted C1-C4 alkylene. In some embodiments, each RN is, independently, H or methyl.
In some embodiments, each of B1 and B4 is, independently,
Figure imgf000067_0001
, ,
Figure imgf000067_0002
Figure imgf000067_0006
In some embodiments,
Figure imgf000067_0003
In some embodiments, B2 is NRN. In some embodiments, B2 is optionally substituted C1-C4 alkylene.
In some embodiments, f is 0. In some embodiments, f is 1. In some embodiments, g is 1. In some embodiments, h is 0. In some embodiments, h is 1. In some embodiments, i is 0. In some embodiments, j is 0. In some embodiments, k is 0.
In some embodiments, the linker has the structure
Figure imgf000067_0004
Figure imgf000067_0005
wherein
x is 1, 2, 3, 4, 5, 6, 7, or 8;
y is 1, 2, 3, or 4; Rx is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
Ry is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl; and
W is O or NRw, wherein Rw is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl.
Figure imgf000068_0001
In some embodiments, Rx is H or me optionally substituted C1-C6 alkyl. In some embodiments, Ry is H or optionally substituted C1-C6 alkyl. In some embodiments, Rw is H or optionally substituted C1- C6 alkyl.
In some embodiments, Rx is H or methyl. In some embodiments, Ry is H or methyl. In some embodiments, Rw is H or methyl.
In some embodiments, the linker has the structure of
CH3 CH3 CH3
N N N O O N H
O , O , O , CH3 H CH3 CH3
N N N N O N H
O , O , O ,
CH3 CH3 CH
H 3 CH3
N O N N N N O N CH3
H
O , O , O , O N
, , CH3 O CH3 O
H N O N N N N
H , H ,
CH3 O CH3 O
N N N O N N
H , H H ,
CH3 O CH3 O H
N O N N N N
H , H ,
H
N C N
O
O
Figure imgf000069_0001
O
Figure imgf000069_0002
In some embodiments, the linker has the structure
Figure imgf000069_0003
Figure imgf000069_0004
.
In some embodiments, the linker has the structure of Formula V:
A1–(E1)–(F1)–(C3)m–(E3)n–(F2)o1–(F3)o2–(E2)p–A2,
Formula V
where
A1 is a bond between the linker and A;
A2 is a bond between B and the linker;
each of m, n, o1, o2, and p is, independently, 0 or 1; each of E1 and E2 is, independently, O, S, NRN, optionally substituted C1–10 alkylene, optionally substituted C2–10 alkenylene, optionally substituted C2–10 alkynylene, optionally substituted C2-C10 polyethylene glycol, or optionally substituted C1–10 heteroalkylene;
E3 is optionally substituted C1-C6 alkylene, optionally substituted C1-C6 heteroalkylene, O, S, or NRN;
each RN is, independently, H, optionally substituted C1–4 alkyl, optionally substituted C2–4 alkenyl, optionally substituted C2–4 alkynyl, optionally substituted C2–6 heterocyclyl, optionally substituted C6–12 aryl, or optionally substituted C1–7 heteroalkyl;
C3 is carbonyl, thiocarbonyl, sulphonyl, or phosphoryl; and
each of F1, F2, and F3 is, independently, optionally substituted C3-C10 carbocyclylene, optionally substituted C2–10 heterocyclylene, optionally substituted C6-C10 arylene, or optionally substituted C2-C9 heteroarylene.
In some embodiments, the linker has the structure of Formula Va:
A1–(E1)–(F1)–(C3)m–(E2)p–A2.
Formula Va
In some embodiments, the linker has the structure of Formula Vb:
A1–(E1)–(F1)–(E2)p–A2.
Formula Vb
In some embodiments, the linker has the structure of Formula Vc:
A1–(E1)–(F1)–A2.
Formula Vc
In some embodiments, the linker has the structure of Formula Vd:
A1–(E1)–(F1)–(C3)m–(F2)o1–A2.
Formula Vd
In some embodiments, the linker has the structure of Formula Ve:
A1–(E1)–(F1)–(E3)n–(F2)o1–(E2)p–A2.
Formula Ve
In some embodiments, the linker has the structure of Formula Vf:
A1–(E1)–(F1)–(C3)m–(E3)n–(F2)o1–(E2)p–A2.
Formula Vf
In some embodiments, the linker has the structure of Formula Vg:
A1–(E1)–(F1)–(E3)n–(F2)o1–A2,
Formula Vg
In some embodiments, each of E1 and E2 is, independently, NRN, optionally substituted C1–10 alkylene, optionally substituted C2-C10 polyethylene glycolene, or optionally substituted C1–10 heteroalkylene.
In some embodiments, E3 is optionally substituted C1-C6 alkylene, O, S, or NRN;
In some embodiments, E3 is optionally substituted C1-C6 alkylene. In some embodiments, E3 is optionally substituted C1-C3 alkylene. In some embodiments, E3 is O, S, or NRN.
In some embodiments, E3 is C1-C6 alkylene. In some embodiments, E3 is C1-C3 alkylene. In some embodiments, E3 is O.
Figure imgf000071_0001
In some embodiments, each RN is, independently, H or optionally substituted C1–4 alkyl. In some embodiments, each RN is, independently, H or methyl. In some embodiments,
Figure imgf000071_0002
Figure imgf000071_0003
Figure imgf000071_0004
,
Figure imgf000071_0005
Figure imgf000072_0001
b is 0, 1, 2, 3, 4, 5, or 6;
Ra is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
Rb is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl; and
Rc is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl.
Figure imgf000072_0002
In some embodiments,
Figure imgf000073_0001
In some embodiments, Ra is H or optionally substituted C1-C6 alkyl. In some embodiments, Rb is H or optionally substituted C1-C6 alkyl. In some embodiments, Rc is H or optionally substituted C1-C6 alkyl.
In some embodiments, Ra is H or methyl. In some embodiments, Rb is H or methyl. In some embodiments, Rc is H or methyl.
In some embodiments, b is 0, 1, 2, or 3. In some embodiments, b is 0. In some embodiments, b is 1. In some embodiments, b is 2. In some embodiments, b is 3.
Figure imgf000073_0002
Figure imgf000073_0004
Figure imgf000073_0003
Figure imgf000074_0001
wherein
c is 0, 1, 2, 3, 4, 5, 6, 7, or 8;
d is 0, 1, 2, or 3;
e is 0, 1, 2, 3, 4, 5, or 6;
f is 0, 1, 2, 3, or 4;
Rd is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
Re is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl; Rf is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
Rg is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl; and
W is O or NRw, wherein Rw is H or optionally substituted C1-C6 alkyl.
Figure imgf000075_0001
In some embodiments, Rd is H or optionally substituted C1-C6 alkyl. In some embodiments, Re is H or optionally substituted C1-C6 alkyl. In some embodiments, Rf is H or optionally substituted C1-C6 alkyl. In some embodiments, Rg is H or optionally substituted C1-C6 alkyl. In some embodiments, Rw is H or optionally substituted C1-C6 alkyl.
In some embodiments, Rd is H or methyl. In some embodiments, Re is H or methyl. In some embodiments, Rf is H or methyl. In some embodiments, Rg is H or methyl. In some embodiments, Rw is H or methyl.
Figure imgf000075_0002
In some embodiments, each of F1, F2, or F3 is, independently, optionally substituted C3-C10 carbocyclylene. In some embodiments, the C3-C10 carbocyclylene is monocyclic. In some embodiments, the C3- C10 carbocyclylene is polycyclic.
In some embodiments, the C3-C10 carbocyclylene is bicyclic.
In some embodiments, the C3-C10 carbocyclylene is bridged. In some embodiments, the C3-C10 carbocyclylene is fused. In some embodiments, the C3-C10 carbocyclylene is spirocyclic.
In some embodiments, the C3-C10 carbocyclylene is
Figure imgf000076_0001
, , , or
Figure imgf000076_0002
In some embodiments, the C3-C10 carbocyclylene i
Figure imgf000076_0003
Figure imgf000076_0004
In some embodiments, each of F1, F2, or F3 is, independently, optionally substituted C2–C9 heterocyclylene.
In some embodiments, the C2–C9 heterocyclylene is monocyclic. In some embodiments, the C2– C9 heterocyclylene is polycyclic.
In some embodiments, the C2–C9 heterocyclylene is bicyclic.
In some embodiments, the C2–C9 heterocyclylene is bridged. In some embodiments, the C2–C9 heterocyclylene is fused. In some embodiments, the C2–C9 heterocyclylene is spirocyclic.
In some embodiments, the C2–C9 heterocyclylene includes a quaternary amine.
In some embodiments, the C2–C9 heterocyclylene i
Figure imgf000076_0005
Figure imgf000076_0006
Figure imgf000077_0001
,
where
q1 is 0, 1, 2, 3, or 4;
q2 is 0, 1, 2, 3, 4, 5, or 6;
q3 is 0, 1, 2, 3, 4, 5, 6, 7, or 8;
each Rh is, independently, 2H, halogen, optionally substituted C1-C6 alkyl, ORi2, or NRi3Ri4; or two Rh groups, together with the carbon atom to which each is attached, combine to form optionally substituted C3-C10 carbocyclyl or optionally substituted C2-C9 heterocyclyl; or two Rh groups, together with the carbon atoms to which each is attached, combine to form optionally substituted C3-C10 carbocyclyl or optionally substituted C2-C9 heterocyclyl;
Ri1 is H or optionally substituted C1-C6 alkyl;
Ri2 is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
Ri3 is H or optionally substituted C1-C6 alkyl; and
Ri4 is H or optionally substituted C1-C6 alkyl.
In some embodiments, each Rh is, independently, halogen, optionally substituted C1-C6 alkyl, ORi2, or NRi3Ri4. In some embodiments, Ri1 is H or optionally substituted C1-C6 alkyl. In some embodiments, Ri2 is H or optionally substituted C1-C6 alkyl. In some embodiments, Ri3 is H or optionally substituted C1-C6 alkyl. In some embodiments, Ri4 is H or optionally substituted C1-C6 alkyl.
In some embodiments, the C2–C9 heterocyclylene
Figure imgf000077_0002
Figure imgf000077_0003
Figure imgf000078_0001
In some embodiments, each Rh is, independently, halogen, optionally substituted C1-C6 alkyl, ORi2, or NRi3Ri4. In some embodiments, each Rh is, independently, halogen, optionally substituted C1-C6 alkyl, or NRi3Ri4.
In some embodiments, each Rh is, independently, 2H, halogen, cyano, optionally substituted C1- C6 alkyl, ORi2, or NRi3Ri4. In some embodiments, two Rh groups, together with the carbon atom to which each is attached, combine to form optionally substituted C3-C10 carbocyclyl or optionally substituted C2-C9 heterocyclyl. In some embodiments, two Rh groups, together with the carbon atoms to which each is attached, combine to form optionally substituted C3-C10 carbocyclyl or optionally substituted C2-C9 heterocyclyl.
F In some embodiments, each Rh is, independently, 2H, F, methyl,
Figure imgf000078_0002
, , ,
Figure imgf000078_0003
In some embodiments, each Rh is, independently, F, methyl, or NRi3Ri4.
In some embodiments, q1 is 0, 1, or 2. In some embodiments, q1 is 0. In some embodiments, q1 is 1. In some embodiments, q1 is 2.
In some embodiments, q2 is 0, 1, or 2. In some embodiments, q2 is 0. In some embodiments, q2 is 1. In some embodiments, q2 is 2.
Figure imgf000078_0004
In some embodiments, the C2–C9 heterocyclylene i
Figure imgf000078_0005
Figure imgf000078_0006
, , , , , , ,
Figure imgf000079_0001
In some embodiments, the C2–C9 heterocyclylene
Figure imgf000080_0001
Figure imgf000080_0002
Figure imgf000080_0003
Figure imgf000080_0004
Figure imgf000081_0001
Figure imgf000081_0002
In some embodiments, Ri1 is H or methyl. In some embodiments, Ri2 is H or methyl. In some embodiments, Ri3 is H or methyl. In some embodiments, Ri4 is H or methyl. In some embodiments, the C2–C9 heterocyclylene i
Figure imgf000082_0001
Figure imgf000082_0002
In some embodiments, the C2–C9 heterocyclylene
Figure imgf000082_0003
Figure imgf000082_0004
.
In some embodiments, the C2–C9 heterocyclylene i
Figure imgf000082_0005
N N N N N N
, , , , , N N N N N N N N N N
, , , , , N N N N N N N N N N N N
, , , , , N N N N
, , , or . N N N N
In some embodiments, the C2–C9 heterocyclylene is , , N N N N N N N N N N
, , , , ,
Figure imgf000083_0001
In some embodiments, the C2–C9 heterocyclylene i
Figure imgf000083_0002
Figure imgf000083_0003
Figure imgf000084_0001
Figure imgf000084_0002
N N
N N N N N N
, , , , ,
O N N N N N N N N F N
, , , F , or F F .
N N N
In some embodiments, the C2–C9 heterocyclyl is , , N N N N N N
, , , , , N N N N N N N N
, , , , , N N N N N N N
, , , , , N O N N N N N N N N
, , , , , N N N N F N
, F , or F F . N N
In some embodiments, the C2–C9 heterocyclyl is , ,
O O O O N N N N N
, , , , , or N
.
Figure imgf000086_0001
,
Figure imgf000087_0001
Figure imgf000087_0002
Figure imgf000088_0001
In some embodiments, each of F1, F2, or F3 is, independently, optionally substituted C6-C10 arylene.
In some embodiments, the C6-C10 arylene
Figure imgf000088_0002
In some embodiments, each of F1, F2, or F3 is, independently, optionally substituted C2-C9 heteroarylene.
Figure imgf000088_0003
Figure imgf000088_0005
Figure imgf000088_0004
. In some embodiments, C3 is
Figure imgf000088_0006
.
In some embodiments, m is 1. In some embodiments, p is 1.
Figure imgf000089_0001
Figure imgf000090_0001
Figure imgf000091_0001
, ,
Figure imgf000092_0001
Figure imgf000093_0001
H F F N O
O
H N O
H N O H N O O N
H
Figure imgf000094_0002
O N H
O N
H
Figure imgf000094_0001
Figure imgf000095_0001
Figure imgf000096_0001
Figure imgf000097_0001
In some embodiments, the linker has the structure of:
Figure imgf000097_0002
, ,
Figure imgf000097_0003
Figure imgf000098_0001
In some embodiments, the linker is optionally substituted C3-C10 carbocyclylene, optionally substituted C2–10 heterocyclylene, optionally substituted C6-C10 arylene, or optionally substituted C2-C9 heteroarylene.
In some embodiments, the linker is optionally substituted C3-C10 carbocyclylene or optionally substituted C2–10 heterocyclylene. In some embodiments, the linker is optionally substituted C6-C10 arylene or optionally substituted C2-C9 heteroarylene.
In some embodiments, the linker is optionally substituted C2–10 heterocyclylene.
In some embodiments, the C2–C9 heterocyclylene is monocyclic. In some embodiments, the C2– C9 heterocyclylene is polycyclic.
In some embodiments, the C2–C9 heterocyclylene is bicyclic.
In some embodiments, the C2–C9 heterocyclylene is bridged. In some embodiments, the C2–C9 heterocyclylene is fused. In some embodiments, the C2–C9 heterocyclylene is spirocyclic. In some embodiments, the linker has the structure of
Figure imgf000099_0001
, , ,
Figure imgf000099_0002
In some embodiments, the linker has the structure of
Figure imgf000099_0003
, ,
Figure imgf000099_0004
In some embodiments, the compound has the structure of any one of compounds D1-D31 in Table 2A, or a pharmaceutically acceptable salt thereof. In some embodiments, the compound has the structure of compounds D32-D184 in Table 2B, or a pharmaceutically acceptable salt thereof. In some embodiments, the compound has the structure of any one of compounds D185-D316 in Table 2C, or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound has the structure of any one of compounds D1, D7, D15- D21, D23, and D27-D30 in Table 2A, or a pharmaceutically acceptable salt thereof. In some embodiments, the compound has the structure of any one of compounds D32-D42, D46, D48-D63, D65- D73, D75-D83, D85-D87, D89-D93, D95-D116, D118, D120-D164, D166-D168, D170, D171, D173, D174, D176-D178, D180, D182, and D184 in Table 2B, or a pharmaceutically acceptable salt thereof. In some embodiments, the compound has the structure of any one of compounds D185-D190, D192-D204, D248, D254-D258, D260, D262-D269, D271-D280, D284, D286-D291, and D293-D316 in Table 2C, or a pharmaceutically acceptable salt thereof.
In an aspect, the disclosure features compounds D1-D31 in Table 2A, or a pharmaceutically acceptable salt thereof.
In an aspect, the disclosure features compounds D32-D184 in Table 2B, or a pharmaceutically acceptable salt thereof.
In an aspect, the disclosure features compounds D185-D316 in Table 2C, or a pharmaceutically acceptable salt thereof. Table 2A. Compounds D1-D31 of the Disclosure
Figure imgf000099_0005
Figure imgf000100_0001
Figure imgf000101_0001
Figure imgf000102_0001
Figure imgf000103_0001
Figure imgf000104_0001
Figure imgf000105_0001
Figure imgf000106_0001
Figure imgf000107_0001
Table 2B. Compounds D32-D184 of the Disclosure
Figure imgf000107_0002
Figure imgf000108_0001
Figure imgf000109_0001
Figure imgf000110_0001
Figure imgf000111_0001
Figure imgf000112_0001
Figure imgf000113_0001
Figure imgf000114_0001
Figure imgf000115_0001
Figure imgf000116_0001
Figure imgf000117_0001
Figure imgf000118_0001
Figure imgf000119_0001
Figure imgf000120_0001
Figure imgf000121_0001
Figure imgf000122_0001
Figure imgf000123_0001
Figure imgf000124_0001
Figure imgf000125_0001
Figure imgf000126_0001
Figure imgf000127_0001
Figure imgf000128_0001
Figure imgf000129_0001
Figure imgf000130_0001
Figure imgf000131_0001
Figure imgf000132_0001
Figure imgf000133_0001
Figure imgf000134_0001
Figure imgf000135_0001
Figure imgf000136_0001
Figure imgf000137_0001
Figure imgf000138_0001
Figure imgf000139_0001
Figure imgf000140_0001
Figure imgf000141_0001
Figure imgf000142_0001
Figure imgf000143_0001
Figure imgf000144_0001
Figure imgf000145_0001
Table 2C. Compounds D185-D316 of the Disclosure
Figure imgf000145_0002
Figure imgf000146_0001
Figure imgf000147_0001
Figure imgf000148_0001
Figure imgf000149_0001
Figure imgf000150_0001
Figure imgf000151_0001
Figure imgf000152_0001
Figure imgf000153_0001
Figure imgf000154_0001
Figure imgf000155_0001
Figure imgf000156_0001
Figure imgf000157_0001
Figure imgf000158_0001
Figure imgf000159_0001
Figure imgf000160_0001
Figure imgf000161_0001
Figure imgf000162_0001
Figure imgf000163_0001
Figure imgf000164_0001
Figure imgf000165_0001
Figure imgf000166_0001
Figure imgf000167_0001
Figure imgf000168_0001
Figure imgf000169_0001
Figure imgf000170_0001
Figure imgf000171_0001
Figure imgf000172_0001
Figure imgf000173_0001
Figure imgf000174_0001
Figure imgf000175_0001
Figure imgf000176_0001
Figure imgf000177_0001
Figure imgf000178_0001
In another aspect, the disclosure features a pharmaceutical composition including any of the foregoing compounds, or pharmaceutically acceptable salts thereof, and a pharmaceutically acceptable excipient.
In an aspect, the disclosure features a method of inhibiting the level and/or activity of BRD9 in a cell, the method involving contacting the cell with an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or a pharmaceutical composition thereof.
In another aspect, the disclosure features a method of reducing the level and/or activity of BRD9 in a cell, the method involving contacting the cell with an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or a pharmaceutical composition thereof.
In some embodiments, the cell is a cancer cell.
In some embodiments, the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, colorectal cancer, a sarcoma (e.g., a soft tissue sarcoma, synovial sarcoma, Ewing’s sarcoma, osteosarcoma, rhabdomyosarcoma, adult fibrosarcoma, alveolar soft-part sarcoma, angiosarcoma, clear cell sarcoma, desmoplastic small round cell tumor, epithelioid sarcoma, fibromyxoid sarcoma, gastrointestinal stromal tumor, Kaposi sarcoma, liposarcoma, leiomyosarcoma, malignant mesenchymoma malignant peripheral nerve sheath tumors, myxofibrosarcoma, low-grade rhabdomyosarcoma), non-small cell lung cancer (e.g., squamous or adenocarcinoma), stomach cancer, or breast cancer. In some embodiments, the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, or colorectal cancer. In some embodiments, the cancer is a sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma), non-small cell lung cancer (e.g., squamous or adenocarcinoma), stomach cancer, or breast cancer. In some embodiments, the cancer is sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma). In some embodiments, the sarcoma is synovial sarcoma.
In an aspect, the disclosure features a method of treating a BAF complex-related disorder in a subject in need thereof, the method involving administering to the subject an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or a pharmaceutical composition thereof. In some embodiments, the BAF complex-related disorder is cancer. In some embodiments, the BAF complex-related disorder is infection.
In another aspect, the disclosure features a method of treating an SS18-SSX fusion protein- related disorder in a subject in need thereof, the method involving administering to the subject an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or a pharmaceutical composition thereof. In some embodiments, the SS18-SSX fusion protein-related disorder is cancer. In some embodiments, the SS18-SSX fusion protein-related disorder is infection. In some embodiments of any of the foregoing methods, the SS18-SSX fusion protein is a
SS18-SSX1 fusion protein, a SS18-SSX2 fusion protein, or a SS18-SSX4 fusion protein.
In yet another aspect, the disclosure features a method of treating a BRD9-related disorder in a subject in need thereof, the method involving administering to the subject an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or a pharmaceutical composition thereof. In some embodiments, the BRD9-related disorder is cancer. In some embodiments, the BRD9- related disorder is infection.
In some embodiments, the cancer is squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, hepatocellular carcinomas, and renal cell carcinomas, cancer of the bladder, bowel, breast, cervix, colon, esophagus, head, kidney, liver, lung, neck, ovary, pancreas, prostate, and stomach; leukemias; benign and malignant lymphomas, particularly Burkitt's lymphoma and Non-Hodgkin's lymphoma; benign and malignant melanomas; myeloproliferative diseases; sarcomas, including Ewing's sarcoma, hemangiosarcoma, Kaposi's sarcoma, liposarcoma, myosarcomas, peripheral
neuroepithelioma, synovial sarcoma, gliomas, astrocytomas, oligodendrogliomas, ependymomas, gliobastomas, neuroblastomas, ganglioneuromas, gangliogliomas, medulloblastomas, pineal cell tumors, meningiomas, meningeal sarcomas, neurofibromas, and Schwannomas; bowel cancer, breast cancer, prostate cancer, cervical cancer, uterine cancer, lung cancer, ovarian cancer, testicular cancer, thyroid cancer, astrocytoma, esophageal cancer, pancreatic cancer, stomach cancer, liver cancer, colon cancer, melanoma; carcinosarcoma, Hodgkin's disease, Wilms' tumor and teratocarcinomas. Additional cancers which may be treated using the disclosed compounds according to the present invention include, for example, acute granulocytic leukemia, acute lymphocytic leukemia (ALL), acute myelogenous leukemia (AML), adenocarcinoma, adenosarcoma, adrenal cancer, adrenocortical carcinoma, anal cancer, anaplastic astrocytoma, angiosarcoma, appendix cancer, astrocytoma, Basal cell carcinoma, B-Cell lymphoma, bile duct cancer, bladder cancer, bone cancer, bone marrow cancer, bowel cancer, brain cancer, brain stem glioma, breast cancer, triple (estrogen, progesterone and HER-2) negative breast cancer, double negative breast cancer (two of estrogen, progesterone and HER-2 are negative), single negative (one of estrogen, progesterone and HER-2 is negative), estrogen-receptor positive, HER2- negative breast cancer, estrogen receptor-negative breast cancer, estrogen receptor positive breast cancer, metastatic breast cancer, luminal A breast cancer, luminal B breast cancer, Her2-negative breast cancer, HER2-positive or negative breast cancer, progesterone receptor-negative breast cancer, progesterone receptor-positive breast cancer, recurrent breast cancer, carcinoid tumors, cervical cancer, cholangiocarcinoma, chondrosarcoma, chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), colon cancer, colorectal cancer, craniopharyngioma, cutaneous lymphoma, cutaneous melanoma, diffuse astrocytoma, ductal carcinoma in situ (DCIS), endometrial cancer, ependymoma, epithelioid sarcoma, esophageal cancer, ewing sarcoma, extrahepatic bile duct cancer, eye cancer, fallopian tube cancer, fibrosarcoma, gallbladder cancer, gastric cancer, gastrointestinal cancer, gastrointestinal carcinoid cancer, gastrointestinal stromal tumors (GIST), germ cell tumor glioblastoma multiforme (GBM), glioma, hairy cell leukemia, head and neck cancer, hemangioendothelioma, Hodgkin lymphoma, hypopharyngeal cancer, infiltrating ductal carcinoma (IDC), infiltrating lobular carcinoma (ILC), inflammatory breast cancer (IBC), intestinal Cancer, intrahepatic bile duct cancer, invasive/infiltrating breast cancer, Islet cell cancer, jaw cancer, Kaposi sarcoma, kidney cancer, laryngeal cancer, leiomyosarcoma, leptomeningeal metastases, leukemia, lip cancer, liposarcoma, liver cancer, lobular carcinoma in situ, low-grade astrocytoma, lung cancer, lymph node cancer, lymphoma, male breast cancer, medullary carcinoma, medulloblastoma, melanoma, meningioma, Merkel cell carcinoma, mesenchymal chondrosarcoma, mesenchymous, mesothelioma metastatic breast cancer, metastatic melanoma metastatic squamous neck cancer, mixed gliomas, monodermal teratoma, mouth cancer mucinous carcinoma, mucosal melanoma, multiple myeloma, Mycosis Fungoides, myelodysplastic syndrome, nasal cavity cancer, nasopharyngeal cancer, neck cancer, neuroblastoma, neuroendocrine tumors (NETs), non-Hodgkin's lymphoma, non-small cell lung cancer (NSCLC), oat cell cancer, ocular cancer, ocular melanoma, oligodendroglioma, oral cancer, oral cavity cancer, oropharyngeal cancer, osteogenic sarcoma, osteosarcoma, ovarian cancer, ovarian epithelial cancer ovarian germ cell tumor, ovarian primary peritoneal carcinoma, ovarian sex cord stromal tumor, Paget's disease, pancreatic cancer, papillary carcinoma, paranasal sinus cancer, parathyroid cancer, pelvic cancer, penile cancer, peripheral nerve cancer, peritoneal cancer, pharyngeal cancer, pheochromocytoma, pilocytic
astrocytoma, pineal region tumor, pineoblastoma, pituitary gland cancer, primary central nervous system (CNS) lymphoma, prostate cancer, rectal cancer, renal cell carcinoma, renal pelvis cancer,
rhabdomyosarcoma, salivary gland cancer, soft tissue sarcoma, bone sarcoma, sarcoma, sinus cancer, skin cancer, small cell lung cancer (SCLC), small intestine cancer, spinal cancer, spinal column cancer, spinal cord cancer, squamous cell carcinoma, stomach cancer, synovial sarcoma, T-cell lymphoma, testicular cancer, throat cancer, thymoma/thymic carcinoma, thyroid cancer, tongue cancer, tonsil cancer, transitional cell cancer, tubal cancer, tubular carcinoma, undiagnosed cancer, ureteral cancer, urethral cancer, uterine adenocarcinoma, uterine cancer, uterine sarcoma, vaginal cancer, vulvar cancer, T-cell lineage acute lymphoblastic leukemia (T-ALL), T-cell lineage lymphoblastic lymphoma (T-LL), peripheral T-cell lymphoma, Adult T-cell leukemia, Pre-B ALL, Pre-B lymphomas, large B-cell lymphoma, Burkitts lymphoma, B-cell ALL, Philadelphia chromosome positive ALL, Philadelphia chromosome positive CML, juvenile myelomonocytic leukemia (JMML), acute promyelocytic leukemia (a subtype of AML), large granular lymphocytic leukemia, Adult T-cell chronic leukemia, diffuse large B cell lymphoma, follicular lymphoma; Mucosa-Associated Lymphatic Tissue lymphoma (MALT), small cell lymphocytic lymphoma, mediastinal large B cell lymphoma, nodal marginal zone B cell lymphoma (NMZL); splenic marginal zone lymphoma (SMZL); intravascular large B-cell lymphoma; primary effusion lymphoma; or lymphomatoid granulomatosis;; B-cell prolymphocytic leukemia; splenic lymphoma/leukemia, unclassifiable, splenic diffuse red pulp small B-cell lymphoma; lymphoplasmacytic lymphoma; heavy chain diseases, for example, Alpha heavy chain disease, Gamma heavy chain disease, Mu heavy chain disease, plasma cell myeloma, solitary plasmacytoma of bone; extraosseous plasmacytoma; primary cutaneous follicle center lymphoma, T cell/histocyte rich large B-cell lymphoma, DLBCL associated with chronic inflammation; Epstein-Barr virus (EBV)+ DLBCL of the elderly; primary mediastinal (thymic) large B-cell lymphoma, primary cutaneous DLBCL, leg type, ALK+ large B-cell lymphoma, plasmablastic lymphoma; large B-cell lymphoma arising in HHV8-associated multicentric, Castleman disease; B-cell lymphoma, unclassifiable, with features intermediate between diffuse large B-cell lymphoma, or B-cell lymphoma, unclassifiable, with features intermediate between diffuse large B-cell lymphoma and classical Hodgkin lymphoma.
In some embodiments, the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, colorectal cancer, a sarcoma (e.g., a soft tissue sarcoma, synovial sarcoma, Ewing’s sarcoma, osteosarcoma, rhabdomyosarcoma, adult fibrosarcoma, alveolar soft-part sarcoma, angiosarcoma, clear cell sarcoma, desmoplastic small round cell tumor, epithelioid sarcoma, fibromyxoid sarcoma, gastrointestinal stromal tumor, Kaposi sarcoma, liposarcoma, leiomyosarcoma, malignant mesenchymoma malignant peripheral nerve sheath tumors, myxofibrosarcoma, low-grade rhabdomyosarcoma), non-small cell lung cancer (e.g., squamous or adenocarcinoma), stomach cancer, or breast cancer. In some embodiments, the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, or colorectal cancer. In some embodiments, the cancer is a sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma), non-small cell lung cancer (e.g., squamous or adenocarcinoma), stomach cancer, or breast cancer. In some embodiments, the cancer is sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma). In some embodiments, the sarcoma is synovial sarcoma.
In some embodiments, the infection is viral infection (e.g., an infection with a virus of the
Retroviridae family such as the lentiviruses (e.g. Human immunodeficiency virus (HIV) and
deltaretroviruses (e.g., human T cell leukemia virus I (HTLV-I), human T cell leukemia virus II (HTLV-II)); Hepadnaviridae family (e.g. hepatitis B virus (HBV)); Flaviviridae family (e.g. hepatitis C virus (HCV)); Adenoviridae family (e.g. Human Adenovirus); Herpesviridae family (e.g. Human cytomegalovirus (HCMV), Epstein-Barr virus, herpes simplex virus 1 (HSV-1), herpes simplex virus 2 (HSV-2), human herpesvirus 6 (HHV-6), Herpesvitus K*, CMV, varicella-zoster virus); Papillomaviridae family (e.g. Human Papillomavirus (HPV, HPV E1)); Parvoviridae family (e.g. Parvovirus B19); Polyomaviridae family (e.g. JC virus and BK virus); Paramyxoviridae family (e.g. Measles virus); or Togaviridae family (e.g. Rubella virus)). In some embodiments, the disorder is Coffin Siris, Neurofibromatosis (e.g., NF-1, NF-2, or Schwannomatosis), or Multiple Meningioma.In an aspect, the disclosure features a method of treating a cancer in a subject in need thereof, the method including administering to the subject an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or any of the foregoing pharmaceutical compositions.
In some embodiments, the cancer is squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, hepatocellular carcinomas, and renal cell carcinomas, cancer of the bladder, bowel, breast, cervix, colon, esophagus, head, kidney, liver, lung, neck, ovary, pancreas, prostate, and stomach; leukemias; benign and malignant lymphomas, particularly Burkitt's lymphoma and Non-Hodgkin's lymphoma; benign and malignant melanomas; myeloproliferative diseases; sarcomas, including Ewing's sarcoma, hemangiosarcoma, Kaposi's sarcoma, liposarcoma, myosarcomas, peripheral
neuroepithelioma, synovial sarcoma, gliomas, astrocytomas, oligodendrogliomas, ependymomas, gliobastomas, neuroblastomas, ganglioneuromas, gangliogliomas, medulloblastomas, pineal cell tumors, meningiomas, meningeal sarcomas, neurofibromas, and Schwannomas; bowel cancer, breast cancer, prostate cancer, cervical cancer, uterine cancer, lung cancer, ovarian cancer, testicular cancer, thyroid cancer, astrocytoma, esophageal cancer, pancreatic cancer, stomach cancer, liver cancer, colon cancer, melanoma; carcinosarcoma, Hodgkin's disease, Wilms' tumor and teratocarcinomas. Additional cancers which may be treated using the disclosed compounds according to the present invention include, for example, acute granulocytic leukemia, acute lymphocytic leukemia (ALL), acute myelogenous leukemia (AML), adenocarcinoma, adenosarcoma, adrenal cancer, adrenocortical carcinoma, anal cancer, anaplastic astrocytoma, angiosarcoma, appendix cancer, astrocytoma, Basal cell carcinoma, B-Cell lymphoma, bile duct cancer, bladder cancer, bone cancer, bone marrow cancer, bowel cancer, brain cancer, brain stem glioma, breast cancer, triple (estrogen, progesterone and HER-2) negative breast cancer, double negative breast cancer (two of estrogen, progesterone and HER-2 are negative), single negative (one of estrogen, progesterone and HER-2 is negative), estrogen-receptor positive, HER2- negative breast cancer, estrogen receptor-negative breast cancer, estrogen receptor positive breast cancer, metastatic breast cancer, luminal A breast cancer, luminal B breast cancer, Her2-negative breast cancer, HER2-positive or negative breast cancer, progesterone receptor-negative breast cancer, progesterone receptor-positive breast cancer, recurrent breast cancer, carcinoid tumors, cervical cancer, cholangiocarcinoma, chondrosarcoma, chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), colon cancer, colorectal cancer, craniopharyngioma, cutaneous lymphoma, cutaneous melanoma, diffuse astrocytoma, ductal carcinoma in situ (DCIS), endometrial cancer, ependymoma, epithelioid sarcoma, esophageal cancer, ewing sarcoma, extrahepatic bile duct cancer, eye cancer, fallopian tube cancer, fibrosarcoma, gallbladder cancer, gastric cancer, gastrointestinal cancer, gastrointestinal carcinoid cancer, gastrointestinal stromal tumors (GIST), germ cell tumor glioblastoma multiforme (GBM), glioma, hairy cell leukemia, head and neck cancer, hemangioendothelioma, Hodgkin lymphoma, hypopharyngeal cancer, infiltrating ductal carcinoma (IDC), infiltrating lobular carcinoma (ILC), inflammatory breast cancer (IBC), intestinal Cancer, intrahepatic bile duct cancer, invasive/infiltrating breast cancer, Islet cell cancer, jaw cancer, Kaposi sarcoma, kidney cancer, laryngeal cancer, leiomyosarcoma, leptomeningeal metastases, leukemia, lip cancer, liposarcoma, liver cancer, lobular carcinoma in situ, low-grade astrocytoma, lung cancer, lymph node cancer, lymphoma, male breast cancer, medullary carcinoma, medulloblastoma, melanoma, meningioma, Merkel cell carcinoma, mesenchymal chondrosarcoma, mesenchymous, mesothelioma metastatic breast cancer, metastatic melanoma metastatic squamous neck cancer, mixed gliomas, monodermal teratoma, mouth cancer mucinous carcinoma, mucosal melanoma, multiple myeloma, Mycosis Fungoides, myelodysplastic syndrome, nasal cavity cancer, nasopharyngeal cancer, neck cancer, neuroblastoma, neuroendocrine tumors (NETs), non-Hodgkin's lymphoma, non-small cell lung cancer (NSCLC), oat cell cancer, ocular cancer, ocular melanoma, oligodendroglioma, oral cancer, oral cavity cancer, oropharyngeal cancer, osteogenic sarcoma, osteosarcoma, ovarian cancer, ovarian epithelial cancer ovarian germ cell tumor, ovarian primary peritoneal carcinoma, ovarian sex cord stromal tumor, Paget's disease, pancreatic cancer, papillary carcinoma, paranasal sinus cancer, parathyroid cancer, pelvic cancer, penile cancer, peripheral nerve cancer, peritoneal cancer, pharyngeal cancer, pheochromocytoma, pilocytic
astrocytoma, pineal region tumor, pineoblastoma, pituitary gland cancer, primary central nervous system (CNS) lymphoma, prostate cancer, rectal cancer, renal cell carcinoma, renal pelvis cancer,
rhabdomyosarcoma, salivary gland cancer, soft tissue sarcoma, bone sarcoma, sarcoma, sinus cancer, skin cancer, small cell lung cancer (SCLC), small intestine cancer, spinal cancer, spinal column cancer, spinal cord cancer, squamous cell carcinoma, stomach cancer, synovial sarcoma, T-cell lymphoma, testicular cancer, throat cancer, thymoma/thymic carcinoma, thyroid cancer, tongue cancer, tonsil cancer, transitional cell cancer, tubal cancer, tubular carcinoma, undiagnosed cancer, ureteral cancer, urethral cancer, uterine adenocarcinoma, uterine cancer, uterine sarcoma, vaginal cancer, vulvar cancer, T-cell lineage acute lymphoblastic leukemia (T-ALL), T-cell lineage lymphoblastic lymphoma (T-LL), peripheral T-cell lymphoma, Adult T-cell leukemia, Pre-B ALL, Pre-B lymphomas, large B-cell lymphoma, Burkitts lymphoma, B-cell ALL, Philadelphia chromosome positive ALL, Philadelphia chromosome positive CML, juvenile myelomonocytic leukemia (JMML), acute promyelocytic leukemia (a subtype of AML), large granular lymphocytic leukemia, Adult T-cell chronic leukemia, diffuse large B cell lymphoma, follicular lymphoma; Mucosa-Associated Lymphatic Tissue lymphoma (MALT), small cell lymphocytic lymphoma, mediastinal large B cell lymphoma, nodal marginal zone B cell lymphoma (NMZL); splenic marginal zone lymphoma (SMZL); intravascular large B-cell lymphoma; primary effusion lymphoma; or lymphomatoid granulomatosis;; B-cell prolymphocytic leukemia; splenic lymphoma/leukemia, unclassifiable, splenic diffuse red pulp small B-cell lymphoma; lymphoplasmacytic lymphoma; heavy chain diseases, for example, Alpha heavy chain disease, Gamma heavy chain disease, Mu heavy chain disease, plasma cell myeloma, solitary plasmacytoma of bone; extraosseous plasmacytoma; primary cutaneous follicle center lymphoma, T cell/histocyte rich large B-cell lymphoma, DLBCL associated with chronic inflammation; Epstein-Barr virus (EBV)+ DLBCL of the elderly; primary mediastinal (thymic) large B-cell lymphoma, primary cutaneous DLBCL, leg type, ALK+ large B-cell lymphoma, plasmablastic lymphoma; large B-cell lymphoma arising in HHV8-associated multicentric, Castleman disease; B-cell lymphoma, unclassifiable, with features intermediate between diffuse large B-cell lymphoma, or B-cell lymphoma, unclassifiable, with features intermediate between diffuse large B-cell lymphoma and classical Hodgkin lymphoma. In some embodiments, the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, colorectal cancer, a sarcoma (e.g., a soft tissue sarcoma, synovial sarcoma, Ewing’s sarcoma, osteosarcoma, rhabdomyosarcoma, adult fibrosarcoma, alveolar soft-part sarcoma, angiosarcoma, clear cell sarcoma, desmoplastic small round cell tumor, epithelioid sarcoma, fibromyxoid sarcoma, gastrointestinal stromal tumor, Kaposi sarcoma, liposarcoma, leiomyosarcoma, malignant mesenchymoma malignant peripheral nerve sheath tumors, myxofibrosarcoma, low-grade rhabdomyosarcoma), non-small cell lung cancer (e.g., squamous or adenocarcinoma), stomach cancer, or breast cancer. In some embodiments, the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, or colorectal cancer. In some embodiments, the cancer is a sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma), non-small cell lung cancer (e.g., squamous or adenocarcinoma), stomach cancer, or breast cancer. In some embodiments, the cancer is sarcoma (e.g., synovial sarcoma or Ewing’s sarcoma). In some embodiments, the sarcoma is synovial sarcoma.
In another aspect, the disclosure features a method for treating a viral infection in a subject in need thereof. This method includes administering to the subject an effective amount of any of the foregoing compounds, or pharmaceutically acceptable salts thereof, or any of the foregoing
pharmaceutical compositions. In some embodiments, the viral infection is an infection with a virus of the Retroviridae family such as the lentiviruses (e.g. Human immunodeficiency virus (HIV) and
deltaretroviruses (e.g., human T cell leukemia virus I (HTLV-I), human T cell leukemia virus II (HTLV-II)); Hepadnaviridae family (e.g. hepatitis B virus (HBV)), Flaviviridae family (e.g. hepatitis C virus (HCV)), Adenoviridae family (e.g. Human Adenovirus), Herpesviridae family (e.g. Human cytomegalovirus (HCMV), , Epstein-Barr virus, herpes simplex virus 1 (HSV-1), herpes simplex virus 2 (HSV-2), human herpesvirus 6 (HHV-6), Herpesvitus K*, CMV, varicella-zoster virus), Papillomaviridae family (e.g. Human Papillomavirus (HPV, HPV E1)), Parvoviridae family (e.g. Parvovirus B19), Polyomaviridae family (e.g. JC virus and BK virus), Paramyxoviridae family (e.g. Measles virus), Togaviridae family (e.g. Rubella virus).
In another embodiment of any of the foregoing methods, the method further includes
administering to the subject an additional anticancer therapy (e.g., chemotherapeutic or cytotoxic agent or radiotherapy).
In particular embodiments, the additional anticancer therapy is: a chemotherapeutic or cytotoxic agent (e.g., doxorubicin or ifosfamide), a differentiation-inducing agent (e.g., retinoic acid, vitamin D, cytokines), a hormonal agent, an immunological agent, or an anti-angiogenic agent. Chemotherapeutic and cytotoxic agents include, but are not limited to, alkylating agents, cytotoxic antibiotics,
antimetabolites, vinca alkaloids, etoposides, and others (e.g., paclitaxel, taxol, docetaxel, taxotere, cis-platinum). A list of additional compounds having anticancer activity can be found in L. Brunton, B. Chabner and B. Knollman (eds). Goodman and Gilman’s The Pharmacological Basis of Therapeutics, Twelfth Edition, 2011, McGraw Hill Companies, New York, NY.
In particular embodiments, the compound of the invention and the additional anticancer therapy and any of the foregoing compounds or pharmaceutical compositions are administered within 28 days of each other (e.g., within 21, 14, 10, 7, 5, 4, 3, 2, or 1 days) or within 24 hours (e.g., 12, 6, 3, 2, or 1 hours; or concomitantly) each in an amount that together are effective to treat the subject. Chemical Terms
The terminology employed herein is for the purpose of describing particular embodiments and is not intended to be limiting.
For any of the following chemical definitions, a number following an atomic symbol indicates that total number of atoms of that element that are present in a particular chemical moiety. As will be understood, other atoms, such as hydrogen atoms, or substituent groups, as described herein, may be present, as necessary, to satisfy the valences of the atoms. For example, an unsubstituted C2 alkyl group has the formula–CH2CH3. When used with the groups defined herein, a reference to the number of carbon atoms includes the divalent carbon in acetal and ketal groups but does not include the carbonyl carbon in acyl, ester, carbonate, or carbamate groups. A reference to the number of oxygen, nitrogen, or sulfur atoms in a heteroaryl group only includes those atoms that form a part of a heterocyclic ring.
Herein a phrase of the form“optionally substituted X” (e.g., optionally substituted alkyl) is intended to be equivalent to“X, wherein X is optionally substituted” (e.g.,“alkyl, wherein said alkyl is optionally substituted”). It is not intended to mean that the feature“X” (e.g., alkyl) per se is optional. As described herein, certain compounds of interest may contain one or more“optionally substituted” moieties. In general, the term“substituted”, whether preceded by the term“optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent, e.g., any of the substituents or groups described herein. Unless otherwise indicated, an“optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position. Combinations of substituents envisioned by the present disclosure are preferably those that result in the formation of stable or chemically feasible compounds. The term“stable”, as used herein, refers to compounds that are not substantially altered when subjected to conditions to allow for their production, detection, and, in certain embodiments, their recovery, purification, and use for one or more of the purposes disclosed herein.
The term“aliphatic,” as used herein, refers to a saturated or unsaturated, straight, branched, or cyclic hydrocarbon.“Aliphatic” is intended herein to include, but is not limited to, alkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, and cycloalkynyl moieties, and thus incorporates each of these definitions. In one embodiment,“aliphatic” is used to indicate those aliphatic groups having 1-20 carbon atoms. The aliphatic chain can be, for example, mono-unsaturated, di-unsaturated, tri-unsaturated, or
polyunsaturated, or alkynyl. Unsaturated aliphatic groups can be in a cis or trans configuration. In one embodiment, the aliphatic group contains from 1 to about 12 carbon atoms, more generally from 1 to about 6 carbon atoms or from 1 to about 4 carbon atoms. In one embodiment, the aliphatic group contains from 1 to about 8 carbon atoms. In certain embodiments, the aliphatic group is C1-C2, C1-C3, C1- C4, C1-C5, or C1-C6. The specified ranges as used herein indicate an aliphatic group having each member of the range described as an independent species. For example, the term C1-C6 aliphatic as used herein indicates a straight or branched alkyl, alkenyl, or alkynyl group having from 1, 2, 3, 4, 5, or 6 carbon atoms and is intended to mean that each of these is described as an independent species. For example, the term C1-C4 aliphatic as used herein indicates a straight or branched alkyl, alkenyl, or alkynyl group having from 1, 2, 3, or 4 carbon atoms and is intended to mean that each of these is described as an independent species. In one embodiment, the aliphatic group is substituted with one or more functional groups that results in the formation of a stable moiety.
The term“heteroaliphatic,” as used herein, refers to an aliphatic moiety that contains at least one heteroatom in the chain, for example, an amine, carbonyl, carboxy, oxo, thio, phosphate, phosphonate, nitrogen, phosphorus, silicon, or boron atoms in place of a carbon atom. In one embodiment, the only heteroatom is nitrogen. In one embodiment, the only heteroatom is oxygen. In one embodiment, the only heteroatom is sulfur.“Heteroaliphatic” is intended herein to include, but is not limited to, heteroalkyl, heteroalkenyl, heteroalkynyl, heterocycloalkyl, heterocycloalkenyl, and heterocycloalkynyl moieties. In one embodiment,“heteroaliphatic” is used to indicate a heteroaliphatic group (cyclic, acyclic, substituted, unsubstituted, branched or unbranched) having 1-20 carbon atoms. In one embodiment, the
heteroaliphatic group is optionally substituted in a manner that results in the formation of a stable moiety. Nonlimiting examples of heteroaliphatic moieties are polyethylene glycol, polyalkylene glycol, amide, polyamide, polylactide, polyglycolide, thioether, ether, alkyl-heterocycle-alkyl,—O-alkyl-O-alkyl, and alkyl- O-haloalkyl.
The term“acyl,” as used herein, represents a hydrogen or an alkyl group that is attached to a parent molecular group through a carbonyl group, as defined herein, and is exemplified by formyl (i.e., a carboxyaldehyde group), acetyl, trifluoroacetyl, propionyl, and butanoyl. Exemplary unsubstituted acyl groups include from 1 to 6, from 1 to 11, or from 1 to 21 carbons.
The term“alkyl,” as used herein, refers to a branched or straight-chain monovalent saturated aliphatic hydrocarbon radical of 1 to 20 carbon atoms (e.g., 1 to 16 carbon atoms, 1 to 10 carbon atoms, 1 to 6 carbon atoms, or 1 to 3 carbon atoms). An“alkylene” is a divalent alkyl group.
The term“alkenyl,” as used herein, alone or in combination with other groups, refers to a straight chain or branched hydrocarbon residue having a carbon-carbon double bond and having 2 to 20 carbon atoms (e.g., 2 to 16 carbon atoms, 2 to 10 carbon atoms, 2 to 6, or 2 carbon atoms). An“alkenylene” is a divalent alkenyl group.
The term“alkynyl,” as used herein, alone or in combination with other groups, refers to a straight chain or branched hydrocarbon residue having a carbon-carbon triple bond and having 2 to 20 carbon atoms (e.g., 2 to 16 carbon atoms, 2 to 10 carbon atoms, 2 to 6, or 2 carbon atoms). An“alkynylene” is a divalent alkynyl group.
The term“amino,” as used herein, represents–N(RN1)2, wherein each RN1 is, independently, H, OH, NO2, N(RN2)2, SO2ORN2, SO2RN2, SORN2, an N-protecting group, alkyl, alkoxy, aryl, arylalkyl, cycloalkyl, acyl (e.g., acetyl, trifluoroacetyl, or others described herein), wherein each of these recited RN1 groups can be optionally substituted; or two RN1 combine to form an alkylene or heteroalkylene, and wherein each RN2 is, independently, H, alkyl, or aryl. The amino groups of the compounds described herein can be an unsubstituted amino (i.e.,–NH2) or a substituted amino (i.e.,–N(RN1)2).
The term“aryl,” as used herein, refers to an aromatic mono- or polycarbocyclic radical of, e.g., 6 to 12, carbon atoms having at least one aromatic ring. Examples of such groups include, but are not limited to, phenyl, naphthyl, 1,2,3,4-tetrahydronaphthyl, 1,2-dihydronaphthyl, indanyl, and 1H-indenyl. The term“arylalkyl,” as used herein, represents an alkyl group substituted with an aryl group. Exemplary unsubstituted arylalkyl groups are from 7 to 30 carbons (e.g., from 7 to 16 or from 7 to 20 carbons, such as C1-C6 alkyl C6-C10 aryl, C1-C10 alkyl C6-C10 aryl, or C1-C20 alkyl C6-C10 aryl), such as, benzyl and phenethyl. In some embodiments, the alkyl and the aryl each can be further substituted with 1, 2, 3, or 4 substituent groups as defined herein for the respective groups.
The term“azido,” as used herein, represents a–N3 group.
The term“bridged cyclyl,” as used herein, refers to a bridged polycyclic group of 5 to 20 atoms, containing from 1 to 3 bridges. Bridged cyclyl includes bridged carbocyclyl (e.g., norbornyl) and bridged heterocyclyl (e.g., 1,4-diazabicyclo[2.2.2]octane).
The term“cyano,” as used herein, represents a–CN group.
The term“carbocyclyl,” as used herein, refers to a non-aromatic C3-C12, monocyclic or polycyclic (e.g., bicyclic or tricyclic) structure in which the rings are formed by carbon atoms. Carbocyclyl structures include cycloalkyl groups (e.g., cyclohexyl) and unsaturated carbocyclyl radicals (e.g., cyclohexenyl). Polycyclic carbocyclyl includes spirocyclic carbocyclyl, bridged carbocyclyl, and fused carbocyclyl. A “carbocyclylene” is a divalent carbocyclyl group.
The term“cycloalkyl,” as used herein, refers to a saturated, non-aromatic, monovalent mono- or polycarbocyclic radical of 3 to 10, preferably 3 to 6 carbon atoms. This term is further exemplified by radicals such as cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, norbornyl, and adamantyl.
The terms“halo” or“halogen,” as used herein, mean a fluorine (fluoro), chlorine (chloro), bromine (bromo), or iodine (iodo) radical.
The term“heteroalkyl,” as used herein, refers to an alkyl group, as defined herein, in which one or more of the constituent carbon atoms have been replaced by nitrogen, oxygen, or sulfur. In some embodiments, the heteroalkyl group can be further substituted with 1, 2, 3, or 4 substituent groups as described herein for alkyl groups. Examples of heteroalkyl groups are an“alkoxy” which, as used herein, refers to alkyl–O– (e.g., methoxy and ethoxy), and an“alkylamino” which, as used herein, refers to –N(alkyl)RNa, where RNa is H or alkyl (e.g., methylamino). A“heteroalkylene” is a divalent heteroalkyl group.
The term“heteroalkenyl,” as used herein, refers to an alkenyl group, as defined herein, in which one or more of the constituent carbon atoms have been replaced by nitrogen, oxygen, or sulfur. In some embodiments, the heteroalkenyl group can be further substituted with 1, 2, 3, or 4 substituent groups as described herein for alkenyl groups. Examples of heteroalkenyl groups are an“alkenoxy” which, as used herein, refers to alkenyl–O–. A“heteroalkenylene” is a divalent heteroalkenyl group.
The term“heteroalkynyl,” as used herein, refers to an alkynyl group, as defined herein, in which one or more of the constituent carbon atoms have been replaced by nitrogen, oxygen, or sulfur. In some embodiments, the heteroalkynyl group can be further substituted with 1, 2, 3, or 4 substituent groups as described herein for alkynyl groups. Examples of heteroalkynyl groups are an“alkynoxy” which, as used herein, refers to alkynyl–O–. A“heteroalkynylene” is a divalent heteroalkynyl group.
The term“heteroaryl,” as used herein, refers to an aromatic monocyclic or polycyclic structure of 5 to 12 atoms having at least one aromatic ring containing 1, 2, or 3 ring atoms selected from nitrogen, oxygen, and sulfur, with the remaining ring atoms being carbon. One or two ring carbon atoms of the heteroaryl group may be replaced with a carbonyl group. Examples of heteroaryl groups are pyridyl, pyrazoyl, benzooxazolyl, benzoimidazolyl, benzothiazolyl, imidazolyl, oxaxolyl, and thiazolyl. A “heteroarylene” is a divalent heteroaryl group.
The term“heteroarylalkyl,” as used herein, represents an alkyl group substituted with a heteroaryl group. Exemplary unsubstituted heteroarylalkyl groups are from 7 to 30 carbons (e.g., from 7 to 16 or from 7 to 20 carbons, such as C1-C6 alkyl C2-C9 heteroaryl, C1-C10 alkyl C2-C9 heteroaryl, or C1-C20 alkyl C2-C9 heteroaryl). In some embodiments, the alkyl and the heteroaryl each can be further substituted with 1, 2, 3, or 4 substituent groups as defined herein for the respective groups.
The term“heterocyclyl,” as used herein, refers a monocyclic or polycyclic radical (e.g., bicyclic or tricyclic) having 3 to 12 atoms having at least one non-aromatic ring containing 1, 2, 3, or 4 ring atoms selected from N, O, or S, and no aromatic ring containing any N, O, or S atoms. Polycyclic heterocyclyl includes spirocyclic heterocyclyl, bridged heterocyclyl, and fused heterocyclyl. Examples of heterocyclyl groups include, but are not limited to, morpholinyl, thiomorpholinyl, furyl, piperazinyl, piperidinyl, pyranyl, pyrrolidinyl, tetrahydropyranyl, tetrahydrofuranyl, and 1,3-dioxanyl. A“heterocyclylene” is a divalent heterocyclyl group.
The term“heterocyclylalkyl,” as used herein, represents an alkyl group substituted with a heterocyclyl group. Exemplary unsubstituted heterocyclylalkyl groups are from 7 to 30 carbons (e.g., from 7 to 16 or from 7 to 20 carbons, such as C1-C6 alkyl C2-C9 heterocyclyl, C1-C10 alkyl C2-C9 heterocyclyl, or C1-C20 alkyl C2-C9 heterocyclyl). In some embodiments, the alkyl and the heterocyclyl each can be further substituted with 1, 2, 3, or 4 substituent groups as defined herein for the respective groups.
The term“hydroxyalkyl,” as used herein, represents alkyl group substituted with an–OH group. The term“hydroxyl,” as used herein, represents an–OH group.
The term“imine,” as used herein, represents =NRN group, where RN is, e.g., H or alkyl.
The term“N-protecting group,” as used herein, represents those groups intended to protect an amino group against undesirable reactions during synthetic procedures. Commonly used N-protecting groups are disclosed in Greene,“Protective Groups in Organic Synthesis,” 3rd Edition (John Wiley & Sons, New York, 1999). N-protecting groups include, but are not limited to, acyl, aryloyl, or carbamyl groups such as formyl, acetyl, propionyl, pivaloyl, t-butylacetyl, 2-chloroacetyl, 2-bromoacetyl, trifluoroacetyl, trichloroacetyl, phthalyl, o-nitrophenoxyacetyl, a-chlorobutyryl, benzoyl, 4-chlorobenzoyl, 4- bromobenzoyl, 4-nitrobenzoyl, and chiral auxiliaries such as protected or unprotected D, L, or D, L-amino acids such as alanine, leucine, and phenylalanine; sulfonyl-containing groups such as benzenesulfonyl, and p-toluenesulfonyl; carbamate forming groups such as benzyloxycarbonyl, p-chlorobenzyloxycarbonyl, p-methoxybenzyloxycarbonyl, p-nitrobenzyloxycarbonyl, 2-nitrobenzyloxycarbonyl, p- bromobenzyloxycarbonyl, 3,4-dimethoxybenzyloxycarbonyl, 3,5-dimethoxybenzyloxycarbonyl, 2,4- 20 dimethoxybenzyloxycarbonyl, 4-methoxybenzyloxycarbonyl, 2-nitro-4,5-dimethoxybenzyloxycarbonyl, 3,4,5-trimethoxybenzyloxycarbonyl, 1-(p-biphenylyl)-1-methylethoxycarbonyl, a,a-dimethyl-3,5- dimethoxybenzyloxycarbonyl, benzhydryloxy carbonyl, t-butyloxycarbonyl, diisopropylmethoxycarbonyl, isopropyloxycarbonyl, ethoxycarbonyl, methoxycarbonyl, allyloxycarbonyl, 2,2,2,-trichloroethoxycarbonyl, phenoxycarbonyl, 4-nitrophenoxy carbonyl, fluorenyl-9-methoxycarbonyl, cyclopentyloxycarbonyl, adamantyloxycarbonyl, cyclohexyloxycarbonyl, and phenylthiocarbonyl, arylalkyl groups such as benzyl, triphenylmethyl, and benzyloxymethyl, and silyl groups, such as trimethylsilyl. Preferred N-protecting groups are alloc, formyl, acetyl, benzoyl, pivaloyl, t-butylacetyl, alanyl, phenylsulfonyl, benzyl, t- butyloxycarbonyl (Boc), and benzyloxycarbonyl (Cbz).
The term“nitro,” as used herein, represents an–NO2 group.
The term“oxo,” as used herein, represents an =O group.
The term“thiol,” as used herein, represents an–SH group.
The alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl (e.g., cycloalkyl), aryl, heteroaryl, and heterocyclyl groups may be substituted or unsubstituted. When substituted, there will generally be 1 to 4 substituents present, unless otherwise specified. Substituents include, for example: alkyl (e.g., unsubstituted and substituted, where the substituents include any group described herein, e.g., aryl, halo, hydroxy), aryl (e.g., substituted and unsubstituted phenyl), carbocyclyl (e.g., substituted and unsubstituted cycloalkyl), halogen (e.g., fluoro), hydroxyl, heteroalkyl (e.g., substituted and unsubstituted methoxy, ethoxy, or thioalkoxy), heteroaryl, heterocyclyl, amino (e.g., NH2 or mono- or dialkyl amino), azido, cyano, nitro, oxo, sulfonyl, or thiol. Aryl, carbocyclyl (e.g., cycloalkyl), heteroaryl, and heterocyclyl groups may also be substituted with alkyl (unsubstituted and substituted such as arylalkyl (e.g., substituted and unsubstituted benzyl)).
Compounds described herein (e.g., compounds of the invention) can have one or more asymmetric carbon atoms and can exist in the form of optically pure enantiomers, mixtures of enantiomers such as, for example, racemates, optically pure diastereoisomers, mixtures of
diastereoisomers, diastereoisomeric racemates, or mixtures of diastereoisomeric racemates. The optically active forms can be obtained for example by resolution of the racemates, by asymmetric synthesis or asymmetric chromatography (chromatography with a chiral adsorbent or eluant). That is, certain of the disclosed compounds may exist in various stereoisomeric forms. Stereoisomers are compounds that differ only in their spatial arrangement. Enantiomers are pairs of stereoisomers whose mirror images are not superimposable, most commonly because they contain an asymmetrically substituted carbon atom that acts as a chiral center. "Enantiomer" means one of a pair of molecules that are mirror images of each other and are not superimposable. Diastereomers are stereoisomers that are not related as mirror images, most commonly because they contain two or more asymmetrically substituted carbon atoms and represent the configuration of substituents around one or more chiral carbon atoms. Enantiomers of a compound can be prepared, for example, by separating an enantiomer from a racemate using one or more well-known techniques and methods, such as, for example, chiral chromatography and separation methods based thereon. The appropriate technique and/or method for separating an enantiomer of a compound described herein from a racemic mixture can be readily determined by those of skill in the art. "Racemate" or "racemic mixture" means a compound containing two enantiomers, wherein such mixtures exhibit no optical activity; i.e., they do not rotate the plane of polarized light.“Geometric isomer" means isomers that differ in the orientation of substituent atoms in relationship to a carbon-carbon double bond, to a cycloalkyl ring, or to a bridged bicyclic system. Atoms (other than H) on each side of a carbon- carbon double bond may be in an E (substituents are on opposite sides of the carbon- carbon double bond) or Z (substituents are oriented on the same side) configuration. "R," "S," "S*," "R*," "E," "Z," "cis," and "trans," indicate configurations relative to the core molecule. Certain of the disclosed compounds may exist in atropisomeric forms. Atropisomers are stereoisomers resulting from hindered rotation about single bonds where the steric strain barrier to rotation is high enough to allow for the isolation of the conformers. The compounds described herein (e.g., the compounds of the invention) may be prepared as individual isomers by either isomer-specific synthesis or resolved from an isomeric mixture. Conventional resolution techniques include forming the salt of a free base of each isomer of an isomeric pair using an optically active acid (followed by fractional crystallization and regeneration of the free base), forming the salt of the acid form of each isomer of an isomeric pair using an optically active amine (followed by fractional crystallization and regeneration of the free acid), forming an ester or amide of each of the isomers of an isomeric pair using an optically pure acid, amine or alcohol (followed by chromatographic separation and removal of the chiral auxiliary), or resolving an isomeric mixture of either a starting material or a final product using various well known chromatographic methods. When the stereochemistry of a disclosed compound is named or depicted by structure, the named or depicted stereoisomer is at least 60%, 70%, 80%, 90%, 99%, or 99.9% by weight relative to the other stereoisomers. When a single enantiomer is named or depicted by structure, the depicted or named enantiomer is at least 60%, 70%, 80%, 90%, 99%, or 99.9% by weight optically pure. When a single diastereomer is named or depicted by structure, the depicted or named diastereomer is at least 60%, 70%, 80%, 90%, 99%, or 99.9% by weight pure. Percent optical purity is the ratio of the weight of the enantiomer or over the weight of the enantiomer plus the weight of its optical isomer.
Diastereomeric purity by weight is the ratio of the weight of one diastereomer or over the weight of all the diastereomers. When the stereochemistry of a disclosed compound is named or depicted by structure, the named or depicted stereoisomer is at least 60%, 70%, 80%, 90%, 99%, or 99.9% by mole fraction pure relative to the other stereoisomers. When a single enantiomer is named or depicted by structure, the depicted or named enantiomer is at least 60%, 70%, 80%, 90%, 99%, or 99.9% by mole fraction pure. When a single diastereomer is named or depicted by structure, the depicted or named diastereomer is at least 60%, 70%, 80%, 90%, 99%, or 99.9% by mole fraction pure. Percent purity by mole fraction is the ratio of the moles of the enantiomer or over the moles of the enantiomer plus the moles of its optical isomer. Similarly, percent purity by moles fraction is the ratio of the moles of the diastereomer or over the moles of the diastereomer plus the moles of its isomer. When a disclosed compound is named or depicted by structure without indicating the stereochemistry, and the compound has at least one chiral center, it is to be understood that the name or structure encompasses either enantiomer of the compound free from the corresponding optical isomer, a racemic mixture of the compound, or mixtures enriched in one enantiomer relative to its corresponding optical isomer. When a disclosed compound is named or depicted by structure without indicating the stereochemistry and has two or more chiral centers, it is to be understood that the name or structure encompasses a diastereomer free of other diastereomers, a number of diastereomers free from other diastereomeric pairs, mixtures of diastereomers, mixtures of diastereomeric pairs, mixtures of diastereomers in which one diastereomer is enriched relative to the other diastereomer(s), or mixtures of diastereomers in which one or more diastereomer is enriched relative to the other diastereomers. The invention embraces all of these forms.
Compounds of the present disclosure also include all of the isotopes of the atoms occurring in the intermediate or final compounds.“Isotopes” refers to atoms having the same atomic number but different mass numbers resulting from a different number of neutrons in the nuclei. For example, isotopes of hydrogen include tritium and deuterium. Unless otherwise stated, structures depicted herein are also meant to include compounds that differ only in the presence of one or more isotopically enriched atoms. Exemplary isotopes that can be incorporated into compounds of the present invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, fluorine, chlorine, and iodine, such as 2H, 3H, 11C, 13C, 14C, 13N, 15N, 15O, 17O, 18O, 32P, 33P, 35S, 18F, 36Cl, 123I and 125I. Isotopically-labeled compounds (e.g., those labeled with 3H and 14C) can be useful in compound or substrate tissue distribution assays. Tritiated (i.e., 3H) and carbon-14 (i.e., 14C) isotopes can be useful for their ease of preparation and detectability. Further, substitution with heavier isotopes such as deuterium (i.e., 2H) may afford certain therapeutic advantages resulting from greater metabolic stability (e.g., increased in vivo half-life or reduced dosage requirements). In some embodiments, one or more hydrogen atoms are replaced by 2H or 3H, or one or more carbon atoms are replaced by 13C- or 14C-enriched carbon. Positron emitting isotopes such as 15O, 13N, 11C, and 18F are useful for positron emission tomography (PET) studies to examine substrate receptor occupancy.
Preparations of isotopically labelled compounds are known to those of skill in the art. For example, isotopically labeled compounds can generally be prepared by following procedures analogous to those disclosed for compounds of the present invention described herein, by substituting an isotopically labeled reagent for a non-isotopically labeled reagent.
As is known in the art, many chemical entities can adopt a variety of different solid forms such as, for example, amorphous forms or crystalline forms (e.g., polymorphs, hydrates, solvate). In some embodiments, compounds of the present invention may be utilized in any such form, including in any solid form. In some embodiments, compounds described or depicted herein may be provided or utilized in hydrate or solvate form.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Methods and materials are described herein for use in the present disclosure; other, suitable methods and materials known in the art can also be used. The materials, methods, and examples are illustrative only and not intended to be limiting. All publications, patent applications, patents, sequences, database entries, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. Definitions
In this application, unless otherwise clear from context, (i) the term“a” may be understood to mean“at least one”; (ii) the term“or” may be understood to mean“and/or”; and (iii) the terms“including” and“including” may be understood to encompass itemized components or steps whether presented by themselves or together with one or more additional components or steps.
As used herein, the terms“about” and“approximately” refer to a value that is within 10% above or below the value being described. For example, the term“about 5 nM” indicates a range of from 4.5 to 5.5 nM.
As used herein, the term“administration” refers to the administration of a composition (e.g., a compound or a preparation that includes a compound as described herein) to a subject or system.
Administration to an animal subject (e.g., to a human) may be by any appropriate route. For example, in some embodiments, administration may be bronchial (including by bronchial instillation), buccal, enteral, interdermal, intra-arterial, intradermal, intragastric, intramedullary, intramuscular, intranasal, intraperitoneal, intrathecal, intratumoral, intravenous, intraventricular, mucosal, nasal, oral, rectal, subcutaneous, sublingual, topical, tracheal (including by intratracheal instillation), transdermal, vaginal, and vitreal.
As used herein, the term“adult soft tissue sarcoma” refers to a sarcoma that develops in the soft tissues of the body, typically in adolescent and adult subjects (e.g., subjects who are at least 10 years old, 11 years old, 12 years old, 13 years old, 14 years old, 15 years old, 16 years old, 17 years old, 18 years old, or 19 years old). Non-limiting examples of adult soft tissue sarcoma include, but are not limited to, synovial sarcoma, fibrosarcoma, malignant fibrous histiocytoma, dermatofibrosarcoma, liposarcoma, leiomyosarcoma, hemangiosarcoma, Kaposi’s sarcoma, lymphangiosarcoma, malignant peripheral nerve sheath tumor/neurofibrosarcoma, extraskeletal chondrosarcoma, extraskeletal osteosarcoma, extraskeletal myxoid chondrosarcoma, and extraskeletal mesenchymal.
The term“antisense,” as used herein, refers to a nucleic acid comprising a polynucleotide that is sufficiently complementary to all or a portion of a gene, primary transcript, or processed mRNA, so as to interfere with expression of the endogenous gene (e.g., BRD9).“Complementary” polynucleotides are those that are capable of base pairing according to the standard Watson-Crick complementarity rules. Specifically, purines will base pair with pyrimidines to form a combination of guanine paired with cytosine (G:C) and adenine paired with either thymine (A:T) in the case of DNA, or adenine paired with uracil (A:U) in the case of RNA. It is understood that two polynucleotides may hybridize to each other even if they are not completely complementary to each other, provided that each has at least one region that is substantially complementary to the other.
The term“antisense nucleic acid” includes single-stranded RNA as well as double-stranded DNA expression cassettes that can be transcribed to produce an antisense RNA.“Active” antisense nucleic acids are antisense RNA molecules that are capable of selectively hybridizing with a primary transcript or mRNA encoding a polypeptide having at least 80% sequence identity (e.g., 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.9% identity, or more) with the targeted polypeptide sequence (e.g., a BRD9 polypeptide sequence). The antisense nucleic acid can be complementary to an entire coding strand, or to only a portion thereof. In some embodiments, an antisense nucleic acid molecule is antisense to a“coding region” of the coding strand of a nucleotide sequence. The term“coding region” refers to the region of the nucleotide sequence comprising codons that are translated into amino acid residues. In some embodiments, the antisense nucleic acid molecule is antisense to a“noncoding region” of the coding strand of a nucleotide sequence. The term“noncoding region” refers to 5ʹ and 3ʹ sequences that flank the coding region that are not translated into amino acids (i.e., also referred to as 5ʹ and 3ʹ untranslated regions). The antisense nucleic acid molecule can be complementary to the entire coding region of mRNA, or can be antisense to only a portion of the coding or noncoding region of an mRNA. For example, the antisense oligonucleotide can be complementary to the region surrounding the translation start site. An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 nucleotides in length.
As used herein, the term“BAF complex” refers to the BRG1- or HRBM-associated factors complex in a human cell. As used herein, the term“BAF complex-related disorder” refers to a disorder that is caused or affected by the level and/or activity of a BAF complex.
As used herein, the terms“GBAF complex” and“GBAF” refer to a SWI/SNF ATPase chromatin remodeling complex in a human cell. GBAF complex subunits may include, but are not limited to, ACTB, ACTL6A, ACTL6B, BICRA, BICRAL, BRD9, SMARCA2, SMARCA4, SMARCC1, SMARCD1, SMARCD2, SMARCD3, and SS18.The term“cancer” refers to a condition caused by the proliferation of malignant neoplastic cells, such as tumors, neoplasms, carcinomas, sarcomas, leukemias, and lymphomas.
As used herein, the term“BRD9” refers to bromodomain-containing protein 9, a component of the BAF (BRG1- or BRM-associated factors) complex, a SWI/SNF ATPase chromatin remodeling complex, and belongs to family IV of the bromodomain-containing proteins. BRD9 is encoded by the BRD9 gene, the nucleic acid sequence of which is set forth in SEQ ID NO: 1. The term“BRD9” also refers to natural variants of the wild-type BRD9 protein, such as proteins having at least 85% identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.9% identity, or more) to the amino acid sequence of wild-type BRD9, which is set forth in SEQ ID NO: 2.
As used herein, the term“BRD9-related disorder” refers to a disorder that is caused or affected by the level and/or activity of BRD9.The term“cancer” refers to a condition caused by the proliferation of malignant neoplastic cells, such as tumors, neoplasms, carcinomas, sarcomas, leukemias, and lymphomas.
As used herein, a“combination therapy” or“administered in combination” means that two (or more) different agents or treatments are administered to a subject as part of a defined treatment regimen for a particular disease or condition. The treatment regimen defines the doses and periodicity of administration of each agent such that the effects of the separate agents on the subject overlap. In some embodiments, the delivery of the two or more agents is simultaneous or concurrent and the agents may be co-formulated. In some embodiments, the two or more agents are not co-formulated and are administered in a sequential manner as part of a prescribed regimen. In some embodiments, administration of two or more agents or treatments in combination is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one agent or treatment delivered alone or in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive (e.g., synergistic). Sequential or substantially simultaneous administration of each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, intramuscular routes, and direct absorption through mucous membrane tissues. The therapeutic agents can be administered by the same route or by different routes. For example, a first therapeutic agent of the combination may be administered by intravenous injection while a second therapeutic agent of the combination may be administered orally.
A“compound of the present invention” and similar terms as used herein, whether explicitly noted or not, refers to compounds useful for treating BAF-related disorders (e.g., cancer or infection) described herein, including, e.g., compounds of Formula I or Formula II (e.g., compounds of Table 2A, Table 2B, and Table 2C), as well as salts (e.g., pharmaceutically acceptable salts), solvates, hydrates,
stereoisomers (including atropisomers), and tautomers thereof. Those skilled in the art will appreciate that certain compounds described herein can exist in one or more different isomeric (e.g., stereoisomers, geometric isomers, atropisomers, and tautomers) or isotopic (e.g., in which one or more atoms has been substituted with a different isotope of the atom, such as hydrogen substituted for deuterium) forms.
Unless otherwise indicated or clear from context, a depicted structure can be understood to represent any such isomeric or isotopic form, individually or in combination. Compounds described herein can be asymmetric (e.g., having one or more stereocenters). All stereoisomers, such as enantiomers and diastereomers, are intended unless otherwise indicated. Compounds of the present disclosure that contain asymmetrically substituted carbon atoms can be isolated in optically active or racemic forms. Methods on how to prepare optically active forms from optically active starting materials are known in the art, such as by resolution of racemic mixtures or by stereoselective synthesis. Many geometric isomers of olefins, C=N double bonds, and the like can also be present in the compounds described herein, and all such stable isomers are contemplated in the present disclosure. Cis and trans geometric isomers of the compounds of the present disclosure are described and may be isolated as a mixture of isomers or as separated isomeric forms. In some embodiments, one or more compounds depicted herein may exist in different tautomeric forms. As will be clear from context, unless explicitly excluded, references to such compounds encompass all such tautomeric forms. In some embodiments, tautomeric forms result from the swapping of a single bond with an adjacent double bond and the concomitant migration of a proton. In certain embodiments, a tautomeric form may be a prototropic tautomer, which is an isomeric protonation states having the same empirical formula and total charge as a reference form. Examples of moieties with prototropic tautomeric forms are ketone - enol pairs, amide - imidic acid pairs,
lactam - lactim pairs, amide - imidic acid pairs, enamine - imine pairs, and annular forms where a proton can occupy two or more positions of a heterocyclic system, such as, 1H- and 3H-imidazole, 1H-, 2H- and 4H-1,2,4-triazole, 1H- and 2H- isoindole, and 1H- and 2H-pyrazole. In some embodiments, tautomeric forms can be in equilibrium or sterically locked into one form by appropriate substitution. In certain embodiments, tautomeric forms result from acetal interconversion.
As used herein, the term“degrader” refers to a small molecule compound including a degradation moiety, wherein the compound interacts with a protein (e.g., BRD9) in a way which results in degradation of the protein, e.g., binding of the compound results in at least 5% reduction of the level of the protein, e.g., in a cell or subject.
As used herein, the term“degradation moiety” refers to a moiety whose binding results in degradation of a protein, e.g., BRD9. In one example, the moiety binds to a protease or a ubiquitin ligase that metabolizes the protein, e.g., BRD9.
By“determining the level of a protein” is meant the detection of a protein, or an mRNA encoding the protein, by methods known in the art either directly or indirectly.“Directly determining” means performing a process (e.g., performing an assay or test on a sample or“analyzing a sample” as that term is defined herein) to obtain the physical entity or value.“Indirectly determining” refers to receiving the physical entity or value from another party or source (e.g., a third-party laboratory that directly acquired the physical entity or value). Methods to measure protein level generally include, but are not limited to, western blotting, immunoblotting, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), immunoprecipitation, immunofluorescence, surface plasmon resonance, chemiluminescence, fluorescent polarization, phosphorescence, immunohistochemical analysis, matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry, liquid chromatography (LC)-mass spectrometry, microcytometry, microscopy, fluorescence activated cell sorting (FACS), and flow cytometry, as well as assays based on a property of a protein including, but not limited to, enzymatic activity or interaction with other protein partners. Methods to measure mRNA levels are known in the art.
As used herein, the terms“effective amount,”“therapeutically effective amount,” and“a“sufficient amount” of an agent that reduces the level and/or activity of BRD9 (e.g., in a cell or a subject) described herein refer to a quantity sufficient to, when administered to the subject, including a human, effect beneficial or desired results, including clinical results, and, as such, an“effective amount” or synonym thereto depends on the context in which it is being applied. For example, in the context of treating cancer, it is an amount of the agent that reduces the level and/or activity of BRD9 sufficient to achieve a treatment response as compared to the response obtained without administration of the agent that reduces the level and/or activity of BRD9. The amount of a given agent that reduces the level and/or activity of BRD9 described herein that will correspond to such an amount will vary depending upon various factors, such as the given agent, the pharmaceutical formulation, the route of administration, the type of disease or disorder, the identity of the subject (e.g., age, sex, and/or weight) or host being treated, and the like, but can nevertheless be routinely determined by one of skill in the art. Also, as used herein, a“therapeutically effective amount” of an agent that reduces the level and/or activity of BRD9 of the present disclosure is an amount which results in a beneficial or desired result in a subject as compared to a control. As defined herein, a therapeutically effective amount of an agent that reduces the level and/or activity of BRD9 of the present disclosure may be readily determined by one of ordinary skill by routine methods known in the art. Dosage regimen may be adjusted to provide the optimum therapeutic response.
As used herein, the term“inhibitor” refers to any agent which reduces the level and/or activity of a protein (e.g., BRD9). Non-limiting examples of inhibitors include small molecule inhibitors, degraders, antibodies, enzymes, or polynucleotides (e.g., siRNA).
The term“inhibitory RNA agent” refers to an RNA, or analog thereof, having sufficient sequence complementarity to a target RNA to direct RNA interference. Examples also include a DNA that can be used to make the RNA. RNA interference (RNAi) refers to a sequence-specific or selective process by which a target molecule (e.g., a target gene, protein, or RNA) is down-regulated. Generally, an interfering RNA (“iRNA”) is a double-stranded short-interfering RNA (siRNA), short hairpin RNA (shRNA), or single- stranded micro-RNA (miRNA) that results in catalytic degradation of specific mRNAs, and also can be used to lower or inhibit gene expression.
By“level” is meant a level of a protein, or mRNA encoding the protein, as compared to a reference. The reference can be any useful reference, as defined herein. By a“decreased level” or an “increased level” of a protein is meant a decrease or increase in protein level, as compared to a reference (e.g., a decrease or an increase by about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 100%, about 150%, about 200%, about 300%, about 400%, about 500%, or more; a decrease or an increase of more than about 10%, about 15%, about 20%, about 50%, about 75%, about 100%, or about 200%, as compared to a reference; a decrease or an increase by less than about 0.01-fold, about 0.02-fold, about 0.1-fold, about 0.3-fold, about 0.5-fold, about 0.8-fold, or less; or an increase by more than about 1.2-fold, about 1.4-fold, about 1.5-fold, about 1.8-fold, about 2.0-fold, about 3.0-fold, about 3.5-fold, about 4.5-fold, about 5.0-fold, about 10-fold, about 15-fold, about 20-fold, about 30-fold, about 40-fold, about 50-fold, about 100-fold, about 1000-fold, or more). A level of a protein may be expressed in mass/vol (e.g., g/dL, mg/mL, mg/mL, ng/mL) or percentage relative to total protein or mRNA in a sample.
The terms“miRNA” and“microRNA” refer to an RNA agent, preferably a single-stranded agent, of about 10-50 nucleotides in length, preferably between about 15-25 nucleotides in length, which is capable of directing or mediating RNA interference. Naturally-occurring miRNAs are generated from stem-loop precursor RNAs (i.e., pre-miRNAs) by Dicer. The term“Dicer” as used herein, includes Dicer as well as any Dicer ortholog or homolog capable of processing dsRNA structures into siRNAs, miRNAs, siRNA-like or miRNA-like molecules. The term microRNA (“miRNA”) is used interchangeably with the term“small temporal RNA” (“stRNA”) based on the fact that naturally-occurring miRNAs have been found to be expressed in a temporal fashion (e.g., during development).
By“modulating the activity of a BAF complex,” is meant altering the level of an activity related to a BAF complex (e.g., GBAF), or a related downstream effect. The activity level of a BAF complex may be measured using any method known in the art, e.g., the methods described in Kadoch et al, Cell 153:71- 85 (2013), the methods of which are herein incorporated by reference.
“Percent (%) sequence identity” with respect to a reference polynucleotide or polypeptide sequence is defined as the percentage of nucleic acids or amino acids in a candidate sequence that are identical to the nucleic acids or amino acids in the reference polynucleotide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent nucleic acid or amino acid sequence identity can be achieved in various ways that are within the capabilities of one of skill in the art, for example, using publicly available computer software such as BLAST, BLAST-2, or Megalign software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For example, percent sequence identity values may be generated using the sequence comparison computer program BLAST. As an illustration, the percent sequence identity of a given nucleic acid or amino acid sequence, A, to, with, or against a given nucleic acid or amino acid sequence, B, (which can alternatively be phrased as a given nucleic acid or amino acid sequence, A that has a certain percent sequence identity to, with, or against a given nucleic acid or amino acid sequence, B) is calculated as follows:
100 multiplied by (the fraction X/Y)
where X is the number of nucleotides or amino acids scored as identical matches by a sequence alignment program (e.g., BLAST) in that program’s alignment of A and B, and where Y is the total number of nucleic acids in B. It will be appreciated that where the length of nucleic acid or amino acid sequence A is not equal to the length of nucleic acid or amino acid sequence B, the percent sequence identity of A to B will not equal the percent sequence identity of B to A.
A“pharmaceutically acceptable excipient,” as used herein, refers any ingredient other than the compounds described herein (for example, a vehicle capable of suspending or dissolving the active compound) and having the properties of being substantially nontoxic and non-inflammatory in a patient. Excipients may include, for example: antiadherents, antioxidants, binders, coatings, compression aids, disintegrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspensing or dispersing agents, sweeteners, and waters of hydration. Exemplary excipients include, but are not limited to: butylated hydroxytoluene (BHT), calcium carbonate, calcium phosphate (dibasic), calcium stearate, croscarmellose, crosslinked polyvinyl pyrrolidone, citric acid, crospovidone, cysteine, ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl methylcellulose, lactose, magnesium stearate, maltitol, mannitol, methionine, methylcellulose, methyl paraben, microcrystalline cellulose, polyethylene glycol, polyvinyl pyrrolidone, povidone, pregelatinized starch, propyl paraben, retinyl palmitate, shellac, silicon dioxide, sodium carboxymethyl cellulose, sodium citrate, sodium starch glycolate, sorbitol, starch (corn), stearic acid, sucrose, talc, titanium dioxide, vitamin A, vitamin E, vitamin C, and xylitol.
As used herein, the term“pharmaceutically acceptable salt” means any pharmaceutically acceptable salt of the compound of any of the compounds described herein. For example,
pharmaceutically acceptable salts of any of the compounds described herein include those that are within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and animals without undue toxicity, irritation, allergic response and are commensurate with a reasonable benefit/risk ratio. Pharmaceutically acceptable salts are well known in the art. For example, pharmaceutically acceptable salts are described in: Berge et al., J. Pharmaceutical Sciences 66:1-19, 1977 and in
Pharmaceutical Salts: Properties, Selection, and Use, (Eds. P.H. Stahl and C.G. Wermuth), Wiley-VCH, 2008. The salts can be prepared in situ during the final isolation and purification of the compounds described herein or separately by reacting a free base group with a suitable organic acid.
The compounds described herein may have ionizable groups so as to be capable of preparation as pharmaceutically acceptable salts. These salts may be acid addition salts involving inorganic or organic acids or the salts may, in the case of acidic forms of the compounds described herein, be prepared from inorganic or organic bases. Frequently, the compounds are prepared or used as pharmaceutically acceptable salts prepared as addition products of pharmaceutically acceptable acids or bases. Suitable pharmaceutically acceptable acids and bases and methods for preparation of the appropriate salts are well-known in the art. Salts may be prepared from pharmaceutically acceptable non-toxic acids and bases including inorganic and organic acids and bases. Representative acid addition salts include acetate, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, fumarate, glucoheptonate, glycerophosphate, hemisulfate, heptonate, hexanoate, hydrobromide, hydrochloride, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, toluenesulfonate, undecanoate, and valerate salts. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, and magnesium, as well as nontoxic ammonium, quaternary ammonium, and amine cations, including, but not limited to ammonium, tetramethylammonium, tetraethylammonium, methylamine, dimethylamine, trimethylamine, triethylamine, and ethylamine.
The term“pharmaceutical composition,” as used herein, represents a composition containing a compound described herein formulated with a pharmaceutically acceptable excipient, and manufactured or sold with the approval of a governmental regulatory agency as part of a therapeutic regimen for the treatment of disease in a mammal. Pharmaceutical compositions can be formulated, for example, for oral administration in unit dosage form (e.g., a tablet, capsule, caplet, gelcap, or syrup); for topical administration (e.g., as a cream, gel, lotion, or ointment); for intravenous administration (e.g., as a sterile solution free of particulate emboli and in a solvent system suitable for intravenous use); or in any other pharmaceutically acceptable formulation.
By“reducing the activity of BRD9,” is meant decreasing the level of an activity related to an BRD9, or a related downstream effect. A non-limiting example of inhibition of an activity of BRD9 is decreasing the level of a BAF complex (e.g., GBAF) in a cell. The activity level of BRD9 may be measured using any method known in the art. In some embodiments, an agent which reduces the activity of BRD9 is a small molecule BRD9 inhibitor. In some embodiments, an agent which reduces the activity of BRD9 is a small molecule BRD9 degrader.
By“reducing the level of BRD9,” is meant decreasing the level of BRD9 in a cell or subject. The level of BRD9 may be measured using any method known in the art.
By a“reference” is meant any useful reference used to compare protein or mRNA levels. The reference can be any sample, standard, standard curve, or level that is used for comparison purposes. The reference can be a normal reference sample or a reference standard or level. A“reference sample” can be, for example, a control, e.g., a predetermined negative control value such as a“normal control” or a prior sample taken from the same subject; a sample from a normal healthy subject, such as a normal cell or normal tissue; a sample (e.g., a cell or tissue) from a subject not having a disease; a sample from a subject that is diagnosed with a disease, but not yet treated with a compound described herein; a sample from a subject that has been treated by a compound described herein; or a sample of a purified protein (e.g., any described herein) at a known normal concentration. By“reference standard or level” is meant a value or number derived from a reference sample. A“normal control value” is a pre-determined value indicative of non-disease state, e.g., a value expected in a healthy control subject. Typically, a normal control value is expressed as a range (“between X and Y”), a high threshold (“no higher than X”), or a low threshold (“no lower than X”). A subject having a measured value within the normal control value for a particular biomarker is typically referred to as“within normal limits” for that biomarker. A normal reference standard or level can be a value or number derived from a normal subject not having a disease or disorder (e.g., cancer); a subject that has been treated with a compound described herein. In preferred embodiments, the reference sample, standard, or level is matched to the sample subject sample by at least one of the following criteria: age, weight, sex, disease stage, and overall health. A standard curve of levels of a purified protein, e.g., any described herein, within the normal reference range can also be used as a reference.
The terms“short interfering RNA” and“siRNA” (also known as“small interfering RNAs”) refer to an RNA agent, preferably a double-stranded agent, of about 10-50 nucleotides in length, the strands optionally having overhanging ends comprising, for example 1, 2 or 3 overhanging nucleotides (or nucleotide analogs), which is capable of directing or mediating RNA interference. Naturally-occurring siRNAs are generated from longer dsRNA molecules (e.g., >25 nucleotides in length) by a cell's RNAi machinery (e.g., Dicer or a homolog thereof).
The term“shRNA”, as used herein, refers to an RNA agent having a stem-loop structure, comprising a first and second region of complementary sequence, the degree of complementarity and orientation of the regions being sufficient such that base pairing occurs between the regions, the first and second regions being joined by a loop region, the loop resulting from a lack of base pairing between nucleotides (or nucleotide analogs) within the loop region.
As used herein, the term“subject” refers to any organism to which a composition in accordance with the invention may be administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include any animal (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans). A subject may seek or be in need of treatment, require treatment, be receiving treatment, be receiving treatment in the future, or be a human or animal who is under care by a trained professional for a particular disease or condition.
As used herein, the term“SS18-SSX fusion protein-related disorder” refers to a disorder that is caused or affected by the level and/or activity of SS18-SSX fusion protein.
As used herein, the terms "treat," "treated," or "treating" mean both therapeutic treatment and prophylactic or preventative measures wherein the object is to prevent or slow down (lessen) an undesired physiological condition, disorder, or disease, or obtain beneficial or desired clinical results. Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms; diminishment of the extent of a condition, disorder, or disease; stabilized (i.e., not worsening) state of condition, disorder, or disease; delay in onset or slowing of condition, disorder, or disease progression; amelioration of the condition, disorder, or disease state or remission (whether partial or total), whether detectable or undetectable; an amelioration of at least one measurable physical parameter, not necessarily discernible by the patient; or enhancement or improvement of condition, disorder, or disease. Treatment includes eliciting a clinically significant response without excessive levels of side effects. Treatment also includes prolonging survival as compared to expected survival if not receiving treatment.
As used herein, the terms“variant” and“derivative” are used interchangeably and refer to naturally-occurring, synthetic, and semi-synthetic analogues of a compound, peptide, protein, or other substance described herein. A variant or derivative of a compound, peptide, protein, or other substance described herein may retain or improve upon the biological activity of the original material.
The details of one or more embodiments of the invention are set forth in the description below. Other features, objects, and advantages of the invention will be apparent from the description and from the claims. Brief Description of the Drawings
FIG.1 is a series of graphs illustrating the effect of specific guide RNA (sgRNA) targeting of the BRD9 BAF complex subunit on synovial sarcoma cell growth. The Y-axis indicated the dropout ratio. The X-axis indicates the nucleotide position of the BRD9 gene. The grey box indicates the range of the negative control sgRNAs in the screen. The SYO1 cell line carries SS18-SSX2 fusion protein. The breakpoint joining the N-terminal region of SS18 to the C-terminal region of SSX2 are indicated by the black lines in their respective panel. The linear protein sequence is show with BRD9 PFAM domains annotated from the PFAM database.
FIG.2 is an image illustrating dose dependent depletion of BRD9 levels in a synovial sarcoma cell line (SYO1) in the presence of a BRD9 degrader. FIG.3 is an image illustrating sustained suppression of BRD9 levels in a synovial sarcoma cell line (SYO1) in the presence of a BRD9 degrader over 72 hours.
FIG.4 is an image illustrating sustained suppression of BRD9 levels in two cell lines (293T and SYO1) in the presence of a BRD9 degrader over 5 days.
FIG.5 is an image illustrating sustained suppression of BRD9 levels in synovial sarcoma cell lines (SYO1 and Yamato) in the presence of a BRD9 degrader over 7 days compared to the levels in cells treated with CRISPR reagents.
FIG.6 is an image illustrating the effect on cell growth of six cell lines (SYO1, Yamato, A549, HS- SY-II, ASKA, and 293T) in the presence of a BRD9 degrader and a BRD9 inhibitor.
FIG.7 is an image illustrating the effect on cell growth of two cell lines (SYO1 and G401) in the presence of a BRD9 degrader.
FIG.8 is an image illustrating the effect on cell growth of three synovial sarcoma cell lines (SYO1, HS-SY-II, and ASKA) in the presence of a BRD9 degrader, BRD9 binder and E3 ligase binder.
FIG.9 is an image illustrating the effect on cell growth of three non-synovial sarcoma cell lines (RD, HCT116, and Calu6) in the presence of a BRD9 degrader, BRD9 binder and E3 ligase binder.
FIG.10 is a graph illustrating the percentage of SYO1 in various cell cycle phases following treatment with DMSO, Compound 1 at 200 nM, or Compound 1 at 1 mM for 8 or 13 days.
FIG.11 is a series of contour plots illustrating the percentage of SYO1 cells in various cell cycle phases following treatment with DMSO, Compound 1 at 200 nM, Compound 1 at 1 mM, or lenalidomide at 200nM for 8 days. Numerical values corresponding to each contour plot are found in the table below.
FIG.12 is a series of contour plots illustrating the percentage of SYO1 cells in various cell cycle phases following treatment with DMSO, Compound 1 at 200 nM, Compound 1 at 1 mM, or lenalidomide at 200nM for 13 days. Numerical values corresponding to each contour plot are found in the table below.
FIG.13 is a series of contour plots illustrating the percentage of early- and late-apoptotic SYO1 cells following treatment with DMSO, Compound 1 at 200 nM, Compound 1 at 1 mM, or lenalidomide at 200nM for 8 days. Numerical values corresponding to each contour plot are found in the table below.
FIG.14 is a graph illustrating the proteins present in BAF complexes including the SS18-SSX fusion protein. Detailed Description
The present disclosure features compositions and methods useful for the treatment of BAF- related disorders (e.g., cancer and infection). The disclosure further features compositions and methods useful for inhibition of the level and/or activity of BRD9, e.g., for the treatment of disorders such as cancer (e.g., sarcoma) and infection (e.g., viral infection), e.g., in a subject in need thereof. Compounds
Compounds described herein reduce the level of an activity related to BRD9, or a related downstream effect, or reduce the level of BRD9 in a cell or subject. Exemplary compounds described herein have the structure according to Formula I or Formula II. Formula I is:
Figure imgf000201_0001
Formula I,
where
R1 is H, optionally substituted C1-C6 alkyl, optionally substituted C2-C6 alkenyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C10 carbocyclyl;
Z1 is CR2 or N;
R2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl;
X1 is N or CH, and X2 is C-R7; or X1 is C-R7, and X2 is N or CH;
R7 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C1-C6 alkoxy, optionally substituted amino, optionally substituted sulfone, optionally substituted sulfonamide, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms;
X3 is N or CH;
X4 is N or CH;
G is optionally substituted C3-C10 carbocyclyl, C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl, or a pharmaceutically acceptable salt thereof.
Formula II is:
A-L-B
Formula II,
where
L is a linker;
B is a degradation moiety; and
A has the structure of Formula III:
Figure imgf000201_0002
Formula III,
where
R1 is H, optionally substituted C1-C6 alkyl, optionally substituted C2-C6 alkenyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C10 carbocyclyl;
Z1 is CR2 or N; R2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl;
X1 is N or CH, and X2 is C-R7ʹʹ; or X1 is C-R7ʹʹ, and X2 is N or CH;
R7'
N
R7ʹʹ is A1
, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C1-C6 alkoxy, optionally substituted amino, optionally substituted sulfone, optionally substituted sulfonamide, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms;
R7ʹ is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C10 carbocycylyl;
X3 is N or CH;
X4 is N or CH;
G'
Gʹʹ is A1
, optionally substituted C3-C10 carbocyclyl, C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl;
Gʹ is optionally substituted C3-C10 carbocyclylene, C2-C9 heterocyclylene, optionally substituted C6-C10 arylene, or optionally substituted C2-C9 heteroarylene; and
A1 is a bond between A and the linker,
R7'
G' N
1
where Gʹʹ is A1
or R 7 ʹʹ is A , or a pharmaceutically acceptable salt thereof.
In some embodiments, the compound has the structure of any one of compounds B1-B6 in Table 1, or a pharmaceutically acceptable salt thereof
In some embodiments, the compound has the structure of any one of compounds D1-D31 in Table 2A, or a pharmaceutically acceptable salt thereof. In some embodiments, the compound has the structure of any one of compounds D32-D184 in Table 2B, or a pharmaceutically acceptable salt thereof. In some embodiments, the compound has the structure of any one of compounds D185-D316 in Table 2C, or a pharmaceutically acceptable salt thereof.
Other embodiments, as well as exemplary methods for the synthesis of production of these compounds, are described herein. Pharmaceutical Uses
The compounds described herein are useful in the methods of the invention and, while not bound by theory, are believed to exert their desirable effects through their ability to modulate the level, status, and/or activity of a BAF complex, e.g., by inhibiting the activity or level of the BRD9 protein in a cell within the BAF complex in a mammal.
An aspect of the present invention relates to methods of treating disorders related to BRD9 such as cancer in a subject in need thereof. In some embodiments, the compound is administered in an amount and for a time effective to result in one of (or more, e.g., two or more, three or more, four or more of): (a) reduced tumor size, (b) reduced rate of tumor growth, (c) increased tumor cell death (d) reduced tumor progression, (e) reduced number of metastases, (f) reduced rate of metastasis, (g) decreased tumor recurrence (h) increased survival of subject, and (i) increased progression free survival of a subject.
Treating cancer can result in a reduction in size or volume of a tumor. For example, after treatment, tumor size is reduced by 5% or greater (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or greater) relative to its size prior to treatment. Size of a tumor may be measured by any reproducible means of measurement. For example, the size of a tumor may be measured as a diameter of the tumor.
Treating cancer may further result in a decrease in number of tumors. For example, after treatment, tumor number is reduced by 5% or greater (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or greater) relative to number prior to treatment. Number of tumors may be measured by any reproducible means of measurement, e.g., the number of tumors may be measured by counting tumors visible to the naked eye or at a specified magnification (e.g., 2x, 3x, 4x, 5x, 10x, or 50x).
Treating cancer can result in a decrease in number of metastatic nodules in other tissues or organs distant from the primary tumor site. For example, after treatment, the number of metastatic nodules is reduced by 5% or greater (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater) relative to number prior to treatment. The number of metastatic nodules may be measured by any reproducible means of measurement. For example, the number of metastatic nodules may be measured by counting metastatic nodules visible to the naked eye or at a specified magnification (e.g., 2x, 10x, or 50x).
Treating cancer can result in an increase in average survival time of a population of subjects treated according to the present invention in comparison to a population of untreated subjects. For example, the average survival time is increased by more than 30 days (more than 60 days, 90 days, or 120 days). An increase in average survival time of a population may be measured by any reproducible means. An increase in average survival time of a population may be measured, for example, by calculating for a population the average length of survival following initiation of treatment with the compound described herein. An increase in average survival time of a population may also be measured, for example, by calculating for a population the average length of survival following completion of a first round of treatment with a pharmaceutically acceptable salt of a compound described herein.
Treating cancer can also result in a decrease in the mortality rate of a population of treated subjects in comparison to an untreated population. For example, the mortality rate is decreased by more than 2% (e.g., more than 5%, 10%, or 25%). A decrease in the mortality rate of a population of treated subjects may be measured by any reproducible means, for example, by calculating for a population the average number of disease-related deaths per unit time following initiation of treatment with a
pharmaceutically acceptable salt of a compound described herein. A decrease in the mortality rate of a population may also be measured, for example, by calculating for a population the average number of disease-related deaths per unit time following completion of a first round of treatment with a
pharmaceutically acceptable salt of a compound described herein. Combination Therapies
A method of the invention can be used alone or in combination with an additional therapeutic agent, e.g., other agents that treat cancer or symptoms associated therewith, or in combination with other types of therapies to treat cancer. In combination treatments, the dosages of one or more of the therapeutic compounds may be reduced from standard dosages when administered alone. For example, doses may be determined empirically from drug combinations and permutations or may be deduced by isobolographic analysis (e.g., Black et al., Neurology 65:S3-S6 (2005)). In this case, dosages of the compounds when combined should provide a therapeutic effect.
In some embodiments, the second therapeutic agent is a chemotherapeutic agent (e.g., a cytotoxic agent or other chemical compound useful in the treatment of cancer). These include alkylating agents, antimetabolites, folic acid analogs, pyrimidine analogs, purine analogs and related inhibitors, vinca alkaloids, epipodopyyllotoxins, antibiotics, L-Asparaginase, topoisomerase inhibitors, interferons, platinum coordination complexes, anthracenedione substituted urea, methyl hydrazine derivatives, adrenocortical suppressant, adrenocorticosteroides, progestins, estrogens, antiestrogen, androgens, antiandrogen, and gonadotropin-releasing hormone analog. Also included is 5-fluorouracil (5-FU), leucovorin (LV), irenotecan, oxaliplatin, capecitabine, paclitaxel, and doxetaxel. Non-limiting examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine,
triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Agnew, Chem. Intl. Ed Engl.33:183-186 (1994)); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo- 5-oxo-L-norleucine, ADRIAMYCIN® (doxorubicin, including morpholino-doxorubicin, cyanomorpholino- doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5- FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil;
bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfomithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin;
phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products, Eugene, OR); razoxane; rhizoxin; sizofuran;
spirogermanium; tenuazonic acid; triaziquone; 2,2',2''-trichlorotriethylamine; trichothecenes (especially T- 2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine;
mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide; thiotepa; taxoids, e.g., TAXOL® (paclitaxel; Bristol-Myers Squibb Oncology, Princeton, NJ), ABRAXANE®, cremophor-free, albumin-engineered nanoparticle formulation of paclitaxel (American Pharmaceutical Partners, Schaumberg, IL), and TAXOTERE® doxetaxel (Rhone-Poulenc Rorer, Antony, France);
chloranbucil; GEMZAR® gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum coordination complexes such as cisplatin, oxaliplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; NAVELBINE® vinorelbine; novantrone; teniposide;
edatrexate; daunomycin; aminopterin; xeloda; ibandronate; irinotecan (e.g., CPT-11); topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above. Two or more
chemotherapeutic agents can be used in a cocktail to be administered in combination with the first therapeutic agent described herein. Suitable dosing regimens of combination chemotherapies are known in the art and described in, for example, Saltz et al., Proc. Am. Soc. Clin. Oncol.18:233a (1999), and Douillard et al., Lancet 355(9209):1041-1047 (2000).
In some embodiments, the second therapeutic agent is a therapeutic agent which is a biologic such a cytokine (e.g., interferon or an interleukin (e.g., IL-2)) used in cancer treatment. In some embodiments the biologic is an anti-angiogenic agent, such as an anti-VEGF agent, e.g., bevacizumab (AVASTIN®). In some embodiments the biologic is an immunoglobulin-based biologic, e.g., a monoclonal antibody (e.g., a humanized antibody, a fully human antibody, an Fc fusion protein or a functional fragment thereof) that agonizes a target to stimulate an anti-cancer response, or antagonizes an antigen important for cancer. Such agents include RITUXAN® (rituximab); ZENAPAX® (daclizumab); SIMULECT® (basiliximab); SYNAGIS® (palivizumab); REMICADE® (infliximab); HERCEPTIN®
(trastuzumab); MYLOTARG® (gemtuzumab ozogamicin); CAMPATH® (alemtuzumab); ZEVALIN® (ibritumomab tiuxetan); HUMIRA® (adalimumab); XOLAIR® (omalizumab); BEXXAR® (tositumomab-I- 131); RAPTIVA® (efalizumab); ERBITUX® (cetuximab); AVASTIN® (bevacizumab); TYSABRI®
(natalizumab); ACTEMRA® (tocilizumab); VECTIBIX® (panitumumab); LUCENTIS® (ranibizumab); SOLIRIS® (eculizumab); CIMZIA® (certolizumab pegol); SIMPONI® (golimumab); ILARIS®
(canakinumab); STELARA® (ustekinumab); ARZERRA® (ofatumumab); PROLIA® (denosumab);
NUMAX® (motavizumab); ABTHRAX® (raxibacumab); BENLYSTA® (belimumab); YERVOY®
(ipilimumab); ADCETRIS® (brentuximab vedotin); PERJETA® (pertuzumab); KADCYLA® (ado- trastuzumab emtansine); and GAZYVA® (obinutuzumab). Also included are antibody-drug conjugates. The second agent may be a therapeutic agent which is a non-drug treatment. For example, the second therapeutic agent is radiation therapy, cryotherapy, hyperthermia, and/or surgical excision of tumor tissue.
The second agent may be a checkpoint inhibitor. In one embodiment, the inhibitor of checkpoint is an inhibitory antibody (e.g., a monospecific antibody such as a monoclonal antibody). The antibody may be, e.g., humanized or fully human. In some embodiments, the inhibitor of checkpoint is a fusion protein, e.g., an Fc-receptor fusion protein. In some embodiments, the inhibitor of checkpoint is an agent, such as an antibody, that interacts with a checkpoint protein. In some embodiments, the inhibitor of checkpoint is an agent, such as an antibody, that interacts with the ligand of a checkpoint protein. In some embodiments, the inhibitor of checkpoint is an inhibitor (e.g., an inhibitory antibody or small molecule inhibitor) of CTLA-4 (e.g., an anti-CTLA4 antibody or fusion a protein such as
ipilimumab/YERVOY® or tremelimumab). In some embodiments, the inhibitor of checkpoint is an inhibitor (e.g., an inhibitory antibody or small molecule inhibitor) of PD-1 (e.g., nivolumab/OPDIVO®; pembrolizumab/KEYTRUDA®; pidilizumab/CT-011). In some embodiments, the inhibitor of checkpoint is an inhibitor (e.g., an inhibitory antibody or small molecule inhibitor) of PDL1 (e.g., MPDL3280A/RG7446; MEDI4736; MSB0010718C; BMS 936559). In some embodiments, the inhibitor of checkpoint is an inhibitor (e.g., an inhibitory antibody or Fc fusion or small molecule inhibitor) of PDL2 (e.g., a PDL2/Ig fusion protein such as AMP 224). In some embodiments, the inhibitor of checkpoint is an inhibitor (e.g., an inhibitory antibody or small molecule inhibitor) of B7-H3 (e.g., MGA271), B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, B-7 family ligands, or a combination thereof.
In some embodiments, the anti-cancer therapy is a T cell adoptive transfer (ACT) therapy. In some embodiments, the T cell is an activated T cell. The T cell may be modified to express a chimeric antigen receptor (CAR). CAR modified T (CAR-T) cells can be generated by any method known in the art. For example, the CAR-T cells can be generated by introducing a suitable expression vector encoding the CAR to a T cell. Prior to expansion and genetic modification of the T cells, a source of T cells is obtained from a subject. T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present invention, any number of T cell lines available in the art, may be used. In some embodiments, the T cell is an autologous T cell. Whether prior to or after genetic modification of the T cells to express a desirable protein (e.g., a CAR), the T cells can be activated and expanded generally using methods as described, for example, in U.S. Patents 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466;
6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No.20060121005.
In any of the combination embodiments described herein, the first and second therapeutic agents are administered simultaneously or sequentially, in either order. The first therapeutic agent may be administered immediately, up to 1 hour, up to 2 hours, up to 3 hours, up to 4 hours, up to 5 hours, up to 6 hours, up to 7 hours, up to, 8 hours, up to 9 hours, up to 10 hours, up to 11 hours, up to 12 hours, up to 13 hours, 14 hours, up to hours 16, up to 17 hours, up 18 hours, up to 19 hours up to 20 hours, up to 21 hours, up to 22 hours, up to 23 hours up to 24 hours or up to 1-7, 1-14, 1-21 or 1-30 days before or after the second therapeutic agent. Pharmaceutical Compositions
The pharmaceutical compositions described herein are preferably formulated into pharmaceutical compositions for administration to human subjects in a biologically compatible form suitable for administration in vivo.
The compounds described herein may be used in the form of the free base, in the form of salts, solvates, and as prodrugs. All forms are within the methods described herein. In accordance with the methods of the invention, the described compounds or salts, solvates, or prodrugs thereof may be administered to a patient in a variety of forms depending on the selected route of administration, as will be understood by those skilled in the art. The compounds described herein may be administered, for example, by oral, parenteral, buccal, sublingual, nasal, rectal, patch, pump, intratumoral, or transdermal administration and the pharmaceutical compositions formulated accordingly. Parenteral administration includes intravenous, intraperitoneal, subcutaneous, intramuscular, transepithelial, nasal, intrapulmonary, intrathecal, rectal, and topical modes of administration. Parenteral administration may be by continuous infusion over a selected period of time.
A compound described herein may be orally administered, for example, with an inert diluent or with an assimilable edible carrier, or it may be enclosed in hard or soft shell gelatin capsules, or it may be compressed into tablets, or it may be incorporated directly with the food of the diet. For oral therapeutic administration, a compound described herein may be incorporated with an excipient and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, and wafers. A compound described herein may also be administered parenterally. Solutions of a compound described herein can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose.
Dispersions can also be prepared in glycerol, liquid polyethylene glycols, DMSO, and mixtures thereof with or without alcohol, and in oils. Under ordinary conditions of storage and use, these preparations may contain a preservative to prevent the growth of microorganisms. Conventional procedures and ingredients for the selection and preparation of suitable formulations are described, for example, in Remington’s Pharmaceutical Sciences (2012, 22nd ed.) and in The United States Pharmacopeia: The National Formulary (USP 41 NF36), published in 2018. The pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases the form must be sterile and must be fluid to the extent that may be easily administered via syringe. Compositions for nasal administration may conveniently be formulated as aerosols, drops, gels, and powders. Aerosol formulations typically include a solution or fine suspension of the active substance in a physiologically acceptable aqueous or non- aqueous solvent and are usually presented in single or multidose quantities in sterile form in a sealed container, which can take the form of a cartridge or refill for use with an atomizing device. Alternatively, the sealed container may be a unitary dispensing device, such as a single dose nasal inhaler or an aerosol dispenser fitted with a metering valve which is intended for disposal after use. Where the dosage form includes an aerosol dispenser, it will contain a propellant, which can be a compressed gas, such as compressed air or an organic propellant, such as fluorochlorohydrocarbon. The aerosol dosage forms can also take the form of a pump-atomizer. Compositions suitable for buccal or sublingual administration include tablets, lozenges, and pastilles, where the active ingredient is formulated with a carrier, such as sugar, acacia, tragacanth, gelatin, and glycerine. Compositions for rectal administration are conveniently in the form of suppositories containing a conventional suppository base, such as cocoa butter. A compound described herein may be administered intratumorally, for example, as an intratumoral injection. Intratumoral injection is injection directly into the tumor vasculature and is specifically contemplated for discrete, solid, accessible tumors. Local, regional, or systemic administration also may be appropriate. A compound described herein may advantageously be contacted by administering an injection or multiple injections to the tumor, spaced for example, at approximately, 1 cm intervals. In the case of surgical intervention, the present invention may be used preoperatively, such as to render an inoperable tumor subject to resection. Continuous administration also may be applied where appropriate, for example, by implanting a catheter into a tumor or into tumor vasculature.
The compounds described herein may be administered to an animal, e.g., a human, alone or in combination with pharmaceutically acceptable carriers, as noted herein, the proportion of which is determined by the solubility and chemical nature of the compound, chosen route of administration, and standard pharmaceutical practice. Dosages
The dosage of the compounds described herein, and/or compositions including a compound described herein, can vary depending on many factors, such as the pharmacodynamic properties of the compound; the mode of administration; the age, health, and weight of the recipient; the nature and extent of the symptoms; the frequency of the treatment, and the type of concurrent treatment, if any; and the clearance rate of the compound in the animal to be treated. One of skill in the art can determine the appropriate dosage based on the above factors. The compounds described herein may be administered initially in a suitable dosage that may be adjusted as required, depending on the clinical response. In general, satisfactory results may be obtained when the compounds described herein are administered to a human at a daily dosage of, for example, between 0.05 mg and 3000 mg (measured as the solid form). Dose ranges include, for example, between 10-1000 mg (e.g., 50-800 mg). In some embodiments, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, or 1000 mg of the compound is administered.
Alternatively, the dosage amount can be calculated using the body weight of the patient. For example, the dose of a compound, or pharmaceutical composition thereof, administered to a patient may range from 0.1-100 mg/kg (e.g., 0.1-50 mg/kg (e.g., 0.25-25 mg/kg)). In exemplary, non-limiting embodiments, the dose may range from 0.5-5.0 mg/kg (e.g., 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, or 5.0 mg/kg) or from 5.0-20 mg/kg (e.g., 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 mg/kg). Kits
The invention also features kits including (a) a pharmaceutical composition including an agent that reduces the level and/or activity of BRD9 in a cell or subject described herein, and (b) a package insert with instructions to perform any of the methods described herein. In some embodiments, the kit includes (a) a pharmaceutical composition including an agent that reduces the level and/or activity of BRD9 in a cell or subject described herein, (b) an additional therapeutic agent (e.g., an anti-cancer agent), and (c) a package insert with instructions to perform any of the methods described herein. Examples
Example 1– High density tiling sgRNA screen against human BAF complex subunits in synovial sarcoma cell line SYO1
The following example shows that BRD9 sgRNA inhibits cell growth in synovial sarcoma cells. Procedure: To perform high density sgRNA tiling screen, an sgRNA library against BAF complex subunits was custom synthesized at Cellecta (Mountain View, CA). Sequences of DNA encoding the BRD9-targeting sgRNAs used in this screen are listed in Table 3. Negative and positive control sgRNA were included in the library. Negative controls consisted of 200 sgRNAs that do not target human genome. The positive controls are sgRNAs targeting essential genes (CDC16, GTF2B, HSPA5, HSPA9, PAFAH1B1, PCNA, POLR2L, RPL9, and SF3A3). DNA sequences encoding all positive and negative control sgRNAs are listed in Table 4. Procedures for virus production, cell infection, and performing the sgRNA screen were previously described (Tsherniak et al, Cell 170:564-576 (2017); Munoz et al, Cancer Discovery 6:900-913 (2016)). For each sgRNA, 50 counts were added to the sequencing counts and for each time point the resulting counts were normalized to the total number of counts. The log2 of the ratio between the counts (defined as dropout ratio) at day 24 and day 1 post-infection was calculated. For negative control sgRNAs, the 2.5 and 97.5 percentile of the log2 dropout ratio of all non-targeting sgRNAs was calculated and considered as background (grey box in the graph). Protein domains were obtained from PFAM regions defined for the UNIPROT identifier: Q9H8M2.
Results: As shown in FIG.1, targeted inhibition of the GBAF complex component BRD9 by sgRNA resulted in growth inhibition of the SYO1 synovial sarcoma cell line. sgRNAs against other components of the BAF complexes resulted in increased proliferation of cells, inhibition of cell growth, or had no effect on SYO1 cells. These data show that targeting various subunits of the GBAF complex represents a therapeutic strategy for the treatment of synovial sarcoma. Table 3: BRD9 sgRNA Library
Figure imgf000209_0001
Figure imgf000210_0001
Figure imgf000211_0001
Figure imgf000212_0001
Table 4: Control sgRNA Library
Figure imgf000213_0001
Figure imgf000214_0001
Figure imgf000215_0001
Figure imgf000216_0001
Figure imgf000217_0001
Figure imgf000218_0001
Figure imgf000219_0001
Figure imgf000220_0001
Figure imgf000221_0001
Figure imgf000222_0001
Figure imgf000223_0001
Figure imgf000224_0001
Figure imgf000225_0001
Figure imgf000226_0001
Figure imgf000227_0001
Figure imgf000228_0001
Figure imgf000229_0001
Figure imgf000230_0001
Figure imgf000231_0001
Example 2– BRD9 degrader depletes BRD9 protein
The following example demonstrates the depletion of the BRD9 protein in synovial sarcoma cells treated with a BRD9 degrader.
Procedure: Cells were treated with DMSO or the BRD9 degrader, Compound 1 (also known as dBRD9, see Remillard et al, Angew. Chem. Int. Ed. Engl.56(21):5738-5743 (2017); see structure of Compound 1 below), for indicated doses and timepoints.
Figure imgf000232_0001
Whole cell extracts were fractionated by SDS-PAGE and transferred to a polyvinylidene difluoride membrane using a transfer apparatus according to the manufacturer’s protocols (Bio-Rad). After incubation with 5% nonfat milk in TBST (10 mM Tris, pH 8.0, 150 mM NaCl, 0.5% Tween 20) for 60 minutes, the membrane was incubated with antibodies against BRD9 (1:1,000, Bethyl laboratory A303- 781A), GAPDH (1:5,000, Cell Signaling Technology), and/or MBP (1:1,000, BioRad) overnight at 4°C. Membranes were washed three times for 10 min and incubated with anti-mouse or anti-rabbit antibodies conjugated with either horseradish peroxidase (HRP, FIGS.2-3) or IRDye (FIG.4, 1:20,000, LI-COR) for at least 1h. Blots were washed with TBST three times and developed with either the ECL system according to the manufacturer’s protocols (FIGS.2-3) or scanned on an Odyssey CLx Imaging system (FIG.4).
Results: Treatment of SYO1 synovial sarcoma cells with the BRD9 degrader Compound 1 results in dose dependent (FIG.2) and time dependent (FIG.3) depletion of BRD9 in the cells. Further, as shown in FIG.4, the depletion of BRD9 by Compound 1 is replicated in a non-synovial sarcoma cell line (293T) and may be sustained for at least 5 days. Example 3– Inhibition of growth of synovial cell lines by BRD9 inhibitors and BRD9 degraders The following example demonstrates that BRD9 degraders and inhibitors selectively inhibit growth of synovial sarcoma cells.
Procedures:
Cells were treated with DMSO or the BRD9 degrader, Compound 1, at indicated concentrations, and proliferation was monitored from day 7 to day 14 by measuring confluency over time using an IncuCyte live cell analysis system (FIG.5). Growth medium and compounds were refreshed every 3-4 days.
Cells were seeded into 12-well plates and treated with DMSO, 1 mM BRD9 inhibitor, Compound 2 (also known as BI-7273, see Martin et al, J Med Chem.59(10):4462-4475 (2016); see structure of Compound 2 below), or 1 µM BRD9 degrader, Compound 1.
Figure imgf000233_0001
(Compound 2)
The number of cells was optimized for each cell line. Growth medium and compounds were refreshed every 3-5 days. SYO1, Yamato, A549, 293T and HS-SY-II cells were fixed and stained at day 11. ASKA cells were fixed and stained at day 23. Staining was done by incubation with crystal violet solution (0.5 g Crystal Violet, 27 ml 37% Formaldehyde, 100 mL 10X PBS, 10 mL Methanol, 863 dH20 to 1L) for 30min followed by 3x washes with water and drying the plates for at least 24h at room
temperature. Subsequently plates were scanned on an Odyssey CLx Imaging system (FIG.6).
Cells were seeded into 96-well ultra low cluster plate (Costar, #7007) in 200 µL complete media and treated at day 2 with DMSO, Staurosporin, or BRD9 degarder, Compound 1, at indicated doses (FIG. 7). Media and compounds were changed every 5 d and cell colonies were imaged at day 14.
Results: As shown in FIGS.5, 6, and 7, treatment of synovial sarcoma cell lines (SYO1, Yamato, HS-SY-II, and ASKA) with a BRD9 inhibitor, Compound 2, or a BRD9 degrader, Compound 1, results in inhibition of the growth of the cells, but does not result in inhibition of the growth of non-synovial control cancer cell lines (293T, A549, G401). Example 4– Selective inhibition of growth of synovial cell lines by BRD9 degraders and BRD9 binders
The following example demonstrates that BRD9 degraders and binders selectively inhibit growth of synovial sarcoma cells.
Procedure: Cells were seeded into 6-well or 12-well plates and were treated daily with a BRD9 degrader (Compound 1), a bromo-domain BRD9 binder (Compound 2), E3 ligase binder (lenalidomide), DMSO, or staurosporin (positive control for cell killing), at indicated concentrations. The number of cells was optimized for each cell line. Growth media was refreshed every 5 days. By day 14, medium was removed, cells were washed with PBS, and stained using 500 mL of 0.005% (w/v) crystal violet solution in 25% (v/v) methanol for at least 1 hour at room temperature. Subsequently plates were scanned on an Odyssey CLx Imaging system.
Results: As shown in FIGS.8 and 9, treatment of synovial sarcoma cell lines (SYO1, HS-SY-II, and ASKA) with Compound 1 or Compound 2 resulted in inhibition of the growth of the cells, but did not result in inhibition of the growth of non-synovial control cancer cell lines (RD, HCT116, and Calu6).
Overall, Compound 1 showed most significant growth inhibition in all synovial cell lines. Example 5- Inhibition of cell growth in synovial sarcoma cells
The following example shows that BRD9 degraders inhibit cell growth and induce apoptosis in synovial sarcoma cells.
Procedure: SYO1 cells were treated for 8 or 13 days with DMSO, a BRD9 degrader (Compound 1) at 200nM or 1mM, or an E3 ligase binder (lenalidomide) at 200nM. Compounds were refreshed every 5 days. Cell cycle analysis was performed using the Click-iT™ Plus EdU Flow Cytometry Assay
(Invitrogen). The apoptosis assay was performed using the Annexin V-FITC Apoptosis Detection Kit (Sigma A9210). Assays were performed according to the manufacturer’s protocol.
Results: As shown in FIGS.10-13, treatment with Compound 1 for 8 or 13 days resulted in reduced numbers of cells in the S-phase of the cell cycle as compared to DMSO and lenalidomide.
Treatment with Compound 1 for 8 days also resulted in increased numbers of early- and late-apoptotic cells as compared to DMSO controls. Example 6– Composition for SS18-SSX1-BAF
The following example shows the identification of BRD9 as a component of SS18-SSX containing BAF complexes.
Procedure: A stable 293T cell line expressing HA-SS18SSX1 was generated using lentiviral integration. SS18-SSX1 containing BAF complexes were subject to affinity purification and subsequent mass spectrometry analysis revealed SS18-SSX1 interacting proteins.
Results: As shown in FIG.14, BAF complexes including the SS18-SSX fusion protein also included BRD9. More than 5 unique peptides were identified for ARID1A (95 peptides), ARID1B (77 peptides), SMARCC1 (69 peptides), SMARCD1 (41 peptides), SMARCD2 (37 peptides), DPF2 (32 peptides), SMARCD3 (26 peptides), ACTL6A (25 peptides), BRD9 (22 peptides), DPF1 Isoform 2 (18 peptides), DPF3 (13 peptides), and ACTL6B (6 peptides). Example 7– Preparation of 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-6- (methylamino)-1,2-dihydro-2,7-naphthyridin-1-one (compound B1)
Figure imgf000234_0001
To a stirred mixture of 6-chloro-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1,2- dihydro-2,7-naphthyridin-1-one (100 mg, 0.26 mmol, 1.0 equiv) and methanamine hydrochloride (174.08 mg, 2.58 mmol, 10.0 equiv) in DMSO (3 mL) was added K2CO3 (890.82 mg, 6.45 mmol, 25.0 equiv) at room temperature. The resulting mixture was stirred for 16 hours at 130 °C, and then it was allowed to cool down to room temperature. The solid was filtered off, the crude solution was purified by Prep-HPLC (conditions: XBridge Shield RP18 OBD Column 30*150mm, 5 mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 40 mL/minute; Gradient: 18% B to 18% B in 2 minutes; 254/220 nm; Rt: 7.43 minutes) to afford 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-6-(methylamino)-1,2- dihydro-2,7-naphthyridin-1-one (27mg, 26%). 1H NMR (400 MHz, Methanol-d4) d 9.08 (s, 1H), 7.40 (s, 1H), 6.74 (s, 2H), 6.44 (s, 1H), 3.88 (s, 6H), 3.69 (s, 2H), 3.58 (s, 3H), 2.88 (s, 3H), 2.33 (s, 6H). LCMS (ESI) m/z: [M+H]+ = 383.20. Example 8– Preparation of 6-(dimethylamino)-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]- 2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (compound B2)
Figure imgf000235_0001
To a stirred mixture of 6-chloro-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1,2- dihydro-2,7-naphthyridin-1-one (77.6 mg, 0.20 mmol, 1.0 equiv) and dimethylamine hydrochloride (163.14 mg, 2.0 mmol, 10.0 equiv) in DMF (6 mL) was added TEA (404.91 mg, 4.0 mmol, 20.0 equiv) at room temperature. The resulting mixture was stirred for 16 hours at 130 °C and then it was allowed to cool down to room temperature. The solid was filtered off, the filtrate was purified by Prep-HPLC with the following conditions (2#SHIMADZU (HPLC-01)): Column, X Bridge Shield RP18 OBD Column,
5 mm,19*150mm; mobile phase, Water (0.05% NH3H2O) and ACN (10% Phase B up to 70% in 8 minutes);To afford 23 mg (27%) of 6-(dimethylamino)-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]- 2-methyl-1,2-dihydro-2,7-naphthyridin-1-one as a brown solid.1H NMR (400 MHz, Methanol-d4) d 9.15 (s, 1H), 7.43 (s, 1H), 6.77 (s, 2H), 6.52 (s, 1H), 3.89 (s, 6H), 3.70 (s, 2H), 3.59 (s, 3H), 3.12 (s, 6H), 2.34 (s, 6H). LCMS (ESI) m/z: [M+H]+ = 397.40. Example 9– Preparation of 4-[4-[(Dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-7- (methylamino)-1,2-dihydro-2,6-naphthyridin-1-one (compound B3)
Figure imgf000235_0002
To a solution of 7-chloro-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1,2-dihydro- 2,6-naphthyridin-1-one (50 mg, 0.13 mmol, 1.0 equiv) and methanamine hydrochloride (87.0 mg, 1.29 mmol, 10.0 equiv) in solvent DMSO (2 mL) was added K2CO3 (445.4 mg, 3.22 mmol, 25.0 equiv). The resulting solution was stirred at 130 °C for overnight. After cooling, the solid was filtered off, the crude solution was purified by Prep-HPLC (conditions: XBridge Shield RP18 OBD Column, 5 mm,19*150mm; Mobile Phase A: Water (0.05%NH3H2O), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 30% B to 80% B in 8 minutes; 220nm nm; Rt: 7.8 minutes) to afford 4-[4-[(dimethylamino)methyl]-3,5- dimethoxyphenyl]-2-methyl-7-(methylamino)-1,2-dihydro-2,6-naphthyridin-1-one (15.5 mg, 31%) as a yellow solid. 1H NMR (300 MHz, Methanol-d4) d 8.53 (d, J = 0.9 Hz, 1H), 7.24 (d, J = 0.9 Hz, 1H), 7.09 (s, 1H), 6.76 (s, 2H), 3.88 (s, 6H), 3.67 (d, J = 11.1 Hz, 5H), 2.97 (s, 3H), 2.31 (s, 6H). LCMS: (ES, m/z): [M+H]+ = 383.30. Example 10– Preparation of 6-amino-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2- methyl-1,2-dihydro-2,7-naphthyridin-1-one (compound B4) and 7-amino-4-(4- ((dimethylamino)methyl)-3,5-dimethoxyphenyl)-2-methyl-2,6-naphthyridin-1(2H)-one (compound
Figure imgf000236_0001
To a solution of 4-bromo-6-chloropyridine-3-carboxylic acid (2.0 g, 8.46 mmol, 1.0 equiv), methanamine hydrochloride (0.63 g, 9.30 mmol, 1.1 equiv) and DIEA (3.28 g, 25.38 mmol, 3.0 equiv) in DCM (20 mL) was added HATU (4.82 g, 12.69 mmol, 1.5 equiv) at room temperature. The resulting mixture was stirred for another 1 hour. Then the reaction was washed with water (20 m x 2), and the organic layer was concentrated under vacuum to give a yellow syrup. The product was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+ = 249.
Figure imgf000237_0001
To a solution of 4-bromo-6-chloro-N-methylpyridine-3-carboxamide (1.0 g, 4.0 mmol, 1 equiv) and 2-[(E)-2-ethoxyethenyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (0.95 g, 4.81 mmol, 1.2 equiv) in dioxane (10 mL) and H2O (2 mL) was added Cs2CO3 (3.92 g, 12.03 mmol, 3.0 equiv) and Pd(dppf)Cl2•CH2Cl2 (0.35 g, 0.48 mmol, 0.12 equiv). The mixture was stirred for 2 hours at 90 °C under nitrogen atmosphere, and the reaction mixture was dilute with water and extracted with ethyl acetate, dried over Na2SO4, and concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH2Cl2/MeOH (20:1) to afford 6-chloro-4-[(E)-2-ethoxyethenyl]-N-methylpyridine-3- carboxamide (680 mg, 57%) as an off-white solid. LCMS (ESI) m/z: [M+H]+ = 241.
Figure imgf000237_0002
Into a 20 mL pressure tube was added 6-chloro-4-[(E)-2-ethoxyethenyl]-N-methylpyridine-3- carboxamide (680 mg, 2.83 mmol, 1.0 equiv) and TFA (5 mL, 67.32 mmol, 23.83 equiv) at room temperature, the reaction was stirred over night at 80 °C. The resulting mixture was concentrated under vacuum to afford 6-chloro-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (580 mg, crude) as a dark yellow solid. The product was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+ = 195. Step 4: Preparation of 4-bromo-6-chloro-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (i10-5)
Br
Cl
Figure imgf000237_0003
To a stirred mixture of 6-chloro-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (580 mg, 2.98 mmol, 1.0 equiv) in DMF (10 mL) was added NBS (583.46 mg, 3.28 mmol, 1.1 equiv), and the resulting mixture was stirred for 2 hours at room temperature. The reaction mixture was diluted with DCM (50 mL) and washed with water (3 x 50 mL). The organic layer was dried over Na2SO4 and concentrated under vacuum. The crude product was purified by flash silica chromatography, eluted with 0 to 80% EtOAc in petroleum ether. Pure fractions were evaporated to dryness to afford 4-bromo-6-chloro-2-methyl-1,2- dihydro-2,7-naphthyridin-1-one (899 mg, 88%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 273. Step 5: Preparation of 6-chloro-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1,2-dihydro- 2,7-naphthyridin-1-one (i10-6)
Figure imgf000238_0001
To a solution of 4-bromo-6-chloro-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (843 mg, 3.08 mmol, 1.0 equiv) and [4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]boronic acid (736.88 mg, 3.08 mmol, 1.0 equiv) in dioxane (40 mL) and H2O (4 mL) was added Cs2CO3 (3.01 g, 9.25 mmol, 3.0 equiv) and Pd(dppf)Cl2•CH2Cl2 (302.04 mg, 0.37 mmol, 0.12 equiv). After stirring for 2 hours at 90 °C under a nitrogen atmosphere, the reaction mixture was diluted with water and extracted with ethyl acetate. The organic layer was dried over Na2SO4 and then concentrated under reduced pressure. The crude product was purified by flash silica chromatography, eluted with 0 to 80% EtOAc in petroleum ether. Pure fractions were evaporated to dryness to afford 6-chloro-4-[4-[(dimethylamino)methyl]-3,5- dimethoxyphenyl]-2-methyl-1,2-dihydro-2,7-naphthyridin-1-one (670 mg, 51 %) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 388. Step 6: Preparation of 6-amino-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1,2-dihydro- 2,7-naphthyridin-1-one (compound B4)
Figure imgf000238_0002
To a stirred mixture of 6-chloro-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1,2- dihydro-2,7-naphthyridin-1-one (232 mg, 060 mmol, 1.0 equiv) and NH4Cl (479.94 mg, 8.97 mmol, 15.0 equiv) in DMSO (10 mL) was added K2CO3 (2.07 g, 14.95 mmol, 25.0 equiv). The resulting mixture was stirred overnight at 130 °C. After completion of the reaction, the reaction mixture was diluted with water and extracted with ethyl acetate, dried over Na2SO4, and then concentrated under reduced pressure. The crude product was purified by Prep-HPLC (conditions: X Select CSH Prep C18 OBD Column, 5 mm, 19*150 mm; mobile phase, Water (0.1% FA) and ACN (hold 7% Phase B in 7 minutes); Detector, UV) to afford 3.4 mg (1.54 %) of 6-amino-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-1,2- dihydro-2,7-naphth- yridin-1-one as an off-white solid. 1H NMR (400 MHz, Methanol-d4) d 9.04 (s, 1H), 7.44 (s, 1H), 6.84 (s, 2H), 6.54 (s, 1H), 4.34 (s, 2H), 3.97 (s, 6H), 3.59 (s, 3H), 2.85 (s, 6H). LCMS (ESI) m/z: [M+H]+ = 369.25. Preparation of 7-amino-4-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-2-methyl-2,6-naphthyridin- 1(2H)-one (compound B5)
Figure imgf000239_0001
Compound B5 was prepared in a similar manner as described above for compound B4. 1H NMR (300 MHz, Methanol-d4) d 8.39 (s, 1H), 7.65 (d, J = 2.2 Hz, 1H), 7.23 (s, 1H), 6.89 (s, 2H), 4.42 (s, 2H), 3.98 (s, 6H), 3.64 (s, 3H), 2.92 (s, 6H). LCMS (ESI) m/z: [M+H]+ = 369.25. Example 11– Preparation of 2-[(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5- oxo-2,6-naphthyridin-3-yl)amino]-N,N-dimethylacetamide formic acid (compound B6 formic acid)
Figure imgf000239_0002
To a stirred mixture of [(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5-oxo-2,6- naphthyridin-3-yl)amino]acetic acid (60.0 mg, 0.141 mmol, 1.00 equiv) and dimethylamine hydrochloride (17.2 mg, 0.211 mmol, 1.50 equiv) in DMF (2.00 mL) was added DIEA (54.6 mg, 0.422 mmol, 3.00 equiv). The mixture was stirred at room temperature for 5 minutes, and then PyBOP (146.43 mg, 0.281 mmol, 2.00 equiv) was added. After stirring at room temperature for 2 hours, the reaction mixture was purified by Prep-HPLC (conditions: Sun Fire C18 OBD Prep Column, 100 Å, 5 mm, 19 mm X 250 mm; mobile phase, Water (0.1% FA) and ACN (10% Phase B up to 31% in 11 minutes). This resulted in 2-[(8- [4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5-oxo-2,6-naphthyridin-3-yl)amino]-N,N- dimethyl acetamide; formic acid (10.9 mg, 17.7%) as a dark yellow solid. 1H NMR (300 MHz, Methanol- d4) d 8.51 (br s, 0.5H, FA), 8.50 (s, 1H), 7.37 (s, 1H), 7.16 (s, 1H), 6.92 (s, 2H), 4.92 (s, 2H), 4.37 (s, 2H), 3.95 (s, 6H), 3.65 (s, 3H), 3.36 (s, 6H), 3.05 (d, J = 5.5 Hz, 6H). LCMS (ESI) m/z: [M+H]+ = 454.20. Example 12– Preparation of 1-([4-[6-(Dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin- 4-yl]-2,6-dimethoxyphenyl]methyl)-N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H- isoindol-4-yl]oxy]pentyl)azetidine-3-carboxamide (compound D1)
Figure imgf000240_0001
Step 1: Preparation of 4-[6-(Dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde (i12-2)
Figure imgf000240_0002
To a solution of 4-bromo-6-(dimethylamino)-2-methyl-2,7-naphthyridin-1-one(400.00 mg, 1.42 mmol, 1.00 eq.) in dioxane(10.00 mL) and H2O(1.00 mL) was added 2,6-dimethoxy-4-(4,4,5,5- tetramethyl-1,3,2-dioxaborolan-2-yl)benzaldehyde(500 mg, 1.70 mmol, 1.2 eq.), Pd(dppf)Cl2 (100.0 mg, 0.14 mmol, 0.1 eq.), and Cs2CO3 (1.39 g, 4.14 mmol, 3 eq.). The resulting solution was stirred at 90 °C for 1 hour under a nitrogen atmosphere. The crude was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH2Cl2/MeOH (10:1) to afford 4-[6- (dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxybenzaldehyde (416.8mg, 119.03%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+ = 367.4.
Figure imgf000241_0001
To a solution of 4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde (331.00 mg, 0.901 mmol, 1.00 eq.) in MeOH (10.00 mL) was added methyl azetidine-3-carboxylate hydrochloride (163.88 mg, 1.081 mmol, 1.2 eq.) and NaBH3CN (169.85 mg, 2.703 mmol, 3 eq.). The resulting solution was stirred at room temperature for 1 hour. The crude mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH2Cl2/MeOH(10:1) to afford methyl 1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin -4-yl]-2,6-dimethoxyphenyl]methyl)azetidine-3-carboxylate (279 mg, 66.38%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+ = 466.5.
Figure imgf000241_0002
To the solution of methyl 1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxyphenyl]methyl)azetidine-3-carboxylate (140.00 mg, 0.300 mmol, 1.00 eq.) in MeOH (3.00 mL) and H2O (3.00 mL) was added LiOH (71.87 mg, 3.001 mmol, 10.00 eq.). The resulting solution was stirred at room temperature for 3 hours. The crude mixture was concentrated under reduced pressure. The residue was purified by reverse flash chromatography (conditions: column, C18 silica gel; mobile phase, HCl in water, 10% to 70% gradient in 35 minutes; detector, UV 254 nm). This resulted in 1-([4-[6- (dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)azetidine-3-carboxylic acid (120 mg, 88.37%) as a white solid. LCMS (ESI) m/z: [M+H]+ = 452.5.
Figure imgf000242_0001
To a solution of 1-([4-[6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl]-2,6- dimethoxyphenyl]methyl)azetidine-3-carboxylic acid (50.00 mg, 0.110 mmol, 1.00 eq.) and 4-[(5- aminopentyl)oxy]-2-(2,6-dioxopiperidin-3-yl)-2,3-dihydro-1H-isoindole-1,3-dione (39.71 mg, 0.110 mmol, 1.00 eq.) in DMF (1.50 mL) was added DIEA (42.84 mg, 0.331 mmol, 3.00 eq.) and PyBOP (86.25 mg, 0.166 mmol, 1.50 eq.). The resulting solution was stirred at room temperature for 1 hour. The crude product (50 mg) was purified by Prep-HPLC (conditions: SunFire C18 OBD Prep Column, 100Å, 5 µm, 19 mm X 250 mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 11% B to 27% B in 18 minutes; 254 nm; Rt: 16.87 minutes) to afford 1-([4-[6-(dimethylamino)-2- methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl]me thyl)-N-(5-[[2-(2,6- dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]pentyl)azetidine-3-carboxamide formate (13.5 mg) as a light yellow solid. 1H NMR (300 MHz, Acetonitrile-d3) d 9.12 (s, 1H), 8.17 (s, 0.3H, FA), 7.76 (dd, J = 8.5, 7.3 Hz, 1H), 7.53– 7.28 (m, 3H), 6.79 (s, 2H), 6.65 (s, 1H), 6.53 (s, 1H), 4.99 (dd, J = 12.1, 5.4 Hz, 1H), 4.26 (s, 2H), 4.23– 4.15 (m, 2H), 4.15– 4.03 (m, 2H), 4.04– 3.92 (m, 2H), 3.87 (s, 6H), 3.52 (s, 3H), 3.42 (t, J = 8.1 Hz, 1H), 3.34– 3.12 (m, 3H), 3.10 (s, 6H), 2.86– 2.62 (m, 3H), 2.21– 2.07 (m, 1H), 1.88– 1.76 (m, 2H), 1.63– 1.50 (m, 4H). LCMS (ESI) m/z: [M+H]+ = 452.45. Example 13– Preparation of 4-(((((S)-1-(4-(6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7- naphthyridin-4-yl)-2,6-dimethoxybenzyl)azetidin-2-yl)methyl)(methyl)amino)methyl)-2-(2,6- dioxopiperidin-3-yl)isoindoline-1,3-dione (compound D2)
Figure imgf000242_0002
Figure imgf000243_0001
To a solution of tert-butyl (2S)-2-(aminomethyl)azetidine-1-carboxylate (900.00 mg, 4.832 mmol, 1.00 equiv) and trifluoroacetic anhydride (1.522 g, 7.248 mmol, 1.5 equiv) in THF (9.00 mL) was added TEA (977.92 mg, 9.664 mmol, 2 equiv). The resulting solution was stirred at 25 °C for 12 hours. The resulting solution was diluted with of EtOAc. The resulting mixture was washed with water (3 x 50 mL), then dried over anhydrous sodium sulfate, filtered, and concentrated to give crude product that was applied onto a silica gel column with ethyl EA/PE(15:85) to afford tert-butyl (2S)-2-[(2,2,2- trifluoroacetamido) methyl]azetidine-1-carboxylate (1.27 g, 93.11%) as a yellow oil. LCMS (ESI) m/z: [M+H]+ = 283. Step 2: Preparation of tert-butyl (S)-2-((2,2,2-trifluoro-N-methylacetamido)methyl)azetidine-1-carboxylate (i13-3)
Figure imgf000243_0002
To a solution of tert-butyl (2S)-2-[(2,2,2-trifluoroacetamido)methyl]azetidine-1-carboxylate (1.27 g, 4.499 mmol, 1.00 equiv) and dimethyl sulfate(681.00 mg, 5.399 mmol, 1.2 equiv) in acetone (15.00 mL) was added K2CO3 (621.83 mg, 4.499 mmol, 1 equiv). The resulting solution was stirred at 25 °C for 12 hours. The resulting mixture was filtered, and the filtrate was evaporated to dryness to afford tert-butyl (2S)-2-[(2,2,2-trifluoro-N-methylacetamido)methyl]azetidine-1-carboxylate (1.64 g, crude) as a yellow oil that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 297.
Figure imgf000243_0003
A solution of tert-butyl (2S)-2-[(2,2,2-trifluoro-N-methylacetamido)methyl]azetidine-1-carboxylate (1.64 g, 5.535 mmol, 1.00 equiv) and TFA (3.50 mL, 47.121 mmol, 8.51 equiv) in DCM (16.00 mL) was stirred for 1 hour at 25 °C. The mixture was concentrated to give N-[(2S)-azetidin-2-ylmethyl]-2,2,2- trifluoro-N-methylacetamide (2.08 g, crude) as a brown oil that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 197.
Figure imgf000244_0001
To a solution of 4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxybenzal- dehyde (620.00 mg, 1.688 mmol, 1.00 equiv) and N-[(2S)-azetidin-2-ylmethyl]-2,2,2-trifluoro-N-methy- lacetamide (496.57 mg, 2.531 mmol, 1.50 equiv) in DMF (5.00 mL, 64.609 mmol, 38.29 equiv) was added NaBH(OAc)3 (715.31 mg, 3.375 mmol, 2 equiv). The resulting solution was stirred at 25 °C for 1 hour. The mixture was concentrated to give crude product that was purified by chromatography on silica gel eluted with MeOH]/DCM (4.2:95.8) to give N-[[(2S)-1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7- naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)azetidin-2-yl]methyl]-2,2,2-trifluoro-N-methylacetamide (436 mg,47.18%) as a dark yellow solid. LCMS (ESI) m/z: [M+H]+ = 548.
Figure imgf000244_0002
A solution of N-[[(2S)-1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxy phenyl]methyl)azetidin-2-yl]methyl]-2,2,2-trifluoro-N-methylacetamide (400.00 mg, 0.730 mmol, 1.00 equiv) and NH3•H2O (2.00 mL, 51.361 mmol, 70.31 equiv) in DMF (4.00 mL, 12.922 mmol, 196.55 equiv) was stirred at 25 °C for 12 hours. The resulting solution was concentrated to give crude product 4-(3,5-dimethoxy-4-[[(2S)-2-[(methylamino)methyl]azetidin-1-yl]methyl]phenyl)-6-(dimethylamino)- 2-methyl-2,7-naphthyridin-1-one (458 mg) as a brown solid that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 452.
Step 6: Preparation of 4-(S)-1-(4-(6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)- 2,6-dimethoxybenzyl)azetidin-2-yl)methyl)(methyl)amino)methyl)-2-(2,6-dioxopiperidin-3-yl)isoindoline- 1,3-dione (compound D2)
Figure imgf000245_0001
4-(3,5-dimethoxy-4-[[(2R)-2-[(methylamino)methyl]azetidin-1-yl]methyl]phenyl)-6-(dimethylamino)- 2-methyl-2,7-naphthyridin-1-one (100.00 mg, 0.221 mmol, 1.00 equiv) and 2-(2,6-dioxopiperidin-3-yl)-1,3- dioxoisoindole-4-carbaldehyde (63.39 mg, 0.221 mmol, 1.00 equiv) were dissolved in MeOH (2.00 mL). Then NaBH3CN (69.58 mg, 1.107 mmol, 5 equiv) was added to the mixture, and the resulting solution was stirred at 25 °C for 1 hour. Without any additional work-up, the mixture was purified by prep-HPLC (conditions: SunFire C18 OBD Prep Column , 100Å, 5 µm, 19 mm X 250 mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 9% B to 19% B in 15 minutes; 254 nm; Rt: 17.67 minutes) to give 4-(((((S)-1-(4-(6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7- naphthyridin-4-yl)-2,6-dimethoxy benzyl)azetidin-2-yl)methyl)(methyl)amino)methyl)-2-(2,6-dioxopiperidin- 3-yl)isoindoli-ne-1,3-dione (20.4 mg, 12.76 %) as a yellow solid. 1H NMR (400 MHz, Methanol-d4) d 9.05 (s, 1H), 8.00– 7.74 (m, 3H), 7.51 (d, J = 6.9 Hz, 1H), 6.88 (d, J = 5.4 Hz, 2H), 6.60 (d, J = 4.5 Hz, 1H), 5.26– 5.05 (m, 1H), 4.64 (dd, J = 12.8, 10.2 Hz, 1H), 4.53 (dd, J = 12.8, 5.7 Hz, 1H), 4.27– 4.08 (m, 4H), 3.93 (d, J = 10.8 Hz, 6H), 3.59 (d, J = 2.1 Hz, 3H), 3.16 (s, 6H), 3.10 (s, 2H), 2.95– 2.80 (m, 1H), 2.80– 2.58 (m, 3H), 2.32 (dd, J = 15.9, 2.4 Hz, 4H), 2.19– 2.08 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 722.20. Example 14– Preparation of 4-([[1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]- 2,6-dimethoxy phenyl]methyl) azetidin-3-yl](methyl)amino]methyl)-2-(2,6-dioxopiperidin-3- yl)isoindole-1,3-dione formic acid (compound D3 formic acid)
O O O N O Boc
N O O N
Br B Boc O O
HO OH HN N
Pd(dppf)Cl2 , Cs 2 CO 3 , NaBH3CN, MeOH
N N N
N
dioxane,H2O 2
O N N step
step 1 N N
i14-1 O i14-2
O i14-3
O H O O N O O H OH N NH HN N O N N O O O O N O O O TFA, DCM NaBH3CN, MeOH
N O N
N step 4
step 3 N
N N O
O i14-4 compound D3 formic acid Step 1: Preparation of 4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde (i14-2)
Figure imgf000246_0001
To a solution of 4-bromo-6-(dimethylamino)-2-methyl-2,7-naphthyridin-1-one (1.80 g, 6.380 mmol, 1.00 equiv) and 4-formyl-3,5-dimethoxyphenylboronic acid (1.34 g, 6.380 mmol, 1.00 equiv) in 1,4- dioxane and water was added CS2CO3 (4.16 g, 12.760 mmol, 2.00 equiv) and Pd(dppf)Cl2 (0.47 g, 0.638 mmol, 0.10 equiv). After stirring for 2 hours at 80 °C under a nitrogen atmosphere, the resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column
chromatography, eluted with PE/EtOAc (1:1) to afford 4-[6-(dimethylamino)-2-methyl-1-oxo-2,7- naphthyridin-4-yl]-2,6-dimethoxybenzaldehyde(1.5 g, 57.59%) as a grey solid. LCMS (ESI) m/z:
[M+H]+ = 368.
Figure imgf000246_0002
To a stirred mixture of 4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde (100.00 mg, 0.272 mmol, 1.00 equiv) and tert-butyl N-(azetidin-3-yl)-N- methylcarbamate hydrochloride (90.93 mg, 0.408 mmol, 1.50 equiv) in MeOH was added NaBH3CN (34.21 mg, 0.544 mmol, 2.00 equiv) in portions. The resulting mixture was stirred for 2 hours at room temperature. The resulting mixture was concentrated under vacuum. The residue was purified by silica gel column chromatography, eluted with DCM/MeOH (20:1) to afford tert-butyl-N-[1-([4-[6- (dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)azetidin-3-yl]-N- methylcarbamate (103 mg, 65.46%) as an off-white solid. LCMS (ESI) m/z: [M+H]+ = 538. Step 3: 4-(3,5-dimethoxy-4-((3-(methylamino)azetidin-1-yl)methyl)phenyl)-6-(dimethylamino)-2-methyl- 2,7-naphthyridin-1(2H)-one (i14-44)
Figure imgf000247_0001
To a stirred solution of tert-butyl-N-[1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4- yl]-2,6-dimethoxy phenyl]methyl)azetidin-3-yl]-N-methylcarbamate (100.00 mg, 0.186 mmol, 1.00 equiv) in DCM (1.00 mL) was added TFA (0.20 mL, 2.693 mmol, 14.48 equiv). The resulting mixture was stirred for 2 hours at room temperature and concentrated under reduced pressure. The residue was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+ = 438. Step 4: Preparation of 4-([[1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxyphenyl]methyl) azetidin-3-yl](methyl)amino]methyl)-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3- dione formic acid (compound D3 formic acid)
Figure imgf000247_0002
O
compound D3 formic acid
To a stirred mixture of 4-(3,5-dimethoxy-4-[[3-(methylamino)azetidin-1-yl]methyl]phenyl)-6- (dimethylamino)-2-methyl-2,7-naphthyridin-1-one (50.00 mg, 0.114 mmol, 1.00 equiv) and 2-(2,6- dioxopiperidin-3-yl)-1,3-dioxoisoindole-4-carbaldehyde (65.42 mg, 0.229 mmol, 2.00 equiv) in MeOH was added NaBH3CN(14.36 mg, 0.229 mmol, 2.00 equiv) in portions. The resulting mixture was stirred for 2 hours at room temperature. The mixture was purified by Prep-HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 mm,19*150mm; mobile phase, Water (0.1% FA) and ACN (16% PhaseB up to 26% in 8 minutes); Detector, UV). This resulted in 4-([[1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4- yl]-2,6-dimethoxyphenyl] methyl)azetidin-3-yl](methyl)amino]methyl)-2-(2,6-dioxopiperidin-3-yl)isoindole- 1,3-dione formic acid (2.8 mg, 3.17%) as a white solid. 1H NMR (400 MHz, Methanol-d4) d 9.16 (d, J = 0.7 Hz, 1H), 8.56 (br s, 1H, FA), 7.90– 7.79 (m, 3H), 7.43 (s, 1H), 6.85 (s, 2H), 6.47 (s, 1H), 5.14 (dd, J = 12.3, 5.4 Hz, 1H), 4.37 (s, 2H), 4.06 (s, 3H), 3.98 -3.85 (m, 9H), 3.59 (s, 3H), 3.55– 3.45 (m 1H), 3.11 (s, 6H), 2.89– 2.80 (m, 1H), 2.77– 2.66 (m, 2H), 2.16 (s, 3H), 2.14– 2.07 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 708.30. Example 15– Preparation of (2S)-1-(4-(6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7- naphthyridin-4-yl)-2,6-dimethoxybenzyl)-N-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-4- yl)methyl)-N-methylazetidine-2-carboxamide formic acid (compound D4 formic acid)
Figure imgf000248_0001
Compound D4 was prepared in a similar manner to Example 12. (2S)-1-(4-(6-(dimethylamino)-2- methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)-2,6-dimethoxybenzyl)-N-((2-(2,6-dioxopiperidin-3-yl)-1,3- dioxoisoindolin-4-yl)methyl)-N-methylazetidine-2-carboxamide formic acid (9.1 mg, 17.56%) was obtained as a light yellow solid. 1H NMR (400 MHz, Methanol-d4) d 9.18– 9.11 (m, 1H), 8.54 (s, 0.2H, FA), 7.93– 7.52 (m, 2H), 7.46– 7.27 (m, 2H), 6.85 (s, 2H), 6.54– 6.30 (m, 1H), 5.34– 4.94 (m, 4H), 4.48– 4.31 (m, 2H), 4.03– 3.79 (m, 8H), 3.91 (s, 3H), 3.14– 2.93 (m, 9H), 2.90– 2.67 (m, 4H), 2.60– 2.38 (m, 1H), 2.23 – 2.09 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 736.45. Example 16– Preparation of 1-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4- yl)phenyl] methyl]-N-(4-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-5- yl]amino]butyl) azetidine-3-sulfonamide formic acid (compound D5 formic acid)
Figure imgf000248_0002
Using a similar procedure as described in Example 7 and substituting with tert-butyl N-(8- aminooctyl)carbamate (945 mg, 3.867 mmol) afforded tert-butyl-N-[8-[(5-[4-[(dimethylamino)methyl]-3,5- dimethoxyphenyl]-7-methyl-8-oxo-2,7-naphthyridin-3-yl)amino]octyl]carbamate (140 mg, 82%) as a yellow syrup. LCMS (ESI) m/z: [M+H]+ = 596.
Figure imgf000249_0001
To a stirred mixture of tert-butyl-N-[8-[(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7- methyl-8-oxo-2,7-naphthyridin-3-yl)amino]octyl]carbamate (140 mg, 0.235 mmol, 1.00 equiv) in dichloromethane (2.0 mL) was added trifluoroacetic acid (0.50 mL, 6.732 mmol, 28.65 equiv). The resulting mixture was stirred for 2 hours at room temperature. The resulting mixture was concentrated under reduced pressure, and the residue was purified by reverse flash chromatography (conditions: column, C18 silica gel; mobile phase, acetonitrile in water (0.1% formic acid), 1% to 20% gradient in 20 minutes; detector, UV 254 nm) to give 6-[(8-aminooctyl)amino]-4-[4-[(dimethylamino)methyl]-3,5- dimethoxyphenyl]-2-methyl-2,7-naphthyridin-1-one (100 mg, 80%) as a yellow syrup. LCMS (ESI) m/z: [M+H]+ = 596.
Figure imgf000249_0002
Using a similar procedure as described in Example 11 and substituting with of 6-[(8- aminooctyl)amino]-4-[4-[(dimethylamino)methyl]-3,5-dimethoxy phenyl]-2-methyl-2,7-naphthyridin-1-one (50.0 mg, 0.101 mmol, 1.00 equiv) and [[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]oxy]acetic acid (30.2 mg, 0.091 mmol, 0.90 equiv) afforded N-[8-[(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7- methyl-8-oxo-2,7-naphthyridin-3-yl)amino]octyl]-2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4- yl]oxy]acetamide formic acid (6.2 mg, 7%) as a white solid. 1H NMR (400 MHz, Methanol-d4) d 9.05 (d, J = 0.7 Hz, 1H), 8.57 (br s, 1H, FA), 7.81 (dd, J = 8.4, 7.3 Hz, 1H), 7.53 (d, J = 7.3 Hz, 1H), 7.46– 7.38 (m, 2H), 6.83 (s, 2H), 6.40 (s, 1H), 5.13 (dd, J = 12.6, 5.5 Hz, 1H), 4.76 (s, 2H), 4.60 (s, 3H), 4.23 (s, 2H), 3.95 (s, 6H), 3.57 (s, 3H), 3.34– 3.23 (m, 2H), 2.93– 2.81 (m, 2H), 2.80– 2.67 (m, 6H), 2.19– 2.10 (m, 1H), 1.62– 1.54 (m, 4H), 1.37– 1.33 (m, 8H). LCMS (ESI) m/z: [M+H]+ = 810.45. Example 17– Preparation of 4-((5-((5-(4-((dimethylamino)methyl)-2,5-dimethoxyphenyl)-7-methyl- 8-oxo-7,8-dihydro-2,7-naphthyridin-3-yl)amino)pentyl)oxy)-2-(2,6-dioxopiperidin-3-yl)isoindoline- 1,3-dione formic acid (compound D6 formic acid)
Figure imgf000250_0001
Using a similar procedure as described in Example 7 and substituting with 6-chloro-4-(4- ((dimethylamino)methyl)-2,5-dimethoxyphenyl)-2-methyl-2,7-naphthyridin-1(2H)-one (150.0 mg, 0.387 mmol, 1.00 equiv) and 5-aminopentanol (39.8 mg, 0.387 mmol, 1.00 equiv) afforded 4-(4- ((dimethylamino)methyl)-2,5-dimethoxyphenyl)-6-((5-hydroxypentyl)amino)-2-methyl-2,7-naphthyridin- 1(2H)-one (90 mg, 51.4%) as a brown solid. LCMS (ESI) m/z: [M+H]+ = 455.
Figure imgf000251_0001
To a solution of 4-(4-((dimethylamino)methyl)-2,5-dimethoxyphenyl)-6-((5-hydroxypentyl) amino)-2-methyl-2,7-naphthyridin-1(2H)-one (90 mg, 0.198 mmol, 1.00 equiv) and triethylamine (100.2 mg, 0.990 mmol, 5.00 equiv) in dichloromethane (2.00 mL) was added methanesulfonyl chloride (45.4 mg, 0.396 mmol, 2.00 equiv) slowly at 0 °C. The reaction mixture was stirred for 30 minutes at 0 °C and then warmed to room temperature slowly. The reaction was quenched with saturated sodium bicarbonate solution (50 mL) and extracted with dichloromethane (50 mL x 3). The organic layers were combined and washed with brine (50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated to afford 5- ((5-(4-((dimethylamino)methyl)-2,5-dimethoxyphenyl)-7-methyl-8-oxo-7,8-dihydro-2,7-naphthyridin-3- yl)amino)pentyl methanesulfonate (80.0 mg, 68.3%) as a brown solid. LCMS (ESI) m/z: [M+H]+ = 533.
Figure imgf000251_0002
To a mixture of 5-((5-(4-((dimethylamino)methyl)-2,5-dimethoxyphenyl)-7-methyl-8-oxo-7, 8-dihydro-2,7-naphthyridin-3-yl)amino)pentyl methanesulfonate (80.0 mg, 0.150 mmol, 1.00 equiv) and 2- (2,6-dioxopiperidin-3-yl)-4-hydroxyisoindoline-1,3-dione (41.2 mg, 0.150 mmol, 1.00 equiv) in DMF (2.00 mL) was added K2CO3 (41.5 mg, 0.300 mmol, 2.00 equiv). The resulting mixture was stirred for 4 hours at 60 °C. The resulting mixture was filtered, and the filtrate was purified by Prep-HPLC (column: SunFire C18 OBD Prep Column, 100Å, 5 µm, 19 mm x 250 mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 11% B to 26% B in 10 minutes; 254 nm; Rt: 8.78 minutes) to afford 4-((5-((5-(4-((dimethylamino)methyl)-2,5-dimethoxyphenyl)-7-methyl-8-oxo-7,8-dihydro-2,7- naphthyridin-3-yl)amino)pentyl)oxy)-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione;formate (15.3 mg, 11.6%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+ = 711.65. 1H NMR (400 MHz, Methanol-d4) d 9.02 (s, 1H), 8.56 (br s, 0.6H, FA), 7.77 (dd, J = 8.5, 7.3 Hz, 1H), 7.43 (dd, J = 11.8, 7.8 Hz, 2H), 7.28 (s, 1H), 7.16 (s, 1H), 7.01 (s, 1H), 5.98 (s, 1H), 5.09 (dd, J = 12.8, 5.4 Hz, 1H), 4.22 (t, J = 6.2 Hz, 2H), 4.03 (s, 2H), 3.88 (s, 3H), 3.75 (s, 3H), 3.56 (s, 3H), 3.28 (t, J = 6.6 Hz, 2H), 2.93– 2.82 (m, 1H), 2.80– 2.70 (m, 2H), 2.65 (s, 6H), 2.15– 2.07 (m, 1H), 1.92– 1.81 (m, 2H), 1.73– 1.64 (m, 2H), 1.64– 1.55 (m, 2H). Example 18– Preparation of 1-([2,6-dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6- naphthyridin-4-yl]phenyl]methyl)-N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4- yl]oxy]pentyl)azetidine-3-carboxamide formic acid (compound D7 formic acid)
Figure imgf000252_0001
Compound 7 was prepared in a similar manner to Example 10 and Example 12. 1-([2,6-dimethoxy- 4-[2-methyl-7-(methylamino)-1-oxo-2,6-naphthyridin-4-yl]phenyl]methyl)-N-(5-[[2-(2,6-dioxopiperidin-3-yl)- 1,3-dioxoisoindol-4-yl]oxy]pentyl)azetidine-3-carboxamide formic acid (30 mg, 30.6%) was obtained as a yellow solid. 1H NMR (300 MHz, Methanol-d4) d 8.56 (br s, 0.7H, FA), 8.51 (d, J = 0.9 Hz, 1H), 7.77 (dd, J = 8.4, 7.4 Hz, 1H), 7.44 (dd, J = 7.9, 2.5 Hz, 2H), 7.23 (d, J = 0.9 Hz, 1H), 7.10 (s, 1H), 6.81 (s, 2H), 5.10 (dd, J = 12.4, 5.5 Hz, 1H), 4.30– 4.21 (m, 3H), 4.02 (d, J = 8.1 Hz, 3H), 3.92 (s, 6H), 3.64 (s, 3H), 3.47 (t, J = 8.2 Hz, 1H), 3.29– 3.13 (m, 3H), 2.97 (s, 3H), 2.90– 2.76 (m, 2H), 2.75– 2.63 (m, 1H), 2.18– 2.07 (m, 1H), 2.01– 1.83 (m, 3H), 1.68– 1.54 (m, 4H). LCMS (ESI) m/z: [M+H]+ = 780.60. Example 19– Preparation of N-[8-[(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5- oxo-2,6-naphthyridin-3-yl)amino]octyl]-2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4- yl]oxy]acetamide (compound D8)
Figure imgf000252_0002
Step 1: Preparation of tert-butyl N-[8-[(8-bromo-6-methyl-5-oxo-2,6-naphthyridin-3- yl)amino]octyl]carbamate (i19-2)
Figure imgf000253_0001
To a mixture of 4-bromo-7-chloro-2-methyl-2,6-naphthyridin-1-one (100 mg, 0.366 mmol, 1.00 equiv) and tert-butyl N-(8-aminooctyl)carbamate (268.1 mg, 1.097 mmol, 3.00 equiv) in DMSO (3.00 mL) was added K2CO3 (505.3 mg, 3.656 mmol, 10.00 equiv). The resulting solution was stirred at 130 °C for 5 hours. The resulting solution was diluted with of EtOAc (80 mL). The resulting mixture was washed with water (3 x 50 mL). The organic layer was concentrated under reduced pressure. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (1:1). Fractions containing the desired compound were evaporated to dryness to afford tert-butyl N-[8-[(8-bromo-6-methyl-5-oxo-2,6- naphthyridin-3-yl)amino]octyl]carbamate (50 mg, 28.4%) as a yellow solid. LCMS (ESI) m/z:
[M+H]+ = 483.
Figure imgf000253_0002
To a solution of tert-butyl N-[8-[(8-bromo-6-methyl-5-oxo-2,6-naphthyridin-3- yl)amino]octyl]carbamate (50.0 mg, 0.104 mmol, 1.00 equiv) and 4-[(dimethylamino)methyl]-3,5- dimethoxyphenylboronic acid (37.2 mg, 0.156 mmol, 1.50 equiv) in H2O (0.50 mL) and dioxane (1.50 mL) was added Cs2CO3 (67.7 mg, 0.208 mmol, 2.00 equiv) and Pd(dppf)Cl2•CH2Cl2 (7.60 mg, 0.010 mmol, 0.10 equiv). The resulting solution was stirred at 90 °C for 1 hour under N2 atmosphere. The resulting solution was diluted with of EtOAc (50 mL). The resulting mixture was washed with water (3 x 30 mL). The resulting mixture was concentrated under reduced pressure. The residue was applied onto a silica gel column with ethyl acetate/petroleum ether (30:70). Fractions containing the desired compound were evaporated to dryness to afford tert-butyl N-[8-[(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6- methyl-5-oxo-2,6-naphthyridin-3-yl)amino]octyl]carbamate (30 mg, 48.5%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 596.
Figure imgf000254_0001
To a solution of tert-butyl N-[8-[(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5- oxo-2,6-naphthyridin-3-yl)amino]octyl]carbamate (30 mg, 0.050 mmol, 1.00 equiv) in DCM (2.00 mL) was added TFA (2.00 mL), and the resulting solution was stirred at 25 °C for 1 hour. The resulting mixture was concentrated under reduced pressure to afford 7-[(8-aminooctyl)amino]-4-[4- [(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-2,6-naphthyridin-1-one (35 mg, crude) as a yellow liquid that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 496. Step 4: Preparation of N-[8-[(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5-oxo-2,6- naphthyridin-3-yl)amino]octyl]-2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]oxy]acetamide (compound D8)
Figure imgf000254_0002
To a solution of [[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]oxy]acetic acid
(24.1 mg, 0.073 mmol, 1.20 equiv) and HATU (46.0 mg, 0.121 mmol, 2.00 equiv) in DMF (2.00 mL) were added 7-[(8-aminooctyl)amino]-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-2,6- naphthyridin-1-one (30.0 mg, 0.061 mmol, 1.00 equiv) and DIEA (39.1 mg, 0.303 mmol, 5.00 equiv). The resulting solution was stirred at 25 °C for 2 hours. The crude product was purified by preparative HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 mm,19*150mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 20% B to 55% B in 8 minutes; 254 nm; Rt: 7.12 minutes) to afford N-[8-[(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5-oxo-2,6- naphthyridin-3-yl)amino]octyl]-2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]oxy]acetamide (12 mg, 24.5%) as a yellow solid. 1H NMR (300 MHz, Methanol-d4) d 8.41 (s, 1H), 7.80 (dd, J = 8.4, 7.4 Hz, 1H), 7.52 (d, J = 7.3 Hz, 1H), 7.43 (d, J = 9.1 Hz, 2H), 7.15 (s, 1H), 6.90 (s, 2H), 5.13 (dd, J = 12.4, 5.4 Hz, 1H), 4.77 (s, 2H), 4.42 (s, 2H), 3.98 (s, 6H), 3.63 (s, 3H), 3.40– 3.35 (m, 2H), 3.30– 3.21 (m, 2H), 2.92 (s, 6H), 2.90– 2.82 (m, 1H), 2.80– 2.65 (m, 2H), 2.21– 2.09 (m, 1H), 1.72– 1.57 (m, 4H), 1.51– 1.34 (m, 8H). LCMS (ESI) m/z: [M+H]+ = 810.60. Example 20– Preparation of N-(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5- oxo-2,6-naphthyridin-3-yl)-3-[2-(2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4- yl]amino]ethoxy)ethoxy]propanamide (compound D9)
Figure imgf000255_0001
Step 1: Preparation of 3-(2-(2-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-5-yl)amino)ethoxy)ethoxy) propanamide (i20-2)
Figure imgf000255_0003
Using a similar procedure as described in Example 10, step 1 and substituting with 5-([2-[2-(3,3- dihydroxypropoxy)ethoxy]ethyl]amino)-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (150 mg, 0.344 mmol, 1.00 equiv) and ammonium chloride (24 mg, 0.448 mmol, 1.30 equiv) affored 3-(2-(2-((2-(2,6- dioxopiperidin-3-yl)-1,3-dioxoisoindolin-5-yl)amino)ethoxy)ethoxy) propanamide (122 mg, 81.5%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 433.
Figure imgf000255_0002
To a solution of 7-chloro-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-2,6- naphthyridin-1-one (50 mg, 0.129 mmol, 1.00 equiv) and 3-[2-(2-[[2-(2,6-dioxopiperidin-3-yl)-1,3- dioxoisoindol-4-yl]amino]ethoxy)ethoxy]propanamide (55.8 mg, 0.129 mmol, 1 equiv) in
dioxane (4 mL) was added tris(dibenzylideneacetone)dipalladium(0) (11.8 mg, 0.013 mmol, 0.10 equiv), cesium carbonate (84.0 mg, 0.258 mmol, 2.0 equiv) and Xantphos (14.9 mg, 0.026 mmol, 0.20 equiv), and the resulting solution was stirred at 90 °C for 3 hours. The mixture filtered through a short pad of Celite, and the filtrate was concentrated under reduced pressure. The residue was purified by Prep- HPLC (conditions: SunFire C18 OBD Prep Column, 100Å, 5 µm, 19 mm X 250 mm; Mobile Phase A: water (0.1% formic acid), Mobile Phase B:acetonitrile; Flow rate:25 mL/minute; Gradient:9 B to 22 B in 18 minutes; 254 nm) to give N-(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5-oxo-2,6- naphthyridin-3-yl)-3-[2-(2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4- yl]amino]ethoxy)ethoxy]propanamide (6 mg, 5.6%) as a yellow solid. 1H NMR (300 MHz, Methanol-d4) d 8.82 (s, 1H), 8.64 (s, 1H), 7.40– 7.30 (m, 2H), 6.89 (s, 2H), 6.86– 6.76 (m, 2H), 4.99 (dd, J = 12.4, 5.4 Hz, 1H), 4.44 (s, 2H), 4.01 (s, 6H), 3.92 (t, J = 5.7 Hz, 2H), 3.82– 3.72 (m, 6H), 3.64 (s, 3H), 3.39 (t, J = 5.0 Hz, 2H), 2.93 (s, 6H), 2.88– 2.61 (m, 5H), 2.29– 2.18 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 784.50. Example 21– Preparation of 4-[[2-(2-[2-[(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7- methyl-8-oxo-2,7-naphthyridin-3-yl)amino]ethoxy]ethoxy)ethyl]amino]-2-(2,6-dioxopiperidin-3- yl)isoindole-1,3-dione formic acid (compound D10 formic acid)
Figure imgf000256_0001
Intermediate i-21-1 was prepared in a similar manner to preparation of i19-4 in Example 19. To a stirred mixture of 6-([2-[2-(2-aminoethoxy)ethoxy]ethyl]amino)-4-[4-[(dimethylamino)methyl]-3,5- dimethoxyphenyl]-2-methyl-2,7-naphthyridin-1-one (100 mg, 0.200 mmol, 1.00 equiv) and 2-(2,6- dioxopiperidin-3-yl)-4-fluoroisoindole-1,3-dione (55.3 mg, 0.200 mmol, 1.00 equiv) in dimethylformamide (2 mL) was added diiopropylethylamine (129.3 mg, 1.001 mmol, 5.00 equiv). After stirring overnight at 90 °C, the mixture was purified by Prep-HPLC (conditions: Atlantis HILIC OBD Column, 19*150mm, 5 mm; mobile phase: A, water (0.1% formic acid) and B, acetonitrile (12% to 21% B in 9 minutes) to afford 4-[[2- (2-[2-[(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7-methyl-8-oxo-2,7-naphthyridin-3- yl)amino]ethoxy]ethoxy)ethyl]amino]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione formic acid (4 mg, 2.5%). 1H NMR (300 MHz, Methanol-d4) d 9.03 (s, 1H), 8.57 (br s, 0.83H, formic acid), 7.51 (t, J = 7.8 Hz, 1H), 7.40 (s, 1H), 7.00 (d, J = 7.8 Hz, 2H), 6.83 (s, 2H), 6.50 (s, 1H), 4.96– 4.90 (m, 1H), 4.32 (s, 2H), 3.96 (s, 6H), 3.71– 3.63 (m, 8H), 3.56 (s, 3H), 3.53– 3.48 (m, 2H), 3.42 (t, J = 5.2 Hz, 2H), 2.85 (s, 6H), 2.78– 2.57 (m, 3H), 2.00 (d, J = 9.2 Hz, 1H). LCMS (ESI) m/z: [M+H]+ = 756.45. Example 22– Preparation of N-(5-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-7-methyl-8- oxo-7,8-dihydro-2,7-naphthyridin-3-yl)-3-(2-(2-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-4- yl)amino)ethoxy)et hoxy)propanamide formic acid (compound D11 formic acid)
Figure imgf000257_0001
Compound D11 was prepared in a similar manner to Example 20. N-(5-[4- [(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7-methyl-8-oxo-2,7-naphthyridin-3-yl)-3-[2-(2-[[2-(2,6-dioxo piperidin-3-yl)-1,3-dioxoisoin dol-4-yl]amino]ethoxy)ethoxy]propanamide formic acid (8.1 mg, 6.62%) was obtained as a yellow solid. 1H NMR (300 MHz, Methanol-d4) d 9.10 (s, 1H), 8.57 (br s, 1H, FA), 8.45 (s, 1H), 7.64 (s, 1H), 7.34 (dd, J = 8.6, 7.1 Hz, 1H), 6.90– 6.75 (m, 4H), 4.86– 4.82 (m, 1H), 4.61 (s, 1H), 4.33 (s, 2H), 4.02 (s, 6H), 3.94– 3.84 (m, 2H), 3.77– 3.71 (m, 6H), 3.65 (s, 3H), 3.36 (s, 1H), 2.85 (s, 6H), 2.75– 2.66 (m, 3H), 2.63– 2.54 (m, 1H), 2.47– 2.31 (m, 1H), 1.84– 1.73 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 784.4. Example 23– Preparation of 2-[(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5- oxo-2,6-naphthy ridin-3-yl)(methyl)amino]-N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4- yl]oxy]penty-l)acetamide formic acid (compound D12 formic acid)
Figure imgf000257_0002
Figure imgf000258_0001
To a stirred solution of 4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-7- (methylamino)-2,6-naphthyridin-1-one (514 mg, 1.344 mmol, 1.00 equiv) and tert-butyl 2-bromoacetate (393.2 mg, 2.016 mmol, 1.50 equiv) in acetone was added cesium carbonate (875.8 mg, 2.688 mmol, 2.00 equiv) in portions at room temperature. The resulting mixture was stirred for 1 hour at room temperature. The resulting mixture was filtered, and the filter cake was washed with dichloromethane (3 x 10 mL). The filtrate was concentrated under reduced pressure. This resulted in tert-butyl 2-[(8-[4- [(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5-oxo-2,6-naphthyridin-3- yl)(methyl)amino]acetate (600 mg, 89.9%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+ = 497.2
Figure imgf000258_0002
To a stirred solution of tert-butyl 2-[(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl- 5-oxo-2,6-naphthyridin-3-yl)(methyl)amino]acetate (600 mg, 1.208 mmol, 1.00 equiv) in dichloromethane was added trifluoroacetic acid (4 mL) dropwise at room temperature. The resulting mixture was stirred for 2 hours at room temperature. The crude product was purified by Prep-HPLC (conditions: MeCN/water 30%) to afford [(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5-oxo-2,6-naphthyridin-3- yl)(methyl)amino]acetic acid (450 mg, 84.6%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+ = 441.
Figure imgf000259_0001
Using a similar procedure as described in Example 11 and substituting with [(8-[4- [(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5-oxo-2,6-naphthyridin-3-yl)(methyl)amino]acetic acid (100 mg, 0.227 mmol, 1.00 equiv) and 4-[(5-aminopentyl)oxy]-2-(2,6-dioxopiperidin-3-yl)isoindole- 1,3-dione (122.4 mg, 0.341 mmol, 1.50 equiv) afforded 2-[(8-[4-[(dimethylamino)methyl]-3,5- dimethoxyphenyl]-6-methyl-5-oxo-2,6-naphthyridin-3-yl)(methyl)amino]-N-(5-[[2-(2,6-dioxopiperidin-3-yl)- 1,3-dioxoisoindol-4-yl]oxy]pentyl)acetamide formic acid (80 mg, 42.6%) as a yellow solid. 1H NMR (300 MHz, Methanol-d4) d 8.56 (s, 1H), 8.51 (brs, 0.8H, formic acid), 7.78 (dd, J = 8.6, 7.2 Hz, 1H), 7.48– 7.42 (m, 2H), 7.25 (s, 1H), 7.14 (s, 1H), 6.89 (s, 2H), 5.10 (dd, J = 12.4, 5.4 Hz, 1H), 4.82 (s, 2H), 4.27 (t, J = 5.9 Hz, 2H), 4.08 (s, 2H), 3.94 (s, 6H), 3.66 (s, 3H), 3.40– 3.36 (m, 2H), 3.28 (s, 6H), 2.98 (s, 3H), 2.90– 2.67 (m, 3H), 2.19– 2.08 (m, 1H), 1.97– 1.86 (m, 2H), 1.74– 1.61 (m, 4H). LCMS (ESI) m/z: [M+H]+ = 782.50. Example 24– Preparation of N-(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5- oxo-2,6-naphthyridin-3-yl)-3-[2-(2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5- yl]amino]ethoxy)ethoxy]propanamide formic acid (compound D13 formic acid)
Figure imgf000259_0002
compound D13 formic acid
Compound D13 was prepared in a similar manner to Example 20. N-(8-[4- [(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5-oxo-2,6-naphthyridin-3-yl)-3-[2-(2-[[2-(2,6- dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]amino]ethoxy)ethoxy]propanamide formic acid (7 mg, 6.9%) was obtained. 1H NMR (300 MHz, Methanol-d4) d 8.86 (d, J = 0.9 Hz, 1H), 8.70 (d, J = 0.9 Hz, 1H), 8.56 (brs, 0.9H, FA), 7.40 (s, 1H), 7.28 (d, J = 8.4 Hz, 1H), 6.82 (s, 2H), 6.63 (d, J = 2.2 Hz, 1H), 6.54 (dd, J = 8.4, 2.2 Hz, 1H), 5.05– 4.97 (m, 1H), 4.33 (s, 2H), 3.98 (s, 6H), 3.93 (t, J = 5.6 Hz, 2H), 3.75– 3.70 (m, 6H), 3.58 (s, 3H), 3.18 (t, J = 5.4 Hz, 2H), 2.85 (s, 6H), 2.79– 2.57 (m, 5H), 2.08– 1.97 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 784.55. Example 25– Preparation of N-(5-(4-((dimethylamino)methyl)-3,5-dimethoxyphenyl)-7-methyl-8- oxo-7,8-dihydro-2,7-naphthyridin-3-yl)-3-(2-(2-((2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-5- yl)amino)ethoxy)ethoxy)propanamide formic acid (compound D14 formic acid)
Figure imgf000260_0001
Compound D13 was prepared in a similar manner to Example 20. N-(5-[4- [(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7-methyl-8-oxo-2,7-naphthyridin-3-yl)-3-[2-(2-[[2-(2,6- dioxopiperidin-3-yl)-1,3-dioxoisoin -dol-5-yl]amino]ethoxy)ethoxy]propanamide formic acid (6 mg, 6.62%) was obtained as a yellow solid. 1H NMR (300 MHz, Methanol-d4) d 9.19 (s, 1H), 8.55 (brs, 1.8H, FA), 8.51 (s, 1H), 7.65 (s, 1H), 7.33 (d, J = 8.3 Hz, 1H), 6.83 (s, 2H), 6.67 (d, J = 2.1 Hz, 1H), 6.56 (dd, J = 8.4, 2.2 Hz, 1H), 5.05– 4.98 (m, 1H), 4.36 (s, 2H), 4.00 (s, 6H), 3.87 (t, J = 5.5 Hz, 2H), 3.72– 3.63 (m, 6H), 3.59 (s, 3H), 3.13 (t, J = 5.4 Hz, 2H), 2.90 (s, 6H), 2.83– 2.60 (m, 5H), 2.11– 2.00 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 784.5. Example 26– Preparation of 4-([5-[9-([2,6-dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6- naphthyridin-4-yl]phenyl]methyl)-1-oxa-4,9-diazaspiro[5.5]undecan-4-yl]-5-oxopentyl]oxy)-2-(2,6- dioxopiperidin-3-yl)isoindole-1,3-dione formic acid (compound D15 formic acid)
Figure imgf000260_0002
Figure imgf000261_0001
To a solution of 2,6-dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6-naphthyridin-4- yl]benzaldehyde (100 mg, 0.283 mmol, 1.00 equiv) and tert-butyl 1-oxa-4,9-diazaspiro[5.5]undecane-4- carboxylate (87.1 mg, 0.340 mmol, 1.20 equiv) in MeOH (2.00 mL) was added NaBH3CN (35.6 mg, 0.566 mmol, 2.00 equiv), and the resulting solution was stirred at 25 °C for 2 hours. The resulting mixture was concentrated. The residue was applied onto a silica gel column with DCM/MeOH (20:1). This resulted in tert-butyl 9-([2,6-dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6-naphthyridin-4-yl]phenyl]methyl)-1- oxa-4,9-diazaspiro[5.5]undecane-4-carboxylate (110 mg, 65.5%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 594.
Figure imgf000261_0002
To a solution of tert-butyl 9-([2,6-dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6-naphthyridin- 4-yl]phenyl]methyl)-1-oxa-4,9-diazaspiro[5.5]undecane-4-carboxylate (100.0 mg, 0.168 mmol, 1.00 equiv) in DCM (2.00 mL) was added TFA (2.00 mL), and the resulting solution was stirred at 25 °C for 2 h. The resulting mixture was concentrated under vacuum to give 4-(3,5-dimethoxy-4-[1-oxa-4,9- diazaspiro[5.5]undecan-9-ylmethyl]phenyl)-2-methyl-7-(methylamino)-2,6-naphthyridin-1-one (90 mg, crude) as a yellow solid that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 494.
Figure imgf000262_0001
To a solution of 5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]oxy]pentanoic acid(15.2 mg, 0.041 mmol, 1.00 equiv) and HATU (30.8 mg, 0.081 mmol, 2.00 equiv), in solvent DMF (2.00 mL) was added 4-(3,5-dimethoxy-4-[1-oxa-4,9-diazaspiro[5.5]undecan-9-ylmethyl]phenyl)-2-methyl-7- (methylamino)-2,6-naphthyridin-1-one(20.0 mg, 0.041 mmol, 1.00 equiv) and DIEA (15.7 mg,
0.122 mmol, 3.00 equiv), and the resulting solution was stirred at 25 °C for 2 hours. The resulting mixture was concentrated. The crude product was purified by preparative HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 mm,19*150mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 20% B to 55% B in 8 minutes; 254 nm; Rt: 7.12 minutes) to afford 4-([5-[9-([2,6- dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6-naphthyridin-4-yl]phenyl]methyl)-1-oxa-4,9- diazaspiro[5.5]undecan-4-yl]-5-oxopentyl]oxy)-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione formic acid (20 mg,52.8%) as a yellow solid. 1H NMR (300 MHz, Methanol-d4) d 8.56 (br s, 0.5H, FA), 8.51 (s, 1H), 7.83– 7.74 (m, 1H), 7.50– 7.42 (m, 2H), 7.24 (d, J = 3.8 Hz, 1H), 7.11 (s, 1H), 6.83 (d, J = 9.2 Hz, 2H), 5.12 (dd, J = 12.2, 5.3 Hz, 1H), 4.33– 4.22 (m, 3H), 3.93 (d, J = 8.5 Hz, 7H), 3.83– 3.69 (m, 3H), 3.67– 3.60 (m, 5H), 3.51 (s, 2H), 3.22– 3.10 (m, 2H), 2.97 (s, 3H), 2.92– 2.63 (m, 5H), 2.18– 1.86 (m, 8H), 1.83– 1.69 (m, 2H). LCMS (ESI) m/z: [M+H]+ = 850.60. Example 27– Preparation of 4-(4-(9-(2,6-dimethoxy-4-(2-methyl-7-(methylamino)-1-oxo-1,2- dihydro-2,6-naphthyridin-4-yl)benzyl)-1-oxa-4,9-diazaspiro[5.5]undecan-4-yl)-4-oxobutoxy)-2-(2,6- dioxopiperidin-3-yl)isoindoline-1,3-dione formic acid (compound D16 formic acid)
Figure imgf000262_0002
Compound D16 was prepared in a similar manner to Example 26. 4-[4-[9-([2,6-dimethoxy-4-[2- methyl-7-(methylamino)-1-oxo-2,6-naphthyridin-4-yl]phenyl]methyl)-1-oxa-4,9-diazaspiro[5.5]undecan-4- yl]-4-oxobutoxy]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (16 mg, 20.0%) was obtained as a light brown solid. 1H NMR (400 MHz, Methanol-d4) d 8.57 (brs, 0.6H, FA), 8.54 (d, J = 4.5 Hz, 1H), 7.80 (t, J = 7.9 Hz, 1H), 7.48 (dd, J = 7.2, 5.0 Hz, 2H), 7.25 (d, J = 1.0 Hz, 1H), 7.13 (d, J = 4.6 Hz, 1H), 6.83 (d, J = 10.9 Hz, 2H), 5.13 (dd, J = 12.5, 5.5 Hz, 1H), 4.31 (t, J = 5.7 Hz, 2H), 4.26– 4.16 (m, 2H), 3.92 (d, J = 12.1 Hz, 6H), 3.75– 3.69 (m, 3H), 3.65 (s, 3H), 3.60– 3.48 (m, 3H), 3.24– 3.02 (m, 4H), 2.97 (s, 3H), 2.81– 2.65 (m, 5H), 2.24– 2.12 (m, 3H), 2.10– 1.84 (m, 3H), 1.79– 1.65 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 836.45. Example 28– Preparation of 4-(4-(4-(2,6-dimethoxy-4-(2-methyl-7-(methylamino)-1-oxo-1,2- dihydro-2,6-naphthyridin-4-yl)benzyl)piperazin-1-yl)-4-oxobutoxy)-2-(2,6-dioxopiperidin-3- yl)isoindoline-1,3-dione formic acid (compound D17 formic acid)
Figure imgf000263_0001
Compound D17 was prepared in a similar manner to Example 26. 4-[4-[4-([2,6-dimethoxy-4-[2- methyl-7-(methylamino)-1-oxo-2,6-naphthyridin-4-yl]phenyl]methyl)piperazin-1-yl]-4-oxobutoxy]-2-(2,6- dioxopiperidin-3-yl)isoindole-1,3-dione formic acid (11.0 mg, 12.8%) was obtained as a yellow solid. 1H NMR (400 MHz, DMSO-d6) d 11.14 (s, 1H), 9.63 (s, 1H), 8.56 (brs, 0.9H, FA), 7.87– 7.77 (m, 1H), 7.55 (d, J = 8.5 Hz, 1H), 7.47 (d, J = 7.2 Hz, 1H), 7.20 (s, 1H), 7.13 (s, 1H), 6.98 (d, J = 4.8 Hz, 1H), 6.86 (s, 2H), 5.09 (dd, J = 12.7, 5.4 Hz, 1H), 4.43 (d, J = 12.5 Hz, 1H), 4.27 (dd, J = 13.9, 7.8 Hz, 4H), 4.07 (d, J = 13.6 Hz, 1H), 3.90 (s, 6H), 3.58– 3.48 (m, 4H), 3.47– 3.38 (m, 3H), 3.26– 2.98 (m, 3H), 2.96– 2.88 (m, 1H), 2.87– 2.83 (m, 3H), 2.65– 2.55 (m, 3H), 2.09– 1.95 (m, 3H). LCMS (ESI) m/z: [M+H]+ = 766.50. Example 29– Preparation of 4-(4-(9-(4-(6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7- naphthyridin-4-yl)-2,6-dimethoxybenzyl)-1-oxa-4,9-diazaspiro[5.5]undecan-4-yl)-4-oxobutoxy)-2- (2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione formic acid (compound D18 formic acid)
Figure imgf000263_0002
Compound D18 was prepared in a similar manner to Example 26. 4-[4-[9-([4-[6-(dimethylamino)- 2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)-1-oxa-4,9-diazaspiro[5.5]undecan-4- yl]-4-oxobutoxy]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione formic acid (12.7 mg) was obtained as a white solid. LCMS (ESI) m/z: [M+H]+ = 850.55.1H NMR (400 MHz, Methanol-d4) d 9.15 (s, 1H), 8.47 (brs, 1.2H, FA), 7.80 (t, J = 7.9 Hz, 1H), 7.48 (d, J = 9.9 Hz, 3H), 6.89 (d, J = 7.2 Hz, 2H), 6.49 (d, J = 3.7 Hz, 1H), 5.13 (dd, J = 12.6, 5.5 Hz, 1H), 4.40 (s, 2H), 4.31 (s, 2H), 3.95 (d, J = 12.5 Hz, 6H), 3.80– 3.65 (m, 4H), 3.60 (d, J = 3.1 Hz, 3H), 3.57– 3.48 (m, 2H), 3.34 (s, 4H), 3.13 (s, 6H), 2.85– 2.59 (m, 5H), 2.24 – 2.04 (m, 6H), 1.84– 1.74 (m, 1H). Example 30– Preparation of 5-((5-(9-(4-(6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7- naphthyridin-4-yl)-2,6-dimethoxybenzyl)-1-oxa-4,9-diazaspiro[5.5]undecan-4-yl)-5-oxopentyl)oxy)- 2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione formic acid (compound D19 formic acid)
Figure imgf000264_0001
Compound D19 was prepared in a similar manner to Example 26. 5-([5-[9-([4-[6- (dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)-1-oxa-4,9- diazaspiro[5.5]undecan-4-yl]-5-oxopentyl]oxy)-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione formic acid (8.1 mg, 11.1%) was obtained as a white solid. LCMS (ESI) m/z: [M+H]+ = 864.55. 1H NMR (400 MHz, Methanol-d4) d 9.14 (d, J = 1.8 Hz, 1H), 8.56 (brs, 0.5H, FA), 7.80 (t, J = 9.0 Hz, 1H), 7.44 (d, J = 2.6 Hz, 1H), 7.40 (dd, J = 4.2, 2.2 Hz, 1H), 7.35– 7.28 (m, 1H), 6.85 (d, J = 6.7 Hz, 2H), 6.49 (s, 1H), 5.15– 5.06 (m, 1H), 4.31– 4.11 (m, 4H), 3.94 (d, J = 4.9 Hz, 6H), 3.81– 3.71 (m, 2H), 3.64– 3.56 (m, 5H), 3.55– 3.45 (m, 2H), 3.25– 3.00 (m, 10H), 2.94– 2.82 (m, 1H), 2.81– 2.66 (m, 2H), 2.62– 2.45 (m, 2H), 2.18– 1.99 (m, 3H), 1.96– 1.71 (m, 6H). Example 31– Preparation of 5-(4-(2-(1-(4-(6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7- naphthyridin-4-yl)-2,6-dimethoxybenzyl)piperidin-4-yl)ethyl)piperazin-1-yl)-2-(2,6-dioxopiperidin-3- yl)isoindoline-1,3-dione formic acid (compound D20 formic acid)
Figure imgf000264_0002
To a mixture of 4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde (30.0 mg, 0.082 mmol, 1.00 equiv) in DMF (1.00 mL) was added 2-(2,6-dioxo piperidin-3-yl)-5-[4-[2-(piperidin-4-yl)ethyl]piperazin-1-yl]isoindole-1,3-dione (37.0 mg, 0.082 mmol, 1.00 equiv). The resulting mixture was stirred for 1 hour, and NaBH(OAc)3 (34.6 mg, 0.163 mmol, 2.00 equiv) was added. The resulting mixture was stirred overnight at room temperature. Without any additional work-up, the mixture was purified by prep-HPLC (conditions: Phenomenex Gemini C6-Phenyl, 21.2*250 mm, 5 mm; Mobile Phase A: Water (0.05% FA), Mobile Phase B:ACN; Flow rate: 25 mL/minute; Gradient: 11% B to 17% B in 17 minutes; 254 nm; RT:14.2 minutes) to afford 5-(4-(2-(1-(4-(6-(dimethyl amino)-2- methyl-1-oxo-1,2-dihydro -2,7-naphthyridin-4-yl)-2,6-dimethoxybenzyl)piperidin-4-yl)ethyl)piperazin-1-yl)- 2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione;formate acid (9.0 mg, 13.8%) as a yellow solid. 1H NMR (300 MHz, DMSO-d6) d 11.09 (s, 1H), 9.45 (brs, 0.6H, FA salt), 9.05 (s, 1H), 8.14 (s, 0.7H, FA), 7.75 (d, J = 8.5 Hz, 1H), 7.61 (s, 1H), 7.46 (s, 1H), 7.34 (d, J = 8.9 Hz, 1H), 6.90 (s, 2H), 6.52 (d, J = 6.4 Hz, 1H), 5.09 (dd, J = 12.7, 5.4 Hz, 1H), 4.21 (s, 3H), 3.91 (s, 7H), 3.50 (s, 4H), 3.47– 3.37 (m, 4H), 3.20– 3.05 (m, 9H), 3.04– 2.86 (m, 4H), 2.74– 2.54 (m, 3H), 2.09– 1.98 (m, 1H), 1.97– 1.75 (m, 3H), 1.70– 1.48 (m, 4H). LCMS (ESI) m/z: [M+H]+ = 805.55. Example 32– Preparation of 5-[4-(2-[2-[([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4- yl]-2,6-dimethoxyphenyl]methyl)(methyl)amino]ethoxy]ethyl)piperazin-1-yl]-2-(2,6-dioxopiperidin- 3-yl)isoindole-1,3-dione (compound D21)
Figure imgf000265_0001
To a solution of 2-(2,6-dioxopiperidin-3-yl)-5-(piperazin-1-yl)isoindole-1,3-dione (50.00 mg, 0.146 mmol, 1.00 equiv) and tert-butyl N-methyl-N-[2-(2-oxoethoxy)ethyl]carbamate (47.60 mg, 0.219 mmol, 1.50 equiv), in DMF (2.00 mL) was added NaBH3CN(18.36 mg, 0.292 mmol, 2.00 equiv), and the resulting solution was stirred at 25 °C for 3 hours. The resulting mixture was concentrated. The residue was applied onto a silica gel column with CH2Cl2/MeOH (20:1). This resulted in tert-butyl N-[2-(2-[4-[2- (2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperazin-1-yl]ethoxy)ethyl]-N-methylcarbamate (45 mg, 56.68%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 544.50. Step 2: Preparation of 2-(2,6-dioxopiperidin-3-yl)-5-(4-[2-[2-(methylamino)ethoxy]ethyl]piperazin-1- yl)isoindole-1,3-dione (i32-3)
Figure imgf000265_0002
A solution of tert-butyl N-[2-(2-[4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperazin-1- yl]eth oxy)ethyl]-N-methylcarbamate (45.00 mg, 0.083 mmol, 1.00 equiv) in TFA (1.00 mL) and CH2Cl2 (1.00 mL) was stirred at 25 °C for 1 hour. The resulting mixture was concentrated, and the crude material was used directly without further purification. 2-(2,6-dioxopiperidin-3-yl)-5-(4-[2-[2- (methylamino)ethoxy]ethyl]piperazin-1-yl)isoindole-1,3-dione was obtained as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 444.50. Step 3: Preparation of 5-[4-(2-[2-[([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimeth oxyphenyl]methyl)(methyl)amino]ethoxy]ethyl)piperazin-1-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3- dione (compound D21)
Figure imgf000266_0001
To a solution of 2-(2,6-dioxopiperidin-3-yl)-5-(4-[2-[2-(methylamino)ethoxy]ethyl]piperazin-1- yl)isoindole-1,3-dione (50.00 mg, 0.113 mmol, 1.00 equiv) and 4-[6-(dimethylamino)-2-methyl-1-oxo-2,7- naphthyridin-4-yl]-2,6-dimethoxybenzaldehyde (49.70 mg, 0.135 mmol, 1.20 equiv) in DMF (2.00 mL) was added NaBH3CN(14.17 mg, 0.225 mmol, 2.00 equiv), and the resulting solution was stirred at 25 °C for 3 hours. The resulting mixture was concentrated. The crude product was purified by preparative HPLC (conditions: XSelect CSH Prep C18 OBD Column, 5 mm, 19*150 mm; Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 25 mL/minute; Gradient: 20% B to 55% B in 8 minutes; 254 nm; RT: 7.12 minutes). This resulted in 5-[4-(2-[2-[([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7- naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)(methyl)amino]ethoxy]ethyl)piperazin-1-yl]-2-(2,6- dioxopiperidin-3-yl)isoindo le-1,3-dione (10 mg, 18.60%) as a yellow solid. 1H NMR (400 MHz, DMSO- d6) d 11.07 (s, 1H), 9.04 (s, 1H), 8.14 (brs, 0.2H, FA), 7.67 (d, J = 8.5 Hz, 1H), 7.58 (s, 1H), 7.32 (d, J = 2.3 Hz, 1H), 7.23 (dd, J = 8.7, 2.3 Hz, 1H), 6.85 (s, 2H), 6.46 (s, 1H), 5.07 (dd, J = 12.9, 5.4 Hz, 1H), 4.39 – 4.01 (m, 2H), 3.88 (s, 7H), 3.76 (s, 3H), 3.62 (t, J = 5.7 Hz, 3H), 3.48 (s, 5H), 3.37– 3.26 (m, 4H), 3.06 (s, 6H), 2.94– 2.84 (m, 1H), 2.63– 2.56 (m, 8H), 2.07– 1.98 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 795.45. Example 33– Preparation 5-[10-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7-methyl-8- oxo-2,7-naph thyridin-3-yl)-4,7-dioxa-1,10-diazaundecan-1-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole- 1,3-dione formic acid (compound D22 formic acid)
Figure imgf000266_0002
Compound D22 was prepared in a similar manner to Example 21. 1H NMR (400 MHz, Methanol- d4) d 9.06 (s, 1H), 8.55 (brs, 1.7H, FA), 7.45 (d, J = 8.4 Hz, 1H), 7.40 (s, 1H), 6.89 (d, J = 2.2 Hz, 1H), 6.83 (s, 2H), 6.74 (dd, J = 8.4, 2.2 Hz, 1H), 6.51 (d, J = 0.7 Hz, 1H), 5.03 (dd, J = 12.7, 5.5 Hz, 1H), 4.56 (s, 2H), 3.95 (s, 6H), 3.72– 3.62 (m, 8H), 3.58– 3.52 (m, 5H), 3.29 (t, J = 5.3 Hz, 2H), 3.13 (s, 9H), 2.95 – 2.81 (m, 1H), 2.79– 2.61 (m, 2H), 2.13– 2.04 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 770.45. Example 34– Preparation 5-([5-[9-([2,6-dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6- naphthyridin-4-yl] phenyl]methyl)-1-oxa-4,9-diazaspiro[5.5]undecan-4-yl]-5-oxopentyl]oxy)-2-(2,6- dioxopiperidin-3-yl)isoindole-1,3-dione formic acid (compound D23 formic acid)
Figure imgf000267_0001
Compound D22 was prepared in a similar manner to Example 26. 1H NMR (400 MHz, Methanol- d4) d 8.58 (brs, 1.1H, formic acid), 8.51 (s, 1H), 7.80 (t, J = 8.9 Hz, 1H), 7.43– 7.39 (m, 1H), 7.35– 7.29 (m, 1H), 7.24 (d, J = 5.0 Hz, 1H), 7.10 (d, J = 3.2 Hz, 1H), 6.83 (d, J = 8.3 Hz, 2H), 5.10 (dt, J = 11.0, 5.5 Hz, 1H), 4.22 (t, J = 6.2 Hz, 3H), 4.10 (s, 1H), 3.93 (d, J = 6.8 Hz, 6H), 3.81– 3.75 (m, 1H), 3.75– 3.70 (m, 1H), 3.65 (s, 3H), 3.63– 3.49 (m, 4H), 3.22– 3.03 (m, 4H), 2.97 (s, 3H), 2.90– 2.71 (m, 3H), 2.52 (dt, J = 30.3, 7.1 Hz, 2H), 2.18– 2.08 (m, 1H), 2.07– 1.97 (m, 2H), 1.96– 1.69 (m, 6H). LCMS (ESI) m/z: [M+H]+ = 850.45. Example 35– Preparation of 4-[[2-(2-[2-[(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6- methyl-5-oxo-2,6-naphthyridin-3-yl)amino]ethoxy]ethoxy)ethyl]amino]-2-(2,6-dioxopiperidin-3- yl)isoindole-1,3-dione (compound D24)
Figure imgf000267_0002
Compound D24 was prepared in a similar manner to Example 21. 1H NMR (400 MHz, Methanol- d4) d 8.44 (d, J = 0.9 Hz, 1H), 7.52– 7.42 (m, 1H), 7.23 (d, J = 0.9 Hz, 1H), 7.07 (s, 1H), 6.97 (dd, J = 18.7, 7.8 Hz, 2H), 6.83 (s, 2H), 5.02– 4.96 (m, 1H), 4.28– 4.11 (m, 2H), 3.96 (s, 6H), 3.80– 3.75 (m, 4H), 3.74– 3.70 (m, 4H), 3.61 (s, 3H), 3.55 (t, J = 5.3 Hz, 2H), 3.47 (t, J = 5.1 Hz, 2H), 2.81– 2.63 (m, 9H), 2.12– 2.04 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 756.33. Example 36– Preparation of 4-((5-((8-(4-((dimethylamino)methyl)-2,5-dimethoxyphenyl)-6-methyl- 5-oxo-5,6-dihydro-2,6-naphthyridin-3-yl)amino)pentyl)oxy)-2-(2,6-dioxopiperidin-3-yl)isoindoline- 1,3-dione (compound D25)
Figure imgf000268_0001
Compound D25 was prepared in a similar manner to Example 17. 1H NMR (300 MHz, Methanol- d4) d 7.94 (s, 1H), 7.76 (dd, J = 8.6, 7.2 Hz, 1H), 7.54 (s, 1H), 7.46– 7.40 (m, 2H), 7.24 (s, 1H), 7.15 (s, 1H), 7.08 (s, 1H), 5.11 (d, J = 10.8 Hz, 1H), 4.42 (s, 2H), 4.28 (t, J = 5.8 Hz, 2H), 3.95 (s, 3H), 3.77 (s, 3H), 3.61 (s, 3H), 3.46 (t, J = 6.5 Hz, 2H), 2.94 (s, 6H), 2.92– 2.83 (m, 1H), 2.80– 2.76 (m, 1H), 2.75– 2.68 (m, 1H), 2.18– 2.07 (m, 1H), 2.01– 1.90 (m, 2H), 1.87– 1.72 (m, 4H). LCMS (ESI) m/z: [M+H]+ = 711.85. Example 37– Preparation 2-[(8-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-6-methyl-5-oxo- 2,6-naphthyridin-3-yl)amino]-N-(5-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-4-yl]oxy]pentyl) acetamide (compound D26)
Figure imgf000268_0002
Compound D26 was prepared in a similar manner to Example 22. 1H NMR (300 MHz, Methanol- d4) d 8.53 (br s, 1.3H, FA), 8.50 (s, 1H), 7.78 (dd, J = 8.6, 7.2 Hz, 1H), 7.48– 7.43 (m, 2H), 7.37 (s, 1H), 7.15 (s, 1H), 6.88 (s, 2H), 5.10 (dd, J = 12.3, 5.4 Hz, 1H), 4.81 (s, 2H), 4.27 (t, J = 5.9 Hz, 2H), 4.08 (s, 2H), 3.94 (s, 6H), 3.65 (s, 3H), 3.27 (s, 6H), 2.95– 2.64 (m, 4H), 2.19– 2.07 (m, 1H), 1.96– 1.87 (m, 2H), 1.79 – 1.58 (m, 5H). LCMS (ESI) m/z: [M+H]+ = 768.40. Example 38– Preparation 4-((5-(9-(4-(6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7- naphthyridin-4-yl)-2,6-dimethoxybenzyl)-1-oxa-4,9-diazaspiro[5.5]undecan-4-yl)-5-oxopentyl)oxy)- 2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione formic acid (compound D27 formic acid)
Figure imgf000269_0001
Compound D27 was prepared in a similar manner to Example 23. 1H NMR (300 MHz, Methanol- d4) d 9.15 (s, 1H), 8.55 (brs, 1.0H, formic acid), 7.79 (t, J = 7.9 Hz, 1H), 7.46 (d, J = 8.4 Hz, 3H), 6.87 (d, J = 7.2 Hz, 2H), 6.49 (s, 1H), 5.12 (dd, J = 12.1, 5.4 Hz, 1H), 4.36– 4.23 (m, 4H), 3.95 (d, J = 6.4 Hz, 6H), 3.82– 3.72 (m, 2H), 3.66– 3.60 (m, 2H), 3.59 (s, 3H), 3.52 (s, 2H), 3.30– 3.16 (m, 4H), 3.12 (s, 6H), 2.91– 2.59 (m, 5H), 2.20– 2.03 (m, 3H), 2.00– 1.76 (m, 6H). LCMS (ESI) m/z: [M+H]+ = 864.40. Example 39– Preparation of 1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxy phenyl]methyl)-N-(2-[4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperazin-1- yl]ethyl)azeti dine-3-sulfonamide (compound D28)
Figure imgf000269_0002
A solution of N-(2-[4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperazin-1- yl]ethyl)azetidine-3-sulfonamide (60.00 mg, 0.119 mmol, 1.00 equiv) and 4-[6-(dimethylamino)-2-methyl- 1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxybenzaldehyde (52.43 mg, 0.143 mmol, 1.20 equiv) in DMF (1.50 mL) was stirred for 20 minute at room temperature. Then NaBH3CN (14.95 mg, 0.238 mmol, 2.00 equiv) was added to the reaction mixture. The resulting mixture was stirred for 1 hour at room
temperature. The crude product was purified by Prep-HPLC (conditions: Column, Phenomenex Gemini C6-Phenyl, 21.2*250 mm, 5 mm; mobile phase, Water(0.05% FA) and ACN (5% PhaseB up to 23% in 20 minutes); Detector, UV). This resulted in 1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]- 2,6-dimethoxyphenyl]methyl)-N-(2-[4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperazin-1- yl]ethyl) azetidine-3-sulfonamide (13.4 mg,13.16%) as a green solid. 1H NMR (400 MHz, DMSO-d6) d 11.08 (s, 1H), 9.02 (s, 1H), 8.26 (s, 0.3H, FA), 7.66 (d, J = 8.5 Hz, 1H), 7.55 (s, 1H), 7.33 (d, J = 2.3 Hz, 1H), 7.23 (dd, J = 8.7, 2.3 Hz, 1H), 7.07 (t, J = 5.9 Hz, 1H), 6.75 (s, 2H), 6.47 (s, 1H), 5.07 (dd, J = 12.9, 5.4 Hz, 1H), 4.01 (q, J = 7.2 Hz, 1H), 3.81 (s, 6H), 3.62 (s, 2H), 3.49– 3.45 (m, 5H), 3.44– 3.39 (m, 7H), 3.06 (s, 8H), 2.94– 2.82 (m, 1H), 2.59 (d, J = 16.8 Hz, 3H), 2.55 (s, 2H), 2.42 (t, J = 6.7 Hz, 2H), 2.07– 1.97 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 856.34. Example 40– Preparation 4-[2-[4-([2,6-dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6- naphthyridin-4-yl]phenyl]methyl)piperazin-1-yl]-2-oxoethoxy]-2-(2,6-dioxopiperidin-3-yl)isoindole- 1,3-dione (compound D29)
Figure imgf000270_0001
Compound D27 was prepared in a similar manner to Example 23. 1H NMR (300 MHz, Methanol- d4) d 8.55 (d, J = 0.9 Hz, 1H), 7.79 (dd, J = 8.5, 7.3 Hz, 1H), 7.52 (d, J = 7.2 Hz, 1H), 7.40 (d, J = 8.5 Hz, 1H), 7.24 (d, J = 0.9 Hz, 1H), 7.10 (s, 1H), 6.81 (s, 2H), 5.16– 5.07 (m, 3H), 4.06 (s, 2H), 3.91 (s, 6H), 3.83– 3.69 (m, 4H), 3.65 (s, 3H), 3.00– 2.85 (m, 7H), 2.83– 2.68 (m, 3H), 2.21– 2.07 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 738.45. Example 41– Preparation of 5-(4-[2-[1-([2,6-dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6- naphthyridin-4-yl] phenyl]methyl)piperidin-4-yl]ethyl]piperazin-1-yl)-2-(2,6-dioxopiperidin-3- yl)isoindole-1,3-dione formic acid (compound D30 formic acid)
Figure imgf000270_0002
To a stirred solution of 4-bromo-7-chloro-2-methyl-2,6-naphthyridin-1-one (200.00 mg, 0.731 mmol, 1.00 equiv) and methanamine hydrochloride (493.73 mg, 7.312 mmol, 10.00 equiv) in DMSO (15.00 mL) was added K2CO3 (2021.21 mg, 14.625 mmol, 20.00 equiv). T he resulting mixture was stirred for 16 hours at 130 °C under nitrogen atmosphere. The resulting mixture was diluted with water (50 mL). The aqueous layer was extracted with EtOAc (4 x 15 mL). The resulting mixture was washed with brine (15 mL). The resulting mixture was concentrated under reduced pressure to afford 4-bromo-2-methyl-7- (methylamino)-2,6-naphthyridin-1-one (100 mg, 51.01%) as a yellow solid. Step 2: Preparation of 2,6-dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6-naphthyridin-4- yl]benzaldehyde (i85-3)
Figure imgf000271_0001
To a stirred solution of 4-bromo-2-methyl-7-(methylamino)-2,6-naphthyridin-1-one (100.00 mg, 0.373 mmol, 1.00 equiv) and 4-formyl-3,5-dimethoxyphenylboronic acid (93.99 mg, 0.448 mmol, 1.20 equiv) in 1,4-dioxane/H2O(4:1) (5.00 mL) was added cesium carbonate (243.80 mg, 0.746 mmol, 2.00 equiv) and Pd(dppf)Cl2 (27.29 mg, 0.037 mmol, 0.10 equiv). The resulting mixture was stirred for 16 hours at 90 °C under nitrogen atmosphere. The resulting mixture was diluted with water (15 mL). The aqueous layer was extracted with EtOAc (3 x 20 mL). The organic layers were concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with
DCM:MeOH (40:1 to 10:1) to afford 2,6-dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6-naphthyridin-4- yl]benzal dehyde (30 mg, 22.76%) as a yellow solid.
Figure imgf000271_0002
A solution of 2,6-dimethoxy-4-[2-methyl-7-(methylamino)-1-oxo-2,6-naphthyridin-4- yl]benzaldehyde (25.00 mg, 0.071 mmol, 1.00 equiv) and 2-(2,6-dioxopiperidin-3-yl)-5-[4-[2-(piperidin-4- yl)ethyl]piperazin-1-yl]isoindole-1,3-dione (32.09 mg, 0.071 mmol, 1.00 equiv) in DMF (1.00 mL) was stirred for 1 hour at 20 °C under nitrogen atmosphere. To the above mixture was added NaBH(OAc)3 (29.99 mg, 0.141 mmol, 2 equiv). The resulting mixture was stirred for additional 1 hour at 20 °C. The crude product was purified by Prep-HPLC (conditions: SunFire C18 OBD Prep Column, 100Å, 5 µm, 19 mm X 250 mm; Mobile Phase A: Water (0.05% FA), Mobile Phase B:ACN; Flow rate:25 mL/minute; Gradient:9 B to 16 B in 13 minutes; 254 nm; RT: 11.47 minutes) to afford 5-(4-[2-[1-([2,6-dimethoxy-4-[2- methyl-7-(methylamino)-1-oxo-2,6-naphthyridin-4-yl] phenyl]methyl)piperidin-4-yl]ethyl]piperazin-1-yl)-2- (2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (11.7 mg, 20.91%) as a yellow solid. 1H NMR (400 MHz, DMSO-d6) d 11.08 (s, 1H), 8.54 (s, 1H), 8.15 (s, 0.9H, FA), 7.68 (d, J = 8.4 Hz, 1H), 7.34 (d, J = 2.4 Hz, 1H), 7.28– 7.23 (m, 1H), 7.18 (s, 1H), 7.13 (s, 1H), 6.93 (d, J = 5.1 Hz, 1H), 6.78 (s, 2H), 5.07 (dd, J = 12.8, 5.4 Hz, 1H), 3.85 (s, 9H), 3.53 (s, 4H), 3.44– 3.42 (m, 5H), 3.12– 3.08 (m, 2H), 2.91– 2.87 (m, 1H), 2.85 (d, J = 4.9 Hz, 3H), 2.64– 2.53 (m, 3H), 2.37– 2.32 (m, 3H), 2.04– 1.99 (m, 1H), 1.77– 1.70 (m, 2H), 1.47– 1.37 (m, 3H), 1.32– 1.23 (m, 3H). LCMS (ESI) m/z: [M+H]+ = 791.50. Example 42– Preparation of 4-[10-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7-methyl-8- oxo-2,7-naph thyridin-3-yl)-4,7-dioxa-1,10-diazaundecan-1-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole- 1,3-dione (compound D31)
Figure imgf000272_0001
To a stirred solution of 6-chloro-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-2,7- naphthyridin-1-one (335.0 mg, 0.864 mmol, 1.00 equiv) and tert-butyl N-[2-[2-(2- aminoethoxy)ethoxy]ethyl]carbamate (643.4 mg, 2.591 mmol, 3.00 equiv) in DMSO (2 mL) was added K2CO3 (238.7 mg, 1.727 mmol, 2.00 equiv) at room temperature. The resulting mixture was stirred overnight at 130 degrees C. The mixture was allowed to cool down to room temperature. The resulting mixture was filtered, and the filter cake was washed with CH2Cl2 (2 x 3 mL). The filtrate was concentrated under reduced pressure. The residue was purified by reverse flash chromatography (conditions: column, C18 silica gel; Mobile Phase A: Water/0.05% TFA ,Mobile Phase B: ACN; Flow rate: 50 mL/min;
Gradient: 0% B to 40% B in 15 min; detector, 254 nm) to afford tert-butyl N-[2-(2-[2-[(5-[4- [(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7-methyl-8-oxo-2,7-naphthyridin-3-yl)amino]ethoxy]ethoxy) ethyl]carbamate (380 mg, 73.36%) as a yellow oil. LCMS (ESI) m/z: [M+H]+ = 600.
Figure imgf000273_0001
To a stirred solution/mixture of tert-butyl N-[2-(2-[2-[(5-[4-[(dimethylamino)methyl]-3,5- dimethoxyphenyl]-7-methyl-8-oxo-2,7-naphthyridin-3-yl)amino]ethoxy]ethoxy)ethyl]carbamate (190.0 mg, 0.317 mmol, 1.00 equiv) and K2CO3 (87.6 mg, 0.634 mmol, 2 equiv) in acetone (3 mL) was added dimethyl sulfate (44.0 mg, 0.348 mmol, 1.10 equiv) at room temperature. The resulting mixture was stirred overnight at room temperature. The reaction was quenched with water at room temperature. The aqueous layer was extracted with CH2Cl2/isopropanol (3 x 5 mL). The combined organic layers were washed with brine (1 x 10 mL) and dried over anhydrous Na2SO4. After filtration, the filtrate was concentrated under reduced pressure to afford tert-butyl N-[2-(2-[2-[(5-[4-[(dimethylamino)methyl]-3,5- dimethoxyphenyl]-7-methyl-8-oxo-2,7-naphthyridin-3-yl)(methyl)amino]ethoxy]ethoxy)ethyl]carbamate (95.00 mg, 48.86%) as a yellow oil. The crude product was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+ = 614.
Figure imgf000273_0002
To a stirred solution of tert-butyl N-[2-(2-[2-[(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]- 7-methyl-8-oxo-2,7-naphthyridin-3-yl)(methyl)amino]ethoxy]ethoxy)ethyl]carbamate (75.00mg, 0.122 mmol, 1.00 equiv) in dichloromethane (3 mL) was added TFA (1 mL) dropwise at room temperature. The resulting mixture was concentrated under vacuum to afford 3,3,3-trifluoropropanoic acid; 6-([2-[2-(2-amino ethoxy)ethoxy]ethyl](methyl)amino)-4-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-2-methyl-2,7- naphthyridin-1-one (103 mg, crude) as yellow oil. The crude product was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+ = 514. Step 4: Preparation of 4-[10-(5-[4-[(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7-methyl-8-oxo-2,7- naphthyridin-3-yl)-4,7-dioxa-1,10-diazaundecan-1-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (compound D31)
Figure imgf000274_0001
To a stirred solution of 6-([2-[2-(2-aminoethoxy)ethoxy]ethyl](methyl)amino)-4-[4-[(dimethylamino) methyl]-3,5-dimethoxyphenyl]-2-methyl-2,7-naphthyridin-1-one (68.00 mg, 0.132 mmol, 1.00 equiv) in DMF (1 mL) was added 2-(2,6-dioxopiperidin-3-yl)-4-fluoroisoindole-1,3-dione (34.6 mg, 0.125 mmol, 0.95 equiv) and DIEA (85.6 mg, 0.662 mmol, 5.00 equiv) at room temperature. The resulting mixture was stirred for overnight at 80 degrees C. The crude product was purified by Prep-HPLC (conditions: Xselect CSH F-Phenyl OBD Column 19*150mm 5um; Mobile Phase A: Water (0.1%FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 9 B to 19 B in 12 min; 254 nm; Rt:12.63 minutes) to afford 4-[10-(5-[4- [(dimethylamino)methyl]-3,5-dimethoxyphenyl]-7-methyl-8-oxo-2,7-naphthyridin-3-yl)-4,7-dioxa-1,10- diazaundecan-1-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (3.2 mg, 3.14%) as a yellow solid. 1H NMR (400 MHz, Methanol-d4) d 8.96 (s, 1H), 7.54– 7.46 (m, 2H), 6.99 (dd, J = 15.8, 7.7 Hz, 2H), 6.84 (s, 2H), 6.74 (s, 1H), 4.96– 4.94 (m, 1H), 4.57 (s, 2H), 3.97 (s, 6H), 3.77– 3.69 (m, 8H), 3.59– 3.53 (m, 5H), 3.41 (t, J = 5.2 Hz, 2H), 3.17– 3.11 (m, 9H), 2.83– 2.53 (m, 3H), 2.04– 1.95 (m, 1H). LCMS (ESI) m/z: [M+H]+ = 770.50. Example 43– Preparation of Compounds D32-D184
In analogy to the procedures described in the examples above, compounds D32-D184 were prepared using the appropriate starting materials
Figure imgf000274_0002
Figure imgf000275_0001
Figure imgf000276_0001
Figure imgf000277_0001
Figure imgf000278_0001
Figure imgf000279_0001
Figure imgf000280_0001
Figure imgf000281_0001
Figure imgf000282_0001
Figure imgf000283_0001
Figure imgf000284_0001
Figure imgf000285_0001
Figure imgf000286_0001
Figure imgf000287_0001
Figure imgf000288_0001
Figure imgf000289_0001
Figure imgf000290_0001
Figure imgf000291_0001
Figure imgf000292_0001
Figure imgf000293_0001
Figure imgf000294_0001
Figure imgf000295_0001
Figure imgf000296_0001
Figure imgf000297_0001
Figure imgf000298_0001
Figure imgf000299_0001
Figure imgf000300_0001
Figure imgf000301_0001
Example 44– Preparation of Compounds D185-D316
In analogy to the procedures described in the examples above, compounds D185-D316 were prepared using the appropriate starting materials
Figure imgf000301_0002
Figure imgf000302_0001
Figure imgf000303_0001
Figure imgf000304_0001
Figure imgf000305_0001
Figure imgf000306_0001
Figure imgf000307_0001
Figure imgf000308_0001
Figure imgf000309_0001
Figure imgf000310_0001
Figure imgf000311_0001
Figure imgf000312_0001
Figure imgf000313_0001
Figure imgf000314_0001
Figure imgf000315_0001
Figure imgf000316_0001
Figure imgf000317_0001
Figure imgf000318_0001
Figure imgf000319_0001
Figure imgf000320_0001
Figure imgf000321_0001
Figure imgf000322_0003
Example 45– Preparation of 4-(6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4- yl)-2,6-dimethoxybenzaldehyde
Figure imgf000322_0001
Step 1: Preparation of 6-chloro-4-methylpyridine-3-carboxamide
Figure imgf000322_0002
To a stirred mixture of 6-chloro-4-methylpyridine-3-carboxylic acid (20.00 g, 116.564 mmol, 1.00 equivalent) and NH4Cl (62.35 g, 1.17 mol, 10.00 equivalent) in DCM (400 mL) was added DIEA (22.60 g, 174.846 mmol, 3.00 equivalent). After stirring for 5 min, HATU (66.48 g, 174.846 mmol, 1.50 equivalent) was added in portions. The resulting mixture was stirred for 3 hours at room temperature. The resulting mixture was concentrated under reduced pressure, and the residue was purified by silica gel column chromatography, eluted with PE/EtOAc from 1/1 to 3/2 to afford 6-chloro-4-methylpyridine-3-carboxamide (18.30 g, 61.3%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 171.
Figure imgf000323_0001
To a stirred mixture of 6-chloro-4-methylpyridine-3-carboxamide (18.30 g, 107.268 mmol, 1.00 equivalent) and in 2-methyltetrahydrofuran (100 mL) was added DMF-DMA (19.17 g, 160.903 mmol, 1.50 equivalent) at 80 oC under nitrogen atmosphere and stirred for additional 1 hour. Then the mixture was cooled and concentrated to afford 6-chloro-N-[(1E)-(dimethylamino)methylidene]-4-methylpyridine-3- carboxamide (26.3 g, 91.3%) as a yellow crude solid, that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 226.
Step 3: Preparation of 6-chloro-2H-2,7-naphthyridin-1-one
Figure imgf000323_0002
To a stirred mixture of 6-chloro-N-[(1E)-(dimethylamino)methylidene]-4-methylpyridine-3- carboxamide (26.30 g) in THF (170.00 mL) was added t-BuOK (174.00 mL,1mol/L in THF), the resulting solution was stirred at 60 oC under nitrogen atmosphere for 30 min. Then the mixture was cooled and concentrated under reduced pressure, the crude solid was washed with saturated NaHCO3 solution (100 mL) and collected to give 6-chloro-2H-2,7-naphthyridin-1-one (14.1g, 67.0%) as a pink solid, that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 181.
Figure imgf000323_0003
To a stirred mixture of 6-chloro-2H-2, 7-naphthyridin-1-one (14.10 g, 78.077 mmol, 1.00 equivalent) in anhydrous THF (280.00 mL) was added NaH (9.37 g, 234.232 mmol, 3.00 equivalent, 60%) in portions at 0 oC. After 10 min, to above mixture was added MeI (33.25 g, 234.232 mmol, 3.00 equivalent) at 0 oC , the mixture was allowed to stir for 10 min at 0 degrees. Then the mixture was allowed to stir for 12h at room temperature. The resulting mixture was concentrated under reduced pressure. The crude solid was slurried with water (100 mL), and the solid was filtered and collected to give the 6-chloro-2-methyl-2,7- naphthyridin-1-one (14.6 g, 94.1%) as a yellow solid, that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 195. Step 5: Preparation of 4-bromo-6-chloro-2-methyl-2,7-naphthyridin-1-one
Figure imgf000324_0001
To a stirred mixture of 6-chloro-2-methyl-2,7-naphthyridin-1-one (8.00 g, 41.106 mmol, 1.00 equivalent) in DMF (160.00 mL) was added NBS (8.78 g, 49.327 mmol, 1.20 equivalent), the resulting mixture was stirred for 2 h at 90 oC. The reaction mixture was cooled and diluted with DCM (150mL), and washed with water (3x100 mL), the organic layers were dried and concentrated. Then the residue was slurried with EtOAc(20 mL), the slurry was filtered, the filter cake was washed with EtOAc (20 mL) to give 4-bromo-6-chloro-2-methyl-2,7-naphthyridin-1-one (6.32 g, 55.7%) as a white solid, that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 273.
Figure imgf000324_0002
A stirred mixture of 4-bromo-6-chloro-2-methyl-2,7-naphthyridin-1-one (6.00 g, 21.937 mmol, 1.00 equivalent), dimethylamine hydrochloride (5.37 g, 65.811 mmol, 3.00 equivalent) and K2CO3 (15.16 g, 109.685 mmol, 5.00 equivalent) in DMSO (60.00 mL) was heated at 130 oC under nitrogen atmosphere. After 3 h, the resulting mixture was cooled and diluted with water (100mL), and then extracted with EtOAc (3 x 100mL). The combined organic layers were washed with saturated NaCl solution (3 x 50 mL), dried over anhydrous Na2SO4, concentrated under reduced pressure to afford 4-bromo-6- (dimethylamino)-2-methyl-2,7-naphthyridin-1-one (5.91g, 93.6%) as a yellow solid, that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 282. Step 7: Preparation of (4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxy benzaldehyde
Figure imgf000324_0003
To a stirred mixture of 4-bromo-6-(dimethylamino)-2-methyl-2,7-naphthyridin-1-one (5.70 g, 20.203 mmol, 1.00 equivalent) and 2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzaldehyde (8.26 g, 28.284 mmol, 1.40 equivalent) in dioxane (100.00 mL) and H2O (10.00 mL) was added
Pd(dppf)Cl2.CH2Cl2 (1.65 g, 2.020 mmol, 0.10 equivalent) and Cs2CO3 (13.16 g, 40.405 mmol, 2.00 equivalent), then the mixture was allowed to stir for 4 h at 70 oC under nitrogen atmosphere. The resulting mixture was cooled and concentrated under reduced pressure, the residue was slurried with water (100mL) and filtered, the filter cake was collected. And this solid was further slurried with MeOH (100mL) and filtered, the solid was collected to afford product to afford 4-[6-(dimethylamino)-2-methyl-1- oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxybenzaldehyde (6.10 g, 77.6%) as a brown solid. LCMS (ESI) m/z: [M+H]+ = 368. Example 46– Preparation of 3-(6-(1-(4-(6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7- naphthyridin-4-yl)-2,6-dimethoxybenzyl)piperidin-4-yl)-1-oxoisoindolin-2-yl)piperidine-2,6-dione formic acid; and 3-(5-(1-(4-(6-(dimethylamino)-2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)- 2,6-dimethoxybenzyl)piperidin-4-yl)-1-oxoisoindolin-2-yl)piperidine-2,6-dione formic acid
Figure imgf000325_0001
To a stirred solution of 5-bromo-2-benzofuran-1,3-dione (10.00 g, 44.050 mmol, 1.00 equivalent), NaOAc (7.23 mg, 88.134 mmol, 2.00 equivalent) and 3-aminopiperidine-2,6-dione (11.29 g, 88.113 mmol, 2.00 equivalent) in AcOH (80.00 mL) at room temperature. The resulting mixture was stirred for 16 h at 115 oC. The resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with petroleum ether/EtOAc (10:1) to afford 5-bromo-2-(2,6- dioxopiperidin-3-yl)isoindole-1,3-dione (13.6 g, 91.6%) as a dark brown solid. LCMS (ESI) m/z: [M+H]+ =337. Step 2: Preparation of tert-butyl 4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]-3,6-dihydro-2H- pyridine-1-carboxylate
Figure imgf000325_0002
To a stirred solution of 5-bromo-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (3.00 g, 8.899 mmol, 1.00 equivalent), tert-butyl4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-3,6-dihydro-2H-pyridine- 1-carboxylate (3.30 g, 10.672 mmol, 1.20 equivalent), K3PO4 (5.67 g, 26.712 mmol, 3.00 equivalent) in dioxane (20.00 mL) and H2O (4.00 mL) was added Pd(PPh3)2Cl2 (0.62 g, 0.883 mmol, 0.10 equivalent) at room temperature under nitrogen atmosphere. The resulting mixture was stirred for 16 h at 80 oC under nitrogen atmosphere. The resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with PE/EtOAc (8/1) to afford tert-butyl 4-[2-(2,6- dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]-3,6-dihydro-2H-pyridine-1-carboxylate (0.8 g, 20.5%) as a colorless oil. LCMS (ESI) m/z: [M+H]+ =440. Step 3: Preparation of tert-butyl 4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperidine-1- carboxylate
Figure imgf000326_0001
To a stirred solution of tert-butyl 4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]-3,6-dihydro- 2H-pyridine-1-carboxylate (0.80 g) in THF (20.00 mL) was added 10% Pd/C (500.0 mg) under nitrogen atmosphere in a 100 mL round-bottom flask. The mixture was hydrogenated at room temperature for 12 h under hydrogen atmosphere using a hydrogen balloon, filtered through a Celite pad and concentrated under reduced pressure. This resulted in tert-butyl 4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5- yl]piperidine-1-carboxylate (0.73 g, crude) as a white solid that was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+ =442. Step 4: Preparation of tert-butyl 4-(2-(2,6-dioxopiperidin-3-yl)-1-hydroxy-3-oxoisoindolin-5-yl)piperidine-1- carboxylate; tert-butyl 4-(2-(2,6-dioxopiperidin-3-yl)-3-hydroxy-1-oxoisoindolin-5-yl)piperidine-1- carboxylate
Figure imgf000326_0002
To a stirred solution of tert-butyl 4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperidine-1- carboxylate (0.73 g, 16.55 mmol, 1.00 equivalent) and Zn (1.08 g, 1.65 mmol, 10.00 equivalent) in AcOH (10.00 mL) at room temperature. The resulting mixture was stirred for 2 h at 60 oC. The resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column
chromatography, eluted with PE/EtOAc (2:1) to afford tert-butyl 4-(2-(2,6-dioxopiperidin-3-yl)-1-hydroxy-3- oxoisoindolin-5-yl)piperidine-1-carboxylate; tert-butyl 4-(2-(2,6-dioxopiperidin-3-yl)-3-hydroxy-1- oxoisoindolin-5-yl)piperidine-1-carboxylate (0.546 g, 74.8%, mixture of two regio-isomers) as a colorless solid. LCMS (ESI) m/z: [M+H]+ =444.
Figure imgf000326_0003
To a stirred solution of tert-butyl 4-(2-(2,6-dioxopiperidin-3-yl)-1-hydroxy-3-oxoisoindolin-5- yl)piperidine-1-carboxylate; tert-butyl 4-(2-(2,6-dioxopiperidin-3-yl)-3-hydroxy-1-oxoisoindolin-5- yl)piperidine-1-carboxylate (mixture of two regio-isomers, 573.00 mg, 1.00 equivalent) and TFA (3.00 mL) in DCM (9.00 mL) was added TES (450.7 mg, 3.876 mmol, 3.00 equivalent) at room temperature. The resulting mixture was stirred for 2 h at room temperature. The resulting mixture was concentrated under reduced pressure, This was used directly without further purification, to afford 3-(1-oxo-6-(piperidin-4- yl)isoindolin-2-yl)piperidine-2,6-dione; 3-(1-oxo-5-(piperidin-4-yl)isoindolin-2-yl)piperidine-2,6-dione (200 mg 36.6% mixture of two regio-isomers) as an off-white oil. LCMS (ESI) m/z: [M+H]+ = 328.
Figure imgf000327_0001
To a stirred solution of 3-[1-oxo-6-(piperidin-4-yl)-3H-isoindol-2-yl]piperidine-2,6-dione (165.0 mg, 0.504 mmol, 1.00 equivalent), and 3-(1-oxo-6-(piperidin-4-yl)isoindolin-2-yl)piperidine-2,6-dione; 3-(1-oxo- 5-(piperidin-4-yl)isoindolin-2-yl)piperidine-2,6-dione (mixture of two regio-isomers, 222.2 mg, 0.605 mmol, 1.20 equivalent) in DMF (4.00 mL) was added NaBH(OAc)3 (427.3 mg, 2.016 mmol, 4.00 equivalent) at room temperature. The resulting mixture was stirred for 16 h at room temperature. The residue was purified by reverse flash chromatography with the following conditions: column, C18 silica gel; mobile phase, CH3CN in water (0.05% FA), 0% to 50% gradient in 30 min; detector, UV 254 nm. The crude product was purified by Prep-HPLC with the following conditions: Column, Sunfire Prep C18 OBD Column, 10 mm, 19*250 mm; mobile phase, water (0.05% FA) and CH3CN (15% to 22% CH3CN in 15 min); Detector, UV 254 nm. This resulted in 3-[6-[1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7- naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)piperidin-4-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione; formic acid (52.5 mg, 26.3%) as a white solid and 3-[5-[1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7- naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)piperidin-4-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione; formic acid (68.4 mg, 34.2%) as a yellow solid.
For 3-[6-[1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxyphenyl]methyl)piperidin-4-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione; formic acid: 1H NMR (400 MHz, DMSO-d6) d 10.97 (s, 1H), 9.04 (s, 1H), 8.20 (s, 1H, FA), 7.58 (d, J = 14.5 Hz, 2H), 7.52 (s, 2H), 6.79 (s, 2H), 6.50 (s, 1H), 5.10 (dd, J = 13.4, 5.1 Hz, 1H), 4.41 (d, J = 17.1 Hz, 1H), 4.28 (d, J = 17.0 Hz, 1H), 3.84 (s, 6H), 3.68 (s, 2H), 3.49 (s, 3H), 3.08– 3.05 (m, 8H), 2.91–2.89 (m, 1H), 2.66– 2.56 (m, 2H), 2.40–2.35 (m, 1H), 2.30 (t, J = 11.3 Hz, 2H), 2.03– 1.95 (m, 1H), 1.88– 1.57 (m, 4H). LCMS (ESI) m/z: [M+H]+ =679.32.
For 3-[5-[1-([4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxyphenyl]methyl)piperidin-4-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione; formic acid: 1H NMR (400 MHz, DMSO-d6) d 10.98 (s, 1H), 9.05 (s, 1H), 8.15 (s, 1H, FA), 7.69 (d, J = 7.8 Hz, 1H), 7.60 (s, 1H), 7.48 (s, 1H), 7.40 (d, J = 7.9 Hz, 1H), 6.87 (s, 2H), 6.51 (s, 1H), 5.11 (dd, J = 13.3, 5.1 Hz, 1H), 4.44 (d, J = 17.3 Hz, 1H), 4.31 (d, J = 17.3 Hz, 1H), 4.05 (s, 2H), 3.90 (s, 6H), 3.49 (s, 3H), 3.31 (d, J = 11.7 Hz, 2H), 3.09 (s, 6H), 2.99– 2.71 (m, 4H), 2.65– 2.56 (m, 1H), 2.47– 2.33 (m, 1H), 2.04– 1.96 (m, 1H), 1.92 (m, 4H). LCMS (ESI) m/z: [M+H]+ =679.32. Example 47– Preparation of 3-[6-[(7-[[1-(2-[4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin- 4-yl]-2,6-dimethoxyphenyl]ethyl)piperidin-4-yl]methyl]-7-azaspiro[3.5]nonan-2-yl)oxy]-1-oxo-3H- isoindol-2-yl]piperidine-2,6-dione bis(trifluoroacetic acid)
Figure imgf000328_0001
Step 1: Preparation of tert-butyl 2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]oxy]-7- azaspiro[3.5]nonane-7-carboxylate
Figure imgf000328_0002
To a solution of 2-(2,6-dioxopiperidin-3-yl)-5-hydroxyisoindole-1,3-dione (1.37 g, 4.996 mmol, 1.00 equivalent) and tert-butyl 2-hydroxy-7-azaspiro[3.5]nonane-7-carboxylate (1.81 g, 7.494 mmol, 1.5 equivalent) in THF (30.00 mL) was added PPh3 (1.97 g, 7.494 mmol, 1.5 equivalent). To the above mixture was added DIAD (1.52 g, 7.494 mmol, 1.5 equivalent) dropwise over 10 min at 0 °C. The resulting mixture was stirred for additional 5 h at room temperature. The resulting mixture was concentrated under reduced pressure. The residue was purified by reverse flash chromatography with the following conditions: column, C18 silica gel; mobile phase, FA in water, 0% to 100% gradient in 45 min; detector, UV 254 nm. This resulted in tert-butyl 2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5- yl]oxy]-7-azaspiro[3.5]nonane-7-carboxylate (1.964 g, 79.0%) as a white solid. LCMS (ESI) m/z: [M+H]+ = 498. Step 2: Preparation of 5-[7-azaspiro[3.5]nonan-2-yloxy]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione; formic acid
Figure imgf000329_0001
To a solution of tert-butyl 2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]oxy]-7- azaspiro[3.5]nonane-7-carboxylate (1.96 g, 3.939 mmol) in DCM (10.00 mL) was added TFA (10.00 mL). The resulting mixture was stirred for 5 h at room temperature. The reaction mixture was concentrated in vacuo to give crude 5-[7-azaspiro[3.5]nonan-2-yloxy]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione; formic acid, which was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+ = 398.
Figure imgf000329_0002
To a solution of 5-[7-azaspiro[3.5]nonan-2-yloxy]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (2.65 g, 6.668 mmol, 1.00 equivalent) and tert-butyl 4-formylpiperidine-1-carboxylate (1.42 g, 6.668 mmol, 1 equivalent) in DMF (30.00 mL) was added NaBH(OAc)3 (4.24 g, 20.003 mmol, 3 equivalent) at room temperature. The resulting mixture was stirred for 3 h at room temperature. The reaction was quenched by the addition of water (100 mL) at room temperature. The resulting mixture was extracted with EtOAc (3 x 150 mL). The combined organic layers were washed with brine (3 x 150 mL), dried over anhydrous Na2SO4. After filtration, the filtrate was concentrated under reduced pressure. This resulted in tert-butyl 4- [(2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]oxy]-7-azaspiro[3.5]nonan-7-yl)methyl]piperidine-1- carboxylate (3.11 g, 78.4%) as a light yellow solid; LCMS (ESI) m/z: [M+H]+ = 595.
Figure imgf000329_0003
To a solution of tert-butyl 4-[(2-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]oxy]-7- azaspiro[3.5]nonan-7-yl)methyl]piperidine-1-carboxylate (3.00 g, 5.044 mmol, 1.00 equivalent) in AcOH (60.00 mL) were added Zn (3.30 g, 50.445 mmol, 10 equivalent) at room temperature. The resulting mixture was stirred for 3 h at 60 °C. The resulting mixture was filtered, and the filter cake was washed with MeCN (3 x 100 mL). The filtrate was concentrated under reduced pressure. The residue was purified by reverse flash chromatography with the following conditions: column, C18 silica gel; mobile phase, FA in water, 0% to 100% gradient in 35 min; detector, UV 254 nm. This resulted in the mixture of tert-butyl 4-[(2-[[2-(2,6-dioxopiperidin-3-yl)-1-hydroxy-3-oxo-1H-isoindol-5-yl]oxy]-7-azaspiro[3.5]nonan-7- yl)methyl]piperidine-1-carboxylate and tert-butyl 4-[(2-[[2-(2,6-dioxopiperidin-3-yl)-3-hydroxy-1-oxo-3H- isoindol-5-yl]oxy]-7-azaspiro[3.5]nonan-7-yl)methyl]piperidine-1-carboxylate (mixture, 1.6 g, 53.2%) a light yellow solid. LCMS (ESI) m/z: [M+H]+ = 597. Step 5: Preparation of 3-(1-oxo-6-[[7-(piperidin-4-ylmethyl)-7-azaspiro[3.5]nonan-2-yl]oxy]-3H-isoindol-2- yl)piperidine-2,6-dione and 3-(1-oxo-5-[[7-(piperidin-4-ylmethyl)-7-azaspiro[3.5]nonan-2-yl]oxy]-3H- isoindol-2-yl)piperidine-2,6-dione.
Figure imgf000330_0001
To a solution of the mixture of tert-butyl 4-[(2-[[2-(2,6-dioxopiperidin-3-yl)-1-hydroxy-3-oxo-1H- isoindol-5-yl]oxy]-7-azaspiro[3.5]nonan-7-yl)methyl]piperidine-1-carboxylate (2.40 g, 4.022 mmol, 1.00 equivalent) and tert-butyl 4-[(2-[[2-(2,6-dioxopiperidin-3-yl)-3-hydroxy-1-oxo-3H-isoindol-5-yl]oxy]-7- azaspiro[3.5]nonan-7-yl)methyl]piperidine-1-carboxylate) in DCM (50.00 mL) were added TFA (5.00 mL, 67.315 mmol, 16.74 equivalent) and Et3SiH (4.68 g, 40.220 mmol, 10 equivalent) at room temperature. The resulting mixture was stirred for 12 h at room temperature. The resulting mixture was concentrated under reduced pressure. The residue was purified by reverse flash chromatography with the following conditions: column, C18 silica gel; mobile phase, TFA in water, 0% to 10% gradient in 45 min; detector, UV 254 nm. This resulted in 3-(1-oxo-6-[[7-(piperidin-4-ylmethyl)-7-azaspiro[3.5]nonan-2-yl]oxy]-3H- isoindol-2-yl)piperidine-2,6-dione (600 mg, 31.0%) and 3-(1-oxo-5-[[7-(piperidin-4-ylmethyl)-7- azaspiro[3.5]nonan-2-yl]oxy]-3H-isoindol-2-yl)piperidine-2,6-dione (1.2 g, 62.1%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+ = 481.
Figure imgf000330_0002
To a stirred mixture of 4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde (150.0 mg, 0.408 mmol, 1.00 equivalent) and
(methoxymethyl)triphenylphosphanium chloride (559.8 mg, 1.633 mmol, 4 equivalent) in THF (5.0 mL) was added t-BuOK (183.2 mg, 1.633 mmol, 4 equivalent). The resulting mixture was stirred for 30 min at room temperature under nitrogen atmosphere. To the above mixture was added HCl (6M, 0.5 mL, 0.30 mmol) dropwise. The resulting mixture was stirred for additional 30 min at room temperature. The resulting mixture was concentrated under vacuum. The residue was purified by reverse phase column with the following conditions: column, C18 silica gel; mobile phase, ACN in water, 10% to 80% gradient in 15 min; detector, UV 254 nm. This resulted in 2-[4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4- yl]-2,6-dimethoxyphenyl]acetaldehyde (160 mg, 95.1%) as a white solid. LCMS (ESI) m/z: [M+H]+ = 382.
Figure imgf000331_0001
To a stirred solution of 2-[4-[6-(dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxyphenyl]acetaldehyde (150.0 mg, 0.393 mmol, 1.00 equivalent) and 3-(1-oxo-6-[[7-(piperidin-4- ylmethyl)-7-azaspiro[3.5]nonan-2-yl]oxy]-3H-isoindol-2-yl)piperidine-2,6-dione (189.0 mg, 0.393 mmol, 1 equivalent) in DMF (2.0 mL) was added NaBH(OAc)3 (250.0 mg, 1.180 mmol, 3 equivalent). The resulting mixture was stirred for 2 h at room temperature under nitrogen atmosphere. The crude reaction mixture was purified by Prep-HPLC with the following conditions (Column: XSelect CSH Prep C18 OBD Column,, 19*250mm, 5 mm; Mobile Phase A :Water (0.05% TFA ), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient:8 B to 25 B in 15 min; 254/220 nm; RT1: 12.28 min) to afford 3-[6-[(7-[[1-(2-[4-[6- (dimethylamino)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl]ethyl)piperidin-4-yl]methyl]-7- azaspiro[3.5]nonan-2-yl)oxy]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione; bis(trifluoroacetic acid) (101.2 mg, 30.4%) as a yellow solid.1H NMR (400 MHz, DMSO-d6) d 11.00 (s, 1H), 9.49 (d, J = 109.5 Hz, 2H, TFA salt), 9.04 (s, 1H), 7.57– 7.48 (m, 2H), 7.18– 7.09 (m, 2H), 6.81 (d, J = 2.8 Hz, 2H), 6.48 (s, 1H), 5.11 (dd, J = 13.1, 5.2 Hz, 1H), 4.89 (p, J = 6.8 Hz, 1H), 4.38 (d, J = 17.0 Hz, 1H), 4.28– 4.22 (m, 2H), 3.85 (s, 6H), 3.68 (d, J = 11.3 Hz, 2H), 3.48 (s, 3H), 3.40 (d, J = 11.9 Hz, 1H), 3.33– 3.18 (m, 1H), 3.08 (s, 6H), 3.06– 2.84 (m, 9H), 2.65– 2.56 (m, 2H), 2.46– 2.36 (m, 2H), 2.14– 1.93 (m, 6H), 1.92– 1.79 (m, 5H), 1.46 (q, J = 12.2 Hz, 2H). LCMS (ESI) m/z: [M+H]+ = 846.25. Example 48– Preparation 4-(6-cyclopropyl-2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)-2,6- dimethoxybenzaldehyde
Figure imgf000332_0001
To a stirred solution of 6-chloro-2-methyl-2,7-naphthyridin-1-one (500.00 mg, 2.569 mmol, 1.00 equivalent) and cyclopropylboronic acid (441.37 mg, 5.138 mmol, 2 equivalent) in toluene (20.00 mL) and water (1.00 mL) was added tricyclohexylphosphane (144.09 mg, 0.514 mmol, 0.20 equivalent), Pd(AcO)2 (57.68 mg, 0.257 mmol, 0.10 equivalent) and K3PO4 (1636.01 mg, 7.707 mmol, 3.00 equivalent) at room temperature under nitrogen atmosphere. The resulting mixture was stirred for 1h at 110 oC. The mixture was concentrated under reduced pressure. The residue was purified by silica gel column
chromatography, eluted with CH2Cl2 / MeOH (50:1) to afford 6-cyclopropyl-2-methyl-2,7-naphthyridin-1- one (340 mg, 59.48%) as a brown solid. LCMS (ESI) m/z: [M+H]+ = 201.
Figure imgf000332_0002
To a stirred solution of 6-cyclopropyl-2-methyl-2,7-naphthyridin-1-one (100.00 mg, 0.499 mmol, 1.00 equivalent) in DMF (4.00mL) was added NBS (106.66 mg, 0.599 mmol, 1.20 equivalent) at room temperature under nitrogen atmosphere. The resulting mixture was stirred for 2h at 90 oC. The resulting mixture was diluted with water (12 mL), extracted with EtOAc (3x100 mL). The combined organic layers were washed with brine (2 x 50 mL), dried over anhydrous Na2SO4. After filtration, the filtrate was concentrated under reduced pressure to afford 4-bromo-6-cyclopropyl-2-methyl-2,7-naphthyridin-1-one (400 mg, 75.96%) as a brown solid. That was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 279.
Figure imgf000333_0001
To a stirred solution of 4-bromo-6-cyclopropyl-2-methyl-2,7-naphthyridin-1-one (420.00 mg, 1.505 mmol, 1.00 equivalent) and 2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzaldehyde (527.48 mg, 1.806 mmol, 1.2 equivalent) in dioxane (10.00mL) and water (2.00 mL) was added
Pd(dppf)Cl2 (110.09 mg, 0.150 mmol, 0.10 equivalent) and K2CO3 (415.90 mg, 3.009 mmol, 2.00 equivalent) at room temperature under nitrogen atmosphere. The resulting mixture was stirred for overnight at 80 oC. The mixture was concentrated under reduced pressure. The residue was purified by Prep-TLC (CH2Cl2 / MeOH 50:1) to afford 4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6- dimethoxybenzaldehyde (440 mg, 72.22%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 365. Example 49– Preparation of 5-[4-[2-(4-[[4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6- dimethoxyphenyl]methyl]piperazin-1-yl)ethyl]piperidin-1-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole- 1,3-dione
Figure imgf000333_0002
To a solution of tert-butyl 4-(2-oxoethyl)piperidine-1-carboxylate (4.02 g, 17.709 mmol, 1.00 equivalent) and benzyl piperazine-1-carboxylate (3.90 g, 17.727 mmol, 1.00 equivalent) in MeOH (40 mL) was added NaBH3CN (2.26 g, 35.313 mmol, 2 equivalent), the resulting solution was stirred at 25 oC for 1 hours. The resulting mixture was diluted with water (50 mL), extracted with EA (30 mL x 3). The combined organic layers were dried over anhydrous Na2SO4, filtered and evaporated to afford crude product. The crude product was purified by flash silica chromatography, elution gradient 0 to 45% THF in petroleum ether. Pure fractions were evaporated to dryness to afford benzyl 4-(2-(1-(tert- butoxycarbonyl)piperidin-4-yl)ethyl)piperazine-1-carboxylate (2.76 g, 35.71%) as a colorless oil. LCMS (ESI) m/z: [M+H]+ = 432.
Figure imgf000334_0001
To a solution of benzyl 4-(2-(1-(tert-butoxycarbonyl)piperidin-4-yl)ethyl)piperazine-1-carboxylate (2.76 g, 6.403 mmol, 1.00 equivalent) in DCM (8.00 mL) was added a solution of HCl in 1,4-dioxane (8.00 mL, 4 mol/L), the resulting mixture was stirred at 25 oC for 1 hour. The resulting mixture was filtered, the filter cake was washed with DCM (5 mL). The collected solid was dried under reduced pressure to afford 4-(2-(piperidin-4-yl)ethyl)piperazine-1-carboxylate (2.08 g, 98.11%) as a white solid. LCMS (ESI) m/z: [M+H]+ = 331.
Figure imgf000334_0002
To a solution of 4-(2-(piperidin-4-yl)ethyl)piperazine-1-carboxylate (1.50 g, 4.532 mmol, 1.00 equivalent) and 2-(2,6-dioxopiperidin-3-yl)-5-fluoroisoindoline-1,3-dione (1.25 g, 4.532 mmol, 1 equivalent) in DMSO (15.00 mL) was added DIEA (3.51 g, 27.192 mmol, 6 equivalent), the resulting solution was stirred at 100 oC for 2 hour. The reaction mixture was diluted with EA (500 mL).
The resulting mixture was washed with water (300 mL x 3) and saturated brine (300 mL x1). The organic layer was dried over Na2SO4, filtered and evaporated to afford crude product. The crude product was purified by silica gel column chromatography, elution gradient 0 to 100% EtOAc in petroleum ether. Pure fractions were evaporated to dryness to afford benzyl 4-(2-(1-(2-(2,6-dioxopiperidin-3-yl)-1,3- dioxoisoindolin-5-yl)piperidin-4-yl)ethyl)piperazine-1-carboxylate (1.44 g, 54.13%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 588. Step 4: Preparation of 2-(2,6-dioxopiperidin-3-yl)-5-(4-(2-(piperazin-1-yl)ethyl)piperidin-1-yl)isoindoline- 1,3-dione
Figure imgf000335_0001
To a solution 4-(2-(1-(2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-5-yl)piperidin-4- yl)ethyl)piperazine-1-carboxylate (1.04 g, 1.772 mmol, 1.00 equivalent) in DCM (30.00 mL) was added a solution of BBr3 in DCM (20 mL, 1M), the resulting mixture was stirred at 0 oC for 1 hour. The reaction mixture was poured into ice-water (100 mL), extracted with DCM (30 mL x 3), the aqueous layer was concentrated under reduced pressure. The residue was purified by flash C18-flash chromatography, elution gradient 0 to 50% MeCN in water (containing 0.1% HCl). Pure fractions were evaporated to dryness to afford 2-(2,6-dioxopiperidin-3-yl)-5-(4-(2-(piperazin-1-yl)ethyl)piperidin-1-yl)isoindoline-1,3- dione (794 mg, 98.75%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 454.
Figure imgf000335_0002
To a stirred mixture of 4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6- dimethoxybenzaldehyde (200.00 mg, 0.549 mmol, 1.00 equivalent) and 2-(2,6-dioxopiperidin-3-yl)-5-[4-[2- (piperazin-1-yl)ethyl]piperidin-1-yl]isoindole-1,3-dione (373.39 mg, 0.823 mmol, 1.50 equivalent) in DMF (3.00 mL) was added NaBH(OAc)3 (68.98 mg, 1.098 mmol, 2.00 equivalent) at room temperature under nitrogen atmosphere. The resulting mixture was stirred for 2h at 40 oC. The mixture solution was purified by Prep-HPLC with the following conditions (Column: Xselect CSH F-Phenyl OBD column, 19*250, 5 mm; Mobile Phase A:Water (0.1%FA), Mobile Phase B: ACN; Flow rate:25 mL/min; Gradient: 6 B to 27 B in 16 min; 254/220 nm; RT1: 15.34 min) to afford 5-[4-[2-(4-[[4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin- 4-yl)-2,6-dimethoxyphenyl]methyl]piperazin-1-yl)ethyl]piperidin-1-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole- 1,3-dione (165 mg, 28.16%) as a yellow solid.1H NMR (400 MHz, DMSO-d6) d 11.09 (s, 1H), 9.30 (s, 1H), 7.80 (s, 1H), 7.67 (d, J = 8.5 Hz, 1H), 7.44 (s, 1H), 7.34 (s, 1H), 7.26 (d, J = 8.8 Hz, 1H), 6.88 (s, 2H), 5.07 (dd, J = 12.9, 5.5 Hz, 1H), 4.35 (s, 2H), 4.08 (d, J = 12.7 Hz, 2H), 3.90 (s, 7H), 3.58 (s, 7H), 3.27– 3.21 (m, 5H), 3.01– 2.82 (m, 3H), 2.64– 2.53 (m, 2H), 2.22 (t, J = 6.5 Hz, 1H), 2.02 (d, J = 12.0 Hz, 1H), 1.77 (d, J = 12.6 Hz, 2H), 1.63 (s, 3H), 1.22 (d, J = 11.6 Hz, 2H), 1.02 (d, J = 8.0 Hz, 4H). LCMS (ESI) m/z: [M+H] + = 802.15. Example 50– Preparation of 3-[6-[(1-[[4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6- dimethoxyphenyl]methyl]335zetidine-3-yl)oxy]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione
Figure imgf000336_0001
Step 1: Preparation of tert-butyl 3-[(4-methylbenzenesulfonyl)oxy]azetidine-1-carboxylate (25).
OTs
BocN
To a stirred solution of tert-butyl 3-hydroxyazetidine-1-carboxylate (2.50 g, 14.433 mmol, 1.00 equivalent) and TsCl (4.13 g, 21.650 mmol, 1.50 equivalent) in DCM were added DMAP (264.49 mg, 2.165 mmol, 0.15 equivalent) and TEA (4.38 g, 43.300 mmol, 3.00 equivalent) in portions at 0 oC under air atmosphere. The resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with Petroleum ether/EtOAc (1:1) to afford tert-butyl 3-[(4-methylbenzenesulfonyl)oxy]azetidine-1-carboxylate (4.4 g, 93.11%) as a brown oil. LCMS (ESI) m/z: [M+H]+ =328. Step 2: Preparation of tert-butyl 3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]oxy] azetidine-1- carboxylate
Figure imgf000336_0002
To a solution of tert-butyl 3-[(4-methylbenzenesulfonyl)oxy]azetidine-1- carboxylate (4.40 g, 13.439 mmol, 1.00 equivalent) and KI (0.22 g, 1.344 mmol, 0.10 equivalent) in DMF was added KHCO3 (4.04 g, 40.318 mmol, 3.00 equivalent) in portions at 100 oC under air atmosphere. The resulting mixture was washed with 3 x 150 mL of EtOAc. The resulting mixture was concentrated under reduced pressure. The residue was purified by reverse flash chromatography with the following conditions: column, C18 silica gel; mobile phase, MeCN in water, 0% to 100% gradient in 40 min; detector, UV 254 nm. This resulted in tert-butyl 3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]oxy]azetidine-1- carboxylate(1.73g, 29.98%) as an off-white solid. LCMS (ESI) m/z: [M+H]+ =430.
Figure imgf000337_0001
A solution of tert-butyl 3-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]oxy] azetidine-1- carboxylate (1.73 g, 4.029 mmol, 1.00 equivalent) and Zn (2.64 g, 40.286 mmol, 10.00 equivalent) in AcOH was stirred for 2 h at 60 oC under air atmosphere. The resulting mixture was washed with 3x100 mL of ethyl acetate. The resulting mixture was concentrated under reduced pressure. The crude product was used in the next step directly without further purification to afford tert-butyl 3-[[2-(2,6- dioxopiperidin-3-yl)-1-hydroxy-3-oxo-1H-isoindol-5-yl] oxy]azetidine-1-carboxylate and tert-butyl 3-[[2- (2,6-dioxopiperidin-3-yl)-3-hydroxy-1-oxo- 3H-isoindol-5-yl]oxy]azetidine-1-carboxylate (2.73 g, 78.53%) as an off-white solid. LCMS (ESI) m/z: [M+H]+ =432.
Figure imgf000337_0002
To a solution of tert-butyl 3-[[2-(2,6-dioxopiperidin-3-yl)-1-hydroxy-3-oxo-1H -isoindol-5- yl]oxy]azetidine-1-carboxylate and tert-butyl 3-[[2-(2,6-dioxopiperidin-3-yl)-3- hydroxy-1-oxo-3H-isoindol- 5-yl]oxy]azetidine-1-carboxylate (2.73 g, 3.164 mmol, 1.00 equivalent) and TFA (1.50 mL, 20.195 mmol, 6.38 equivalent) in DCM was added Et3SiH (3.68 g, 31.638 mmol, 10.00 equivalent) in portions at room temperature under air atmosphere. The resulting mixture was concentrated under reduced pressure. The crude product (mg) was purified by Prep-HPLC with the following conditions (Column: Xcelect CSH F-pheny OBD Column, 19*250mm,5 mm; Mobile Phase A:Water (0.05% TFA ), Mobile Phase B: can; Flow rate: 30 mL/min; Gradient:5 B to 21 B in 10 min; 254/220 nm; RT1: 7.20/8.67 min) to afford 3-[6- (azetidin-3-yloxy)-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione (165 mg, 8.27%) as an off-white solid. LCMS (ESI) m/z: [M+H]+ =316.
Figure imgf000338_0001
To a stirred solution of 3-[6-(azetidin-3-yloxy)-1-oxo-3H-isoindol-2-yl piperidine-2,6-dione (75.00 mg, 0.238 mmol, 1.00 equivalent) and 4-(6-cyclopropyl-2-methyl-1-oxo- 2,7-naphthyridin-4-yl)-2,6- dimethoxybenzaldehyde (86.67 mg, 0.238 mmol, 1.00 equivalent) in DMF was added NaBH(OAc)3 (100.82 mg, 0.476 mmol, 2.00 equivalent) dropwise at room temperature under air atmosphere for 2 hours. The crude product (mg) was purified by Prep-HPLC with the following conditions (Column:
XSelect CSH Prep C18 OBD Column, 19*250mm, 5mm; Mobile Phase A:Water (0.05% TFA ), Mobile Phase B:ACN; Flow rate: 25 mL/min; Gradient:15 B to 23 B in 12 min; 254/220 nm; RT1: 10.38 min) to afford 3-[6-[(1-[[4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6-dimethoxyphenyl]
methyl]azetidin-3-yl)oxy]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione (18.9 mg, 11.69%) as an off-white solid. 1H NMR (400 MHz, Methanol-d4) d 9.39 (d, J = 0.8 Hz, 1H), 7.80 (d, J = 4.5 Hz, 1H), 7.60 (t, J = 7.2 Hz, 1H), 7.42 (d, J = 5.4 Hz, 1H), 7.32– 7.24 (m, 1H), 7.22 (d, J = 3.2 Hz, 1H), 6.89 (s, 2H), 5.35– 5.19 (m, 1H), 5.16 (dd, J = 13.3, 5.2 Hz, 1H), 4.84– 4.69 (m, 2H), 4.65 (s, 2H), 4.48 (d, J = 10.6 Hz, 2H), 4.42 (s, 2H), 3.98 (d, J = 22.6 Hz, 6H), 3.69 (s, 3H), 2.93 (ddd, J = 17.6, 13.5, 5.4 Hz, 1H), 2.80 (ddd, J = 17.6, 4.7, 2.4 Hz, 1H), 2.52 (qd, J = 13.2, 4.7 Hz, 1H), 2.21 (dddd, J = 14.5, 10.7, 6.9, 3.9 Hz, 2H), 1.23– 1.12 (m, 2H), 1.09 (d, J = 4.4 Hz, 2H). LCMS (ESI) m/z: [M+H]+ =664. Example 51. Preparation of 5-((7-((1-(4-(6-cyclopropyl-2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin- 4-yl)-2,6-dimethoxybenzyl)piperidin-4-yl)methyl)-7-azaspiro[3.5]nonan-2-yl)oxy)-2-(2,6- dioxopiperidin-3-yl)isoindoline-1,3-dione
Figure imgf000338_0002
To a stirred solution of 2-(2,6-dioxopiperidin-3-yl)-5-[[7-(piperidin-4-ylmethyl)-7-azaspiro[3.5]no nan-2-yl]oxy]isoindole-1,3-dione (100.00 mg, 0.202 mmol, 1.00 equivalent) and 4-(6-cyclopropyl-2- methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6-dimethoxybenzaldehyde (73.68 mg, 0.202 mmol, 1 equivalent) in MeOH (3.00 mL) was added NaBH3CN (25.41 mg, 0.404 mmol, 2 equivalent). The resulting mixture was stirred at 40 °C for 4 hours. Without any additional work-up, the mixture was purified by prep-HPLC (Column: Kinetex EVO C18 Column, 21.2*150,5 mm; Mobile Phase A: Water (10 mM NH4HCO3), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 25 B to 50 B in 12 min; 254/220 nm; RT1:11.92 min) to give 5-([7-[(1-[[4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6- dimethoxyphenyl]methyl]piperidin-4-yl)methyl]-7-azaspiro[3.5]nonan-2-yl]oxy)-2-(2,6-dioxopiperidin-3- yl)isoindole-1,3-dione (35mg, 20.53%) as a white solid.1H NMR (300 MHz, DMSO-d6) d 11.13 (s, 1H), 9.29 (s, 1H), 8.19 (s, 2H), 7.87– 7.74 (m, 2H), 7.44 (s, 1H), 7.35– 7.21 (m, 2H), 6.74 (s, 2H), 5.12 (dd, J = 12.8, 5.4 Hz, 1H), 4.99 (t, J = 6.9 Hz, 1H), 3.82 (s, 6H), 3.60 (s, 2H), 3.59-3.57(m,3H) 2.93– 2.84 (m, 4H), 2.63 (s, 1H), 2.62-2.60 (s, 1H),2.55 (s, 3H), 2.23 (d, J = 6.9 Hz, 3H),2.20-2.15(s,1H),2.10 (dd, J = 15.2, 4.6 Hz, 4H), 1.80 (dd, J = 12.0, 6.3 Hz, 2H), 1.69– 1.60 (m, 4H), 1.60-1.50(m,2H)1.47 (s, 1H), 1.07 (d, J = 11.5 Hz, 2H), 1.03– 0.96 (m, 4H). LCMS (ESI) m/z: [M+H]+ = 843.55. Example 52– Preparation of 3-[6-([7-[(1-[[4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)- 2,6-dimethoxyphenyl]methyl]piperidin-4-yl)methyl]-7-azaspiro[3.5]nonan-2-yl]oxy)-1-oxo-3H- isoindol-2-yl]piperidine-2,6-dione
Figure imgf000339_0001
To a stirred solution of 4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6- dimethoxybenzaldehyde) and 3-(1-oxo-6-[[7-(piperidin-4-ylmethyl)-7-azaspiro[3.5]nonan-2-yl]oxy]-3H- isoindol-2-yl)piperidine-2,6-dione) in DMF (10 mL) was added NaBH(OAc)3 in portions at room temperature. The resulting mixture was stirred for 12 h at room temperature. The crude product was purified by Prep-HPLC to afford 3-[6-([7-[(1-[[4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6- dimethoxyphenyl]methyl]piperidin-4-yl)methyl]-7-azaspiro[3.5]nonan-2-yl]oxy)-1-oxo-3H-isoindol-2- yl]piperidine-2,6-dione (14.6 mg, 8.0%) as an off-white solid.1H NMR (300 MHz, Methanol-d4) d 9.40 (s, 1H), 7.76 (s, 1H), 7.51 (d, J = 8.4 Hz, 1H), 7.42 (d, J = 6.3 Hz, 1H), 7.25– 7.14 (m, 2H), 6.89 (s, 2H), 5.16 (dd, J = 13.3, 5.1 Hz, 1H), 4.92– 4.83 (m, 1H), 4.58– 4.35 (m, 4H), 3.99 (s, 6H), 3.69 (s, 3H), 3.67– 3.44 (m, 4H), 3.28– 2.63 (m, 9H), 2.61– 2.46 (m, 2H), 2.36– 1.86 (m, 11H), 1.68 (q, J = 13.1 Hz, 2H), 1.23– 1.08 (m, 4H). LCMS (ESI) m/z: [M+H]+ = 830.01.
Example 53– Preparation of 5-[7-[(1-[[4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6- dimethoxyphenyl]methyl]azetidin-3-yl)methyl]-2,7-diazaspiro[3.5]nonan-2-yl]-2-(2,6-dioxopiperidin- 3-yl)isoindole-1,3-dione
Figure imgf000340_0001
Step 1: Preparation of tert-butyl 2-(2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindolin-5-yl)-2,7-diazaspiro[3.5] nonane-7-carboxylate
Figure imgf000340_0002
To a stirred solution of 2-(2,6-dioxopiperidin-3-yl)-5-fluoroisoindole-1,3-dione (5.00 g, 18.101 mmol, 1.00 equivalent) and tert-butyl 2,7-diazaspiro[3.5]nonane-7-carboxylate (4.10 g, 0.018 mmol, 1 equivalent) in DMSO (50 mL) was added DIEA (9.36 g, 72.422 mmol, 4.00 equivalent), the resulting solution was stirred at 100 oC for 4 hours under nitrogen atmosphere. The resulting mixture was diluted with EtOAc (500 mL), the resulting mixture was washed with 3 x 300 mL of water and 300 mL saturated brine. The organic layer was dried over Na2SO4, filtered and evaporated to afford tert-butyl 2-[2-(2,6- dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]-2,7-diazaspiro[3.5]nonane-7-carboxylate (9 g, crude) as a yellow solid. The crude product was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+ = 483
Figure imgf000341_0001
To a solution of tert-butyl 2-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]-2,7- diazaspiro[3.5]nonane-7-carboxylate (9.00 g, 18.651 mmol, 1.00 equivalent) in DCM (90.00 mL) was added TFA (30.00 mL), the resulting solution was stirred at 25 oC for 1 hour. The resulting mixture were evaporated to dryness to afford 5-[2,7-diazaspiro[3.5]nonan-2-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3- dione (11.4g, crude) as a yellow solid that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 383.
Figure imgf000341_0002
To a stirred solution of 5-[2,7-diazaspiro[3.5]nonan-2-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3- dione (3.00 g, 7.845 mmol, 1.00 equivalent) and tert-butyl 3-formylazetidine-1-carboxylate (1.45 g, 7.845 mmol, 1.00 equivalent) in DMF (30.00 mL) was added NaBH(OAc)3 (3.33 g, 15.690 mmol, 2 equivalent), the resulting solution was stirred at 25 oC for 12 hours. The reaction mixture was diluted with EA (500 mL). The resulting mixture was washed with 3x300 mL of water and 300 mL saturated brine. The organic layer was dried over Na2SO4, filtered and evaporated to afford tert-butyl 3-([2-[2-(2,6- dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]-2,7-diazaspiro[3.5]nonan-7-yl]methyl)azetidine-1-carboxylate (3.13 g, 72.33%) as a yellow solid that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 552 Step 4: Preparation of 5-[7-(azetidin-3-ylmethyl)-2,7-diazaspiro[3.5]nonan-2-yl]-2-(2,6-dioxopiperidin-3- yl)isoindole-1,3-dione
Figure imgf000341_0003
To a stirred solution of tert-butyl 3-([2-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]-2,7- diazaspiro [3.5]nonan-7-yl]methyl)azetidine-1-carboxylate (3.13 g, 5.674 mmol, 1.00 equivalent) in DCM (30.00 mL) was added TFA (10.00 mL), the resulting solution was stirred at 25 oC for 1 hour. The resulting mixture were evaporated to dryness to afford 5-[7-(azetidin-3-ylmethyl)-2,7- diazaspiro[3.5]nonan-2-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (4.1g,crude) as a yellow solid that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 452 Step 5: Preparation of 5-[7-[(1-[[4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6- dimethoxyphenyl]methyl]azetidin-3-yl)methyl]-2,7-diazaspiro[3.5]nonan-2-yl]-2-(2,6-dioxopiperidin-3- yl)isoindole-1,3-dione
Figure imgf000342_0001
To a stirred solution of 5-[7-(azetidin-3-ylmethyl)-2,7-diazaspiro[3.5]nonan-2-yl]-2-(2,6- dioxopiperidin-3-yl)isoindole-1,3-dione (110.00 mg, 0.244 mmol, 1.00 equivalent) and 4-(6-cyclopropyl-2- methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6-dimethoxybenzaldehyde (88.77 mg, 0.244 mmol, 1.00 equivalent) in MeOH (2.00 mL, 24.699 mmol, 1115.22 equivalent) was added NaBH3CN (30.62 mg, 0.487 mmol, 2.00 equivalent). The resulting mixture was stirred for overnight at room temperature. The mixture solution was purified by Prep-HPLC with the following conditions (Column: XSelect CSH Prep C18 OBD Column,, 5 mm,19*150mm ; Mobile Phase A: Water (0.05% TFA ), Mobile Phase B: ACN; Flow rate:25 mL/min; Gradient: 5 B to 27 B in 15 min; 254/220 nm; RT1:12.38 min) to afford 5-[7-[(1-[[4-(6-cyclopropyl-2- methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6-dimethoxyphenyl]methyl]azetidin-3-yl)methyl]-2,7- diazaspiro[3.5]nonan-2-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (63.9 mg, 31.71%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 800.1H NMR (400 MHz, Methanol-d4) d 9.39 (s, 1H), 7.79 (d, J = 6.3 Hz, 1H), 7.68 (d, J = 8.4, 1.2 Hz, 1H), 7.41 (d, J = 2.9 Hz, 1H), 6.88 (s, 3H), 6.76– 6.67 (m, 1H), 5.13– 5.02 (m, 1H), 4.55 (d, 2H), 4.40 (t, J = 9.3 Hz, 2H), 4.29– 4.11 (m, 2H), 4.05– 3.76 (m, 10H), 3.69 (s, 3H), 3.61– 3.43 (m, 5H), 3.22– 2.98 (m, 2H), 2.94– 2.80 (m, 1H), 2.79– 2.65 (m, 2H), 2.43– 1.93 (m, 6H), 1.27– 1.14 (m, 2H), 1.14– 1.05 (m, 2H). Example 54– Preparation of 5-[4-[2-(1-[[4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6- dimethoxyphenyl]methyl]piperidin-4-yl)ethyl]piperazin-1-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole- 1,3-dione
NH O O O O N O O NH Boc NH
TFA, DCM NH
N O DIPEA,90 o N O N O
C F N N O N O
Boc HN O O O O O O NH NH N O N O N
Boc N TFA, DCM N
N O N O
NaBH(OAc) 3, DMF N HN
Boc
O O N N N N O O O O N O O O N HN N O N
O
Figure imgf000343_0001
To a stirred solution of 2-(2,6-dioxopiperidin-3-yl)-5-fluoroisoindole-1,3-dione (3.00 g, 10.861 mmol, 1.00 equivalent) and tert-butyl piperazine-1-carboxylate (2.02 g, 10.861 mmol, 1.00 equivalent) in NMP (30.00 mL) was added DIPEA (4.21 g, 32.574 mmol, 3.00 equivalent). The resulting mixture was stirred for 2hours at 90 oC under nitrogen atmosphere. The resulting mixture was diluted with water (100 mL). The aqueous layer was extracted with EtOAc (3 x 30 mL). The resulting mixture was concentrated under reduced pressure. The residue was purified by reverse flash chromatography with the following conditions: column, C18 silica gel; mobile phase, MeCN in water, 5% to 90% gradient in 30 min; detector, UV 254 nm. This resulted in tert-butyl 4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperazine-1- carboxylate (1.6 g, 33.29%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 443.
Figure imgf000343_0002
To a stirred solution of tert-butyl 4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperazine -1- carboxylate (2.10 g, 4.746 mmol, 1.00 equivalent) in DCM (32.00 mL) was added TFA (8.00 mL). The resulting mixture was stirred for 2 hours at room temperature. The resulting mixture was concentrated under vacuum to afford 2-(2,6-dioxopiperidin-3-yl)-5-(piperazin-1-yl)isoindole- 1,3-dione (2.6 g, 160%) as a yellow solid. That was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 343. Step 3: tert-butyl 4-(2-[4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperazin-1-yl]ethyl)piperidine- 1-carboxylate
Figure imgf000343_0003
To a stirred solution of 2-(2,6-dioxopiperidin-3-yl)-5-(piperazin-1-yl)isoindole-1,3-dione (2.00 g, 5.842 mmol, 1.00 equivalent) in DMF (25.00 mL) were added tert-butyl 4-(2-oxoethyl)piperidine-1- carboxylate (1.33 g, 5.842 mmol, 1.00 equivalent) under nitrogen atmosphere. The resulting mixture was stirred for 16 hours at 15 oC under nitrogen atmosphere. To the above mixture was added NaBH(OAc)3 (2.48 g, 11.684 mmol, 2.00 equivalent) at 15 oC. The resulting mixture was stirred for additional 2 hours at 15 oC. The resulting mixture was diluted with water (70 mL). The aqueous layer was extracted with EtOAc (4x30 mL). The organic layers were concentrated under vacuum. The residue was purified by silica gel column chromatography, eluted with DCM:MeOH (50:1 to 10:1) to afford tert-butyl 4-(2-[4-[2- (2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperazin-1-yl]ethyl)piperidine-1-carboxylate (3 g, 92.75%) as a yellow oil. LCMS (ESI) m/z: [M+H]+ = 555.
Figure imgf000344_0001
To a stirred solution tert-butyl 4-(2-[4-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperazin- 1-yl]ethyl)piperidine-1-carboxylate (3.00 g, 5.418 mmol, 1.00 equivalent) in DCM (20.00 mL) was added TFA (5.00 mL) at room temperature. The resulting mixture was stirred for overnight at room
temperature. The resulting mixture was concentrated under vacuum to afford 2-(2,6-dioxopiperidin-3-yl)- 5-[4-[2-(piperidin-4-yl)ethyl]piperazin-1-yl]isoindole-1,3-dione (3.5 g, 126.33%) as a yellow oil. That was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 454.
Figure imgf000344_0002
To a stirred solution of 4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6- dimethoxybenzaldehyde (150.00 mg, 0.412 mmol, 1.00 equivalent) and 2-(2,6-dioxopiperidin -3-yl)-5-[4- [2-(piperidin-4-yl)ethyl]piperazin-1-yl]isoindole-1,3-dione (186.69 mg, 0.412 mmol, 1.00 equivalent) in DMF (3.00 mL)was added NaBH(OAc)3 (261.73 mg, 1.235 mmol, 3.00 equivalent) dropwise at room temperature under air atmosphere. The resulting mixture was stirred for overnight at room temperature. The mixture solution was purified by Prep-HPLC with the following conditions (Column: Xselect CSH F- Phenyl OBD column, 19*250, 5 mm; Mobile Phase A: Water(0.05%TFA ), Mobile Phase B:ACN; Flow rate: 25 mL/min; Gradient:12 B to 12 B in 2 min; 254/220 nm; RT1: 11.13min) to afford 5-[4-[2-(1-[[4-(6- cyclopropyl-2-methyl- 1-oxo-2,7-naphthyridin-4-yl)-2,6-dimethoxyphenyl]methyl]piperidin-4- yl)ethyl]piperazin-1-yl]-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione (62 mg, 18.78%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+ = 802.30.1H NMR (400 MHz, DMSO-d6) d 9.30 (s, 1H), 7.83 (d, J = 1.7 Hz, 1H), 7.77 (dd, J = 8.4, 4.8 Hz, 1H), 7.51– 7.40 (m, 2H), 7.40– 7.32 (m, 1H), 6.85 (s, 2H), 5.13– 5.03 (m, 1H), 4.24 (s, 4H), 3.88 (s, 6H), 3.57 (s, 5H), 3.44 (d, J = 11.9 Hz, 2H), 3.20 (q, J = 10.4, 9.5 Hz, 6H), 3.02 (t, J = 12.2 Hz, 2H), 2.94– 2.80 (m, 1H), 2.65– 2.56 (m, 1H), 2.54 (d, J = 4.9 Hz, 1H), 2.30– 2.19 (m, 1H), 2.08– 1.99 (m, 1H), 1.91– 1.70 (m, 3H), 1.67– 1.41 (m, 4H), 1.11– 0.98 (m, 4H). Example 55. Preparation of 3-(6-[4-[2-(1-[[4-(6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)- 2,6-dimethoxyphenyl]methyl]piperidin-4-yl)ethyl]piperazin-1-yl]-1-oxo-3H-isoindol-2-yl)piperidine- 2,6-dione formic acid
Figure imgf000345_0001
To a stirred solution of 3-(1-oxo-6-[4-[2-(piperidin-4-yl)ethyl]piperazin-1-yl]-3H-isoindol-2- yl)piperidine-2,6-dione (160.00 mg, 0.364 mmol, 1.00 equivalent) and 4-(6-cyclopropyl-2-methyl-1-oxo- 2,7-naphthyridin-4-yl)-2,6-dimethoxybenzaldehyde (132.64 mg, 0.364 mmol, 1.00 equivalent) in DMF (2.00 mL) was added NaBH(AcO)3 (154.29 mg, 0.728 mmol, 2.00 equivalent) and titanium isopropoxide (10.35 mg, 0.036 mmol, 0.10 equivalent). The resulting mixture was stirred for 28h at room temperature. The mixture solution was purified by Prep-HPLC with the following conditions: Column: Xselect CSH F- Phenyl OBD column, 19*250, 5 mm; Mobile Phase A: Water (0.05%FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 8 B to 19 B in 10 min; 220/254 nm; RT1: 8.28 min. This resulted in 3-(6-[4-[2-(1-[[4- (6-cyclopropyl-2-methyl-1-oxo-2,7-naphthyridin-4-yl)-2,6-dimethoxyphenyl]methyl]piperidin-4- yl)ethyl]piperazin-1-yl]-1-oxo-3H-isoindol-2-yl)piperidine-2,6-dione; formic acid (16.6 mg, 5.78%) as a white solid. LCMS (ESI) m/z: [M+H]+=788.1H NMR (400 MHz, DMSO-d6) d 10.98 (s, 1H), 9.28 (s, 1H), 8.18 (s, 4H, FA), 7.80 (s, 1H), 7.45– 7.39 (m, 2H), 7.26 (dd, J = 8.4, 2.4 Hz, 1H), 7.16 (d, J = 2.4 Hz, 1H), 6.74 (s, 2H), 5.10 (dd, J = 13.3, 5.1 Hz, 1H), 4.39– 4.16 (m, 2H), 3.82 (s, 6H), 3.60 (s, 3H), 3.56 (s, 4H), 3.18 (s, 5H), 2.90 (d, J = 11.6 Hz, 3H), 2.73– 2.56 (m, 3H), 2.35– 2.32 (m, 2H), 2.30– 2.22 (m, 1H), 2.18 – 2.08 (m, 2H), 2.05– 1.90 (m, 1H), 1.64 (d, J = 12.3 Hz, 2H), 1.39 (d, J = 7.7 Hz, 2H), 1.26– 1.19 (m, 1H), 1.19– 1.09 (m, 2H), 0.99 (dd, J = 10.0, 3.7 Hz, 4H).
Example 56– Preparation of 4-(6-cyclopropyl-2-(methyl-d3)-1-oxo-1,2-dihydro-2,7-naphthyridin-4- yl)-2,6-dimethoxybenzaldehyde
Figure imgf000346_0001
A solution of 6-chloro-2H-2,7-naphthyridin-1-one (500.00 mg, 2.769 mmol, 1.00 equivalent) in THF (5.00 mL) was treated with NaH (132.89 mg, 5.537 mmol, 2.00 equivalent) for 5min at 0 oC followed by the addition of CD3I (802.69 mg, 5.537 mmol, 2.00 equivalent) in portions at 0 °C. After stirring at 0 °C for 1 h, the reaction mixture was poured into ice-water (50 mL), the precipitated solids were collected by filtration and washed with water (3 x 50 mL), then the solid was dried under vacuum to afford 6-chloro- 2-(2H3)methyl-2,7-naphthyridin-1-one (500 mg,91.37%) as a light yellow solid that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 198.
Figure imgf000346_0002
A mixture of 6-chloro-2-(2H3)methyl-2,7-naphthyridin-1-one(400.00 mg, 2.024 mmol, 1.00 equivalent), cyclopropylboronic acid (260.78 mg, 3.036 mmol, 1.50 equivalent), K3PO4 (1288.81 mg, 6.072 mmol, 3.00 equivalent), PCy3 (113.51 mg, 0.405 mmol, 0.20 equivalent) and Pd(AcO)2(45.44 mg, 0.202 mmol, 0.10 equivalent) in Toluene(20.00 mL) and H2O(1.00 mL) was stirred for 2 h at 110 oC under nitrogen atmosphere. The resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH2Cl2 / MeOH (10:1) to afford 6-cyclopropyl-2- (2H3)methyl-2,7-naphthyridin-1-one (350 mg, 85.08%) as a white solid. LCMS (ESI) m/z: [M+H]+ = 204
Figure imgf000347_0001
A mixture of 6-cyclopropyl-2-(2H3)methyl-2,7-naphthyridin-1-one (300.00 mg, 1.476 mmol, 1.00 equivalent) and NBS (315.23 mg, 1.771 mmol, 1.20 equivalent) in ACN (3.00 mL) was stirred for 2 h at 90 oC. The resulting mixture was diluted with 1x50 mL of water. The resulting mixture was extracted with EtOAc (3 x 50 mL). The combined organic layers were washed with water (3 x 50 mL), dried over anhydrous Na2SO4. After filtration, the filtrate was concentrated under reduced pressure. The resulting mixture was concentrated under reduced pressure.to afford 4-bromo-6-cyclopropyl-2-(2H3)methyl-2,7- naphthyridin-1-one(350mg, 84.04%) as a yellow solid that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 282. Step 4: Preparation of 4-[6-cyclopropyl-2-(2H3)methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde
Figure imgf000347_0002
A mixture of 4-bromo-6-cyclopropyl-2-(2H3)methyl-2,7-naphthyridin-1-one (350.00 mg, 1.240 mmol, 1.00 equivalent), 2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzaldehyde (434.86 mg, 1.489 mmol, 1.20 equivalent), Cs2CO3 (808.33 mg, 2.481 mmol, 2.00 equivalent) and Pd(dppf)Cl2(90.76 mg, 0.124 mmol, 0.10 equivalent) in dioxane (3.00 mL) and H2O (1.00 mL) was stirred for 3 hours at 90 oC under nitrogen atmosphere. The resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH2Cl2 / MeOH (10:1) to afford 4-[6-cyclopropyl-2 (2H3) methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxybenzaldehyde (200 mg,43.88%) as an orange solid. LCMS (ESI) m/z: [M+H]+ = 368.
Example 57– Preparation of 5-(7-[[1-([4-[6-cyclopropyl-2-(2H3)methyl-1-oxo-2,7-naphthyridin-4-yl]- 2,6-dimethoxyphenyl]methyl)azetidin-3-yl]methyl]-2,7-diazaspiro[3.5]nonan-2-yl)-2-(2,6- dioxopiperidin-3-yl)isoindole-1,3-dione formic acid
Figure imgf000348_0001
A mixture of 4-[6-cyclopropyl-2-(2H3)methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde(120.00 mg, 0.327 mmol, 1.00 equivalent), 2-(2,6-dioxopiperidin-3-yl)-5-[[7- (piperidin-4-ylmethyl)-7-azaspiro[3.5]nonan-2-yl]oxy]isoindole-1,3-dione(161.54 mg, 0.327 mmol, 1.00 equivalent) and NaBH(AcO)3 (138.44 mg, 0.653 mmol, 2.00 equivalent) in DMF (3.00 mL) was stirred for 2 hours at room temperature. Without any additional work-up, the mixture was purified by Prep-HPLC with the following conditions (Column: XSelect CSH Prep C18 OBD Column, 5 mm,19*150mm ; Mobile Phase A:Water(0.05%FA), Mobile Phase B:ACN; Flow rate:25 mL/min; Gradient:10 B to 18 B in 15 min; 254/220 nm; RT1:12.37; RT2:; Injection Volume: mL; Number Of Runs;) to afford 5-(7-[[1-([4-[6- cyclopropyl-2-(2H3)methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)azetidin-3-yl]methyl]- 2,7-diazaspiro[3.5]nonan-2-yl)-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3-dione; formic acid(12.2mg) as a yellow solid.1H NMR (400 MHz, DMSO-d6) d 11.08 (s, 1H), 9.29 (s, 1H), 8.20 (s, 1H, FA), 7.78 (s, 1H), 7.64 (d, J = 8.2 Hz, 1H), 7.40 (s, 1H), 6.76 (d, J = 4.0 Hz, 3H), 6.64 (dd, J = 8.4, 2.1 Hz, 1H), 5.05 (dd, J = 12.9, 5.4 Hz, 1H), 3.84 (s, 6H), 3.79 (s, 2H), 3.74 (s, 4H), 3.55 (s, 3H), 3.13 (s, 3H), 2.97– 2.79 (m, 1H), 2.71– 2.56 (m, 2H), 2.46 (d, J = 7.0 Hz, 2H), 2.36– 2.21 (m, 4H), 2.05– 1.95 (m, 1H), 1.78– 1.69 (m, 4H), 1.00 (dd, J = 6.6, 4.3 Hz, 4H). LCMS (ESI) m/z: [M+H]+ = 803. Example 58– Preparation of 5-[(7-[[1-([4-[6-cyclopropyl-2-(2H3)methyl-1-oxo-2,7-naphthyridin-4- yl]-2,6-dimethoxyphenyl]methyl)piperidin-4-yl]methyl]-7-azaspiro[3.5]nonan-2-yl)oxy]-2-(2,6- dioxopiperidin-3-yl)isoindole-1,3-dione
Figure imgf000348_0002
A mixture of 4-[6-cyclopropyl-2-(2H3)methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde(60.00 mg, 0.163 mmol, 1.00 equivalent), 2-(2,6-dioxopiperidin-3-yl)-5-[[7- (piperidin-4-ylmethyl)-7-azaspiro[3.5]nonan-2-yl]oxy]isoindole-1,3-dione(80.77 mg, 0.163 mmol, 1.00 equivalent) and NaBH(AcO)3 (69.22 mg, 0.327 mmol, 2.00 equivalent) in DCM (2.00 mL) was stirred for 2 hours at room temperature. The crude product was purified by Prep-HPLC with the following conditions (Column: XSelect CSH Prep C18 OBD Column, 19*250mm, 5 mm; Mobile Phase A: Water (0.05% TFA ), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient:16 B to 21 B in 13 min; 254/220 nm; RT1:10.97 min) to afford 5-[(7-[[1-([4-[6-cyclopropyl-2-(2H3)methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxyphenyl]methyl)piperidin-4-yl]methyl]-7-azaspiro[3.5]nonan-2-yl)oxy]-2-(2,6-dioxopiperidin-3- yl)isoindole-1,3-dione (11.1 mg) as a white solid.1H NMR (300 MHz, Methanol-d4) d 9.38 (s, 1H), 8.56 (s, 1H), 7.81 (d, J = 8.2 Hz, 1H), 7.66 (s, 1H), 7.38 (d, J = 0.9 Hz, 1H), 7.31– 7.20 (m, 2H), 6.86 (s, 2H), 5.13 (dd, J = 12.4, 5.4 Hz, 1H), 4.32 (s, 2H), 3.97 (s, 6H), 3.50 (d, J = 12.2 Hz, 2H), 3.03 (s, 2H), 2.91– 2.70 (m, 3H), 2.51 (d, J = 8.6 Hz, 6H), 2.33 (d, J = 6.7 Hz, 2H), 2.21– 2.08 (m, 2H), 2.07– 1.89 (m, 5H), 1.83 – 1.70 (m, 4H), 1.51 (s, 2H), 1.17– 1.04 (m, 4H).LCMS (ESI) m/z: [M+H]+ = 846. Example 59– Preparation of 5-(4-[2-[4-([2,6-dimethoxy-4-[2-methyl-6-(oxetan-3-yl)-1-oxo-2,7- naphthyridin-4-yl]phenyl]methyl)piperazin-1-yl]ethyl]piperidin-1-yl)-2-(2,6-dioxopiperidin-3- yl)isoindole-1,3-dione formic acid
Figure imgf000349_0001
To a solution of 6-chloro-2-methyl-2,7-naphthyridin-1-one
(300.0 mg, 1.541 mmol, 1.00 equivalent) and 3-bromooxetane (422.3 mg, 3.083 mmol, 2.00 equivalent) in DMF (3.00 mL) was added Zn (302.5 mg, 4.624 mmol, 3.00 equivalent) and NaI (57.8 mg, 0.385 mmol, 0.25 equivalent). The resulting mixture was stirring at 60 oC for 12 hours under a nitrogen atmosphere. The resulting mixture was concentrated. The crude mixture was purified by reverse phase column directly with the following conditions (Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 45 mL/min; Gradient: 8% B to 80% B in 20 min; 254/220 nm) to afford 2-methyl-6-(oxetan-3-yl)-2,7- naphthyridin-1-one (150 mg, 45.0%) as a white solid. LCMS (ESI) m/z: [M+H]+ = 217.
Figure imgf000350_0001
To a solution of 2-methyl-6-(oxetan-3-yl)-2,7-naphthyridin-1- one(100.0 mg, 0.462 mmol, 1.00 equivalent) in DMF (3.00 mL) was added NBS
(90.5 mg, 0.509 mmol, 1.10 equivalent). The resulting mixture was stirring at 25 oC for 2 hours. The resulting mixture was concentrated. The crude mixture was purified by reverse phase column directly with the following conditions (Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 45 mL/min; Gradient: 8% B to 80% B in 20 min; 254/220 nm) to afford 4-bromo-2-methyl-6-(oxetan-3-yl)-2,7- naphthyridin-1-one (105 mg,76.9%) as a white solid. LCMS (ESI) m/z: [M+H]+ = 295. Step 3: Preparation of 2,6-dimethoxy-4-[2-methyl-6-(oxetan-3-yl)-1-oxo-2,7-naphthyridin-4- yl]benzaldehyde
Figure imgf000350_0002
To a solution of 4-bromo-2-methyl-6-(oxetan-3-yl)-2,7-naphthyridin-1-one
(100.0 mg, 0.339 mmol, 1.00 equivalent) and 2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2- yl)benzaldehyde (148.5 mg, 0.508 mmol, 1.50 equivalent) in dioxane (3.00 mL) and H2O (1.00 mL) were added Cs2CO3 (331.2 mg, 1.016 mmol, 3.00 equivalent) and Pd(dppf)Cl2 (24.8 mg, 0.034 mmol, 0.10 equivalent) under nitrogen atmosphere. The resulting mixture was stirring at 80 degree for 3 hours under nitrogen atmosphere. The resulting mixture was concentrated. The crude mixture was purified by reverse phase column directly with the following conditions (Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 45 mL/min; Gradient: 8% B to 80% B in 20 min; 254/220 nm) to afford. This resulted in (130mg, crude) of 2,6-dimethoxy-4-[2-methyl-6-(oxetan-3-yl)-1-oxo-2,7-naphthyridin-4- yl]benzaldehyde (110 mg, 85.3%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 381.
Figure imgf000351_0001
To a stirred mixture of 2,6-dimethoxy-4-[2-methyl-6-(oxetan-3-yl)-1-oxo-2,7-naphthyridin-4- yl]benzaldehyde (50.0 mg, 0.131 mmol, 1.00 equivalent) and 2-(2,6-dioxopiperidin-3-yl)-5-[4-[2- (piperazin-1-yl)ethyl]piperidin-1-yl]isoindole-1,3-dione (65.6 mg, 0.145 mmol, 1.10 equivalent) in DMF (2.00 mL) was added NaBH(OAc)3 (55.72 mg, 0.263 mmol, 2.00 equivalent) at room temperature. The above mixture was stirred for 3 hours. Then the crude reaction mixture was directly purified by Prep- HPLC (Column: Xselect CSH F-phenyl OBD Column, 19*250mm, 5 mm; Mobile Phase A: Water (0.05% TFA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 15% B to 24% B in 14 min; 254 /220nm; Rt: 12.97 min). This resulted in 5-(4-[2-[4-([2,6-dimethoxy-4-[2-methyl-6-(oxetan-3-yl)-1-oxo-2,7- naphthyridin-4-yl]phenyl]methyl)piperazin-1-yl]ethyl]piperidin-1-yl)-2-(2,6-dioxopiperidin-3-yl)isoindole-1,3- dione; formic acid (40 mg, 37.2%) as a yellow solid.1H NMR (400 MHz, DMSO-d6) d 11.08 (s, 1H), 9.50 (s, 1H), 8.15 (s, 1H, FA), 7.87 (s, 1H), 7.65 (d, J = 8.5 Hz, 1H), 7.46 (s, 1H), 7.30 (d, J = 2.2 Hz, 1H), 7.23 (dd, J = 8.8, 2.3 Hz, 1H), 6.74 (s, 2H), 5.07 (dd, J = 13.0, 5.3 Hz, 1H), 4.89 (dd, J = 8.4, 5.5 Hz, 2H), 4.79 (dd, J = 6.7, 5.5 Hz, 2H), 4.59– 4.47 (m, 1H), 4.04 (d, J = 13.0 Hz, 2H), 3.81 (s, 6H), 3.58 (d, J = 8.8 Hz, 6H), 3.00– 2.82 (m, 3H), 2.73– 2.57 (m, 4H), 2.55– 2.41 (m, 4H), 2.40– 2.23 (m, 3H), 2.05– 1.97 (m, 1H), 1.78– 1.71 (m, 2H), 1.66– 1.51 (m, 1H), 1.42– 1.34 (m, 2H), 1.24– 1.11 (m, 2H). LCMS (ESI) m/z: [M+H]+ = 818.60.
Example 60– Preparation of 3-[5-(4-[2-[4-([2,6-dimethoxy-4-[2-methyl-1-oxo-6-(trifluoromethyl)-2,7- naphthyridin-4-yl]phenyl]methyl)piperazin-1-yl]ethyl]piperidin-1-yl)-1-oxo-3H-isoindol-2- yl]piperidine-2,6-dione
Figure imgf000352_0001
To a stirred solution of 5-bromo-4-methyl-2-(trifluoromethyl)pyridine (500.00 mg, 2.083 mmol, 1.00 equivalent) and Zn(CN)2 (146.79 mg, 1.250 mmol, 0.6 equivalent) in DMF (5.00 mL) was added Pd2(dba)3 (38.15 mg, 0.042 mmol, 0.02 equivalent) and DPPF (46.03 mg, 0.083 mmol, 0.04 equivalent), the resulting solution was stirred at 120 oC for 3 hours. Without any additional work-up, the mixture was purified by flash C18-flash chromatography, elution gradient 0 to 80% MeCN in water (containing 0.1% NH4HCO3). Pure fractions were evaporated to dryness to afford 4-methyl-6-(trifluoromethyl)pyridine-3- carbonitrile (220mg, 56.74%) as a yellow oil. LCMS (ESI) m/z: [M+H]+ = 187.
Figure imgf000352_0002
To a stirred solution of 4-methyl-6-(trifluoromethyl)pyridine-3-carbonitrile (200.00 mg, 1.074 mmol, 1.00 equivalent) and NH3.H2O (1.00 mL) in EtOH (1.00 mL) was added H2O2 (0.20 mL), the resulting solution was stirred at 25 oC for 4 hours. The reaction mixture was concentrated under reduced pressure to afford 4-methyl-6-(trifluoromethyl)pyridine-3-carboxamide (372 mg, crude) as a white solid that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 205. Step 3: Preparation of N-[(1Z)-(dimethylamino)methylidene]-4-methyl-6-(trifluoromethyl)pyridine-3- carboxamide
Figure imgf000353_0001
To a stirred solution of 4-methyl-6-(trifluoromethyl)pyridine-3-carboxamide (350.00 mg, 1.714 mmol, 1.00 equivalent) and DMF-DMA (306.44 mg) in 2-methyltetrahydrofuran (5.00 mL) was stirred at 80 oC for 2 hours. Then the mixture was concentrated under reduced pressure to afford N-[(1Z)- (dimethylamino)methylidene]-4-methyl-6-(trifluoromethyl)pyridine-3-carboxamide (360 mg crude) as a yellow solid that was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+ = 260.
Figure imgf000353_0002
To a stirred solution of N-[(1Z)-(dimethylamino)methylidene]-4-methyl-6-(trifluoromethyl)pyridine- 3-carboxamide (350.00 mg, 1.350 mmol, 1.00 equivalent) and t-BuOK (227.25 mg, 2.025 mmol, 1.50 equivalent) in THF (4.00 mL) was stirred at 60 oC for 2 hours. The resulting mixture was cooled and concentrated under reduced pressure, the residue was washed with saturated NaHCO3 solution (100 mL). Then the solid was dried under vacuum to give 6-(trifluoromethyl)-2H-2,7-naphthyridin-1-one (295 mg, crude) as an off-white solid. The crude product was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+ = 215.
Figure imgf000353_0003
To a stirred mixture of 6-(trifluoromethyl)-2H-2,7-naphthyridin-1-one (275.00 mg, 1.284 mmol, 1.00 equivalent) in anhydrous DMF (3.00 mL) was added NaH (36.98 mg, 1.541 mmol, 1.20 equivalent, 60%) in portions at 0 oC . After 10 minutes, to above mixture was added MeI (546.82 mg, 3.852 mmol, 3.00 equivalent) at 0 oC and the mixture was allowed to stir for 10 min at 0 oC. Then the mixture was allowed to stir for 12hr at room temperature under nitrogen atmosphere. The crude solid was slurried with water (100 mL), and the solid was filtered and collected to give the 2-methyl-6-(trifluoromethyl)-2,7-naphthyridin-1-one (242 mg, 82.59%) as a yellow solid, that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 229.
Figure imgf000354_0001
To a stirred mixture of 2-methyl-6-(trifluoromethyl)-2,7-naphthyridin-1-one (220.00 mg, 0.964 mmol, 1.00 equivalent) in anhydrous DMF (5.00 mL) was added NBS (188.77 mg, 1.061 mmol, 1.10 equivalent), the mixture was stirred at 90 oC for 2 hours. Without any additional work-up, the residue was purified by Prep-TLC (PE/EtOAc 1:1) to afford 4-bromo-2-methyl-6-(trifluoromethyl)-2,7-naphthyridin-1-one (192 mg, 64.85%) as a white solid. LCMS (ESI) m/z: [M+H]+ = 307.
.
Figure imgf000354_0002
To a solution of 4-bromo-2-methyl-6-(trifluoromethyl)-2,7-naphthyridin-1-one (142.00 mg, 0.462 mmol, 1.00 equivalent) and 2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzaldehyde (189.13 mg, 0.647 mmol, 1.4 equivalent) in dioxane (3.00 mL) was added Pd(dppf)Cl2 (33.84 mg, 0.046 mmol, 0.10 equivalent) and Cs2CO3 (301.34 mg, 0.925 mmol, 2 equivalent), the resulting solution was stirred at 70 oC for 3 hours. Without any additional work-up, the residue was purified by silica gel column chromatography, eluted with CH2Cl2/MeOH (10:1) to afford 2,6-dimethoxy-4-[2-methyl-1-oxo-6- (trifluoromethyl)-2,7-naphthyridin-4-yl]benzaldehyde (275 mg, crude) as a brown solid, that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 393.
Figure imgf000354_0003
To a solution of 2,6-dimethoxy-4-[2-methyl-1-oxo-6-(trifluoromethyl)-2,7-naphthyridin-4- yl]benzaldehyde (78.00 mg, 0.199 mmol, 1.00 equivalent) and 3-(1-oxo-5-[4-[2-(piperazin-1- yl)ethyl]piperidin-1-yl]-3H-isoindol-2-yl)piperidine-2,6-dione (131.08 mg, 0.298 mmol, 1.50 equivalent) in DMF (2.00 mL) was added NaBH(OAc)3 (84.27 mg, 0.398 mmol, 2 equivalent), the resulting solution was stirred at 25 oC for 12 hours. Without any additional work-up, the mixture was purified by prep-HPLC (Column: SunFire Prep C18 OBD Column, 19×150mm 5 mm 10nm; Mobile Phase A: Water (0.05%TFA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient:10 B to 32 B in 10 min; 254/220 nm; RT1:
8.95min) to afford 3-[5-(4-[2-[4-([2,6-dimethoxy-4-[2-methyl-1-oxo-6-(trifluoromethyl)-2,7-naphthyridin-4- yl]phenyl] methyl)piperazin-1-yl]ethyl]piperidin-1-yl)-1-oxo-3H-isoindol-2-yl]piperidine-2,6- dione(25mg,15.41%) as a light brown solid.1H NMR (400 MHz, DMSO-d6) d 10.96 (s, 1H), 9.59 (s, 1H), 8.08 (s, 1H), 7.93 (s, 1H), 7.52 (d, J = 8.5 Hz, 1H), 7.06 (d, J = 8.2 Hz, 2H), 6.94 (d, J = 18.1 Hz, 2H), 5.05 (dd, J = 13.4, 5.1 Hz, 1H), 4.38– 4.15 (m, 3H), 3.87 (s, 8H), 3.67 (s, 3H), 3.63 (s, 3H), 3.11– 3.25 (m, 4H), 2.87 (dt, J = 36.3, 12.4 Hz, 6H), 2.59 (d, J = 18.0 Hz, 2H), 2.36– 2.29 (m, 1H), 2.00– 1.91 (m, 1H), 1.75 (d, J = 12.5 Hz, 2H), 1.57 (s, 3H), 1.25 (d, J = 11.0 Hz, 2H). LCMS (ESI) m/z: [M+H]+ = 816.15. Example 61– Preparation of 3-[5-[7-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxyphe nyl]methyl)-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6- dione formic acid
Figure imgf000355_0001
To a solution of 4-bromo-6-chloro-2-methyl-2,7-naphthyridin-1-one (5.00 g, 18.281 mmol, 1.00 equivalent) and azetidine hydrochloride (3.2 g, 54.843 mmol, 3 equivalent) in DMSO (50.00 mL) was added K2CO3 (12.6 g, 91.404 mmol, 5 equivalent). The resulting solution was stirred at 130 oC for 2 hours. The resulting mixture was cooled and diluted with water (100 mL), and then extracted with EtOAc (3 x 100 mL). The combined organic layers were washed with saturated NaCl solution (3 x 50 mL), dried over anhydrous Na2SO4, concentrated under reduced pressure to afford 6-(azetidin-1-yl)-4-bromo-2- methyl-2,7-naphthyridin-1-one (3.7 g, 68.8%) as a grey solid, that was used directly without further purification. LCMS (ESI) m/z: [M+H]+ = 294. Step 2: Preparation of 4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde
Figure imgf000355_0002
To a solution of 6-(azetidin-1-yl)-4-bromo-2-methyl-2,7-naphthyridin-1-one (1.42 g, 4.827 mmol, 1.00 equivalent) and 4-formyl-3,5-dimethoxyphenylboronic acid (1.52 g, 7.241 mmol, 1.5 equivalent) in dioxane (16.00 mL) and H2O (4.00 mL) were added Pd(dppf)Cl2 (353.2 mg, 0.483 mmol, 0.1 equivalent) and Cs2CO3 (3.15 g, 9.655 mmol, 2 equivalent), and the resulting solution was stirred at 70 oC for 2 hours. The resulting mixture was cooled and concentrated under reduced pressure. The residue was slurried with water (30 mL) and filtered, the filter cake was collected. And this solid was further slurried with MeOH (30 mL) and filtered. The solid was collected to afford product to afford 4-[6-(azetidin-1-yl)-2- methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxybenzaldehyde (1.42 g, 77.5%) as a grey and solid. LCMS (ESI) m/z: [M+H]+ = 380. Example 62– Preparation of 3-[5-[7-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxyph enyl]methyl)-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6- dione formic acid
Figure imgf000356_0001
Step 1: Preparation of tert-butyl 2-[2-(2,6-dioxopiperidin-3-yl)-3-hydroxy-1-oxo-3H-isoindol-5-yl]-2,7-diaza spiro[3.5]nonane-7-carboxylate
Figure imgf000356_0002
To a stirred solution of tert-butyl 2-[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]-2,7- diazaspiro[3.5]nonane-7-carboxylate (500.0 mg, 1.036 mmol, 1.00 equivalent) in AcOH (4.00 mL) was added Zn (677.7 mg, 10.362 mmol, 10.00 equivalent). The resulting mixture was stirred at 60 oC for 2 h. The reaction mixture was filtered, and the filtrate was evaporated to afford crude product. The crude product was purified by reverse phase column, elution gradient 0 to 30% MeCN in water (containing 0.1% formic acid). Pure fractions were evaporated to dryness to afford tert-butyl 2-[2-(2,6-dioxopiperidin-3-yl)- 3-hydroxy-1-oxo-3H-isoindol-5-yl]-2,7-diaza spiro[3.5]nonane-7-carboxylate (277.3 mg, 55.2%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 485.
Figure imgf000357_0001
To a stirred solution of tert-butyl 2-[2-(2,6-dioxopiperidin-3-yl)-3-hydroxy-1-oxo-3H-isoindol-5-yl]- 2,7-diazaspiro[3.5]nonane-7-carboxylate (250.0 mg, 0.516 mmol, 1.00 equivalent) in DCM (2.00 mL) were added TFA (0.50 mL) and Et3SiH (0.20 mL). The resulting mixture was stirred at room temperature for 1 hour. The resulting mixture was concentrated under reduced pressure. This resulted in 3-(5-[2,7- diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2-yl)piperidine-2,6-dione (267.5 mg, crude) as a yellow gum. The crude product was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+ =369.
Figure imgf000357_0002
To a stirred solution of 3-(5-[2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2-yl)piperidine-2,6- dione (400.0 mg, 1.086 mmol, 1.00 equivalent) and 4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4- yl]-2,6-dimethoxybenzaldehyde (494.3 mg, 1.303 mmol, 1.20 equivalent) in DMF (3.00 mL) was added NaBH(OAc)3 (920.4 mg, 4.343 mmol, 4.00 equivalent) at room temperature. The resulting mixture was stirred at room temperature for 2 hours. The crude reaction solution was directly purified by Prep-HPLC with the following conditions (Column: XSelect CSH Prep C18 OBD Column, 5 mm,19*150mm; Mobile Phase A: Water(0.05%FA), Mobile Phase B: ACN; Flow rate:25 mL/min; Gradient:14 B to 22 B in 15 min; 254/220 nm; RT1: 11.72 min) to afford 3-[6-[7-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]- 2,6-dimethoxyp henyl]methyl)-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione; formic acid (99.2 mg, 12.5%) as a white solid.1H NMR (400 MHz, DMSO-d6) d 10.94 (s, 1H), 9.02 (s, 1H), 8.15 (s, 1H, FA), 7.61 (s, 1H), 7.48 (d, J = 8.2 Hz, 1H), 6.75 (s, 2H), 6.53– 6.44 (m, 2H), 6.21 (s, 1H), 5.04 (dd, J = 13.3, 5.2 Hz, 1H), 4.30 (d, J = 17.0 Hz, 1H), 4.17 (d, J = 16.9 Hz, 1H), 4.01 (t, J = 7.4 Hz, 4H), 3.83 (s, 6H), 3.61 (d, J = 13.2 Hz, 6H), 3.48 (s, 3H), 2.96– 2.84 (m, 1H), 2.63– 2.54 (m, 3H), 2.51– 2.45 (m, 2H), 2.35 (q, J = 6.6 Hz, 3H), 1.95 (d, J = 12.9 Hz, 1H), 1.75 (s, 4H). LCMS (ESI) m/z: [M+H]+ = 732.45. Example 63– Preparation of 3-[5-(7-[[1-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]- 2,6-dimethoxyphenyl]methyl)azetidin-3-yl]methyl]-2,7-diazaspiro[3.5]nonan-2-yl)-1-oxo-3H- isoindol-2-yl]piperidine-2,6-dione bis(formic acid)
Figure imgf000358_0001
A solution of methyl 5-bromo-2-methylbenzoate (1.0 g, 4.365 mmol, 1.00 equivalent), BPO (223.7 mg, 0.873 mmol, 0.20 equivalent) and NBS (777.0 mg, 4.365 mmol, 1.00 equivalent) in solvent CCl4 (10.00 mL) was stirred at 80 degree for 3 hours. The resulting mixture was concentrated. The residue was applied onto a silica gel column, eluted with petroleum ether /EtOAc (20:1) to afford methyl 5-bromo-2-(bromomethyl)benzoate (1.1 g, 81.8%) as a light-yellow liquid.
Figure imgf000358_0002
To a solution of methyl 5-bromo-2-(bromomethyl)benzoate (1.0 g, 3.247 mmol, 1.00 equivalent), 3-aminopiperidine-2,6-dione (499.26 mg, 3.896 mmol, 1.20 equivalent) in solvent DMF (10.00 mL) was added DIEA (1.26 g, 9.741 mmol, 3.00 equivalent) at room temperature, and the resulting solution was stirred at 80 degree for 12 hours. The resulting mixture was concentrated. The residue was dissolved in water (100 mL) and extracted with 30% i-PrOH/CH2Cl2 (100 mL x 3). The combined organic layers were washed with brine (100 mL), dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to afford of 3-(6-bromo-1-oxo-3H-isoindol-2-yl)piperidine-2,6-dione (500 mg, 47.7%) as a grey solid. LCMS (ESI) m/z: [M+H]+ = 323. Step 3: Preparation of 4-[6-[7-(tert-butoxycarbonyl)-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2-yl]- 4-carbamoylbutanoic acid
Figure imgf000359_0001
To a mixture of 3-(6-bromo-1-oxo-3H-isoindol-2-yl)piperidine-2,6- dione (500.0 mg, 1.547 mmol, 1.00 equivalent), tert-butyl 2,7-diazaspiro[3.5]nonane-7- carboxylate (350.2 mg, 1.547 mmol, 1.00 equivalent), Cs2CO3 (1.51 g, 4.642 mmol, 3.00 equivalent) and RuPhos Palladacycle Gen 3 (129.4 mg, 0.155 mmol, 0.10 equivalent) was added
solvent dioxane (5.00 mL) under nitrogen atmosphere, and the resulting mixture was stirred at 100 degree for 6 hours under nitrogen atmosphere. The resulting mixture was concentrated. The crude product was purified by reverse phase column directly with the following conditions (Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 45 mL/min; Gradient: 8% B to 80% B in 20 min; 254/220 nm) to afford 4-[6-[7-(tert-butoxycarbonyl)-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2-yl]- 4-carbamoylbutanoic acid (150 mg, 19.9%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 487. Step 4: Preparation of tert-butyl 2-[2-(2,6-dioxopiperidin-3-yl)-3-oxo-1H-isoindol-5-yl]-2,7- diazaspiro[3.5]nonane-7-carboxylate
Figure imgf000359_0002
To a solution of 4-[6-[7-(tert-butoxycarbonyl)-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2- yl]-4-carbamoylbutanoic acid (200.0 mg, 0.411 mmol, 1.00 equivalent) in solvent CH3CN (5.00 mL) was added CDI (133.3 mg, 0.822 mmol, 2.00 equivalent). The resulting solution was stirred at 80 degree for 6 hours. The resulting mixture was concentrated. The crude product was purified by reverse phase column directly with the following conditions (Mobile Phase A: Water (0.1% FA), Mobile Phase B: ACN; Flow rate: 45 mL/min; Gradient: 8% B to 80% B in 20 min; 254/220 nm) to afford tert-butyl 2-[2-(2,6- dioxopiperidin-3-yl)-3-oxo-1H-isoindol-5-yl]-2,7-diazaspiro[3.5]nonane-7-carboxylate (170 mg, 88.3%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 469.
Figure imgf000359_0003
To a solution of tert-butyl 2-[2-(2,6-dioxopiperidin-3-yl)-3-oxo-1H-isoindol-5-yl]-2,7- diazaspiro[3.5]nonane-7-carboxylate (100.0 mg, 0.213 mmol, 1.00 equivalent) in DCM (3.00 mL) was added TFA (1.00 mL) at room temperature. The resulting mixture was stirred for 1 hour at room temperature. It was then concentrated in vacuo to give a crude product which was used directly in the next step. LCMS (ESI) m/z: [M+H]+ = 369.
Figure imgf000360_0001
To a solution of 3-(6-[2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2-yl)piperidine-2,6- dione (100.0 mg, 0.271 mmol, 1.00 equivalent), tert-butyl 3-formylazetidine-1- carboxylate (50.3 mg, 0.271 mmol, 1.00 equivalent) in solvent DMF (3.00 mL) was added
NaBH(OAc)3 (172.6 mg, 0.814 mmol, 3.00 equivalent). The resulting solution was stirred at 25 degree for 3 hours. The mixture was concentrated. The crude product was purified by reverse phase column directly with the following conditions (Mobile Phase A:Water (0.1% FA), Mobile Phase B:ACN; Flow rate: 45 mL/min; Gradient: 8% B to 80% B in 20 min; 254/220 nm) to afford tert-butyl 3-([2-[2-(2,6- dioxopiperidin-3-yl)-3-oxo-1H-isoindol-5-yl]-2,7-diazaspiro[3.5]nonan-7-yl]methyl)azetidine-1- carboxylate (60 mg, 41.1%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 538. Step 7: Preparation of 3-[6-[7-(azetidin-3-ylmethyl)-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2- yl]piperidine-2,6-dione
Figure imgf000360_0002
To a solution of tert-butyl 3-([2-[2-(2,6-dioxopiperidin-3-yl)-3-oxo-1H-isoindol-5-yl]-2,7- diazaspiro[3.5]nonan-7-yl]methyl)azetidine-1-carboxylate (100.0 mg, 0.186 mmol, 1.00 equivalent) in DCM (3.00 mL) was added TFA (1.00 mL) at room temperature. The resulting mixture was stirred for 1 hour at room temperature. It was then concentrated in vacuo to give a crude product which was used directly in the next step. LCMS (ESI) m/z: [M+H]+ = 438.
Figure imgf000360_0003
To a stirred solution of 3-[5-[7-(azetidin-3-ylmethyl)-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H- isoindol-2-yl]piperidine-2,6-dione(35.0 mg, 0.080 mmol, 1.00 equivalent) and 4-[6-(azetidin-1-yl)-2-methyl- 1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxybenzaldehyde(30.4 mg, 0.080 mmol, 1.00 equivalent) in DMF(4.00 mL) was added NaBH(OAc)3 (50.9 mg, 0.240 mmol, 3.00 equivalent) at room temperature. The resulting mixture was stirred for overnight at room temperature. The mixture was filtered, and the filtrate was purified by Prep-HPLC (Column: XSelect CSH Prep C18 OBD Column, 19*250mm,5 mm; Mobile Phase A: Water(0.05%FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient: 5 B to 17 B in 12 min; 254/220 nm; RT1: 8.9-9.53 min) to afford 3-[6-(7-[[1-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7- naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)azetidin-3-yl]methyl]-2,7-diazaspiro[3.5]nonan-2-yl)-1-oxo- 3H-isoindol-2-yl]piperidine-2,6-dione; bis(formic acid) (5.1 mg,7.6%) as a light yellow solid. 1H NMR (400 MHz, DMSO-d6) d 10.97 (s, 1H), 9.02 (s, 1H), 8.18 (s, 2H, FA), 7.61 (s, 1H), 7.38 (d, J = 8.2 Hz, 1H), 6.79 (s, 2H), 6.68 (d, J = 7.5 Hz, 2H), 6.18 (s, 1H), 5.08 (dd, J = 13.2, 5.1 Hz, 1H), 4.31 (d, J = 16.6 Hz, 1H), 4.18 (d, J = 16.7 Hz, 1H), 4.11– 3.97 (m, 6H), 3.86 (s, 6H), 3.82– 3.69 (m, 4H), 3.58 (s, 3H), 3.49 (s, 3H), 2.96– 2.85 (m, 2H), 2.78– 2.71 (m, 1H), 2.64– 2.60 (m, 1H), 2.59– 2.55 (m, 1H), 2.43– 2.26 (m, 7H), 2.06– 1.95 (m, 2H), 1.78– 1.67 (m, 4H). LCMS (ESI) m/z: [M+H]+ = 800.96. Example 64– Preparation of 3-[5-[1-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxy phenyl]methyl)piperidin-4-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione formic acid; and 3-[6-[1-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl] methyl)pipe ridin-4-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione formic acid
Figure imgf000361_0001
To a stirred solution of tert-butyl 4-[2-(2, 6-dioxopiperidin-3-yl)-1,3-dioxoisoindol-5-yl]piperidine-1- carboxylate (1.00 g, 2.265 mmol, 1.00 equivalent) in DCM (8 mL) was added TFA (2.00 mL) at room temperature. The resulting mixture was stirred for 2 h at room temperature. The resulting mixture was concentrated under reduced pressure. This resulted in 2-(2,6-dioxopiperidin-3-yl)-5-(piperidin-4- yl)isoindole-1,3-dione (1.23 g, crude) as a white solid that was used in the next step directly without further purification. LCMS (ESI) m/z: [M+H]+=342.
Figure imgf000362_0001
To a solution of 2-(2,6-dioxopiperidin-3-yl)-5-(piperidin-4-yl)isoindole-1,3-dione (300.0 mg, 0.879 mmol, 1.00 equivalent) in AcOH (5.00 mL) was added Zn (574.9 mg, 8.788 mmol, 10 equivalent), and the resulting solution was stirred at 25 oC for 2 hours. The mixture was diluted with EtOAc (30 mL) and washed with water (30 mL x 3). The organic layers were combined and dried over anhydrous sodium sulfate, filtered and concentrated to give a crude product. The crude product was purified by flash C18 chromatography (elution gradient 0 to 11% ACN in H2O) to give 3-[3-hydroxy-1-oxo-5-(piperidin-4-yl)-3H- isoindol-2-yl]piperidine-2,6-dione and 3-[1-hydroxy-3-oxo-5-(piperidin-4-yl)-1H-isoindol-2-yl]piperidine-2,6- dione (280 mg, mixture of two regio-isomers, 92.8%) as a white solid. LCMS (ESI) m/z: [M+H]+ =344.
Figure imgf000362_0002
To a solution of 3-[3-hydroxy-1-oxo-5-(piperidin-4-yl)-3H-isoindol-2-yl]piperidine-2,6-dione and 3- [1-hydroxy-3-oxo-5-(piperidin-4-yl)-1H-isoindol-2-yl]piperidine-2,6-dione (mixture of two regio-isomers, 260.0 mg, 0.757 mmol, 1.00 equivalent), 4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde (287.3 mg, 0.757 mmol, 1 equivalent) in DMF (3 mL) was added NaBH(OAc)3 (321.0 mg, 1.514 mmol, 2 equivalent), and the resulting solution was stirred at 25 oC for 4 hours. The mixture was diluted with EtOAc (20 mL) and washed with water (20 mL x 3). The organic layers were combined and dried over anhydrous sodium sulfate, filtered and concentrated to give a crude product. The crude product was purified by Prep-TLC (CH2Cl2 / MeOH 10:1) to give 3-[5-[1-([4-[6-(azetidin-1-yl)-2- methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)piperidin-4-yl]-3-hydroxy-1-oxo-3H- isoindol-2-yl]piperidine-2,6-dione and 3-[5-[1-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]- 2,6-dimethoxyphenyl]methyl)piperidin-4-yl]-1-hydroxy-3-oxo-1H-isoindol-2-yl]piperidine-2,6-dione (208 mg, mixture of two regio-isomers, 38.9%) as a white solid. LCMS (ESI) m/z: [M+H]+ =707.
Figure imgf000363_0001
To a solution of 3-[5-[1-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxyph enyl]methyl)piperidin-4-yl]-3-hydroxy-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione and 3-[5- [1-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)piperidin-4-yl]- 1-hydroxy-3-oxo-1H-isoindol-2-yl]piperidine-2,6-dione (mixture of two regio-isomers, 200.0 mg, 0.141 mmol, 1.00 equivalent) in DCM (3.00 mL) was added TFA (2.00 mL, 26.926 mmol, 95.16 equivalent) and triethylsilane (1.00 mL, 6.192 mmol, 21.88 equivalent), and the resulting solution was stirred at 25 oC for 1 hour. The crude product was purified by Prep-HPLC (Column: XSelect CSH Prep C18 OBD Column, 5 mm,19*150 mm; Mobile Phase A: Water (0.05%FA), Mobile Phase B: ACN; Flow rate:25 mL/min;
Gradient: 3 B to 26 B in 14 minutes; 254 nm; RT1: 13.32 min) to afford 3-[5-[1-([4-[6-(azetidin-1-yl)-2- methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl) piperidin-4-yl]-1-oxo-3H-isoindol-2- yl]piperidine-2,6-dione (39.5 mg, 39.1%) and 3-[6-[1-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7- naphthyridin-4-yl]-2,6-dimethoxyphenyl] methyl)piperidin-4-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione; formic acid (24.8 mg, 22.7%) both as a white solid.
For 3-[5-[1-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxyphenyl]methyl) piperidin-4-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione: 1H NMR (400 MHz, DMSO-d6) d 10.99 (s, 1H), 9.02 (s, 1H), 8.16 (s, 1H, FA), 7.68– 7.60 (m, 2H), 7.49 (s, 1H), 7.39 (dd, J = 7.8, 1.4 Hz, 1H), 6.76 (s, 2H), 6.22 (s, 1H), 5.10 (dd, J = 13.3, 5.1 Hz, 1H), 4.42 (d, J = 17.3 Hz, 1H), 4.28 (d, J = 17.3 Hz, 1H), 4.01 (t, J = 7.4 Hz, 4H), 3.84 (s, 6H), 3.69 (s, 2H), 3.49 (s, 3H), 3.05 (d, J = 11.2 Hz, 2H), 2.92 (ddd, J = 17.3, 13.6, 5.4 Hz, 1H), 2.66– 2.60 (m, 1H), 2.60– 2.55 (m, 1H), 2.46– 2.38 (m, 1H), 2.37– 2.28 (m, 4H), 2.04– 1.95 (m, 1H), 1.78– 1.65 (m, 4H). LCMS (ESI) m/z: [M+H]+ = 691.35.
For 3-[6-[1-([4-[6-(azetidin-1-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl] methyl)piperidin-4-yl]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione; formic acid: 1H NMR (400 MHz, DMSO- d6) d 10.99 (s, 1H), 9.02 (s, 1H), 8.18 (s, FA), 7.62 (s, 1H), 7.58– 7.48 (m, 3H), 6.75 (s, 2H), 6.22 (s, 1H), 5.10 (dd, J = 13.3, 5.1 Hz, 1H), 4.41 (d, J = 17.1 Hz, 1H), 4.27 (d, J = 17.1 Hz, 1H), 4.01 (t, J = 7.4 Hz, 4H), 3.84 (s, 6H), 3.63 (s, 2H), 3.48 (s, 3H), 3.00 (d, J = 11.0 Hz, 2H), 2.97– 2.85 (m, 1H), 2.65– 2.60 (m, 1H), 2.60– 2.56 (m, 1H), 2.45– 2.37 (m, 1H), 2.37– 2.30 (m, 1H), 2.24 (t, J = 11.3 Hz, 2H), 2.03– 1.96 (m, 1H), 1.80– 1.73 (m, 2H), 1.73– 1.62 (m, 2H). LCMS (ESI) m/z: [M+H]+ = 691.55. Example 65– Preparation of 3-(5-[[1-([2,6-dimethoxy-4-[2-methyl-6-(morpholin-4-yl)-1-oxo-2,7- naphthyridin-4-yl]phenyl]methyl)azetidin-3-yl]oxy]-1-oxo-3H-isoindol-2-yl)piperidine-2,6-dione
Figure imgf000364_0001
To a stirred solution of 4-bromo-6-chloro-2-methyl-2,7-naphthyridin-1-one (547.00 mg, 2.000 mmol, 1.00 equivalent) and morpholine (522.71 mg, 6.000 mmol, 3.00 equivalent) in DMSO (6.00 mL) was added K2CO3 (1382.00 mg, 10.000 mmol, 5.00 equivalent). The resulting mixture was stirred for 1 h at 130 oC under nitrogen atmosphere. The reaction mixture was diluted with EA (100 mL).
The resulting mixture was washed with 3x100 mL of water and 1x100 mL saturated brine. The organic layer was dried over Na2SO4, filtered and evaporated to afford crude product. The residue was purified by silica gel column chromatography, elution gradient 0 to 10% MeOH in DCM. Pure fractions were evaporated to dryness to afford 4-bromo-2-methyl-6-(morpholin-4-yl)-2,7-naphthyridin-1-one (541 mg, 83.44%) as a light yellow solid. LCMS (ESI) m/z: [M+H]+ = 324. Step 2: Preparation of 2,6-dimethoxy-4-[2-methyl-6-(morpholin-4-yl)-1-oxo-2,7-naphthyridin -4- yl]benzaldehyde
Figure imgf000364_0002
To a solution of 4-bromo-2-methyl-6-(morpholin-4-yl)-2,7-naphthyridin-1-one (540.00 mg, 1.666 mmol, 1.00 equivalent) and 4-formyl-3,5-dimethoxyphenylboronic acid (454.73 mg, 2.165 mmol, 1.30 equivalent), Cs2CO3 (1628.20 mg, 4.997 mmol, 3.00 equivalent) in H2O (1.00 mL) and dioxane (5.00 mL) was added Pd(dppf)Cl2 CH2Cl2 (136.03 mg, 0.167 mmol, 0.10 equivalent) under nitrogen. After stirring for 1 h at 90 oC under a nitrogen atmosphere, the resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, elution gradient 0 to 10% MeOH in DCM. Pure fractions were evaporated to dryness to afford 2,6-dimethoxy-4-[2-methyl-6-(morpholin-4- yl)-1-oxo-2,7 naphthyridin-4-yl] benzaldehyde (356 mg, 52.20%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 410.
Figure imgf000365_0001
To a stirred solution of 3-[5-(azetidin-3-yloxy)-1-oxo-3H-isoindol-2-yl]piperidine -2,6-dione (100.00 mg, 0.317 mmol, 1.00 equivalent) and 2,6-dimethoxy-4 -[2-methyl-6-(morpholin-4-yl)-1-oxo-2,7- naphthyridin-4-yl]benzaldehyde (129.85 mg, 0.317 mmol, 1.00 equivalent) in DMF was added
NaBH(OAc)3 (134.43 mg, 0.634 mmol, 2.00 equivalent) dropwise at room temperature under air atmosphere for 2 hours. The residue was purified by reverse flash chromatography with the following conditions: column, C18 silica gel; mobile phase, MeCN in water, 0% to 100% gradient in 45 min;
detector, UV 254 nm. The crude product was purified by Prep-HPLC with the following conditions (Column: Xcelect CSH F-pheny OBD Column, 19*250mm, 5 mm; Mobile Phase A: Water(0.05%FA); Mobile Phase B: ACN; Flow rate: 30 mL/min; Gradient: 13 B to 33 B in 14 min; 254/220 nm; RT1: 12.85 min) to afford 3-(5-[[1-([2,6-dimethoxy-4-[2-methy l-6-(morpholin-4-yl)-1-oxo-2,7-naphthyridin-4- yl]phenyl]methyl)azetidin-3-yl]oxy]-1-oxo-3H-isoindol-2-yl)piperidine-2,6-dione (100 mg, 44.15%) as a yellow solid.1H NMR (400 MHz, Methanol-d4) d 9.18 (s, 1H), 7.80 (t, J = 6.7 Hz, 1H), 7.49 (s, 1H), 7.09 (t, J = 7.3 Hz, 2H), 6.88 (s, 2H), 6.63 (d, J = 4.9 Hz, 1H), 5.40– 5.20 (m, 1H), 5.15 (dd, J = 13.3, 5.2 Hz, 1H), 4.77 (ddd, J = 24.3, 12.5, 6.8 Hz, 2H), 4.65 (d, J = 22.0 Hz, 2H), 4.48 (d, J = 6.3 Hz, 2H), 4.44– 4.28 (m, 2H), 3.96 (d, J = 23.6 Hz, 6H), 3.78 (t, J = 4.8 Hz, 4H), 3.61 (s, 3H), 3.56 (d, J = 4.7 Hz, 4H), 2.93 (ddd, J = 18.5, 13.5, 5.3 Hz, 1H), 2.80 (ddd, J = 17.5, 4.6, 2.3 Hz, 1H), 2.49 (qd, J = 13.2, 4.7 Hz, 1H), 2.23– 2.14 (m, 1H). LCMS (ESI) m/z: [M+H]+ =709. Example 66– Preparation of 3-[5-[(7-[[1-([4-[6-(1-hydroxy-2-methylpropan-2-yl)-2-methyl-1-oxo-2,7- naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)piperidin-4-yl]methyl]-7-azaspiro[3.5]nonan-2- yl)oxy]-1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione
Figure imgf000366_0001
To a stirred mixture of LDA (825.63 mg, 7.707 mmol, 1.5 equivalent) in THF (20 mL) was added ethyl isobutyrate (895.28 mg, 7.707 mmol, 1.5 equivalent) dropwise at -78 oC under nitrogen atmosphere. The resulting mixture was stirred for 30min at -78oC under nitrogen atmosphere. To the above mixture was added 6-chloro-2-methyl-2,7-naphthyridin-1-one (1.00 g, 5.138 mmol, 1.00 equivalent) in THF (1 mL) dropwise over 2min at -78oC. The resulting mixture was stirred for additional 2 hours at room
temperature. The reaction was quenched with aqueous NH4Cl (5mL) at 0 oC. The resulting mixture was extracted with CH2Cl2 (100 mL). The combined organic layers were washed with water (100 mL), dried over anhydrous Na2SO4. After filtration, the filtrate was concentrated under reduced pressure. The reaction mixture was purified by reverse phase flash with the following conditions (Mobile Phase A: Water (0.3% FA); Mobile Phase B: ACN; Flow rate: 80 mL/min; Gradient: 5% B to 50% B in 30 min) to afford ethyl 2-methyl-2-(7-methyl-8-oxo-2,7-naphthyridin-3-yl)propanoate (320 mg, 11.35%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 275. Step 2: Preparation of 6-(1-hydroxy-2-methylpr
HO
Figure imgf000366_0002
To a stirred mixture of ethyl 2-methyl-2-(7-methyl-8-oxo-2,7-naphthyridin-3-yl)propanoate (240.00 mg, 0.875 mmol, 1.00 equivalent) in EtOH (20.00 mL) was added LiBH4 (209.64 mg, 9.624 mmol, 11.00 equivalent) in portions at 0 oC under nitrogen atmosphere. The resulting mixture was stirred for 16h at room temperature under nitrogen atmosphere. The reaction was quenched with Water at room temperature. The resulting mixture was extracted with CH2Cl2 (20 mL). The combined organic layers were washed with water (2 x 20 mL), dried over anhydrous Na2SO4. After filtration, the filtrate was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH2Cl2 / MeOH (20:1) to afford 6-(1-hydroxy-2-methylpropan-2-yl)-2-methyl-2,7-naphthyridin- 1-one (120 mg, 53.14%) as a white solid. LCMS (ESI) m/z: [M+H]+ = 233.
Figure imgf000367_0001
To a stirred mixture of 6-(1-hydroxy-2-methylpropan-2-yl)-2-methyl-2,7-naphthyridin-1-one (90.00 mg, 0.387 mmol, 1.00 equivalent) in DMF (1.00 mL) was added NBS (82.75 mg, 0.465 mmol, 1.2 equivalent) at room temperature under nitrogen atmosphere. The resulting mixture was stirred for 2 hours at 80 oC under nitrogen atmosphere. The residue was purified by silica gel column chromatography, eluted with CH2Cl2 / MeOH (17:1) to afford 4-bromo-6-(1-hydroxy-2-methylpropan-2-yl)-2-methyl-2,7-naphthyridin- 1-one (80 mg, 66.35%) as a yellow oil. LCMS (ESI) m/z: [M+H]+ = 311.
Step 4: Preparation of 4-[6-(1-hydroxy-2-methylpropan-2-yl)-2-methyl-1-oxo-2,7-naphthyridin-4-yl]-2,6- dimethoxybenzaldehyde
Figure imgf000367_0002
To a solution of 4-bromo-6-(1-hydroxy-2-methylpropan-2-yl)-2-methyl-2,7-naphthyridin-1-one (50.00 mg, 0.161 mmol, 1.00 equivalent) and 2,6-dimethoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2- yl)benzaldehyde (70.41 mg, 0.241 mmol, 1.50 equivalent) in dioxane (2.00 mL) and water (0.40 mL) were added K3PO4 (102.32 mg, 0.482 mmol, 3.00 equivalent) and Pd(PPh3)2Cl2 (11.28 mg, 0.016 mmol, 0.10 equivalent). After stirring for 16 hours at 80 oC under a nitrogen atmosphere, the resulting mixture was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH2Cl2 / MeOH (17:1) to afford 4-[6-(1-hydroxy-2-methylpropan-2-yl)-2-methyl-1-oxo-2,7- naphthyridin-4-yl]-2,6-dimethoxybenzaldehyde (38 mg, 53.69%) as a yellow oil. LCMS (ESI) m/z: [M+H]+ = 397.
Figure imgf000368_0001
To a stirred mixture of 4-[6-(1-hydroxy-2-methylpropan-2-yl)-2-methyl-1-oxo-2,7-naphthyridin-4- yl]-2,6-dimethoxybenzaldehyde (80.00 mg, 0.202 mmol, 1.00 equivalent) and 3-(1-oxo-5-[[7-(piperidin-4- ylmethyl)-7-azaspiro[3.5]nonan-2-yl]oxy]-3H-isoindol-2-yl)piperidine-2,6-dione (96.98 mg, 0.202 mmol, 1.00 equivalent) in DMF (1.00 mL) was added NaBH(OAc)3 (85.54 mg, 0.404 mmol, 2.00 equivalent) at room temperature under nitrogen atmosphere. The resulting mixture was stirred for 2 hours at room temperature under nitrogen atmosphere. The crude product was purified by Prep-HPLC with the following conditions (Column: Xselect CSH F-Phenyl OBD Column 19*150mm 5 mm; Mobile Phase A: Water(0.05%TFA ); Mobile Phase B: ACN; Flow rate:25 mL/min; Gradient:12 B to 24 B in 12 min;
254/220 nm; RT1:9.07 min) to afford 3-[5-[(7-[[1-([4-[6-(1-hydroxy-2-methylpropan-2-yl)-2-methyl-1-oxo- 2,7-naphthyridin-4-yl]-2,6-dimethoxyphenyl]methyl)piperidin-4-yl]methyl]-7-azaspiro[3.5] nonan-2-yl)oxy]- 1-oxo-3H-isoindol-2-yl]piperidine-2,6-dione (73.3 mg, 41.60%) as a yellow solid.1H NMR (400 MHz, DMSO-d6) d 9.42 (d, J = 0.7 Hz, 1H), 7.89 (d, J = 2.9 Hz, 1H), 7.70– 7.61 (m, 2H), 7.06 (d, J = 2.2 Hz, 1H), 6.98 (dd, J = 8.4, 2.3 Hz, 1H), 6.91 (s, 2H), 5.05 (dd, J = 13.2, 5.1 Hz, 1H), 4.87 (q, J = 6.5 Hz, 1H), 4.43– 4.32 (m, 2H), 4.26 (d, J = 13.6 Hz, 2H), 3.91 (s, 6H), 3.55 (s, 3H), 3.45 (d, J = 12.0 Hz, 2H), 3.37 (s, 4H), 3.23– 3.14 (m, 1H), 3.10– 2.83 (m, 6H), 2.61 (d, J = 16.6 Hz, 2H), 2.45– 2.33 (m, 2H), 2.08 (d, J = 11.8 Hz, 1H), 1.87 (d, J = 28.7 Hz, 9H), 1.55– 1.41 (m, 2H), 1.27 (s, 6H). LCMS (ESI) m/z: [M+H]+ = 861. Example 67– Preparation of 3-(6-[7-[(1-[[2,6-dimethoxy-4-(6-methoxy-2-methyl-1-oxo-2,7- naphthyridin-4-yl)phenyl]methyl]azetidin-3-yl)methyl]-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H- isoindol-2-yl)piperidine-2,6-dione
O O O O B N N O O O N N O KOH, MeOH NBS, DMF O
O N N N N
O ,Cs
Cl 70 oC O 90 oC Br Pd(dppf)Cl2 o 2CO3
DMF, 70 C O O H O O N O O O N N N O N N O NH N O NH O O N N O
NaBH(AcO)3 , DMF N
Figure imgf000369_0001
A mixture of 6-chloro-2-methyl-2,7-naphthyridin-1-one (1.00 g, 5.138 mmol, 1.00 equiv) and KOH (0.43 g, 7.707 mmol, 1.50 equiv) in MeOH (10.00 mL) was stirred for 4 hours at 70 oC under nitrogen atmosphere. The resulting mixture was diluted with100 mL of water. The resulting mixture was extracted with EtOAc (3 x 100 mL). The combined organic layers were washed with brine (100 mL), dried over anhydrous Na2SO4. After filtration, the filtrate was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH2Cl2 / MeOH (10:1) to afford 6-methoxy-2- methyl-2,7-naphthyridin-1-one (800 mg, 81.86%) as a white solid. LCMS (ESI) m/z: [M+H]+ = 191.
Figure imgf000369_0002
A mixture of 6-methoxy-2-methyl-2,7-naphthyridin-1-one (800.00 mg, 4.206 mmol, 1.00 equiv) and NBS (898.33 mg, 5.047 mmol, 1.20 equiv) in DMF (10.00 mL) was stirred for 2 hours at 90 oC under nitrogen atmosphere. The resulting mixture was diluted with 100 mL of water. The resulting mixture was extracted with EtOAc (3 x 100 mL). The combined organic layers were washed with brine (100 mL), dried over anhydrous Na2SO4. After filtration, the filtrate was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH2Cl2 / MeOH (10:1) to afford 4- bromo-6-methoxy-2-methyl-2,7-naphthyridin-1-one (600 mg, 53.01%) as a white solid. LCMS (ESI) m/z: [M+H]+ = 269. Step 3: Preparation of tert-butyl 4-[3-(2,6-dioxopiperidin-3-yl)-2-methyl-4-oxoquinazolin-6-yl]piperazine-1- carboxylate
Figure imgf000369_0003
A mixture of 4-bromo-6-methoxy-2-methyl-2,7-naphthyridin-1-one (600.00 mg, 2.230 mmol, 1.00 equiv) , 4-boranyl-2,6-dimethoxybenzaldehyde (396.86 mg, 2.230 mmol, 1.00 equiv), Pd(dppf)Cl2 (163.15 mg, 0.223 mmol, 0.10 equiv) and Cs2CO3 (1452.94 mg, 4.459 mmol, 2.00 equiv) in DMF (10.00 mL) was stirred for 4 hours at 70 oC under nitrogen atmosphere. The resulting mixture was diluted with 100 mL of water, the resulting mixture was extracted with EtOAc (2 x 100 mL). The combined organic layers were washed with brine (50 mL), dried over anhydrous Na2SO4. After filtration, the filtrate was concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluted with CH2Cl2 / MeOH (10:1) to afford 2,6-dimethoxy-4-(6-methoxy-2-methyl-1-oxo-2,7-naphthyridin-4- yl)benzaldehyde (100 mg, 12.66%) as a yellow solid. LCMS (ESI) m/z: [M+H]+ = 355. Step 4: Preparation of 3-(6-[7-[(1-[[2,6-dimethoxy-4-(6-methoxy-2-methyl-1-oxo-2,7-naphthyridin-4- yl)phenyl]methyl]azetidin-3-yl)methyl]-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2-yl)piperidine- 2,6-dione
Figure imgf000370_0001
A mixture of 2,6-dimethoxy-4-(6-methoxy-2-methyl-1-oxo-2,7-naphthyridin-4-yl)benzaldehyde (80.00 mg, 0.226 mmol, 1.00 equiv), 3-[6-[7-(azetidin-3-ylmethyl)-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo- 3H-isoindol-2-yl]piperidine-2,6-dione (98.78 mg, 0.226 mmol, 1.00 equiv) and NaBH(AcO)3 (95.69 mg, 0.452 mmol, 2.00 equiv) in DMF (2.00 mL) was stirred for 3 hours at room temperature. Without any additional work-up, the mixture was purified by Prep-HPLC with the following conditions (Column:
XSelect CSH Prep C18 OBD Column 5um, 19*150mm; Mobile Phase A: Water(0.05% FA), Mobile Phase B: ACN; Flow rate: 25 mL/min; Gradient:13 B to 20 B in 15 min; 254/220 nm; RT1:13.18-14 min) to afford 3-(6-[7-[(1-[[2,6-dimethoxy-4-(6-methoxy-2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]azetidin-3- yl)methyl]-2,7-diazaspiro[3.5]nonan-2-yl]-1-oxo-3H-isoindol-2-yl)piperidine-2,6-dione(11.8mg,6.74%) as a yellow solid.1H NMR (300 MHz, Methanol-d4) d 9.25 (s, 1H), 7.57 (s, 1H), 7.41 (d, J = 8.2 Hz, 1H), 6.96– 6.72 (m, 5H), 5.14 (dd, J = 13.2, 5.1 Hz, 1H), 4.55 (s, 2H), 4.49– 4.30 (m, 4H), 4.27– 4.07 (m, 2H), 3.99 (d, J = 9.8 Hz, 9H), 3.78 (s, 4H), 3.64 (s, 3H), 3.59– 3.48 (m, 5H), 3.27– 3.01 (m, 2H), 3.00– 2.69 (m, 2H), 2.50 (dd, J = 13.1, 4.8 Hz, 1H), 2.35–2.00 (m, 5H). LCMS (ESI) m/z: [M+H]+ = 776. Example 68– BRD9 bromodomain TR-FRET Competition Binding Assay
This example demonstrates the ability of the compounds of the disclosure to biochemically inhibit BRD9 bromodomain in a competition binding assay.
Procedure: His-Flag-BRD9 (P133-K239; Swiss Prot Q9H8M2; SEQ ID NO:1
mgsshhhhhhenlyfq/gdykddddkgslevlfqg/PAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMII KHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK) was cloned, expressed, purified, and then treated with TEV protease. Cleaved His tag was removed by purification. The binding of a biotinylated small molecule ligand of BRD9 was assessed via the LANCE® TR-FRET platform (PerkinElmer), and the compounds were assayed for inhibitory activity against this interaction.
Results: A mixture of biotinylated-ligand and SureLight™ Allophycocyanin-Streptavidin (APC- SA, PerkinElmer AD0201) in 50 mM HEPES (pH 7.4), 50 mM NaCl, 1 mM TCEP (pH 7), 0.01% (v/v) Tween-20, 0.01% (w/v) bovine serum albumin was added to a white 384-well PerkinElmer Proxiplate Plus plate. DMSO or 3-fold serially diluted compounds were then added to the Proxiplate followed by addition of Flag-BRD9. After a 10-minute incubation at room temperature, Eu-W1024 anti-FLAG (PerkinElmer, AD0273) was added. The final reaction mixture that contained 3.75 nM biotinylated ligand, 3 nM Flag- BRD9, 7.5 nM SureLight™ Allophycocyanin-Streptavidin, and 0.2 nM Eu-W1024 anti-FLAG was incubated at room temperature for 90 minutes.
The plates were then read on a PerkinElmer Envision plate reader to determine the ratio of emission at 665 nm over 615 nm. Data was normalized to a DMSO control (100%) and a no protein control (0%) and then fit to a four parameter, non-linear curve fit to calculate an IC50 (mM) as shown in Table 5. As shown by the results in Table 5, a number of compounds of the present disclosure exhibit an IC50 value of < 1 mM for BRD9 binding, indicating their affinity for targeting BRD9. Table 5. Bromodomain TR-FRET Binding
Figure imgf000371_0001
Figure imgf000372_0001
“+” indicates inhibitory effect of ³ 1000 nM;
“++” indicates inhibitory effect of ³ 100 nM;
“+++” indicates inhibitory effect of ³ 10 nM;
“++++” indicates inhibitory effect of < 10 nM;
“NT” indicates not tested Example 69– SYO1 BRD9 NanoLuc Degradation Assay
This example demonstrates the ability of the compounds of the disclosure to degrade a
Nanoluciferase-BRD9 fusion protein in a cell-based degradation assay.
Procedure: A stable SYO-1 cell line expressing 3xFLAG-NLuc-BRD9 was generated. On day 0 cells were seeded in 30 mL media into each well of 384-well cell culture plates. The seeding density was 8000 cells/well. On day 1, cells were treated with 30 nL DMSO or 30 nL of 3-fold serially DMSO-diluted compounds (10 points in duplicates with 1 mM as final top dose). Subsequently plates were incubated for 6 hours in a standard tissue culture incubator and equilibrated at room temperature for 15 minutes. Nanoluciferase activity was measured by adding 15 mL of freshly prepared Nano-Glo Luciferase Assay Reagent (Promega N1130), shaking the plates for 10 minutes and reading the bioluminescence using an EnVision reader.
Results: The Inhibition% was calculated using the following formula: %Inhibition = 100 x (LumHC – LumSample) / (LumHC–LumLC). DMSO treated cells are employed as High Control (HC) and 1 mM of a known BRD9 degrader standard treated cells are employed as Low Control (LC). The data was fit to a four parameter, non-linear curve fit to calculate IC50 (mM) values as shown in Table 6A, Table 6B, and Table 6C. As shown by the results in Table 6A, Table 6B, and Table 6C, a number of compounds of the present disclosure exhibit an IC50 value of < 1 mM for the degradation of BRD9, indicating their use as compounds for reducing the levels and/or activity of BRD9 and their potential for treating BRD9-related disorders. Table 6A. SYO1 BRD9-NanoLuc Degradation
Figure imgf000373_0001
“+” indicates inhibitory effect of ³ 1000 nM; “++” indicates inhibitory effect of ³ 100 nM; “+++” indicates inhibitory effect of ³ 10 nM; “++++” indicates inhibitory effect of < 10 nM; “NT” indicates not tested Table 6B. SYO1 BRD9-NanoLuc Degradation
Figure imgf000374_0001
Figure imgf000375_0001
Figure imgf000376_0001
Figure imgf000377_0001
Figure imgf000378_0001
“+” indicates inhibitory effect of ³ 1000 nM; “++” indicates inhibitory effect of ³ 100 nM; “+++” indicates inhibitory effect of ³ 10 nM; “++++” indicates inhibitory effect of < 10 nM; “NT” indicates not tested Table 6C. SYO1 BRD9-NanoLuc Degradation
Figure imgf000378_0002
Figure imgf000379_0001
Figure imgf000380_0001
Figure imgf000381_0001
“+” indicates inhibitory effect of ³ 1000 nM;
“++” indicates inhibitory effect of ³ 100 nM;
“+++” indicates inhibitory effect of ³ 10 nM;
“++++” indicates inhibitory effect of < 10 nM;
“NT” indicates not tested Other Embodiments
All publications, patents, and patent applications mentioned in this specification are incorporated herein by reference in their entirety to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference in its entirety. Where a term in the present application is found to be defined differently in a document incorporated herein by reference, the definition provided herein is to serve as the definition for the term.
While the invention has been described in connection with specific embodiments thereof, it will be understood that invention is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure that come within known or customary practice within the art to which the invention pertains and may be applied to the essential features hereinbefore set forth, and follows in the scope of the claims.
Other embodiments are in the claims.

Claims

Claims
1. A compound having the structure Formula I:
Figure imgf000383_0001
Formula I,
where
R1 is H, optionally substituted C1-C6 alkyl, optionally substituted C2-C6 alkenyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C10 carbocyclyl;
Z1 is CR2 or N;
R2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl;
X1 is N or CH, and X2 is C-R7; or X1 is C-R7, and X2 is N or CH;
R7 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C1-C6 alkoxy, optionally substituted amino, optionally substituted sulfone, optionally substituted sulfonamide, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms;
X3 is N or CH;
X4 is N or CH;
G is optionally substituted C3-C10 carbocyclyl, C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl,
or a pharmaceutically acceptable salt thereof. 2. A compound having the structure of Formula II:
A-L-B
Formula II,
wherein
L is a linker;
B is a degradation moiety; and
A has the structure of Formula III:
Figure imgf000384_0001
Formula III,
wherein
R1 is H, optionally substituted C1-C6 alkyl, optionally substituted C2-C6 alkenyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C10 carbocyclyl;
Z1 is CR2 or N;
R2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl;
X1 is N or CH, and X2 is C-R7ʹʹ; or X1 is C-R7ʹʹ, and X2 is N or CH;
Figure imgf000384_0002
, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C1-C6 alkoxy, optionally substituted amino, optionally substituted sulfone, optionally substituted sulfonamide, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms;
R7ʹ is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C10 carbocycylyl;
X3 is N or CH;
X4 is N or CH;
Figure imgf000384_0003
, optionally substituted C3-C10 carbocyclyl, C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl;
Gʹ is optionally substituted C3-C10 carbocyclylene, C2-C9 heterocyclylene, optionally substituted C6-C10 arylene, or optionally substituted C2-C9 heteroarylene; and
A1 is a bond between A and the linker,
Figure imgf000384_0004
or a pharmaceutically acceptable salt thereof. 3. The compound of claim 1 or 2, wherein R1 is H, optionally substituted C1-C6 alkyl, optionally substituted C2-C6 alkenyl, or optionally substituted C3-C10 carbocyclyl. 4. The compound of claim 3, wherein R1 is H. 5. The compound of claim 3, wherein R1 is optionally substituted C1-C6 alkyl.
2H 2H
CH 3 2 H CH
6. The compound of claim 5, wherein R1 is , , 3 ,
Figure imgf000385_0001
,
Figure imgf000385_0002
7. The compound of claim 6, wherein R1 is optionally substituted C2-C6 alkenyl. 8. The compound of claim 7, wherein R1 is
Figure imgf000385_0003
, , , or
Figure imgf000385_0004
. 9. The compound of claim 8, wherein R1 is optionally substituted C3-C10 carbocyclyl.
10. The compound of claim 9, wherein R1 is
Figure imgf000385_0005
. CH3
11. The compound of claim 3, wherein R1 is H or . 12. The compound of claim 11, wherein R1 is H. CH3
13. The compound of claim 11, wherein R1 is . 14. The compound of any one of claims 1 to 13, wherein Z1 is N. 15. The compound of any one of claims 1 to 13, wherein Z1 is CR2. 16. The compound of claim 15, wherein R2 is H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, or optionally substituted C6-C10 aryl. 17. The compound of claim 16, wherein R2 is H, halogen, or optionally substituted C1-C6 alkyl. 18. The compound of claim 17, wherein R2 is H,
Figure imgf000385_0006
. 19. The compound of any one of claims 2 to 18, wherein X1 is N and X2 is C-R7ʹʹ. 20. The compound of any one of claims 2 to 18, wherein X1 is CH and X2 is C-R7ʹʹ.
21. The compound of any one of claims 2 to 18, wherein X1 is C-R7ʹʹ and X2 is N. 22. The compound of any one of claims 2 to 18, wherein X1 is C-R7ʹʹ and X2 is CH. 23. The compound of any one of claims 2 to 22, wherein R7ʹʹ is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted carbocyclyl having 3 to 6 atoms, or optionally substituted heterocyclyl having 3 to 6 atoms. 24. The compound of claim 23, wherein R7ʹʹ is optionally substituted C1-C6 alkyl.
25. The compound of claim 24, wherein R7ʹʹ is
Figure imgf000386_0001
, , , or
Figure imgf000386_0002
. 26. The compound of claim 23, wherein R7ʹʹ is optionally substituted C1-C6 heteroalkyl. 27. The compound of claim 23, wherein R7ʹʹ is optionally substituted C1-C6 alkoxy or optionally substituted amino. 28. The compound of claim 26 or 27, wherein R7ʹʹ is–NR3R4 or–OR4, where R3 is H or optionally substituted C1-C6 alkyl, and R4 is optionally substituted C1-C6 alky. 29. The compound of claim 28, wherein R7ʹʹ is–NR3R4. 30. The compound of claim 29, wherein X1 is N and X2 is C-NR3R4. 31. The compound of claim 29, wherein X1 is C-NR3R4 and X2 is N. 32. The compound of claim 28, wherein R7 is -OR4. 33. The compound of claim 32, wherein X1 is N and X2 is C-OR4. 34. The compound of claim 32, wherein X1 is C-OR4 and X2 is N. 35. The compound of any one of claims 28 to 34, wherein R3 is H.
36. The compound of any one of claims 28 to 35, wherein R3 is
Figure imgf000387_0001
, , ,
,
Figure imgf000387_0006
38. The compound of claim 23, wherein R7ʹʹ is optionally substituted carbocyclyl having 3 to 6 atoms.
39. The compound of claim 38, wherein R7ʹʹ is
Figure imgf000387_0002
, , , ,
Figure imgf000387_0003
40. The compound of claim 23, wherein R7ʹʹ is optionally substituted heterocyclyl having 3 to 6 atoms.
Figure imgf000387_0004
42. The compound of claim 23, wherein R7ʹʹ is optionally substituted sulfone or optionally substituted sulfonamide.
43. The compound of claim 42, wherein R7ʹʹ is
Figure imgf000387_0005
.
Figure imgf000388_0001
O
N
46. The compound of claim 45, wherein R7ʹʹ
Figure imgf000388_0002
, or . G'
47. The compound of any one of claims 2 to 46, wherein Gʹʹ is A1
. 48. The compound of claim 47, wherein Gʹ is optionally substituted C6-C10 arylene or optionally substituted C2-C9 heteroarylene. 49. The compound of claim 48, wherein Gʹ is optionally substituted C6-C10 arylene.
50. The compound of claim 49, wherein
Figure imgf000388_0003
wherein each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is, independently, H, A1, halogen, optionally substituted C1- C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG1ʹ and RG2ʹ, RG2ʹ and RG3ʹ, RG3ʹ and RG4ʹ, and/or RG4ʹ and RG5ʹ, together with the carbon atoms to which each is attached, combine to form
Figure imgf000389_0001
and
Figure imgf000389_0002
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl, any of which is optionally substituted with A1, wherein one of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is A1, or
Figure imgf000389_0003
is substituted with A1. 51. The compound of claim 50, wherein each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl; or RG1ʹ and RG2ʹ, RG2ʹ and RG3ʹ, RG3ʹ and RG4ʹ, and/or RG4ʹ and RG5ʹ, together with the carbon atoms to which each is attached, combine to form
Figure imgf000389_0004
and
Figure imgf000389_0005
is optionally substituted C2-C9 heteroaryl or optionally substituted C2-C9 heterocyclyl, any of which is optionally substituted with A1, wherein one of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is A1, or
Figure imgf000389_0006
is substituted with A1. 52. The compound of claim 51, wherein each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
.
53. The compound of claim 52, wherein each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is,
Figure imgf000389_0007
Figure imgf000390_0001
54. The compound of claim 53, wherein each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is,
Figure imgf000390_0004
55. The compound of claim 54, wherein each of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is,
Figure imgf000390_0005
. 56. The compound of claim 55, wherein RG3ʹ is A1. O CH
57. The compound of claim 55, wherein RG1ʹ is H; RG2ʹ is 3 ; RG3ʹ is A1; RG4ʹ is O CH3 ; and RG5ʹ is H. O CH
58. The compound of claim 55, wherein RG1ʹ is H; RG2ʹ is 3 ; RG3ʹ is A1; RG4ʹ is H;
Figure imgf000390_0002
O CH
59. The compound of claim 55, wherein RG1ʹ is H; RG2ʹ is 3 ; RG3ʹ is A1; RG4ʹ is Cl or F; and RG5ʹ is H. 60. The compound of claim 55, wherein RG1ʹ is H; RG2ʹ is
Figure imgf000390_0003
; RG3ʹ is A1; RG4ʹ is H; and RG5ʹ is H.
O
CH
61. The compound of claim 55, wherein RG1ʹ is H; RG2ʹ is 3 ; RG3ʹ is A1; RG4ʹ is
Figure imgf000391_0001
62. The compound of claim 51, wherein RG1ʹ and RG2ʹ, RG2ʹ and RG3ʹ, RG3ʹ and RG4ʹ, and/or RG4ʹ and RG5ʹ, together with the carbon atoms to which each is attached, combine to form
Figure imgf000391_0002
; and
M
is optionally substituted C2-C9 heterocyclyl, which is optionally substituted with A1, wherein one of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is A1, or
Figure imgf000391_0003
is substituted with A1. 63. The compound of claim 51, wherein RG1ʹ and RG2ʹ, RG2ʹ and RG3ʹ, RG3ʹ and RG4ʹ, and/or RG4ʹ and RG5ʹ, together with the carbon atoms to which each is attached, combine to form
Figure imgf000391_0004
; and
Figure imgf000391_0005
is optionally substituted C2-C9 heteroaryl, which is optionally substituted with A1, wherein one of RG1ʹ, RG2ʹ, RG3ʹ, RG4ʹ, and RG5ʹ is A1, or
Figure imgf000391_0006
is substituted with A1.
64. The compound of claim 62, wherein
Figure imgf000391_0007
Figure imgf000391_0008
wherein RG6ʹ is H, A1, or optionally substituted C1-C6 alkyl.
Figure imgf000392_0001
Figure imgf000392_0005
CH3
66. The compound of claim 64 or 65, wherein RG6ʹ is H, A1, or . 67. The compound of claim 66, wherein RG6ʹ is H. 68. The compound of claim 48, wherein Gʹ is optionally substituted C2-C9 heteroarylene.
69. The compound of claim 68, wherein
Figure imgf000392_0002
Figure imgf000392_0003
,
wherein
each of RG7ʹ, RG8ʹ, RG9ʹ, RG10ʹ, and RG11ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG7ʹ and RG8ʹ, RG8ʹ and RG9ʹ, RG9ʹ and RG10ʹ, and/or RG10ʹ and RG11ʹ, together with the carbon atoms to which each is attached, combine to form
Figure imgf000392_0004
and
Figure imgf000393_0001
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl, any of which is optionally substituted with A1, wherein one of RG7ʹ, RG8ʹ, RG9ʹ, RG10ʹ, and
Figure imgf000393_0002
is substituted with A1. 70. The compound of claim 69, wherein each of RG7ʹ, RG8ʹ, RG9ʹ, RG10ʹ, and RG11ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
71. The compound of claim 69 or 70, wherein
Figure imgf000393_0003
O CH
72. The compound of any one of claims 69 to 71, wherein RG7ʹ is H; RG8ʹ is 3 ; RG9ʹ is A1; and RG11ʹ is H.
73. The compound of claim 68, wherein Gʹ is
Figure imgf000393_0004
Figure imgf000393_0005
,
wherein
each of RG12ʹ, RG13ʹ, and RG14ʹ is, independently, H, A1, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG12ʹ and RG14ʹ, together with the carbon atoms to which each is attached, combine to form
Figure imgf000393_0006
; and
Figure imgf000393_0007
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl, any of which is optionally substituted with A1, M
wherein one of RG12ʹ, RG13ʹ, and RG14ʹ is A1; or is substituted with A1. R7'
N
A1
74. The compound of any one of claims 2 to 22, wherein R7ʹʹ is . 75. The compound of claim 74, wherein Gʹʹ is optionally substituted C6-C10 aryl or optionally substituted C2-C9 heteroaryl. 76. The compound of claim 75, wherein Gʹʹ is optionally substituted C6-C10 aryl.
77. The compound of claim 76, wherein
Figure imgf000394_0001
wherein
each of RG1, RG2, RG3, RG4, and RG5 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl. 78. The compound of claim 77, wherein each of RG1, RG2, RG3, RG4, and RG5 is,
independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl; or RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl or optionally substituted C2-C9 heterocyclyl. 79. The compound of claim 78, wherein each of RG1, RG2, RG3, RG4, and RG5 is,
independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
80. The compound of claim 79, wherein each of RG1, RG2, RG3, RG4, and RG5 is,
Figure imgf000395_0001
O O S CH3. 81. The compound of claim 80, wherein each of RG1, RG2, RG3, RG4, and RG5 is,
Figure imgf000395_0007
82. The compound of claim 81, wherein each of RG1, RG2, RG3, RG4, and RG5 is, independently,
Figure imgf000395_0002
83. The compound of claim 82, wherein two or more of RG1, RG2, RG3, RG4, and RG5 is H.
84. The compound of claim 83, wherein RG1 is H; RG2 is
Figure imgf000395_0003
;
Figure imgf000395_0004
85. The compound of claim 83, wherein RG1 is H; RG2 is
Figure imgf000395_0005
;
O CH RG4 is H; and RG5 is 3. CH
N 3 86. The compound of claim 83, wherein RG1 is H; RG2 is CH3
Figure imgf000395_0006
; RG4 is Cl or F; and RG5 is H. 87. The compound of claim 83, wherein RG1 is H; RG2 is
RG4 is H; and RG5 is H.
Figure imgf000396_0005
88. The compound of claim 83, wherein RG1 is H; RG2 is
Figure imgf000396_0001
;
Figure imgf000396_0002
89. The compound of claim 78, wherein RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heterocyclyl. 90. The compound of claim 78, wherein RG1 and RG2, RG2 and RG3, RG3 and RG4, and/or RG4 and RG5, together with the carbon atoms to which each is attached, combine to form optionally substituted C2-C9 heteroaryl.
91. The compound of claim 89, wherein Gʹʹ is
Figure imgf000396_0003
, ,
Figure imgf000396_0004
wherein RG6 is H or optionally substituted C1-C6 alkyl. R
92. The compound of claim 90, wherein Gʹʹ is
G6
Figure imgf000397_0004
Figure imgf000397_0003
wherein RG6 is H or optionally substituted C1-C6 alkyl. CH3
93. The compound of claim 91 or 92, wherein RG6 is H or . 94. The compound of claim 93, wherein RG6 is H. 95. The compound of claim 75, wherein Gʹʹ is optionally substituted C2-C9 heteroaryl.
96. The compound of claim 95, wherein Gʹʹ is
Figure imgf000397_0001
, , or
Figure imgf000397_0002
,
wherein
each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally
substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG7 and RG8, RG8 and RG9, RG9 and RG10, and/or RG10 and RG11, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl.
97. The compound of claim 96, wherein each of RG7, RG8, RG9, RG10, and RG11 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, or optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl.
Figure imgf000398_0005
R
98. The compound of claim 96 or 97, wherein Gʹʹ is
Figure imgf000398_0006
99. The compound of claim 98, wherein RG7 is H; RG8 is
Figure imgf000398_0007
100. The compound of claim 89, wherein Gʹʹ is
Figure imgf000398_0001
Figure imgf000398_0002
,
wherein
each of RG12, RG13, and RG14 is, independently, H, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C3-C6 carbocyclyl, optionally substituted -C1-C3 alkyl-C2-C5 heterocyclyl, hydroxyl, thiol, or optionally substituted amino; or RG12 and RG14, together with the carbon atoms to which each is attached, combine to form optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or optionally substituted C2-C9 heterocyclyl. 101. The compound of any one of claims 74 to 100, wherein R7ʹ is H, optionally substituted C1- C6 alkyl, or optionally substituted C3-C10 carbocycylyl. 102. The compound of claim 101, wherein R7ʹ is H or optionally substituted C1-C6 alkyl.
103. The compound of claim 102, wherein R7ʹ is H,
Figure imgf000398_0003
, , ,
Figure imgf000398_0004
104. The compound of claim 103, wherein R7ʹ is H or
Figure imgf000399_0003
105. The compound of claim 104, wherein R7ʹ is H.
106. The compound of claim 104, wherein R7ʹ is
Figure imgf000399_0004
107. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIa:
Figure imgf000399_0001
Formula IIIa,
or a pharmaceutically acceptable salt thereof. 108. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIc:
Figure imgf000399_0002
Formula IIIc,
or a pharmaceutically acceptable salt thereof. 109. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIe:
Figure imgf000400_0002
Formula IIIe,
or a pharmaceutically acceptable salt thereof. 110. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIf:
Figure imgf000400_0003
Formula IIIf,
or a pharmaceutically acceptable salt thereof. 111. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIg:
Figure imgf000400_0001
Formula IIIg,
or a pharmaceutically acceptable salt thereof. 112. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIh:
Figure imgf000401_0003
Formula IIIh,
or a pharmaceutically acceptable salt thereof. 113. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIj:
Figure imgf000401_0001
Formula IIIj,
or a pharmaceutically acceptable salt thereof. 114. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIn:
Figure imgf000401_0002
Formula IIIn,
or a pharmaceutically acceptable salt thereof. 115. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIo:
Figure imgf000402_0001
Formula IIIo,
or a pharmaceutically acceptable salt thereof. 116. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIs:
Figure imgf000402_0003
Formula IIIs,
or a pharmaceutically acceptable salt thereof. 117. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIu:
Figure imgf000402_0002
Formula IIIu,
or a pharmaceutically acceptable salt thereof. 118. The compound of any one of claims 2 to 106, wherein A has the structure of Formula IIIv:
Figure imgf000403_0001
Formula IIIv,
or a pharmaceutically acceptable salt thereof. 119. The compound of any one of claims 2 to 118, wherein the degradation moiety is a ubiquitin ligase binding moiety. 120. The compound of claim 119, wherein the ubiquitin ligase binding moiety comprises Cereblon ligands, IAP (Inhibitors of Apoptosis) ligands, mouse double minute 2 homolog (MDM2), or von Hippel-Lindau (VHL) ligands, or derivatives or analogs thereof. 121. The compound of claim 119 or 120, wherein the degradation moiety comprises the structure of Formula Y:
Figure imgf000403_0002
where
A2 is a bond between the degradation moiety and the linker;
v1 is 0, 1, 2, 3, 4, or 5;
u1 is 1, 2, or 3;
Figure imgf000403_0003
R5A is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl; each RJ1 is, independently, halogen, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
JA is absent, O, optionally substituted amino, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl; and
J is absent, optionally substituted C3-C10 carbocyclylene, optionally substituted C6-C10 arylene, optionally substituted C2-C9 heterocyclylene, or optionally substituted C2-C9 heteroarylene,
or a pharmaceutically acceptable salt thereof.
122. The compound of claim 121, wherein T2 is
Figure imgf000404_0001
.
123. The compound of claim 122, wherein T2 is
Figure imgf000404_0002
.
124. The compound of claim 122, wherein T2 is
Figure imgf000404_0003
125. The compound of any one of claims 121 to 124, wherein the structure of Formula Y has the structure of Formula Y1:
Figure imgf000404_0004
Formula Y1,
or a pharmaceutically acceptable salt thereof. 126. The compound of claim 125, wherein T1 is a bond.
127. The compound of claim 125, wherein
Figure imgf000404_0005
128. The compound of any one of claims 121 to 127, wherein the structure of Formula Y has the structure of Formula Y2: A2
Figure imgf000405_0001
Formula Y2,
or a pharmaceutically acceptable salt thereof. 129. The compound of any one of claims 121 to 127, wherein the structure of Formula Y has the structure of Formula Z:
Figure imgf000405_0002
Formula Z,
or a pharmaceutically acceptable salt thereof. 130. The compound of any one of claims 121 to 129, wherein u1 is 2. 131. The compound of claim 130, wherein the structure of Formula Z has the structure of Formula AA0:
Figure imgf000405_0003
Formula AA0,
or a pharmaceutically acceptable salt thereof. 132. The compound of any one of claims 121 to 129, wherein u1 is 1. 133. The compound of claim 132, wherein the structure of Formula Z has the structure of Formula AB:
Figure imgf000405_0004
Formula AB,
or a pharmaceutically acceptable salt thereof.
134. The compound of any one of claims 121 to 129, wherein u1 is 3. 135. The compound of claim 134, wherein the structure of Formula Z has the structure of Formula AC:
Figure imgf000406_0001
Formula AC,
or a pharmaceutically acceptable salt thereof. 136. The compound of any one of claims 121 to 135, wherein JA is absent. 137. The compound of any one of claims 121 to 135, wherein JA is optionally substituted C1-C6 alkyl.
138. The compound of claim 137, wherein JA is
Figure imgf000406_0002
. 139. The compound of claim 138, wherein the structure of Formula AA0 has the structure of Formula AA0:
Figure imgf000406_0003
Formula AA,
or a pharmaceutically acceptable salt thereof. 140. The compound of any one of claims 121 to 139, wherein v1 is 0, 1, 2, or 3. 141. The compound of claim 140, wherein v1 is 0. 142. The compound of claim 141, wherein the structure of Formula AA has the structure of Formula AA1:
Figure imgf000406_0004
Formula AA1, or a pharmaceutically acceptable salt thereof. 143. The compound of any one of claims 121 to 142, wherein RA5 is H or optionally substituted C1-C6 alkyl. 144. The compound of claim 143, wherein RA5 is H. 145. The compound of claim 143, wherein RA5 is methyl. 146. The compound of any one of claims 121 to 142, wherein RA5 is optionally substituted C1- C6 heteroalkyl.
147. The compound of claim 146, wherein
Figure imgf000407_0001
148. The compound of claim 139, wherein the structure of Formula AA has the structure of Formula AA1:
Figure imgf000407_0002
Formula AA1,
or a pharmaceutically acceptable salt thereof. 149. The compound of claim 133, wherein the structure of Formula AB has the structure of Formula AB1:
Figure imgf000407_0003
Formula AB1,
or a pharmaceutically acceptable salt thereof. 150. The compound of claim 135, wherein the structure of Formula AC has the structure of Formula AC1:
Figure imgf000407_0004
or a pharmaceutically acceptable salt thereof.
151. The compound of any one of claims 121 to 150, wherein J is absent. 152. The compound of claim 151, wherein the structure of Formula AA1 has the structure of Formula AA2:
Figure imgf000408_0001
Formula AA2,
or a pharmaceutically acceptable salt thereof. 153. The compound of any one of claims 121 to 150, wherein J is optionally substituted C3-C10 carbocyclylene or optionally substituted C6-C10 arylene. 154. The compound of claim 153, wherein the structure of Formula AA has the structure of Formula AA4:
Figure imgf000408_0002
Formula AA4,
or a pharmaceutically acceptable salt thereof. 155. The compound of any one of claims 121 to 150, wherein J is optionally substituted C2-C9 heterocyclylene or optionally substituted C2-C9 heteroarylene. 156. The compound of claim 155, wherein the structure of Formula AA has the structure of Formula AA3:
Figure imgf000408_0003
Formula AA3,
or a pharmaceutically acceptable salt thereof. 157. The compound of claim 155, wherein the structure of Formula AA has the structure of Formula A: ,
Figure imgf000409_0006
RA5 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
RA6 is H or optionally substituted C1-C6 alkyl; and RA7 is H or optionally substituted C1-C6 alkyl; or RA6 and RA7, together with the carbon atom to which each is bound, combine to form optionally substituted C3-C6 carbocyclyl or optionally substituted C2-C5 heterocyclyl; or RA6 and RA7, together with the carbon atom to which each is bound, combine to form optionally substituted C3-C6 carbocyclyl or optionally substituted C2-C5 heterocyclyl;
RA8 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
each of RA1, RA2, RA3, and RA4 is, independently, H, A2, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, hydroxyl, thiol, or optionally substituted amino; or RA1 and RA2, RA2 and RA3, and/or RA3 and RA4, together with the carbon atoms to which each is attached, combine to form
Figure imgf000409_0001
; and
Figure imgf000409_0002
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl, any of which is optionally substituted with A2, wherein one of RA1, RA2, RA3, and
Figure imgf000409_0003
is substituted with A2, or a pharmaceutically acceptable salt thereof. 158. The compound of claim 157, each of RA1, RA2, RA3, and RA4 is, independently, H, A2, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6
heteroalkenyl, hydroxyl, thiol, or optionally substituted amino; or RA1 and RA2, RA2 and RA3, and/or RA3 and RA4, together with the carbon atoms to which each is attached, combine to form
Figure imgf000409_0004
; and
Figure imgf000409_0005
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl, any of which is optionally substituted with A2, wherein one of RA1, RA2, RA3, and
Figure imgf000410_0001
is substituted with A2, or a pharmaceutically acceptable salt thereof. 159. The compound of claim 158, wherein each of RA1, RA2, RA3, and RA4 is, H, A2, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, hydroxyl, optionally substituted amino; or RA1 and RA2, RA2 and RA3, or RA3 and RA4, together with the carbon atoms to which each is attached, combine to form
Figure imgf000410_0002
and
N
is optionally substituted C2-C9 heterocyclyl, which is optionally substituted with A2,
N
wherein one of RA1, RA2, RA3, and RA4 is A2, or is substituted with A2. 160. The compound of claim 159, wherein each of RA1, RA2, RA3, and RA4 is, independently, H,
Figure imgf000410_0003
together with the carbon atoms to which each is attached, combine to form
Figure imgf000410_0004
and
N
is optionally substituted C2-C9 heterocyclyl, which is optionally substituted with A2,
N
wherein one of RA1, RA2, RA3, and RA4 is A2, or is substituted with A2. 161. The compound of any one of claims 157 to 160, wherein Y1
Figure imgf000410_0005
. O 162. The compound of claim 161, wherein Y1 is . RA6 RA7 163. The compound of claim 161, wherein Y1 is .
164. The compound of claim 163, wherein Y1 is ,
Figure imgf000410_0006
, , ,
Figure imgf000410_0007
165. The compound of claim 164, wherein Y1 is . 166. The compound of any one of claims 157 to 165, wherein the structure of Formula A has the structure of Formula A1:
Figure imgf000411_0001
,
Formula A1
or a pharmaceutically acceptable salt thereof. 167. The compound of any one of claims 157 to 165 wherein the structure of Formula A has the structure of Formula A2:
Figure imgf000411_0002
,
Formula A2
or a pharmaceutically acceptable salt thereof. 168. The compound of any one of claims 157 to 165, wherein the structure of Formula A has the structure of Formula A3:
Figure imgf000411_0003
,
Formula A3
or a pharmaceutically acceptable salt thereof. 169. The compound of any one of claims 157 to 167, wherein the structure of Formula A has the structure of Formula A4:
Figure imgf000411_0004
,
Formula A4
or a pharmaceutically acceptable salt thereof.
170. The compound of any one of claims 157 to 167, wherein the structure of Formula A has the structure of Formula A5:
Figure imgf000412_0001
,
Formula A5
or a pharmaceutically acceptable salt thereof. 171. The compound of any one of claims 157 to 167, wherein the structure of Formula A has the structure of Formula A6:
Figure imgf000412_0002
,
Formula A6
or a pharmaceutically acceptable salt thereof. 172. The compound of any one of claims 157 to 167, wherein the structure of Formula A has the structure of Formula A7:
Figure imgf000412_0003
,
Formula A7
or a pharmaceutically acceptable salt thereof. 173. The compound of any one of claims 157 to 167, wherein the structure of Formula A has the structure of Formula A8:
Figure imgf000412_0004
,
Formula A8
or a pharmaceutically acceptable salt thereof. 174. The compound of any one of claims 157 to 167, wherein the structure of Formula A has the structure of Formula A9:
Figure imgf000413_0001
,
Formula A9
or a pharmaceutically acceptable salt thereof. 175. The compound of any one of claims 157 to 167, wherein the structure of Formula A has the structure of Formula A10:
Figure imgf000413_0002
,
Formula A10
or a pharmaceutically acceptable salt thereof. 176. The compound of any one of claims 157 to 175, wherein the structure of Formula A is
Figure imgf000413_0004
A2
or derivative or analog thereof.
Figure imgf000413_0003
177. The compound of claim 176, wherein the structure of Formula A is
O
Figure imgf000414_0005
178. The compound of claim 177, wherein the structure of Formula A is
or derivative or analog thereof.
Figure imgf000414_0004
179. The compound of any one of claims 157 to 175, wherein
Figure imgf000414_0001
Figure imgf000414_0002
,
wherein RA9 is H, A2, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl. 180. The compound of claim 179, wherein the structure of Formula A is
Figure imgf000414_0003
.
181. The compound of claim 180, wherein RA9 is H.
182. The compound of claim 180, wherein RA9 is A2. 183. The compound of claim 182, wherein the structure of Formula A is
Figure imgf000415_0001
184. The compound of claim 155, wherein the structure of Formula AA has the structure of Formula B:
,
Figure imgf000415_0002
wherein
RA5 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
each of RA1, RA2, RA3, and RA4 is, independently, H, A2, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, optionally substituted -O-C3-C6 carbocyclyl, hydroxyl, thiol, or optionally substituted amino; or RA1 and RA2, RA2 and RA3, and/or RA3 and RA4, together with the carbon atoms to which each is attached, combine to form
Figure imgf000415_0003
; and
Figure imgf000415_0004
is optionally substituted C6-C10 aryl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heteroaryl, or C2-C9 heterocyclyl, any of which is optionally substituted with A2, wherein one of RA1, RA2, RA3, and
Figure imgf000415_0005
is substituted with A2,
or a pharmaceutically acceptable salt thereof. 185. The compound of claim 184, wherein each of RA1, RA2, RA3, and RA4 is, H, A2, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted -O-C3-C6 carbocyclyl, hydroxyl, optionally substituted amino; or RA1 and RA2, RA2 and RA3, or RA3 and RA4, together with the carbon atoms to which each is attached, combine to form
Figure imgf000415_0006
and
Figure imgf000415_0007
is optionally substituted C2-C9 heterocyclyl, which is optionally substituted with A2, wherein one of RA1, RA2, RA3, and
Figure imgf000416_0001
is substituted with A2. 186. The compound of claim 185, wherein each of RA1, RA2, RA3, and RA4 is, independently, H,
Figure imgf000416_0002
together with the carbon atoms to which each is attached, combine to form
Figure imgf000416_0003
; and
Figure imgf000416_0004
is optionally substituted C2-C9 heterocyclyl, which is optionally substituted with A2, wherein one of RA1, RA2, RA3, and RA4 is A2,
Figure imgf000416_0005
is substituted with A2. 187. The compound of any one of claims 184 to 186, wherein the structure of Formula B has the structure of Formula B1:
,
Figure imgf000416_0006
or a pharmaceutically acceptable salt thereof. 188. The compound of any one of claims 184 to 186, wherein the structure of Formula B has the structure of Formula B2:
,
Figure imgf000416_0007
or a pharmaceutically acceptable salt thereof. 189. The compound of any one of claims 184 to 186, wherein the structure of Formula B has the structure of Formula B3:
Figure imgf000416_0008
,
Formula B3 or a pharmaceutically acceptable salt thereof. 190. The compound of any one of claims 184 to 186, wherein the structure of Formula B has the structure of Formula B4:
Figure imgf000417_0001
or a pharmaceutically acceptable salt thereof. 191. The compound of any one of claims 184 to 186, wherein the structure of Formula B is A2 N N
N O N O N NH A2 N NH
O O or O O . 192. The compound of any one of claims 2 to 118, wherein the degradation moiety comprises the structure of Formula C:
R
Figure imgf000417_0002
wherein
RB1 is H, A2, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
RB2 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
RB3 is A2, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1-C6 alkyl C6-C10 aryl;
RB4 is H, optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1- C6 alkyl C6-C10 aryl;
RB5 is H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
v2 is 0, 1, 2, 3, or 4;
each RB6 is, independently, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino; and each of RB7 and RB8 is, independently, H, halogen, optionally substituted C1-C6 alkyl, or optionally substituted C6-C10 aryl,
wherein one of RB1 and RB3 is A2,
or a pharmaceutically acceptable salt thereof. 193. The compound of claim 192, wherein the structure of Formula C is
Figure imgf000418_0001
194. The compound of any one of claims 2 to 118, wherein the degradation moiety comprises the structure of Formula D:
Figure imgf000418_0002
wherein
A2 is a bond between B and the linker;
each of RC1, RC2, and RC7 is, independently, H, optionally substituted C1-C6 alkyl, or optionally substituted C1-C6 heteroalkyl;
RC3 is optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1- C6 alkyl C6-C10 aryl;
RC5 is optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1- C6 alkyl C6-C10 aryl;
v3 is 0, 1, 2, 3, or 4;
each RC8 is, independently, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino; v4 is 0, 1, 2, 3, or 4; and
each RC9 is, independently, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino,
or a pharmaceutically acceptable salt thereof. 195. The compound of claim 194, wherein the structure of Formula D is
Figure imgf000419_0001
r derivative or analog thereof. 196. The compound of any one of claims 2 to 118, wherein the degradation moiety comprises the structure of Formula E:
wherein
A2 is a bond between B an
Figure imgf000419_0002
d the linker;
each of RC10 and RC11 is, independently, H, optionally substituted C1-C6 alkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C6-C10 aryl, optionally substituted C1-C6 alkyl C3-C10 carbocyclyl, or optionally substituted C1-C6 alkyl C6-C10 aryl;
v5 is 0, 1, 2, 3, or 4;
each RC12 is, independently, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino;
v6 is 0, 1, 2, 3, or 4; and
each R21 is, independently, halogen, optionally substituted C1-C6 alkyl, optionally substituted C1- C6 heteroalkyl, optionally substituted C3-C10 carbocyclyl, optionally substituted C2-C9 heterocyclyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, optionally substituted C2-C6 alkenyl, optionally substituted C2-C6 heteroalkenyl, hydroxy, thiol, or optionally substituted amino,
or a pharmaceutically acceptable salt thereof. 197. The compound of claim 196, wherein the structure of Formula E is
CH
O A2 , or derivative or analog thereof.
Figure imgf000420_0001
198. The compound of any one of claims 2 to 118, wherein the degradation moiety comprises the structure of Formula FA:
Figure imgf000420_0002
where
or a bicyclic moiety which is substituted with A 2 and substituted
Figure imgf000420_0003
with one or more groups independently selected from H, RFF1, and oxo;
is a single bond or a double bond;
u2 is 0, 1, 2, or 3;
A2 is a bond between the degrader and the linker;
YFa is CRFbRFc, C═O, C═S, C═CH2, SO2, S(O), P(O)Oalkyl, P(O)NHalkyl, P(O)N(alkyl)2, P(O)alkyl, P(O)OH, P(O)NH2;
YFb is NH, NRFF1, CH2, CHRFF1, C(RFF1)2, O, or S;
YFc is CRFdRFe, C═O, C═S, C═CH2, SO2, S(O), P(O)Oalkyl, P(O)NHalkyl, P(O)N(alkyl)2, P(O)alkyl, P(O)OH, P(O)NH2;
each of RFb, RFc, RFd, and RFe is, independently, H, alkyl, aliphatic, heteroaliphatic, aryl, heteroaryl, carbocyclyl, hydroxyl, alkoxy, amino,—NHalkyl, or—Nalkyl2; or RFb and RFc, together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
or RFd and RFe, together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O; and
or RFd and RFb, together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
each of YFd and YFf is, independently, CH2, CHRFF2, C(RFF2)2, C(O), N, NH, NRFF3, O, S, or S(O); YFe is a bond or a divalent moiety attached to YFd and YFf that contains 1 to 5 contiguous carbon atoms that form a 3 to 8-membered ring,
wherein 1, 2, or 3 carbon atoms can be replaced with a nitrogen, oxygen, or sulfur atom; wherein one of the ring atoms is substituted with A2 and the others are substituted with one or more groups independently selected from H and RFF1; and
wherein the contiguous atoms of YFe can be attached through a single or double bond; each RFF1 is, independently, H, alkyl, alkenyl, alkynyl, aliphatic, heteroaliphatic, carbocyclyl, halogen, hydroxyl, amino, cyano, alkoxy, aryl, heteroaryl, heterocyclyl, alkylamino, alkylhydroxyl, or haloalkyl;
each RFF2 is, independently, alkyl, alkene, alkyne, halogen, hydroxyl, alkoxy, azide, amino, —C(O)H,—C(O)OH,—C(O)(aliphatic, including alkyl),—C(O)O(aliphatic, including alkyl),
—NH(aliphatic, including alkyl),—N(aliphatic including alkyl)(aliphatic including alkyl),—NHSO2alkyl, —N(alkyl)SO2alkyl,—NHSO2aryl,—N(alkyl)SO2aryl,—NHSO2alkenyl,—N(alkyl)SO2alkenyl, —NHSO2alkynyl,—N(alkyl)SO2alkynyl, aliphatic, heteroaliphatic, aryl, heteroaryl, hetercyclic, carbocyclic, cyano, nitro, nitroso,—SH,—Salkyl, or haloalkyl; and
RFF3 is alkyl, alkenyl, alkynyl,—C(O)H,—C(O)OH,—C(O)alkyl, or—C(O)Oalkyl,
wherein if YFd or YFf is substituted with A2, then YFe is a bond, or a pharmaceutically acceptable salt thereof. 199. The compound of any one of claims 2 to 118, wherein the degradation moiety comprises the structure of Formula FB:
where
Figure imgf000421_0002
Figure imgf000421_0001
bicyclic moiety which is substituted with A 2 and substituted with one or more groups independently selected from H, RFF1, and oxo; A2 is a bond between the degrader and the linker;
YFa is CRFbRFc, C═O, C═S, C═CH2, SO2, S(O), P(O)Oalkyl, P(O)NHalkyl, P(O)N(alkyl)2, P(O)alkyl, P(O)OH, P(O)NH2;
each of YFb and YFg is, independently, NH, NRFF1, CH2, CHRFF1, C(RFF1)2, O, or S;
YFc is CRFdRFe, C═O, C═S, C═CH2, SO2, S(O), P(O)Oalkyl, P(O)NHalkyl, P(O)N(alkyl)2, P(O)alkyl, P(O)OH, P(O)NH2;
each of RFb, RFc, RFd, RFe, RFf, and RFg is, independently, H, alkyl, aliphatic, heteroaliphatic, aryl, heteroaryl, carbocyclyl, hydroxyl, alkoxy, amino,—NHalkyl, or—Nalkyl2;
or RFb and RFc, together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
or RFd and RFe, together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
or RFf and RFg, together with the carbon atom to which each is attached, combine to form a 3-, 4-, 5-, or 6-membered spirocarbocyclylene, or a 4-, 5-, or 6-membered spiroheterocyclylene comprising 1 or 2 heteroatoms selected from N and O;
or RFd and RFb, together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
or RFd and RFf, together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
or RFb and RFg, together with the carbon atoms to which each is attached, combine to form a 1, 2, 3, or 4 carbon bridged ring;
each of YFd and YFf is, independently, CH2, CHRFF2, C(RFF2)2, C(O), N, NH, NRFF3, O, S, or S(O); YFe is a bond or a divalent moiety attached to YFd and YFf that contains 1 to 5 contiguous carbon atoms that form a 3 to 8-membered ring,
wherein 1, 2, or 3 carbon atoms can be replaced with a nitrogen, oxygen, or sulfur atom; wherein one of the ring atoms is substituted with A2 and the others are substituted with one or more groups independently selected from H and RFF1; and
wherein the contiguous atoms of YFe can be attached through a single or double bond; each RFF1 is, independently, H, alkyl, alkenyl, alkynyl, aliphatic, heteroaliphatic, carbocyclyl, halogen, hydroxyl, amino, cyano, alkoxy, aryl, heteroaryl, heterocyclyl, alkylamino, alkylhydroxyl, or haloalkyl;
each RFF2 is, independently, alkyl, alkene, alkyne, halogen, hydroxyl, alkoxy, azide, amino, —C(O)H,—C(O)OH,—C(O)(aliphatic, including alkyl),—C(O)O(aliphatic, including alkyl),
—NH(aliphatic, including alkyl),—N(aliphatic including alkyl)(aliphatic including alkyl),—NHSO2alkyl, —N(alkyl)SO2alkyl,—NHSO2aryl,—N(alkyl)SO2aryl,—NHSO2alkenyl,—N(alkyl)SO2alkenyl, —NHSO2alkynyl,—N(alkyl)SO2alkynyl, aliphatic, heteroaliphatic, aryl, heteroaryl, hetercyclic, carbocyclic, cyano, nitro, nitroso,—SH,—Salkyl, or haloalkyl; and
RFF3 is alkyl, alkenyl, alkynyl,—C(O)H,—C(O)OH,—C(O)alkyl, or—C(O)Oalkyl, wherein if YFd or YFf is substituted with A2, then YFe is a bond, or a pharmaceutically acceptable salt thereof. 200. The compound of any one of claims 2 to 118, wherein the degradation moiety comprises the structure of Formula F1:
Figure imgf000423_0001
Formula F1,
wherein
A2 is a bond between the degrader and the linker; and
RF1 is absent or O,
or a pharmaceutically acceptable salt thereof. 201. The compound of any one of claims 2 to 118, wherein the degradation moiety comprises the structure of Formula F2:
Figure imgf000423_0002
wherein
A2 is a bond between the degrader and the linker; and
RF1 is absent or O,
or a pharmaceutically acceptable salt thereof. 202. The compound of any one of claims 2 to 118, wherein the degradation moiety comprises the structure of Formula G:
Figure imgf000423_0003
Formula G,
wherein
A2 is a bond between the degrader and the linker; and
RF1 is absent or O,
or a pharmaceutically acceptable salt thereof. 203. The compound of any one of claims 2 to 202, wherein the linker has the structure of Formula IV: A1-(B1)f-(C1)g-(B2)h-(D)-(B3)i-(C2)j-(B4)k–A2
Formula IV
wherein
A1 is a bond between the linker and A;
A2 is a bond between B and the linker;
each of B1, B2, B3, and B4 is, independently, optionally substituted C1-C2 alkyl, optionally substituted C1-C3 heteroalkyl, O, S, S(O)2, or NRN;
each RN is, independently, H, optionally substituted C1–4 alkyl, optionally substituted C2–4 alkenyl, optionally substituted C2–4 alkynyl, optionally substituted C2–6 heterocyclyl, optionally substituted C6–12 aryl, or optionally substituted C1–7 heteroalkyl;
each of C1 and C2 is, independently, carbonyl, thiocarbonyl, sulphonyl, or phosphoryl;
each of f, g, h, i, j, and k is, independently, 0 or 1; and
D is optionally substituted C1–10 alkyl, optionally substituted C2–10 alkenyl, optionally substituted C2–10 alkynyl, optionally substituted C2–6 heterocyclyl, optionally substituted C6–12 aryl, optionally substituted C2-C10 polyethylene glycol, or optionally substituted C1–10 heteroalkyl, or a chemical bond linking A1-(B1)f-(C1)g-(B2)h- to -(B3)i-(C2)j-(B4)k–A2. 204. The compound of claim 203, wherein each of B1, B2, B3, and B4 is, independently, optionally substituted C1-C4 alkyl, optionally substituted C1-C4 heteroalkyl, or NRN. 205. The compound of claim 202 or 203, wherein each RN is, independently, H or optionally substituted C1-C4 alkyl. 206. The compound of any one of claims 202 to 205, wherein each RN is, independently, H or methyl. 207. The compound of any one of claims 203 to 206, wherein each of B1 and B4 is,
independently,
Figure imgf000424_0001
208. The compound of claim 207 wherein B1 is
Figure imgf000424_0002
Figure imgf000424_0003
. 209. The compound of any one of claims 203 to 208, wherein each of C1 and C2 is, independently,
Figure imgf000424_0004
210. The compound of claim 209, wherein C1 is
Figure imgf000425_0002
211. The compound of any one of claims 203 to 210, wherein B2 is NRN. 212. The compound of any one of claims 203 to 210, wherein B2 is optionally substituted C1- C4 alkyl. 213. The compound of any one of claims 203 to 212, wherein f is 0. 214. The compound of any one of claims 203 to 212, wherein f is 1. 215. The compound of any one of claims 203 to 214, wherein g is 1. 216. The compound of any one of claims 203 to 215, wherein h is 0. 217. The compound of any one of claims 203 to 215, wherein h is 1. 218. The compound of any one of claims 203 to 217, wherein i is 0. 219. The compound of any one of claims 203 to 218, wherein j is 0. 220. The compound of any one of claims 203 to 219, wherein k is 0. 221. The compound of any one of claims 203 to 220, wherein the linker has the structure of
Figure imgf000425_0001
wherein
x is 1, 2, 3, 4, 5, 6, 7, or 8;
y is 1, 2, 3, or 4;
Rx is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl; Ry is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl; and
W is O or NRw, wherein Rw is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl. 222. The compound of any one of claims 203 to 221, wherein the linker has the structure of:
Figure imgf000426_0001
Figure imgf000427_0001
223. The compound of any one of claims 203 to 221, wherein the linker has the structure of
Figure imgf000427_0002
. 224. The compound of any one of claims 2 to 202, wherein the linker has the structure of Formula V:
A1–(E1)–(F1)–(C3)m–(E3)n–(F2)o1–(F3)o2–(E2)p–A2,
Formula V
wherein
A1 is a bond between the linker and A;
A2 is a bond between B and the linker;
each of m, n, o1, o2, and p is, independently, 0 or 1;
each of E1 and E2 is, independently, O, S, NRN, optionally substituted C1–10 alkylene, optionally substituted C2–10 alkenylene, optionally substituted C2–10 alkynylene, optionally substituted C2-C10 polyethylene glycol, or optionally substituted C1–10 heteroalkylene;
E3 is optionally substituted C1-C6 alkylene, optionally substituted C1-C6 heteroalkylene, O, S, or NRN;
each RN is, independently, H, optionally substituted C1–4 alkyl, optionally substituted C2–4 alkenyl, optionally substituted C2–4 alkynyl, optionally substituted C2–6 heterocyclyl, optionally substituted C6–12 aryl, or optionally substituted C1–7 heteroalkyl;
C3 is carbonyl, thiocarbonyl, sulphonyl, or phosphoryl; and
each of F1, F2, and F3 is, independently, optionally substituted C3-C10 carbocyclylene, optionally substituted C2–10 heterocyclylene, optionally substituted C6-C10 arylene, or optionally substituted C2-C9 heteroarylene. 225. The compound of claim 224, wherein the linker has the structure of Formula Va:
A1–(E1)–(F1)–(C3)m–(E2)p–A2.
Formula Va 226. The compound of claim 224, wherein the linker has the structure of Formula Vb:
A1–(E1)–(F1)–(E2)p–A2.
Formula Vb 227. The compound of claim 224, wherein the linker has the structure of Formula Vc: A1–(E1)–(F1)–A2.
Formula Vc 228. The compound of claim 224, wherein the linker has the structure of Formula Vd:
A1–(E1)–(F1)–(C3)m–(F2)o1–A2.
Formula Vd 229. The compound of claim 224, wherein the linker has the structure of Formula Ve:
A1–(E1)–(F1)–(E3)n–(F2)o1–(E2)p–A2.
Formula Ve 230. The compound of claim 224, wherein the linker has the structure of Formula Vf:
A1–(E1)–(F1)–(C3)m–(E3)n–(F2)o1–(E2)p–A2.
Formula Vf 231. The compound of claim 224, wherein the linker has the structure of Formula Vg:
A1–(E1)–(F1)–(E3)n–(F2)o1–A2,
Formula Vg 232. The compound of any one of claims 224 to 231, wherein each of E1 and E2 is, independently, NRN, optionally substituted C1–10 alkylene, optionally substituted C2-C10 polyethylene glycolene, or optionally substituted C1–10 heteroalkylene. 233. The compound of any one of claims 224 to 232, wherein E3 is optionally substituted C1- C6 alkylene, O, S, or NRN. 234. The compound of claim 233, wherein E3 is optionally substituted C1-C6 alkylene. 235. The compound of claim 233, wherein E3 is optionally substituted C1-C3 alkylene.
Figure imgf000428_0001
237. The compound of claim 233, wherein E3 is
Figure imgf000428_0002
, , ,
Figure imgf000428_0003
238. The compound of claim 233, wherein E3 is O. 239. The compound of any one of claims 224 to 238, wherein each RN is, independently, H or optionally substituted C1–4 alkyl. 240. The compound of claim 239, wherein each RN is, independently, H or methyl.
241. The compound of any one of claims 224 to 240, wherein E1 is
Figure imgf000429_0001
, ,
Figure imgf000429_0002
, , , , , , , or , where a is 0, 1, 2, 3, 4, or 5.
Figure imgf000429_0003
242. The compound of claim 241, wherein E1 is
Figure imgf000429_0005
, , , ,
Figure imgf000429_0004
243. The compound of claim 242, wherein E1 is
Figure imgf000429_0006
244. The compound of any one of claims 224 to 243, wherein E1 is
Figure imgf000429_0007
,
Figure imgf000429_0008
Figure imgf000430_0001
wherein
b is 0, 1, 2, 3, 4, 5, or 6;
Ra is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
Rb is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl; and
Rc is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl.
245. The compound of claim 244, wherein E1 is
Figure imgf000430_0002
, ,
F CH
Figure imgf000430_0005
246. The compound of claim 245, wherein E1 is
Figure imgf000430_0003
H H
Figure imgf000430_0004
247. The compound of claim 246, wherein
Figure imgf000431_0001
Figure imgf000431_0002
248. The compound of claim 247, wherein
Figure imgf000431_0003
CH3
N
O . 249. The compound of any one of claims 244 to 248, wherein Ra is H or methyl. 250. The compound of claim 249, wherein Ra is H. 251. The compound of claim 249, wherein Ra is methyl.
252. The compound of any one of claims 224 to 251, wherein E2 is O, NRw,
Figure imgf000431_0004
,
F F
Figure imgf000431_0005
wherein
c is 0, 1, 2, 3, 4, 5, 6, 7, or 8;
d is 0, 1, 2, or 3;
e is 0, 1, 2, 3, 4, 5, or 6;
f is 0, 1, 2, 3, or 4;
Rd is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl; Re is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
Rf is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
Rg is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl; and
W is O or NRw, wherein Rw is H or optionally substituted C1-C6 alkyl.
253. The compound of claim 252, wherein E2 is O,
Figure imgf000432_0003
,
Figure imgf000432_0004
254. The compound of any one of claims 224 to 253, wherein each of F1, F2, or F3 is, independently, optionally substituted C3-C10 carbocyclylene. 255. The compound of claim 254, wherein the C3-C10 carbocyclylene is monocyclic. 256. The compound of claim 254, wherein the C3-C10 carbocyclylene is polycyclic. 257. The compound of claim 256, wherein the C3-C10 carbocyclylene is fused. 258. The compound of claim 256, wherein the C3-C10 carbocyclylene is spirocyclic. 259. The compound of claim 256, wherein the C3-C10 carbocyclylene is bridged.
260. The compound of claim 259, wherein the C3-C10 carbocyclylene
Figure imgf000432_0001
Figure imgf000432_0002
261. The compound of claim 260, wherein the C3-C10 carbocyclylene is
Figure imgf000433_0001
. 262. The compound of any one of claims 224 to 253, wherein each of F1, F2, or F3 is, independently, optionally substituted C2-C6 heterocyclylene. 263. The compound of claim 262, wherein the C2-C6 heterocyclylene is monocyclic.
264. The compound of claim 263, wherein the C2-C6 heterocyclylene is
Figure imgf000433_0002
,
Figure imgf000433_0003
( )q ,
wherein
q1 is 0, 1, 2, 3, or 4;
q2 is 0, 1, 2, 3, 4, 5, or 6;
q3 is 0, 1, 2, 3, 4, 5, 6, 7, or 8;
each Rh is, independently, 2H, halogen, optionally substituted C1-C6 alkyl, ORi2, or NRi3Ri4; or two Rh groups, together with the carbon atom to which each is attached, combine to form optionally substituted C3-C10 carbocyclyl or optionally substituted C2-C9 heterocyclyl; or two Rh groups, together with the carbon atoms to which each is attached, combine to form optionally substituted C3-C10 carbocyclyl or optionally substituted C2-C9 heterocyclyl;
Ri1 is H or optionally substituted C1-C6 alkyl; Ri2 is H, optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, or optionally substituted C3-C6 carbocyclyl;
265. The compound of claim 264, wherein the C2–C9 heterocyclylene
Figure imgf000434_0001
Figure imgf000434_0002
266. The compound of claim 264 or 265, wherein each Rh is, independently, 2H, halogen, cyano, optionally substituted C1-C6 alkyl, ORi2, or NRi3Ri4. CF3 267. The compound of claim 266, wherein each Rh is, independently, 2H, F, methyl, ,
Figure imgf000434_0003
268. The compound of claim 267, wherein each Rh is, independently, F, methyl, or NRi3Ri4. 269. The compound of any one of claims 264 to 268, wherein q1 is 0, 1, or 2. 270. The compound of any one of claims 264 to 269, wherein q2 is 0, 1, or 2. 271. The compound of any one of claims 264 to 270, wherein q3 is 0, 1, or 2.
272. The compound of any one of claims 264 to 271, wherein the C2–C9 heterocyclylene is
Figure imgf000435_0001
Figure imgf000436_0001
273. The compound of claim 272, wherein the C2–C9 heterocyclylene is
Figure imgf000436_0002
,
Figure imgf000436_0005
274. The compound of claim 273, wherein the C2–C9 heterocyclylene is
Figure imgf000436_0004
Figure imgf000436_0003
275. The compound of any one of claims 264 to 274, wherein F1 is
Figure imgf000437_0002
Figure imgf000437_0003
276. The compound of any one of claims 264 to 275, wherein F2 is
Figure imgf000437_0004
,
Figure imgf000437_0005
277. The compound of any one of claims 264 to 275, wherein F3 is
Figure imgf000437_0001
,
Figure imgf000437_0006
278. The compound of claim 262, wherein the C2-C6 heterocyclylene is polycyclic. 279. The compound of claim 278, wherein the C2-C6 heterocyclylene is bicyclic.
280. The compound of claim 278 or 279, wherein the C2-C6 heterocyclylene is bridged.
281. The compound of claim 280, wherein the C2-C6 heterocyclylene is
Figure imgf000438_0002
Figure imgf000438_0001
282. The compound of claim 278 or 279, wherein the C2-C6 heterocyclylene is fused. 283. The compound of claim 282, wherein the C2–C9 heterocyclylene is
Figure imgf000438_0003
,
Figure imgf000438_0004
284. The compound of claim 283, wherein F1 is
Figure imgf000438_0006
Figure imgf000438_0005
285. The compound of claim 283 or 284, wherein
Figure imgf000439_0001
Figure imgf000439_0002
286. The compound of claim 278 or 279, wherein the C2-C6 heterocyclylene is spirocyclic. 287. The compound of claim 286, wherein the C2-C6 heterocyclylene is
Figure imgf000439_0003
,
Figure imgf000439_0004
Figure imgf000440_0001
288. The compound of claim 287, wherein F1 is
Figure imgf000440_0003
Figure imgf000440_0002
289. The compound of claim 287 or 288, wherein F2 is
Figure imgf000440_0004
Figure imgf000440_0005
290. The compound of any one of claims 287 to 289, wherein F3 is
Figure imgf000440_0006
,
Figure imgf000440_0007
291. The compound of any one of claims 262 to 290 wherein the C2-C9 heterocyclylene comprises a quaternary amine.
292. The compound of any one of claims 224 to 253, wherein each of F1, F2, or F3 is, independently, optionally substituted C6-C10 arylene.
293. The compound of claim 292, wherein the C6-C10 arylene i
Figure imgf000441_0001
Figure imgf000441_0002
294. The compound of any one of claims 224 to 253, wherein each of F1, F2, or F3 is, independently, optionally substituted C2-C9 heteroarylene.
295. The compound of claim 294, wherein the C2-C9 heteroarylene is
Figure imgf000441_0003
,
Figure imgf000441_0004
296. The compound of claim 295, wherein F2 is
Figure imgf000441_0005
or .
297. The compound of claim 296, wherein F2 is
Figure imgf000441_0006
. O O O
298. The compound of any one of claims 224 to 297, C3 is
Figure imgf000441_0007
.
O
299. The compound of claim 298, wherein C3 is .
300. The compound of any one of claims 224 to 299, wherein m is 1.
301. The compound of any one of claims 224 to 299, wherein m is 0.
302. The compound of any one of claims 224 to 301, wherein p is 1.
303. The compound of any one of claims 224 to 301, wherein p is 0.
304. The compound of any one of claims 224 to 303, wherein o1 is 1.
305. The compound of any one of claims 224 to 303, wherein o1 is 0.
306. The compound of any one of claims 224 to 305, wherein o2 is 1.
307. The compound of any one of claims 224 to 305, wherein o2 is 0.
308. The compound of any one of claims 224 to 307, wherein n is 1.
309. The compound of any one of claims 224 to 307, wherein n is 0.
310. The compound of any one of claims 224 to 309, wherein the linker has the structure of ,
Figure imgf000442_0001
, ,
Figure imgf000443_0001
Figure imgf000444_0001
Figure imgf000445_0001
311. The compound of any one of claims 224 to 309, wherein the linker has the structure of
Figure imgf000445_0002
Figure imgf000446_0001
Figure imgf000447_0001
Figure imgf000448_0001
Figure imgf000449_0001
Figure imgf000450_0001
312. The compound of any one of claims 224 to 309, wherein the linker has the structure of:
Figure imgf000450_0002
Figure imgf000451_0001
313. The compound of any one of claims 2 to 202, wherein the linker is optionally substituted C3-C10 carbocyclylene, optionally substituted C2–10 heterocyclylene, optionally substituted C6-C10 arylene, or optionally substituted C2-C9 heteroarylene. 314. The compound of claim 313, wherein the linker is optionally substituted C2–10 heterocyclylene 315. The compound of claim 312, wherein the linker has the structure of
Figure imgf000452_0004
Figure imgf000452_0003
316. The compound of claim 315, wherein the linker has the structure of
Figure imgf000452_0002
Figure imgf000452_0001
317. The compound of any one of claims 2 to 202, wherein the linker is absent. 318. The compound of claim 1, wherein the compound has the structure of any one of compounds B1-B6 in Table 1, or a pharmaceutically acceptable salt thereof. 319. The compound of any one of claims 2 to 317, wherein the compound has the structure of any one of compounds D1-D31 in Table 2A, or a pharmaceutically acceptable salt thereof. 320. The compound of any one of claims 2 to 317, wherein the compound has the structure of any one of compounds D32-D184 in Table 2B, or a pharmaceutically acceptable salt thereof. 321. The compound of any one of claims 2 to 317, wherein the compound has the structure of any one of compounds D185-D316 in Table 2C, or a pharmaceutically acceptable salt thereof. 322. A pharmaceutical composition comprising the compound of any one of claims 1 to 321 and a pharmaceutically acceptable excipient. 323. A method of inhibiting the level of BRD9 in a cell, the method involving contacting the cell with an effective amount of a compound of any one of claims 1 to 321, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of claim 322. 324. A method of inhibiting the activity of BRD9 in a cell, the method involving contacting the cell with an effective amount of a compound of any one of claims 1 to 321, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of claim 322.
325. The method of claim 323 or 324, wherein the cell is a cancer cell. 326. The method of claim 325, wherein the cancer is a malignant, rhabdoid tumor, a CD8+ T- cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, colorectal cancer, a sarcoma, non-small cell lung cancer, stomach cancer, or breast cancer. 327. The method of claim 326, wherein the cancer is a sarcoma. 328. The method of claim 327, wherein the sarcoma is a soft tissue sarcoma, synovial sarcoma, Ewing’s sarcoma, osteosarcoma, rhabdomyosarcoma, adult fibrosarcoma, alveolar soft-part sarcoma, angiosarcoma, clear cell sarcoma, desmoplastic small round cell tumor, epithelioid sarcoma, fibromyxoid sarcoma, gastrointestinal stromal tumor, Kaposi sarcoma, liposarcoma, leiomyosarcoma, malignant mesenchymoma malignant peripheral nerve sheath tumors, myxofibrosarcoma, or low-grade rhabdomyosarcoma. 329. The method of claim 328, wherein the sarcoma is synovial sarcoma. 330. A method of treating a BAF complex-related disorder in a subject in need thereof, the method involving administering to the subject an effective amount of a compound of any one of claims 1 to 321, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of claim 322. 331. A method of treating an SS18-SSX fusion protein-related disorder in a subject in need thereof, the method involving administering to the subject an effective amount of a compound of any one of claims 1 to 321, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of claim 322. 332. A method of treating a BRD9-related disorder in a subject in need thereof, the method involving administering to the subject an effective amount of a compound of any one of claims 1 to 321, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of claim 322. 333. The method of any one of claims 330 to 332, wherein the disorder is cancer. 334. A method of treating a cancer in a subject in need thereof, the method including administering to the subject an effective amount of a compound of any one of claims 1 to 321, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of claim 322. 335. The method of claim 333 or 334, wherein the cancer is a malignant, rhabdoid tumor, a CD8+ T-cell lymphoma, endometrial carcinoma, ovarian carcinoma, bladder cancer, stomach cancer, pancreatic cancer, esophageal cancer, prostate cancer, renal cell carcinoma, melanoma, colorectal cancer, a sarcoma, non-small cell lung cancer, stomach cancer, or breast cancer. 336. The method of claim 335, wherein the cancer is a sarcoma. 337. The method of claim 336, wherein the sarcoma is a soft tissue sarcoma, synovial sarcoma, Ewing’s sarcoma, osteosarcoma, rhabdomyosarcoma, adult fibrosarcoma, alveolar soft-part sarcoma, angiosarcoma, clear cell sarcoma, desmoplastic small round cell tumor, epithelioid sarcoma, fibromyxoid sarcoma, gastrointestinal stromal tumor, Kaposi sarcoma, liposarcoma, leiomyosarcoma, malignant mesenchymoma malignant peripheral nerve sheath tumors, myxofibrosarcoma, or low-grade rhabdomyosarcoma. 338. The method of claim 337, wherein the sarcoma is synovial sarcoma. 339. The method of any one of claims 330 to 332, wherein the disorder is infection. 340. A method of treating infection in a subject in need thereof, the method comprising administering to the subject an effective amount of a compound of any one of claims 1 to 321, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of claim 322. 341. The method of claim 339 or 340, wherein the infection is viral infection. 342. The method of claim 341, wherein the viral infection is an infection with a virus of the Retroviridae family, Hepadnaviridae family, Flaviviridae family, Adenoviridae family, Herpesviridae family, Papillomaviridae family, Parvoviridae family, Polyomaviridae family, Paramyxoviridae family, or
Togaviridae family. 343. The method of claim 341 or 342, wherein the viral infection is Coffin Siris,
Neurofibromatosis, or Multiple Meningioma.
PCT/US2020/015740 2019-01-29 2020-01-29 Compounds and uses thereof Ceased WO2020160192A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
EP20749033.5A EP3917526A4 (en) 2019-01-29 2020-01-29 CONNECTIONS AND USES THEREOF
EA202192106A EA202192106A1 (en) 2019-07-31 2020-01-29 COMPOUNDS AND THEIR APPLICATIONS
JP2021544150A JP2022523073A (en) 2019-01-29 2020-01-29 Compounds and their use
US17/425,132 US12391686B2 (en) 2019-01-29 2020-01-29 Compounds and uses thereof
AU2020214802A AU2020214802A1 (en) 2019-01-29 2020-01-29 Compounds and uses thereof
CN202080025205.9A CN113874016A (en) 2019-01-29 2020-01-29 Compound and use thereof
IL285178A IL285178A (en) 2019-01-29 2021-07-28 compounds and their use

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201962798434P 2019-01-29 2019-01-29
US62/798,434 2019-01-29
US201962881018P 2019-07-31 2019-07-31
US201962881163P 2019-07-31 2019-07-31
US62/881,018 2019-07-31
US62/881,163 2019-07-31

Publications (1)

Publication Number Publication Date
WO2020160192A1 true WO2020160192A1 (en) 2020-08-06

Family

ID=71840250

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/015740 Ceased WO2020160192A1 (en) 2019-01-29 2020-01-29 Compounds and uses thereof

Country Status (7)

Country Link
US (1) US12391686B2 (en)
EP (1) EP3917526A4 (en)
JP (1) JP2022523073A (en)
CN (1) CN113874016A (en)
AU (1) AU2020214802A1 (en)
IL (1) IL285178A (en)
WO (1) WO2020160192A1 (en)

Cited By (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021155225A1 (en) * 2020-01-29 2021-08-05 Foghorn Therapeutics Inc. Compounds and uses thereof
WO2021178920A1 (en) 2020-03-05 2021-09-10 C4 Therapeutics, Inc. Compounds for targeted degradation of brd9
WO2021222542A1 (en) * 2020-04-30 2021-11-04 President And Fellows Of Harvard College 5-amino-2-piperidinon-3-yl-1-oxoisoindoline derivatives for degradation of ikzf2 degraders
EP4021580A1 (en) * 2019-08-27 2022-07-06 The Regents Of The University Of Michigan Cereblon e3 ligase inhibitors
US11414416B1 (en) 2019-01-29 2022-08-16 Foghorn Therapeutics Inc. Compounds and uses thereof
WO2022232391A1 (en) * 2021-04-29 2022-11-03 Dana-Farber Cancer Institute, Inc. Phthalimido cereblon complex binders and transcription factor degraders and methods of use
WO2022270994A1 (en) 2021-06-25 2022-12-29 한국화학연구원 Novel bifunctional heterocyclic compound having btk degradation function via ubiquitin proteasome pathway, and use thereof
WO2023283263A1 (en) * 2021-07-06 2023-01-12 Foghorn Therapeutics Inc. Citrate salt, pharmaceutical compositions, and methods of making and using the same
WO2023010354A1 (en) * 2021-08-04 2023-02-09 四川大学华西医院 Small molecule compound having egfr inhibitory activity, and preparation method therefor and use thereof
CN115894450A (en) * 2021-11-30 2023-04-04 知和(山东)大药厂有限公司 Novel polycyclic compound, composition and application thereof
WO2023109892A1 (en) * 2021-12-15 2023-06-22 海思科医药集团股份有限公司 Compound for inhibiting or degrading brd9, and composition and pharmaceutical use thereof
CN116669769A (en) * 2020-10-16 2023-08-29 达纳-法伯癌症研究所公司 Piperidinyl small molecule degradation agent and method of use of HELIOS
US11773085B2 (en) 2018-01-30 2023-10-03 Foghorn Therapeutics Inc. Methods and compounds for treating disorders
US11787800B2 (en) 2020-07-29 2023-10-17 Foghorn Therapeutics Inc. BRD9 degraders and uses thereof
JP2023545396A (en) * 2020-10-16 2023-10-30 ダナ-ファーバー キャンサー インスティテュート,インコーポレイテッド Helios' piperidinyl low molecule decomposer and how to use it
CN117242060A (en) * 2021-01-13 2023-12-15 蒙特罗萨医疗公司 Isoindolinone compounds
WO2024057021A1 (en) 2022-09-13 2024-03-21 Amphista Therapeutics Limited Compounds for targeted protein degradation
WO2024064358A1 (en) 2022-09-23 2024-03-28 Ifm Due, Inc. Compounds and compositions for treating conditions associated with sting activity
WO2024163609A1 (en) * 2023-02-01 2024-08-08 Foghorn Therapeutics Inc. Compositions for treating cancer
US12351579B2 (en) 2019-01-29 2025-07-08 Foghorn Therapeutics Inc. Compounds and uses thereof
US12384776B2 (en) 2019-01-29 2025-08-12 Foghorn Therapeutics Inc. Compounds and uses thereof
US12391686B2 (en) 2019-01-29 2025-08-19 Foghorn Therapeutics Inc. Compounds and uses thereof
US12441733B2 (en) 2018-03-26 2025-10-14 Novartis Ag Substituted 2,4-dioxotetrahydropyrimidines as intermediates in the synthesis of bruton's tyrosine kinase inhibitors
US12528825B2 (en) 2020-01-29 2026-01-20 Foghorn Therapeutics Inc. Compounds and uses thereof
WO2026052822A1 (en) 2024-09-06 2026-03-12 Amphista Therapeutics Limited Tetrahydroisoquinoline compounds for targeted protein degradation
US12590079B2 (en) 2019-07-31 2026-03-31 Foghorn Therapeutics Inc. Compounds and uses thereof
EP4644382A4 (en) * 2022-12-27 2026-04-01 Gluetacs Therapeutics Shanghai Co Ltd COMPOUND BASED ON A SULFUR/OXIDUM-SUBSTITUTED GLUTARIMID-BASED ISOINDOLINONE SCALE AND USE THEREOF

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR112022003514A2 (en) * 2019-09-16 2022-05-17 Novartis Ag Bifunctional brd9 degraders and their methods of use
CN119524139A (en) * 2023-08-28 2025-02-28 海创药业股份有限公司 A combined drug of estrogen protein targeted degradation agent and its use

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170050968A1 (en) * 2015-04-15 2017-02-23 Celgene Quanticel Research, Inc. Bromodomain inhibitor
WO2017223452A1 (en) * 2016-06-23 2017-12-28 Dana-Farber Cancer Institute, Inc. Degradation of bromodomain-containing protein 9 (brd9) by conjugation of brd9 inhibitors with e3 ligase ligand and methods of use
US20180044335A1 (en) * 2015-03-05 2018-02-15 Boehringer Ingelheim International Gmbh New Pyridinones and Isoquinolinones as Inhibitors of the Bromodomain BRD9
US20180215766A1 (en) * 2013-11-18 2018-08-02 Forma Therapeutics, Inc. Tetrahydroquinoline compositions as bet bromodomain inhibitors

Family Cites Families (93)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
JPH0733773A (en) 1993-07-22 1995-02-03 Mitsubishi Chem Corp Phenylfuropyridazinone
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
WO2001059094A2 (en) 2000-02-11 2001-08-16 The Salk Institute For Biological Studies Method of regulating transcription in a cell by altering remodeling of cromatin
US7572631B2 (en) 2000-02-24 2009-08-11 Invitrogen Corporation Activation and expansion of T cells
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
BR0108545A (en) 2000-02-24 2004-06-29 Xcyte Therapies Inc Simultaneous cell stimulation and concentration
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20050079512A1 (en) 2003-02-26 2005-04-14 Emerson Beverly M. Methods of modulating gene expression
DK2238982T3 (en) 2003-06-27 2013-01-28 Astellas Pharma Inc Therapeutic agent for soft tissue sarcoma
AU2005245386B2 (en) 2004-05-07 2008-11-27 Amgen Inc. Nitrogenated heterocyclic derivatives as protein kinase modulators and use for the treatment of angiogenesis and cancer
EP2148678A4 (en) 2007-05-23 2010-08-04 Siga Technologies Inc Antiviral drugs for treatment or prevention of dengue infection
WO2009018018A2 (en) 2007-07-31 2009-02-05 University Of Utah Research Foundation Animal model of synovial sarcoma
TW201105669A (en) 2009-07-30 2011-02-16 Irm Llc Compounds and compositions as Syk kinase inhibitors
MX2014010176A (en) 2012-02-23 2014-11-10 Abbvie Inc Pyridopyrimidinone inhibitors of kinases.
US9271978B2 (en) 2012-12-21 2016-03-01 Zenith Epigenetics Corp. Heterocyclic compounds as bromodomain inhibitors
US9410943B2 (en) 2013-03-14 2016-08-09 The Board Of Trustees Of The Leland Stanford Junior University Methods, compositions and screens for therapeutics for the treatment of synovial sarcoma
US10976320B2 (en) 2013-05-21 2021-04-13 The Board Of Trustees Of The Leland Stanford Junior University Methods for identifying and treating cancer patients
JPWO2015046193A1 (en) 2013-09-25 2017-03-09 塩野義製薬株式会社 Aromatic heterocyclic amine derivatives having TRPV4 inhibitory activity
DK3290407T3 (en) 2013-10-18 2020-03-23 Celgene Quanticel Res Inc Bromodomain inhibitors
EP3102193B1 (en) 2014-02-06 2023-01-11 Rutgers, The State University of New Jersey Antibacterial agents: n(alpha)-aroyl-n-aryl-phenylalaninamides
US20160058872A1 (en) 2014-04-14 2016-03-03 Arvinas, Inc. Imide-based modulators of proteolysis and associated methods of use
JP6566607B2 (en) 2014-05-22 2019-08-28 株式会社 資生堂 Pretreatment method and analysis method of lenalidomide in biological sample
JP6616934B2 (en) 2014-05-22 2019-12-04 株式会社 資生堂 Optical resolution method of lenalidomide
MA40943A (en) 2014-11-10 2017-09-19 Constellation Pharmaceuticals Inc SUBSTITUTED PYRROLOPYRIDINES USED AS BROMODOMA INHIBITORS
US9694084B2 (en) 2014-12-23 2017-07-04 Dana-Farber Cancer Institute, Inc. Methods to induce targeted protein degradation through bifunctional molecules
US9918243B2 (en) 2015-02-05 2018-03-13 Telefonaktiebolaget Lm Ericsson (Publ) Measurement procedure under adaptive frequency separation
EP3270694A4 (en) 2015-02-17 2018-09-05 Neupharma, Inc. Certain chemical entities, compositions, and methods
WO2017007612A1 (en) 2015-07-07 2017-01-12 Dana-Farber Cancer Institute, Inc. Methods to induce targeted protein degradation through bifunctional molecules
US12282014B2 (en) 2015-11-19 2025-04-22 Dana-Farber Cancer Institute, Inc. Methods of identifying compounds that interfere with ERG-driven misguidance of BAF complexes in TMPRSS2-ERG driven prostate cancers
CN105838039B (en) 2016-01-11 2018-05-01 珠海万通化工有限公司 A kind of PBAT resin combinations
CN109562107A (en) 2016-05-10 2019-04-02 C4医药公司 Heterocycle degron body for target protein degradation
EP4483875A3 (en) 2016-05-10 2025-04-02 C4 Therapeutics, Inc. Spirocyclic degronimers for target protein degradation
CN109641874A (en) 2016-05-10 2019-04-16 C4医药公司 C for target protein degradation3The glutarimide degron body of carbon connection
WO2017197056A1 (en) 2016-05-10 2017-11-16 C4 Therapeutics, Inc. Bromodomain targeting degronimers for target protein degradation
EP3455219A4 (en) 2016-05-10 2019-12-18 C4 Therapeutics, Inc. AMINE-LINKED C3-GLUTARIMIDE DEGRONIMERS FOR THE DEGRADATION OF TARGET PROTEINS
LT3660004T (en) 2016-10-11 2023-06-12 Arvinas Operations, Inc. COMPOUNDS AND METHODS FOR TARGETED ANDROGEN RECEPTOR DEGRADATION
WO2018102725A1 (en) 2016-12-01 2018-06-07 Arvinas, Inc. Tetrahydronaphthalene and tetrahydroisoquinoline derivatives as estrogen receptor degraders
AU2017382176A1 (en) 2016-12-21 2019-05-30 Biotheryx, Inc. Thienopyrrole derivatives for use in targeting proteins, compositions, methods, and uses thereof
US10138827B2 (en) 2017-01-04 2018-11-27 Ford Global Technologies, Llc Evaporative emissions system check valve monitor for a multi-path purge ejector system
CN107056772A (en) 2017-01-23 2017-08-18 中国药科大学 Bifunctional molecule and its preparation and the application of BET degradeds are induced based on cereblon parts
TW201840337A (en) 2017-02-03 2018-11-16 美商藍治療公司 Methods for treating cancer using hsp90 inhibitors
CN108658972A (en) 2017-03-28 2018-10-16 中国海洋大学 A kind of substituted lactams compounds and its preparation method and application
EP3641762B1 (en) 2017-06-20 2026-02-18 C4 Therapeutics, Inc. N/o-linked degrons and degronimers for protein degradation
WO2019023149A1 (en) 2017-07-24 2019-01-31 Salk Institute For Biological Studies Use of bromodomain-containing protein 9 antagonists in combination with vitamin d receptor agonists in diabetes treatment
WO2019040098A1 (en) 2017-08-21 2019-02-28 Dana-Farber Cancer Institute, Inc. Methods for modulating the interaction between ews-fli1 and baf complexes
CN111372585A (en) 2017-11-16 2020-07-03 C4医药公司 Degradants and degrons for target protein degradation
EP3737946B1 (en) 2018-01-12 2024-11-20 Celgene Corporation Methods for screening cereblon modifying compounds
US11497752B2 (en) 2018-01-30 2022-11-15 Foghorn Therapeutics Inc. Compounds and uses thereof
EP3746135A4 (en) 2018-01-30 2022-03-09 Foghorn Therapeutics Inc. Methods and compounds for treating disorders
KR20240130153A (en) 2018-04-01 2024-08-28 아비나스 오퍼레이션스, 인코포레이티드 Brm targeting compounds and associated methods of use
WO2019204354A1 (en) 2018-04-16 2019-10-24 C4 Therapeutics, Inc. Spirocyclic compounds
WO2019207538A1 (en) 2018-04-26 2019-10-31 Aurigene Discovery Technologies Limited Pyridazine derivatives as smarca2/4 degraders
EP3578561A1 (en) 2018-06-04 2019-12-11 F. Hoffmann-La Roche AG Spiro compounds
CN108690020A (en) 2018-07-04 2018-10-23 清华大学 It is a kind of targeting degradation BET albumen compound and its application
WO2020028444A1 (en) 2018-07-30 2020-02-06 University Of Southern California Improving the efficacy and safety of adoptive cellular therapies
EP3846800A4 (en) 2018-09-04 2022-08-24 C4 Therapeutics, Inc. LINKS TO BREAK DOWN BRD9 OR MTH1
WO2020078933A1 (en) 2018-10-16 2020-04-23 Boehringer Ingelheim International Gmbh Proteolysis targeting chimera (protacs) as degraders of smarca2 and/or smarca4
WO2020081556A2 (en) 2018-10-17 2020-04-23 Dana-Farber Cancer Institute, Inc. Non-canonical swi/snf complex and uses thereof
CN120698983A (en) 2018-12-20 2025-09-26 C4医药公司 Targeted protein degradation
US20230066136A1 (en) 2019-01-29 2023-03-02 Foghorn Therapeutics Inc. Compounds and uses thereof
CN113874016A (en) 2019-01-29 2021-12-31 福宏治疗公司 Compound and use thereof
WO2020160196A1 (en) 2019-01-29 2020-08-06 Foghorn Therapeutics Inc. Compounds and uses thereof
US20230065463A1 (en) 2019-01-29 2023-03-02 Foghorn Therapeutics Inc. Compounds and uses thereof
WO2020160198A1 (en) 2019-01-29 2020-08-06 Foghorn Therapeutics Inc. Compounds and uses thereof
CN113544130B (en) 2019-05-31 2024-01-09 西藏海思科制药有限公司 A BTK inhibitor ring derivative and its preparation method and pharmaceutical application
EP3990119A4 (en) 2019-06-26 2024-03-27 Fred Hutchinson Cancer Center METHODS AND COMPOSITIONS USING BRD9 ACTIVATION THERAPIES FOR THE TREATMENT OF CANCER AND RELATED DISEASES
WO2021022163A2 (en) 2019-07-31 2021-02-04 Foghorn Therapeutics Inc. Compounds and uses thereof
BR112022003514A2 (en) 2019-09-16 2022-05-17 Novartis Ag Bifunctional brd9 degraders and their methods of use
KR20220133259A (en) 2020-01-29 2022-10-04 포그혼 쎄라퓨틱스 인크. Compounds and uses thereof
US12528825B2 (en) 2020-01-29 2026-01-20 Foghorn Therapeutics Inc. Compounds and uses thereof
IL295709A (en) 2020-03-05 2022-10-01 C4 Therapeutics Inc Compounds for targeted knockdown of brd9
US11787800B2 (en) 2020-07-29 2023-10-17 Foghorn Therapeutics Inc. BRD9 degraders and uses thereof
JP2024507232A (en) 2021-02-22 2024-02-16 セルジーン・クオンティセル・リサーチ・インコーポレイテッド Bromodomain (BET) inhibitors used to treat prostate cancer
WO2023283263A1 (en) 2021-07-06 2023-01-12 Foghorn Therapeutics Inc. Citrate salt, pharmaceutical compositions, and methods of making and using the same
US20240325370A1 (en) 2021-07-28 2024-10-03 Foghorn Therapeutics Inc. Therapeutic regimens of a degrader of brd9
CN115806547A (en) 2021-09-09 2023-03-17 C4医药公司 Selected compounds for targeted degradation of BRD9
WO2023200800A1 (en) 2022-04-11 2023-10-19 Foghorn Therapeutics Inc. Methods of treating androgen receptor-independent prostate cancer
WO2024006292A2 (en) 2022-06-27 2024-01-04 Foghorn Therapeutics Inc. Methods of treating cancer
WO2024013766A1 (en) 2022-07-09 2024-01-18 Tvs Motor Company Limited Method and device to actuate a cornering lamp, headlamp assembly with a cornering lamp, two wheeler vehicle with the headlmap assembly
JP7819766B2 (en) 2022-07-11 2026-02-25 Ntt株式会社 Wireless communication system, terminal device, base station device, control device, and wireless communication system selection method
JP2024010814A (en) 2022-07-13 2024-01-25 三菱重工業株式会社 Heat exchanger unit, positioning method, and heat exchanger unit assembly method
JP2025527583A (en) 2022-08-18 2025-08-22 スージョウ・アボジェン・バイオサイエンシズ・カンパニー・リミテッド Lipid nanoparticle composition
WO2024163609A1 (en) 2023-02-01 2024-08-08 Foghorn Therapeutics Inc. Compositions for treating cancer
WO2024163751A1 (en) 2023-02-01 2024-08-08 Foghorn Therapeutics Inc. Formulations for treating cancer
WO2024163641A2 (en) 2023-02-01 2024-08-08 Foghorn Therapeutics Inc. Formulations for treating cancer
EP4743074A1 (en) 2023-07-12 2026-05-20 Foghorn Therapeutics Inc METHOD FOR THE TREATMENT OF BLOOD CANCER
WO2025015149A2 (en) 2023-07-12 2025-01-16 Foghorn Therapeutics Inc. Methods of treating cancer

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180215766A1 (en) * 2013-11-18 2018-08-02 Forma Therapeutics, Inc. Tetrahydroquinoline compositions as bet bromodomain inhibitors
US20180044335A1 (en) * 2015-03-05 2018-02-15 Boehringer Ingelheim International Gmbh New Pyridinones and Isoquinolinones as Inhibitors of the Bromodomain BRD9
US20170050968A1 (en) * 2015-04-15 2017-02-23 Celgene Quanticel Research, Inc. Bromodomain inhibitor
WO2017223452A1 (en) * 2016-06-23 2017-12-28 Dana-Farber Cancer Institute, Inc. Degradation of bromodomain-containing protein 9 (brd9) by conjugation of brd9 inhibitors with e3 ligase ligand and methods of use

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
DATABASE Pubchem 30 November 2012 (2012-11-30), XP055060459, Database accession no. 68310947 *

Cited By (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11773085B2 (en) 2018-01-30 2023-10-03 Foghorn Therapeutics Inc. Methods and compounds for treating disorders
US12441733B2 (en) 2018-03-26 2025-10-14 Novartis Ag Substituted 2,4-dioxotetrahydropyrimidines as intermediates in the synthesis of bruton's tyrosine kinase inhibitors
US11560381B1 (en) 2019-01-29 2023-01-24 Foghorn Therapeutics Inc. Compounds and uses thereof
US12391686B2 (en) 2019-01-29 2025-08-19 Foghorn Therapeutics Inc. Compounds and uses thereof
US11414416B1 (en) 2019-01-29 2022-08-16 Foghorn Therapeutics Inc. Compounds and uses thereof
US12351579B2 (en) 2019-01-29 2025-07-08 Foghorn Therapeutics Inc. Compounds and uses thereof
US12384776B2 (en) 2019-01-29 2025-08-12 Foghorn Therapeutics Inc. Compounds and uses thereof
US12590079B2 (en) 2019-07-31 2026-03-31 Foghorn Therapeutics Inc. Compounds and uses thereof
EP4021580A1 (en) * 2019-08-27 2022-07-06 The Regents Of The University Of Michigan Cereblon e3 ligase inhibitors
US12528825B2 (en) 2020-01-29 2026-01-20 Foghorn Therapeutics Inc. Compounds and uses thereof
WO2021155225A1 (en) * 2020-01-29 2021-08-05 Foghorn Therapeutics Inc. Compounds and uses thereof
US11851445B2 (en) 2020-01-29 2023-12-26 Foghorn Therapeutics Inc. Compounds and uses thereof
US11691972B2 (en) 2020-03-05 2023-07-04 C4 Therapeutics, Inc. Compounds for targeted degradation of BRD9
US12157735B2 (en) 2020-03-05 2024-12-03 C4 Therapeutics, Inc. Compounds for targeted degradation of BRD9
US12049464B2 (en) 2020-03-05 2024-07-30 C4 Therapeutics, Inc. Compounds for targeted degradation of BRD9
WO2021178920A1 (en) 2020-03-05 2021-09-10 C4 Therapeutics, Inc. Compounds for targeted degradation of brd9
WO2021222542A1 (en) * 2020-04-30 2021-11-04 President And Fellows Of Harvard College 5-amino-2-piperidinon-3-yl-1-oxoisoindoline derivatives for degradation of ikzf2 degraders
US11787800B2 (en) 2020-07-29 2023-10-17 Foghorn Therapeutics Inc. BRD9 degraders and uses thereof
JP2023545396A (en) * 2020-10-16 2023-10-30 ダナ-ファーバー キャンサー インスティテュート,インコーポレイテッド Helios' piperidinyl low molecule decomposer and how to use it
CN116669769A (en) * 2020-10-16 2023-08-29 达纳-法伯癌症研究所公司 Piperidinyl small molecule degradation agent and method of use of HELIOS
CN117242060A (en) * 2021-01-13 2023-12-15 蒙特罗萨医疗公司 Isoindolinone compounds
WO2022232391A1 (en) * 2021-04-29 2022-11-03 Dana-Farber Cancer Institute, Inc. Phthalimido cereblon complex binders and transcription factor degraders and methods of use
WO2022270994A1 (en) 2021-06-25 2022-12-29 한국화학연구원 Novel bifunctional heterocyclic compound having btk degradation function via ubiquitin proteasome pathway, and use thereof
US12161722B2 (en) 2021-06-25 2024-12-10 Korea Research Institute Of Chemical Technology Bifunctional heterocyclic compound having BTK degradation function via ubiquitin proteasome pathway, and use thereof
US11767330B2 (en) 2021-07-06 2023-09-26 Foghorn Therapeutics Inc. Citrate salt, pharmaceutical compositions, and methods of making and using the same
WO2023283263A1 (en) * 2021-07-06 2023-01-12 Foghorn Therapeutics Inc. Citrate salt, pharmaceutical compositions, and methods of making and using the same
WO2023010354A1 (en) * 2021-08-04 2023-02-09 四川大学华西医院 Small molecule compound having egfr inhibitory activity, and preparation method therefor and use thereof
CN115894450B (en) * 2021-11-30 2023-09-12 山东如至生物医药科技有限公司 Novel polycyclic compound and composition and application thereof
CN115894450A (en) * 2021-11-30 2023-04-04 知和(山东)大药厂有限公司 Novel polycyclic compound, composition and application thereof
WO2023109892A1 (en) * 2021-12-15 2023-06-22 海思科医药集团股份有限公司 Compound for inhibiting or degrading brd9, and composition and pharmaceutical use thereof
WO2024057021A1 (en) 2022-09-13 2024-03-21 Amphista Therapeutics Limited Compounds for targeted protein degradation
WO2024064358A1 (en) 2022-09-23 2024-03-28 Ifm Due, Inc. Compounds and compositions for treating conditions associated with sting activity
EP4644382A4 (en) * 2022-12-27 2026-04-01 Gluetacs Therapeutics Shanghai Co Ltd COMPOUND BASED ON A SULFUR/OXIDUM-SUBSTITUTED GLUTARIMID-BASED ISOINDOLINONE SCALE AND USE THEREOF
WO2024163609A1 (en) * 2023-02-01 2024-08-08 Foghorn Therapeutics Inc. Compositions for treating cancer
WO2026052822A1 (en) 2024-09-06 2026-03-12 Amphista Therapeutics Limited Tetrahydroisoquinoline compounds for targeted protein degradation
US12624035B2 (en) 2024-09-06 2026-05-12 Amphista Therapeutics Limited Compounds for targeted protein degradation

Also Published As

Publication number Publication date
AU2020214802A1 (en) 2021-08-12
EP3917526A1 (en) 2021-12-08
US20230077730A1 (en) 2023-03-16
EP3917526A4 (en) 2022-11-02
US12391686B2 (en) 2025-08-19
CN113874016A (en) 2021-12-31
IL285178A (en) 2021-09-30
JP2022523073A (en) 2022-04-21

Similar Documents

Publication Publication Date Title
AU2020214802A1 (en) Compounds and uses thereof
JP7639010B2 (en) Compounds and their uses
EP3917529A1 (en) Compounds and uses thereof
EP3917934A2 (en) Compounds and uses thereof
US20240150328A1 (en) Methods and compounds for treating disorders
WO2020160198A1 (en) Compounds and uses thereof
US11787800B2 (en) BRD9 degraders and uses thereof
US12528825B2 (en) Compounds and uses thereof
WO2021022163A2 (en) Compounds and uses thereof
EP4247815A1 (en) Compounds and uses thereof
WO2023283263A1 (en) Citrate salt, pharmaceutical compositions, and methods of making and using the same
WO2022025880A1 (en) Compounds and uses thereof
EA047751B1 (en) COMPOUNDS AND METHODS OF THEIR APPLICATION
HK40080957A (en) Compounds and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20749033

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2021544150

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020214802

Country of ref document: AU

Date of ref document: 20200129

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2020749033

Country of ref document: EP

Effective date: 20210830

WWG Wipo information: grant in national office

Ref document number: 17425132

Country of ref document: US