WO2020160182A1 - Targeted delivery of ifn gamma using antibody fusion proteins - Google Patents

Targeted delivery of ifn gamma using antibody fusion proteins Download PDF

Info

Publication number
WO2020160182A1
WO2020160182A1 PCT/US2020/015727 US2020015727W WO2020160182A1 WO 2020160182 A1 WO2020160182 A1 WO 2020160182A1 US 2020015727 W US2020015727 W US 2020015727W WO 2020160182 A1 WO2020160182 A1 WO 2020160182A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
construct
interferon gamma
cancer
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/015727
Other languages
French (fr)
Inventor
Kham M Trinh
John Matthew TIMMERMAN
Sherie Leaver MORRISON
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of California Berkeley
University of California San Diego UCSD
Original Assignee
University of California Berkeley
University of California San Diego UCSD
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of California Berkeley, University of California San Diego UCSD filed Critical University of California Berkeley
Priority to US17/310,279 priority Critical patent/US20220177598A1/en
Publication of WO2020160182A1 publication Critical patent/WO2020160182A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/555Interferons [IFN]
    • C07K14/57IFN-gamma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/734Complement-dependent cytotoxicity [CDC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • Interferon-gamma is a pleiotropic cytokine secreted by Natural
  • IFN-g has pleiotropic activities including: directly inhibiting cell growth, inducing an antiviral state in cells, upregulating cell surface markers such as Class I and II MHC, and regulating the activity of macrophages, NK cells, neutrophils, B-cells, and T-cells. As such, IFN-g has broad appeal for use as a cancer therapeutic.
  • IFN-g functions as a dimeric cytokine that binds to a heterodimeric receptor consisting of the IFN-g Receptor Chain 1 (IFNGR1), which provides binding affinity, and Receptor Chain 2 (IFNGR2), which is involved in signal transduction.
  • IFNGR1 IFN-g Receptor Chain 1
  • IFNGR2 Receptor Chain 2
  • the human IFNy gene encodes a polypeptide of 143 amino acid residues.
  • Human IFNy Natural forms of human IFNy are modified to contain N-linked glycosylation at two positions, and a heterogeneous C terminus.
  • Mouse IFNy contains only 2 potential sites of N-glycosylation. However, glycosylation is not necessary for activity as recombinant IFNy produced in E. coli is active.
  • Human IFNy has a heterogeneous carboxy-terminus and studies have shown that proteins missing 9 of the c-terminal amino acids have improved anti-viral activity.
  • the crystal structure of human IFNy revealed an alpha-helical homodimer composed of two peptide chains.
  • Each domain consists of six tightly associated a-helices of which four are donated from one peptide chain and the last two from the other to form intertwined or domain- swapped dimers. This dimer binds two copies of IFNGR1 in solution and the IFN-g dimer structure is important for full activity.
  • Embodiment 1 A chimeric construct comprising a full-length
  • immunoglobulin or a camelid antibody attached to an interferon gamma IENg wherein:
  • said immunoglobulin or camelid antibody is an antibody that binds to a tumor associated antigen
  • a first interferon gamma is attached to a first constant heavy region 3 (CEE) of said immunoglobulin or camelid antibody by a first proteolysis resistant peptide linker;
  • a second interferon gamma is attached to a second constant heavy region 3 (CEE) of said immunoglobulin or camelid antibody by a second proteolysis resistant peptide linker; and
  • said first proteolysis resistant linker and said second proteolysis linker have a length and flexibility that permits said first interferon gamma and said second interferon gamma to dimerize.
  • Embodiment 2 The construct of embodiment 1, wherein said first proteolysis resistant peptide linker and said second proteolysis peptide linker comprise amino acid sequences independently selected from the amino acid sequences of the peptide linkers shown in Table 1.
  • Embodiment 3 The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the Landar linker.
  • Embodiment 4 The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the Double landar linker.
  • Embodiment 5 The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the lqo0E_l linker.
  • Embodiment 6 The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the IgG3 hinge linker.
  • Embodiment ? The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the IgG3 hinge delta cys linker.
  • Embodiment 8 The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the IgGl hinge delta cys linker.
  • Embodiment 9 The construct according to any one of embodiments 1-8, wherein said interferon gamma comprises a murine interferon gamma, or a truncated and/or mutated murine interferon gamma.
  • Embodiment 10 The construct of embodiment 9, wherein said interferon gamma comprises a full-length murine interferon gamma.
  • Embodiment 11 The construct according to any one of embodiments 9-10, wherein said murine interferon gamma is not glycosylated.
  • Embodiment 12 The construct according to any one of embodiments 9- lOwherein said murine interferon gamma is glycosylated at Asn 38 and/or at ASN 90.
  • Embodiment 13 The construct according to any one of embodiments 1-8, wherein said interferon gamma comprises a human interferon gamma or a truncated and/or mutated human interferon gamma.
  • Embodiment 14 The construct of embodiment 13, wherein said human interferon gamma is not glycosylated.
  • Embodiment 15 The construct of embodiment 13, wherein said human interferon gamma comprises N-linked glycosylation at Asn-25 and/or at Asn-97.
  • Embodiment 16 The construct according to any one of embodiments 13-15, wherein said human interferon gamma comprises a full-length human interferon.
  • Embodiment 17 The construct according to any one of embodiments 13-15, wherein said human interferon gamma comprises a huIFNy C-terminally truncated with 1- 15 amino acid residues, e.g. with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acid residues.
  • Embodiment 18 The construct according to any one of embodiments 13-15, and 17, wherein said human interferon gamma comprises a human interferon gamma N- terminally truncated with 1, 2, or 3 amino acid residues.
  • Embodiment 19 The construct according to any one of embodiments 13-15, wherein said human interferon gamma comprise a human interferon gamma with an N- terminai addition CYC.
  • Embodiment 20 The construct according to any one of embodiments 13-19, wherein said human interferon gamma comprises a cysteine substitutions at one or more of Glu8, Ser70, Alal8, Hisl l2, Lys81, Leul21, Gln49, and leu96 (relative to the amino acid sequence of SEQ ID NO: 13).
  • Embodiment 21 The construct of embodiment 20, wherein said human interferon gamma comprises at least one pair of amino acids from predetermined amino acid pairs exchanged for cysteine, wherein said four amino acid pairs are Glu8 and Ser70, Alai 8 and His 112, Lys81 and Leul21, and Gln-49 and Leu96.
  • TPI TRP-2, Tyrosinase, VEGF, VLA, ZAG, and b-catenin.
  • Embodiment 23 The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to CSPG4.
  • Embodiment 24 The construct of embodiment 23, wherein said antibody comprises the CDRs of an antibody selected from the group consisting of 9.2.27, VF1- TP34, VF1-TP34, VF1-TP41.2, TP61.5, 149.53, 149.53, 225.28, 225.28s, 763.74, and scFv- FcC21.
  • Embodiment 25 The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD 138.
  • Embodiment 26 The construct of embodiment 25, wherein said antibody comprises the CDRs of an antibody comprises an antibody selected from the group consisting of nBT062, B-B4, BC/B-B4, B-B2, DL-101, 1 D4, MI15, 1.BB.210, 2Q1484, 5F7, 104-9, and 281-2.
  • Embodiment 27 The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to a member of the EGF receptor family.
  • Embodiment 28 The construct of embodiment 27, wherein said antibody comprises the CDRs of an antibody comprises an antibody selected from the group consisting of C6.5, C6ML3-9, C6MH3-B1, C6-B1D2, F5, HER3.A5, HER3.F4, HER3.H1, HER3.H3, HER3.E12, HER3.B12, EGFR.E12, EGFR.C10, EGFR.Bl l, EGFR.E8, HER4.B4, HER4.G4, HER4.F4, HER4.A8, HER4.B6, HER4.D4, HER4.D7, HER4.D11, HER4.D12, HER4.E3, HER4.E7, HER4.F8 and HER4.C7.
  • Embodiment 29 The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD20.
  • Embodiment 30 The construct of embodiment 29, wherein said antibody comprises the CDRs of an antibody comprises an antibody selected from the group consisting of rituximab, Ibritumomab tiuxetan, and tositumomab.
  • Embodiment 31 The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to endoplasmin.
  • Embodiment 32 The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD33.
  • Embodiment 33 The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD276.
  • Embodiment 34 The construct according to any one of embodiments 1-33, wherein said antibody or camelid antibody is a full-length immunoglobulin.
  • Embodiment 35 The construct of embodiment 34, wherein said antibody is a human antibody.
  • Embodiment 36 The construct of embodiment 34, wherein said antibody is a humanized or chimeric antibody.
  • Embodiment 37 The construct according to any one of embodiments 1-33, wherein said antibody or camelid antibody is a camelid antibody.
  • Embodiment 38 A pharmaceutical formulation comprising:
  • a pharmaceutically acceptable carrier [0050] a pharmaceutically acceptable carrier.
  • Embodiment 39 The pharmaceutical formulation of embodiment 38, wherein said formulation is a unit dosage formulation.
  • Embodiment 40 The formulation according to any one of embodiments 38-
  • said formulation is formulated for administration via a route selected from the group consisting of oral administration, nasal administration, rectal administration, intraperitoneal injection, intravascular injection, subcutaneous injection, transcutaneous administration, and intramuscular injection.
  • Embodiment 41 A method of inhibiting growth and/or proliferation of a cell that expresses or overexpresses CD 138, said method comprising contacting said cell with a chimeric construct according to any of embodiments 1-36, or a formulation according to any one of embodiments 37-39 in an amount sufficient to inhibit growth or proliferation of said cell.
  • Embodiment 42 The method of embodiment 41, wherein said cell is a cancer cell.
  • Embodiment 43 The method of embodiment 42, wherein said cancer cell is a metastatic cell.
  • Embodiment 44 The method of embodiment 42, wherein said cancer cell is in a solid tumor.
  • Embodiment 45 The method of embodiment 42, wherein said cancer cell is cell produced by a cancer selected from the group consisting of multiple myeloma, ovarian carcinoma, cervical cancer, endometrial cancer, kidney carcinoma, gall bladder carcinoma, transitional cell bladder carcinoma, gastric cancer, prostate adenocarcinoma, breast cancer, prostate cancer, lung cancer, colon carcinoma, Hodgkin's and non-Hodgkin's lymphoma, chronic lymphocytic leukemia (CLL), acute lymphoblastic leukemia (ALL), acute myeloblastic leukemia (AML), a solid tissue sarcoma, colon carcinoma, non-small cell lung carcinoma, squamous cell lung carcinoma, colorectal carcinoma, hepato-carcinoma, pancreatic cancer, and head and neck carcinoma.
  • a cancer selected from the group consisting of multiple myeloma, ovarian carcinoma, cervical cancer, endometrial cancer, kidney carcinoma, gall bladder carcinoma, transitional cell bladder carcinoma, gastric cancer
  • Embodiment 46 The method of embodiment 42, wherein said cancer cell is a cell of a multiple myeloma.
  • Embodiment 47 The method according to any one of embodiments 41-46, wherein said method comprises inhibiting, delaying and/or preventing the growth of a tumor and/or spread of malignant tumor cells.
  • Embodiment 48 The method according to any one of embodiments 41-47, wherein said contacting comprises systemically administering said construct or formulation to a mammal.
  • Embodiment 49 The method according to any one of embodiments 41-47, wherein said contacting comprises administering said construct or formulation directly into a tumor site.
  • Embodiment 50 The method according to any one of embodiments 41-47, wherein said contacting comprises administering said construct or formulation via a route selected from the group consisting of oral administration, intravenous administration, intramuscular administration, direct tumor administration, inhalation, rectal administration, vaginal administration, transdermal administration, and subcutaneous depot administration ⁇
  • Embodiment 51 The method according to any one of embodiments 41-47, wherein said contacting comprises administering said construct or formulation
  • Embodiment 52 The method according to any one of embodiments 41-51, wherein said cell is a cell in a human.
  • Embodiment 53 The method according to any one of embodiments 41-51, wherein said cell is a cell in a non-human mammal.
  • Embodiment 54 The method of embodiment 41, wherein said cancer cell is a cell produced by a multiple myeloma.
  • Embodiment 55 The method according to any one of embodiments 41-54, wherein said method comprises co-administration of said chimeric construct with bortezomib.
  • Embodiment 55 The method according to any one of embodiments 41-55, wherein said method comprises co- administration of said chimeric construct with ibrutinib.
  • Embodiment 57 The method according to any one of embodiments 55-55, wherein said co- administration provides a synergistic effect.
  • targeted interferon refers to an interferon attached to a "targeting moiety” (e.g. , an antibody) that binds to a molecule disposed, for example, on the surface of a cell (e.g., a cancer cell).
  • a targeting moiety e.g. , an antibody
  • binds to a molecule disposed, for example, on the surface of a cell e.g., a cancer cell.
  • a illustrative targeted interferon comprises a chimeric moiety comprising an antibody or a camelid antibody attached to two interferon gamma molecules as described herein.
  • polypeptide refers to a polymer of amino acid residues.
  • the terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers.
  • the term also includes variants on the traditional peptide linkage joining the amino acids making up the polypeptide.
  • amino terminus refers to the free a- amino group on an amino acid at the amino terminal of a peptide or to the a-amino group (imino group when participating in a peptide bond) of an amino acid at any other location within the peptide.
  • carboxy terminus refers to the free carboxyl group on the carboxy terminus of a peptide or the carboxyl group of an amino acid at any other location within the peptide.
  • Peptides also include essentially any polyamino acid including, but not limited to peptide mimetics such as amino acids joined by an ether as opposed to an amide bond.
  • an "antibody”, as used herein, refers to a protein consisting of one or more polypeptides substantially encoded by immunoglobulin genes or fragments of
  • the immunoglobulin genes are human immunoglobulin genes. Recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as myriad
  • Light chains are typically classified as either kappa or lambda.
  • Heavy chains are typically classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
  • a typical (native) immunoglobulin (antibody) (full-length antibody) structural unit comprises a tetramer.
  • Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kD) and one "heavy” chain (about 50-70 kD).
  • the N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
  • the terms variable light chain (VL) and variable heavy chain (VH) refer to these regions of the light and heavy chains respectively. It is noted that immunoglobulins IgA and IgM contain multiple copies of the four chain structure.
  • the phrase "inhibition of growth and/or proliferation" of a cancer cell refers to decrease in the growth rate and/or proliferation rate of a cancer cell. In certain embodiments this includes death of a cancer cell (e.g. via apoptosis). In certain
  • this term also refers to inhibiting the growth and/or proliferation of a solid tumor and/or inducing tumor size reduction or elimination of the tumor.
  • tumor associated antigen refers to biomolecules such as proteins, carbohydrates, glycoproteins, and the like that are exclusively or preferentially or differentially expressed on a cancer cell and/or are found in association with a cancer cell and thereby provide targets preferential or specific to the cancer.
  • the preferential expression can be preferential expression as compared to any other cell in the organism, or preferential expression within a particular area of the organism (e.g. within a particular organ or tissue).
  • subject may be used interchangeably and refer to a mammal, preferably a human or a non-human primate, but also domesticated mammals (e.g., canine or feline), laboratory mammals (e.g., mouse, rat, rabbit, hamster, guinea pig), and agricultural mammals (e.g., equine, bovine, porcine, ovine).
  • domesticated mammals e.g., canine or feline
  • laboratory mammals e.g., mouse, rat, rabbit, hamster, guinea pig
  • agricultural mammals e.g., equine, bovine, porcine, ovine
  • the subject can be a human (e.g., adult male, adult female, adolescent male, adolescent female, male child, female child) under the care of a physician or other health worker in a hospital, psychiatric care facility, as an outpatient, or other clinical context.
  • the subject may not be under the care or prescription of a physician or other health worker.
  • the phrase "cause to be administered” refers to the actions taken by a medical professional (e.g., a physician), or a person controlling medical care of a subject, that control and/or permit the administration of the agent(s)/compound(s) at issue to the subject.
  • Causing to be administered can involve diagnosis and/or determination of an appropriate therapeutic or prophylactic regimen, and/or prescribing particular
  • agent(s)/compounds for a subject can include, for example, drafting a prescription form, annotating a medical record, and the like. Where administration is described herein, "causing to be administered" is also contemplated.
  • the term "exhibiting IFN gamma activity" is intended to indicate that the polypeptide has one or more of the functions of native IFNy, in particular huIFNy or rhuIFNy. Such functions include, inter alia, the capability to bind to an IFNy receptor and cause transduction of the signal transduced upon huIFNy-binding of its receptor as determined in vitro or in vivo (/. ⁇ ? ., in vitro or in vivo bioactivity).
  • the IFNy receptor has been described by Aguet et al. (1988) Cell 55: 273-280) and Calderon et al. (1988) Proc. Natl. Acad. Sci. USA, 85:4837-4841.
  • the "IFNy polypeptide” is a polypeptide exhibiting IFNy activity and is used herein about the polypeptide in monomer or dimeric form, as appropriate. For instance, when specific substitutions are indicated these are normally indicated relative to the IFNy polypeptide monomer. When reference is made to the IFNy as part of a conjugate this is normally in dimeric form (and thus, e.g., comprises two IFNy polypeptide monomers modified as described).
  • the dimeric form of the IFNy polypeptides may be provided by the normal association of two monomers or be in the form of a single chain dimeric IFNy polypeptide.
  • the IFNy polypeptide described herein may have an in vivo or in vitro bioactivity of the same magnitude as huJFNy or rhuIFNy or lower or higher, e.g. an in vivo or in vitro bioactivity of > 100% (e.g., 125% or greater, or 150% or greater, or 200% or greater, or 300% or greater, or 400% or greater, or 500% or greater, or 1000% (10-fold) or greater, and so forth), 1-100% of that of huIFNy or rhuIFNy, as measured under the same conditions, e.g. 1-25% or 1-50% or 25-100% or 50-100% of that of huIFNy or rhuIFNy.
  • Figure 1 Inhibition of proliferation by anti-CSPG4 fusions with IFNy using different linkers.
  • OVCAR and T98MG cells were treated for 3 days and A375 cells were treated with 4 days with the indicated fusion proteins at different concentrations and the metabolic activity of the remaining cells determined using the MTS assay.
  • Figure 2 Inhibition of proliferation by anti-CSPG4 fusions with IFNy using different linkers. Cells were treated for 6 days with the indicated fusion proteins at different concentrations and the metabolic activity of the remaining cells determined using the MTS assay.
  • FIG. 1 Ovarian cancer cell lines were stained with the indicated antibodies and analyzed by flow cytometry.
  • Cells were treated for 6 days and proliferation analyzed by MTS.
  • Figure 5 Inhibition of proliferation of ovarian cell lines following treatment with hIFNy, targeted anti-CD 138 IFNy, or untargeted anti-CD20-IFNy for 6 days.
  • Figure 6 Inhibition of proliferation of the glioblastoma T98MG following treatment with targeted unfused anti-CD138, anti-CD138-IFNa2, anti-CD 138-IFNal4, anti- CD 138-IFNa2 YNS , or anti-CD 138IFNy or untargeted anti-CD20-IFNy for 6 days. Metabolic activity of surviving cells was determined using the MTS assay.
  • FIG. 8 B16 mouse myeloma cells were incubated with either 1.5 nM mouse IFNy (mlFNy) or .75 nM anti-CD20-mIFNy for 24 hours, stained with PE-labeled mouse anti-H2-K b and analyzed by flow-cytometry. Controls included cells that were not treated with INFy (Untreated) but were stained with anti-H2-K b and cells treated with IFNy but stained with a mouse antibody of irrelevant specificity.
  • Figure 9 Inhibition of proliferation of the murine melanoma B16 following treatment with untargeted mlFNy or anti-CD20-mIFNy for 4 days. Metabolic activity of surviving cells was determined using the MTS assay.
  • Figure 10 Inhibition of proliferation of the murine melanoma B 16 expressing human CD20 following treatment with untargeted mIFNa, mIFN or mlFNy or targeted anti-CD20-mIFNa, anti-CD20-mIFN or anti-CD20-mIFNy for 4 days. Metabolic activity of surviving cells was determined using the MTS assay.
  • FIG. 11 Effect of treatment on in vivo tumor growth.
  • C57/BL6 mice injected subcutaneously with B16huCD20 cells were treated on days 5, 6 and 7 with either PBS or 100 pg of anti -hC D20-m I FNy and monitored for tumor growth. Mice were sacrificed when tumors exceeded 1.5 cm in diameter per institutional guidelines.
  • Figure 15 Inhibition of proliferation of the murine lymphoma 38C13 following treatment with untargeted mIFNy or anti-CD20-mIFNy for 4 days. Metabolic activity of surviving cells was determined using the MTS assay.
  • FIG. 17 Three independent experiments showing effect of treatment on tumor growth. C3H/HeJ mice injected subcutaneously with 38C13huCD20 cells were treated on days 5, 6 and 7 with either PBS or 100 mg of anti-hCD20-mIFNy and monitored for tumor growth. Mice were sacrificed when tumors exceeded 1.5 cm in diameter per institutional guidelines.
  • FIG. 18 Panel 18, panels A-C: Anti-hCD20mIgG2a-mIFNy was more effective in inhibiting tumor growth in vivo than anti-hCD20mIgG2a.
  • 38C13huCD20 cells were either treated on days 5, 6 and 7 either PBS, 100 pg of anti- hCD20-mIFNy. 50 pg of anti -hCD20- m I FNy or 25 pg of anti-hCD20-mIFNy and monitored for tumor growth. Mice were sacrificed when tumors exceeded 1.5 cm in diameter per institutional guidelines.
  • FIG. 20 panels A-F: To evaluate the ability of the fusion proteins to induce apoptosis in MWCL-1, cells were treated with 12.5 nM of the indicated proteins for 5 days and apoptosis evaluated by flow-cytometry following staining with Annexin V and PI.
  • FIG. 21 panels A-F: To determine the ability of the proteins to inhibit proliferation, MWCL-1 cells were incubated with 12.5 nM protein for 72 hours, then pulsed with 3 H-thymidine for 8 hours and proliferation measured by determining the amount of 3 H- thymidine incorporated into DNA.
  • FIG. 22 panels A-E, illustrates STAT activation (pSTATl, total STAT1, pSTAT3 and total STAT3) following treatment with the various interferon constructs.
  • Panel A Comparison of STAT activation by anti-CD138, anti-CD20, anti-CD138-IFNa2, anti-CD 138-IFNy, anti-CD138-IFNal4, anti-CD20-IFNal4, anti-CD 138-IFNa2 YNS , anti- CD20-IFNa2 YNS , and anti-CD20-IFNy.
  • Panel B Comparison of STAT activation by anti- CD 138-IFNa2+anti-CD20-IFNa2, anti-CD 138-IFNal4+anti-CD20-IFNal4, anti-CD 138- IFNa2 YNS +anti-CD20-IFNa2 YNS .
  • Panel C Comparison of STAT activation by anti- CD 138-IFNy+anti-CD 138, anti-CD 138-IFNy+anti-CD 138-IFNa2, anti-CD 138-IFNy+anti- CD138-IFNal4, anti -CD 138-1 FNy+anti -C D 138- 1 FNa2 YNS , anti-CD 138-IFNy+anti-CD20, anti-CD 138-IFNy+anti-CD20-IFNa2, anti-CD 138y+anti-CD20-IFNal4, anti-CDl 38y+anti- CD20-IFNa2 YNS .
  • Panel D Comparison of STAT activation by anti -C D20- 1 FNy+anti - CD20, anti-CD20-IFNy+anti-CD138-IFNa2, anti-CD20y+anti-CD138-IFNal4, anti-CD20- IFNy+anti-CD 138-IFNa2 YNS , anti-CD20-IFNy+anti-CD20, anti-CD20-IFNy+anti-CD20- IFNa2, an ti -CD20- 1 FNy+anti -C D20- 1 FN a 14, anti-CD20-IFNy+anti-CD20-IFNa2 YNS .
  • Panel E Comparison of STAT activation by anti-CD138IFNa2, anti-CD 138-IFNa2+anti- CD138-IFNy, anti-CD 138-IFNy; anti-CD20-IFNa2+anti-cdl38-IFNy.
  • FIG. 23 panels A-C, illustrates anti-proliferative activity of IFN-g fusion proteins in combination with bortezomib or ibrutinib.
  • FIG. 24 panels A-C, illustrates anti-proliferative activity of IFN-g fusion proteins in combination with bortezomib or ibrutinib.
  • Panel C Ibrutinib antiproliferative activity.
  • the linkers have different properties. IgGl delta cys and lqoOE_l are similar in length (18 and 19 aa, respectively) but have different conformations (coil and alpha helix, respectively). IgG3 and IgG3 delta cys are of the same length but there are no disulfide bonds in the latter.
  • the Landar linker has a relatively short 10 aa sequence.
  • CSPG4 transiently expressed in 293T cells and protein isolated from culture supernatants.
  • the fusion proteins were then evaluated for their ability to inhibit the proliferation of OVCAR3, an ovarian cancer, T98MG, a glioma, and A375, a melanoma ( Figure 1).
  • OVCAR3 and T98MG do not express CSPG-4, while A375 expresses it to high levels.
  • chimeric constructs are provided for the selective/specific delivery of active interferon gamma.
  • the chimeric construct(s) comprise a full-length immunoglobulin or a camelid antibody attached to an interferon gamma (IFNy) where the immunoglobulin or camelid antibody is an antibody that binds to a tumor associated antigen (TAA), a first interferon gamma (IFNy) is attached to a first constant heavy region 3 (CH3) of the immunoglobulin or camelid antibody by a first proteolysis resistant peptide linker, a second interferon gamma is attached to a second constant heavy region 3 (CH3) of the
  • first proteolysis resistant linker and the second proteolysis linker have a length and flexibility that permits the first interferon gamma and the second interferon gamma to dimerize.
  • first proteolysis resistant peptide linker and the second proteolysis peptide linker comprise or consist of amino acid sequences
  • the linker comprises or consists of the amino acid sequence of the landar linker (SEQ ID NO:l).
  • the linker comprises or consists of the amino acid sequence of the double landar linker (SEQ ID NO:2).
  • the linker comprises or consists of the amino acid sequence of the lqo0E_l linker (SEQ ID NO:3).
  • the linker comprises or consists of the amino acid sequence of the IgG3 hinge linker (SEQ ID NO:4).
  • the linker comprises or consists of the amino acid sequence of the IgG3 hinge delta cys (IgG3 hinge A cys) linker (SEQ ID NO: 5). In yet still another illustrative embodiment the linker comprises or consists of the amino acid sequence of the IgGl hinge delta cys (IgGl hinge A cys) linker (SEQ ID NO:6).
  • the chimeric constructs and/or pharmaceutical formulations comprising the constructs are useful in the treatment of various cancers. Interferon gamma.
  • interferon gamma molecules used in the chimeric constructs described herein include full length human or murine interferon as well as truncated human or murine interferon and/or mutated human or murine interferon.
  • Interferon-gamma is a cytokine produced by T-lymphocytes and natural killer cells and exists as a homodimer of two noncovalently bound polypeptide subunits.
  • the sequence of the protein encoded by the human interferon gene is:
  • the first 23 amino acids are the leader sequence which is cleaved from the protein yielding a mature protein of 143 amino acids - but no methionine.
  • Each subunit has two potential N-glycosylation sites (Aggarwal et al. (1992)
  • IFNy subunit polypeptides Various naturally-occurring or mutated forms of the IFNy subunit polypeptides have been reported, including one comprising a Cys-Tyr-Cys N-terminal amino acid sequence (positions (-3)-(-l) relative to SEQ ID NO: 13), one comprising an N- terminal methionine (position -1 relative to SEQ ID NO: 13), and various C-terminally truncated forms comprising 127-134 amino acid residues. It is known that 1-15 amino acid residues may be deleted from the C-terminus without abolishing IFNy activity of the molecule. Furthermore, heterogeneity of the huIFNy C-terminus was described by Pan et al. (1987) Eur. J. Biochem. 166: 145-149. [0115] HuIFNy muteins are reported by Slodowski et al. (1991) Eur. J. Biochem.
  • WO 1992/008737 discloses IFNy variants comprising an added methionine in the N- terminal end of the full (residues 1-143) or partial (residues 1-132) amino acid sequence of wildtype human IFNG.
  • EP 219 781 discloses partial huIFNy sequences comprising amino 10 acid residues 3-124 (of SEQ ID NO: 13)).
  • US 4,832,959 discloses partial huIFNy sequences comprising residues 1-127, 5-146 and 5-127 of an amino acid sequence that compared to SEQ ID NO: 13 has three additional N-terminal amino acid residues (CYC).
  • US Patent No: 5,004,689 discloses a DNA sequence encoding huIFNy without the 3 N-terminal amino acid residues CYC and its expression in E. coli.
  • European patent EP 446582 discloses E. coli produced rhuIFNy free of an 15 N-terminal methionine.
  • US Patent No: 6,120,762 discloses a peptide fragment of huIFNy comprising residues 95- 134 thereof (relative to SEQ ID NO: 13).
  • the interferon gamma component(s) of the construct can be any polypeptide with IFNy activity, and thus be derived from any origin, e.g. a non-human mammalian origin.
  • the parent polypeptide is huIFNy, e.g. , with the amino acid sequence shown in SEQ ID NO: 13, or a variant or fragment thereof.
  • variants of hIFNy that can be incorporated in the constructs contemplated herein are described above, and include, but are not limited to, e.g. huIFNy with the N-terminal addition CYC, the cysteine modified variants described in US Patent No: 6,046,034, and the like.
  • the hIFNy that can be incorporated in the constructs contemplated herein comprises cysteine substitutions at on or more of Glu8, Ser70, Alal8, Hisll2, Lys81, Leul21, Gln49, and leu96 (relative to the amino acid sequence of SEQ ID NO: 13).
  • the interferon gamma differs from the monomer of recombinant human interferon gamma in that at least one pair of amino acids from four predetermined amino acid pairs is exchanged for cysteine. These four amino acid pairs are Glu8 and Ser70, Alal8 and His 112, Lys81 and Leul21, and Gln- 49 and Leu96 (see U.S. Patent No: 6,046,034). [0119] Additionally specific examples of fragments are those described above, and include, but are not limited to huIFNy C-terminally truncated with 1-15 amino acid residues, e.g.
  • the interferon comprises a truncated interferon consisting of the amino acid sequence:
  • the use of chemically modified interferon is also contemplated.
  • the interferon is chemically modified to increase serum half-life.
  • (2-sulfo-9-fluorenylmethoxycarbonyl) 7 - interferon-oc2 undergoes time-dependent spontaneous hydrolysis, generating active interferon ⁇ see, e.g., Shechter et al. (2001) Proc. Natl. Acad. Sci., USA, 98(3): 1212-1217).
  • Other modifications include for example, N-terminal modifications in including, but not limited to the addition of PEG, protecting groups, and the like.
  • U.S. Patent 5,824,784 for example, describing N-terminally chemically modified interferon.
  • interferons gamma(s) are intended to be illustrative and not limiting. Using the teaching provided herein, other suitable modified interferon gamma can readily be identified and produced.
  • Antibodies targeting moiety
  • the chimeric constructs described herein comprise a full-length antibody or a camelid antibody that specifically or preferentially binds a marker expressed by (e.g., on the surface of) or associated with the target cell(s). While essentially any cell can be targeted, certain preferred cells include those associated with a pathology characterized by hyperproliferation of a cell (/. ⁇ ? ., a hyperproliferative disorder). Illustrative hyperproliferative disorders include, but are not limited to psoriasis, neutrophilia, polycythemia, thrombocytosis, and cancer.
  • Hyperproliferative disorders characterized as cancer include but are not limited to solid tumors, including, but not limited to cancers of the breast, respiratory tract, brain, reproductive organs, digestive tract, urinary tract, eye, liver, skin, head and neck, thyroid, parathyroid and their distant metastases. These disorders also include lymphomas, sarcomas, and leukemias. Examples of breast cancer include, but are not limited to invasive ductal carcinoma, invasive lobular carcinoma, ductal carcinoma in situ, and lobular carcinoma in situ. Examples of cancers of the respiratory tract include, but are not limited to small-cell and non-small-cell lung carcinoma, as well as bronchial adenoma and pleuropulmonary blastoma.
  • brain cancers include, but are not limited to brain stem and hypothalamic glioma, cerebellar and cerebral astrocytoma, medulloblastoma, ependymoma, as well as neuroectodermal and pineal tumor.
  • Tumors of the male reproductive organs include, but are not limited to prostate and testicular cancer.
  • Tumors of the female reproductive organs include, but are not limited to endometrial, cervical, ovarian, vaginal, and vulvar cancer, as well as sarcoma of the uterus.
  • Tumors of the digestive tract include, but are not limited to anal, colon, colorectal, esophageal, gallbladder, gastric, pancreatic, rectal, small-intestine, and salivary gland cancers.
  • Tumors of the urinary tract include, but are not limited to bladder, penile, kidney, renal pelvis, ureter, and urethral cancers.
  • Eye cancers include, but are not limited to intraocular melanoma and
  • liver cancers include, but are not limited to hepatocellular carcinoma (liver cell carcinomas with or without fibrolamellar variant), cholangiocarcinoma (intrahepatic bile duct carcinoma), and mixed hepatocellular cholangiocarcinoma.
  • Skin cancers include, but are not limited to squamous cell carcinoma, Kaposi's sarcoma, malignant melanoma, Merkel cell skin cancer, and non-melanoma skin cancer.
  • Head-and- neck cancers include, but are not limited to laryngeal/ hypopharyngeal/nasopharyngeal /oropharyngeal cancer, and lip and oral cavity cancer.
  • Lymphomas include, but are not limited to AIDS-related lymphoma, non-Hodgkin's lymphoma, cutaneous T-cell lymphoma, Hodgkin's disease, and lymphoma of the central nervous system.
  • Sarcomas include, but are not limited to sarcoma of the soft tissue, osteosarcoma, malignant fibrous histiocytoma, lymphosarcoma, and rhabdomyosarcoma.
  • Leukemias include, but are not limited to acute myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, chronic myelogenous leukemia, and hairy cell leukemia.
  • the antibody or camelid antibody specifically or preferentially binds a cancer marker (e.g., a tumor associated antigen).
  • a cancer marker e.g., a tumor associated antigen.
  • a wide variety of cancer markers are known to those of skill in the art.
  • the markers need not be unique to cancer cells, but can also be effective where the expression of the marker is elevated in a cancer cell (as compared to normal healthy cells) or where the marker is not present at comparable levels in surrounding tissues (especially where the chimeric construct is delivered locally).
  • Illustrative cancer markers include, for example, chrondroitin sulfate proteoglycan 4 (CSPG4).
  • Chrondroitin sulfate proteoglycan 4 (CSPG4) consisting of a protein core and a chondroitin sulfate side chain is also known as high- molecular weight melanoma associated antigen (HMW-MAA) and melanoma chondroitin sulface proteoglycan (MCSP). It has been studied as a target for the treatment of melanoma. This tumor antigen is highly expressed on greater than 80% of human melanomas and has a restricted distribution in normal tissues.
  • HMW-MAA high- molecular weight melanoma associated antigen
  • MCSP melanoma chondroitin sulface proteoglycan
  • CSPG4 plays an important role in the biology of melanoma cells through its modulation of integrin function and enhanced growth factor receptor-regulated pathways including sustained activation of ERK 1,2. It is also expressed on cancer- initiating cells and a broad range of other tumors including breast cancer including triple negative breast cancer, glioma, squamonous cell carcinoma of head and neck, myeloid leukemic cells, pancreatic carcinoma,
  • CSPG4 chondrosarcoma, chordoma, mesothelioma, renal cell carcinoma, lung carcinoma, cancer stem cells, and ovarian carcinoma.
  • Expression of CSPG4 is associated with the progression of many different cancers.
  • CD138 is a marker associated with multiple myeloma (MM) cells, ovarian carcinoma, kidney carcinoma, gall bladder carcinoma, breast carcinoma, prostate cancer, lung cancer, colon carcinoma cells and cells of Hodgkin's and non-Hodgkin's lymphomas, chronic lymphocytic leukemia (CLL), acute lymphoblastic leukemia (ALL), acute myeloblastic leukemia (AML), solid tissue sarcomas, colon carcinomas as well as other hematologic malignancies and solid tumors that express CD138.
  • CLL chronic lymphocytic leukemia
  • ALL acute lymphoblastic leukemia
  • AML acute myeloblastic leukemia
  • solid tissue sarcomas colon carcinomas as well as other hematologic malignancies and solid tumors that express CD138.
  • Other cancers that have been shown to be positive for CD138 expression are many ovarian adenocarcinomas, transitional cell bladder carcinomas, kidney clear cell carcinomas, squamous cell lung
  • Alpha-fetoprotein is a marker for, inter alia, liver cancer and germ cell tumors
  • beta-2-microglobulin B2M is a marker for, inter alia, Multiple myeloma, chronic lymphocytic leukemia, and some lymphomas
  • beta-human chorionic gonadotropin Beta-hCG is a marker for, inter alia, choriocarcinoma and germ cell tumors
  • BRCA1 and BRCA2 gene mutations are markers for, inter alia, ovarian cancer
  • c-kit/CD117 is a marker for, inter alia, gastrointestinal stromal tumor and mucosal melanoma
  • CA15-3/CA27.29 is a marker for, inter alia, breast cancer
  • CA19-9 is a marker for, inter alia, pancreatic cancer, gallbladder cancer, bile duct cancer, and gastric cancer
  • CA-125 is a marker for, inter alia, ovarian cancer, car
  • the tumor marker recognized by the ND4 monoclonal antibody.
  • This marker is found on poorly differentiated colorectal cancer, as well as gastrointestinal neuroendocrine tumors (see, e.g., Tobi el al. (1998) Cancer Detection and Prevention,
  • CD46 membrane bound complement regulatory glycoprotein
  • CD55 membrane bound complement regulatory glycoprotein
  • CD59 membrane bound complement regulatory glycoprotein
  • WT1 Wild- type Wilms' tumor gene WT1 is expressed at high levels not only in most of acute myelocytic, acute lymphocytic, and chronic myelocytic leukemia, but also in various types of solid tumors including lung cancer.
  • Acute lymphocytic leukemia has been characterized by the TAAs HLA-Dr,
  • CD1, CD2, CD5, CD7, CD19, and CD20 Acute myelogenous leukemia has been characterized by the TAAs HLA-Dr, CD7, CD13, CD14, CD15, CD33, and CD34.
  • Breast cancer has been characterized by the markers EGFR, HER2, MUC1, Tag-72.
  • Various carcinomas have been characterized by the markers MUC1, TAG-72, and CEA.
  • Chronic lymphocytic leukemia has been characterized by the markers CD3, CD 19, CD20, CD21, CD25, and HLA-DR.
  • Hairy cell leukemia has been characterized by the markers CD 19, CD20, CD21, CD25.
  • Hodgkin's disease has been characterized by the Leu-Ml marker.
  • Various melanomas have been characterized by the HMB 45 marker.
  • Non-hodgkins lymphomas have been characterized by the CD20, CD 19, and la marker, and various prostate cancers have been characterized by the PSMA and SE
  • tumor cells display unusual antigens that are either inappropriate for the cell type and/or its environment, or are only normally present during the organisms' development (e.g. fetal antigens).
  • antigens include the glycosphingolipid GD2, a disialoganglioside that is normally only expressed at a significant level on the outer surface membranes of neuronal cells, where its exposure to the immune system is limited by the blood-brain barrier.
  • GD2 is expressed on the surfaces of a wide range of tumor cells including neuroblastoma, medulloblastomas, astrocytomas, melanomas, small-cell lung cancer, osteosarcomas and other soft tissue sarcomas. GD2 is thus a convenient tumor- specific target for immunotherapies.
  • tumor cells display cell surface receptors that are rare or absent on the surfaces of healthy cells, and which are responsible for activating cellular signaling pathways that cause the unregulated growth and division of the tumor cell.
  • Examples include (ErbB2). HER2/n ⁇ ? w, a constitutively active cell surface receptor that is produced at abnormally high levels on the surface of breast cancer tumor cells.
  • Table 2 Illustrative cancer markers and associated references, all of which are incorporated herein by reference for the purpose of identifying the referenced tumor markers.
  • the target markers include, but are not limited to CD138, CSPG4, members of the epidermal growth factor family (e.g., HER2, HER3, EGF, HER4), CD1, CD2, CD3, CD5, CD7, CD13, CD14, CD15, CD19, CD20, CD21, CD23, CD25, CD33, CD34, CD38, 5E10, CEA, HLA-DR, HM 1.24, HMB 45, la, Leu-Ml, MUC1, PMSA, TAG-72, phosphatidyl serine antigen, and the like.
  • members of the epidermal growth factor family e.g., HER2, HER3, EGF, HER4
  • CD1, CD2, CD3, CD5, CD7, CD13, CD14, CD15, CD19, CD20, CD21, CD23, CD25, CD33, CD34, CD38 5E10, CEA, HLA-DR, HM 1.24, HMB 45, la, Leu-Ml, MUC1, PMSA, T
  • Antibodies that specifically or preferentially bind tumor markers are well known to those of skill in the art and may are commercially available or the amino acid sequences thereof are well known and can readily be used to fabricate the antibody using methods well known to those of skill in the art.
  • Antibodies that bind to CSPG4 include, but are not limited to VF1-TP34,
  • CD138 antibodies that specifically or preferentially bind CD138 are well known to those of skill in the art and many are commercially available. For example Wijdenes et al. (1996) British J. Haematol. 94, 318-323 describe an antibody that is specific for CD138 (syndecan-1) and this antibody is commercially available from Abeam, Miltenyi Biotec, and the like.
  • anti-CD 138 antibodies include, but are not limited to the polyclonal rabbit anti-human CD138 antibody LS-B3341 and the monoclonal mouse anti-Human CD138 Antibody LS-B4051 available from LifeSpan Biosciences, Inc., monoclonal antibody (MI15) available from Pierce Antibodies, Biotest BT-062 anti-CD138, and the like.
  • Other anti-CD138 antibodies include, but are not limited to B-B2, 1D4, nBT062, B-B4, BC/B-B4, B-B2, DL-101, 1 D4, MI15, 1.BB.210, 2Q1484, 5F7, 104-9, and 281-2 (see, e.g., Gattei et al. (1999) British J. Haematol., 104(1): 152-162, and U.S. Patent Pub No: 2009/0175863).
  • Antibodies to CD33 include for example, HuM195 (see, e.g., Kossman et al.
  • Antibodies to CD38 include for example, AT13/5 (see, e.g., Ellis et al.
  • Antibodies been developed against Her-2/neu include, but are not limited to trastuzumab (e.g., HERCEPTIN®.; Former et al. (1999) Oncology (Huntingt) 13: 647-58), TAB-250 (Rosenblum et al. (1999) Clin. Cancer Res. 5: 865-874), BACH-250 (Id.), TA1 (Maier et al. (1991) Cancer Res. 51: 5361-5369), and the mAbs described in U.S. Pat. Nos. 5,772,997; 5,770,195 (mAb 4D5; ATCC CRL 10463); and U.S. Pat. No. 5,677,171.
  • trastuzumab e.g., HERCEPTIN®.; Former et al. (1999) Oncology (Huntingt) 13: 647-58
  • TAB-250 Rosenblum et al. (1999) Clin. Cancer Res. 5:
  • C6 antibodies such as C6.5, DPL5, G98A, C6MH3-B1, B1D2, C6VLB, C6VLD, C6VLE, C6VLF, C6MH3-D7, C6MH3-D6, C6MH3-D5, C6MH3-D3, C6MH3-D2, C6MH3-D1, C6MH3-C4, C6MH3-C3, C6MH3-B9, C6MH3-B5, C6MH3-B48, C6MH3-B47, C6MH3-B46, C6MH3-B43, C6MH3-B41, C6MH3-B39, C6MH3-B34, C6MH3-B33, C6MH3-B31, C6MH3-B27, C6MH3-B25, C6MH3-B21, C6
  • Illustrative anti-MUC-1 antibodies include, but are not limited to Mc5 (see, e.g., Peterson et al. (1997) Cancer Res. 57: 1103-1108; Ozzello et al. (1993) Breast Cancer Res. Treat. 25: 265-276), and hCTMOl (see, e.g., Van Hof et al. (1996) Cancer Res. 56: 5179-5185).
  • Illustrative anti-TAG-72 antibodies include, but are not limited to CC49 (see, e.g., Pavlinkova et al. (1999) Clin. Cancer Res. 5: 2613-2619), B72.3 (see, e.g., Divgi et al. (1994) Nucl. Med. Biol. 21: 9-15), and those disclosed in U.S. Patent No: 5,976,531.
  • Illustrative anti-HM1.24 antibodies include, but are not limited to a mouse monoclonal anti-HM1.24 IgG2 a /K and a humanized anti-HM1.24 IgGi/k antibody (see, e.g., Ono et al. (1999) Mol. Immunol. 36: 387-395).
  • Antibodies directed to various members of the epidermal growth factor receptor family include, but are not limited to anti-EGF-R antibodies as described in U.S. Patent Nos: 5,844,093 and 5,558,864, and in European Patent No. 706, 799 A).
  • anti-EGFR family antibodies include, but are not limited to antibodies such as C6.5, C6ML3-9, C6MH3-B1, C6-B1D2, F5, HER3.A5, HER3.F4, HER3.H1, HER3.H3, HER3.E12, HER3.B12, EGFR.E12, EGFR.C10, EGFR.B11, EGFR.E8, HER4.B4, HER4.G4, HER4.F4, HER4.A8, HER4.B6, HER4.D4, HER4.D7, HER4.D11, HER4.D12, HER4.E3, HER4.E7, HER4.F8 and HER4.C7 and the like (see, e.g., U.S. Patent publications US 2006/0099205 Al and US 2004/0071696 Al which are incorporated herein by reference).
  • Anti-CD20 antibodies are well known to those of skill and include, but are not limited to rituximab, Ibritumomab tiuxetan, and tositumomab, AME-133v (Applied Molecular Evolution), Ocrelizumab (Roche), Ofatumumab (Genmab), TRU-015 (Trubion) and IMMU-106 (Immunomedics).
  • the antibody is an anti-CD138 which comprises a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 15:
  • the antibody is an anti-Her2/neu antibody which comprises the heavy chain having an amino acid sequence as set forth in SEQ ID NO: 17:
  • amino acid residues 1-19 represent a signal peptide; and the light chain having an amino acid sequence as set forth in SEQ ID NO: 18:
  • the antibody is an anti-CD20 antibody which comprises the heavy chain having an amino acid sequence as set forth in SEQ ID NO: 19:
  • amino acid residues 1-19 represent a signal peptide; and the light chain having an amino acid sequence as set forth in SEQ ID NO:20:
  • amino acid residues 1-19 represent a signal peptide.
  • the antibody is an anti-endoplasmin antibody which comprises the heavy chain having an amino acid sequence as set forth in SEQ ID NO:21 :
  • amino acid residues 1-19 represent a signal peptide; and the light chain having an amino acid sequence as set forth in SEQ ID NO:22:
  • the antibody is an anti-CD33 antibody which comprises the heavy chain having an amino acid sequence as set forth in SEQ ID NO:23:
  • amino acid residues 1-19 represent a signal peptide; and the light chain having an amino acid sequence as set forth in SEQ ID NO: 24:
  • the antibody is an anti-CD276 antibody that comprises a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO:25:
  • amino acid residues 1-19 represent a signal peptide; and the light chain having an amino acid sequence as set forth in SEQ ID NO: 26:
  • amino acid residues 1-20 represent a signal peptide.
  • the full-length antibodies (immunoglobulins) used in the chimeric constructs described herein include, but are not limited to an IgA, IgD, IgE, IgG or IgM antibody.
  • the antibody can comprise kappa (K) light chains or lambda (l) light chains.
  • the IgG antibody can be an IgGl, IgG2, IgG3 or IgG4 antibody.
  • the antibody binds to a(n) antigen target that is expressed in or on the cell membrane (e.g., on the cell surface) of a tumor cell.
  • the antibody is an IgG antibody, e.g., an IgGl antibody, more particularly, an IgGl antibody having kappa light chains.
  • the antibodies described herein can comprise a human antibody, a humanized antibody, or a chimeric antibody.
  • the antibody can be a non-human antibody (e.g., a murine antibody).
  • Humanized antibodies are antibodies that contain sequences derived from a human-antibody and from a non-human antibody. Suitable methods for humanizing antibodies include CDR-grafting (complementarity determining region grafting) (EP 0 239 400; WO 91/09967; U.S. Pat. Nos. 5,530,101; and 5,585,089), veneering or resurfacing (EP 0 592 106; EP 0 519 596; Padlan (1991) Mol. Immunol., 28: 489-498.; Studnicka et al. (1994) Protein Eng., 7(6: 805-814; Roguska et al. (1994) Proc. Natl. Acad. Sci.
  • CDRs complementarity-determining regions
  • mAh B-B4 complementarity-determining regions
  • hB-B4 antibody human B-B4 antibody
  • the resurfacing technology uses a combination of molecular modeling, statistical analysis and mutagenesis to alter the non-CDR surfaces of antibody variable regions to resemble the surfaces of known antibodies of the target host.
  • Strategies and methods for the resurfacing of antibodies, and other methods for reducing immunogenicity of antibodies within a different host, are disclosed, for example, in U.S. Pat. No. 5,639,641.
  • Human antibodies can be made by a variety of methods known in the art including phage display methods. See also U.S. Pat. Nos.
  • Antibodies that have undergone any non-natural modification such as chimeric human/mouse antibodies or a chimeric human/monkey antibodies, humanized antibodies or antibodies that were engineered to, for example, improve their affinity to the target cells or diminish their immunogenicity are also contemplated.
  • Chimerized antibodies maintain the antibody binding region of the non human antibody, e.g., the murine antibody they are based on, while any constant regions may be provided for by, e.g., a human antibody.
  • chimerization and/or the exchange of constant regions of an antibody will not affect the affinity of an antibody because the regions of the antibody that contribute to antigen binding are not affected by this exchange.
  • the engineered, in particular chimerized, antibody may have a higher binding affinity (as expressed by KD values) than the respective non-human antibody it is based on.
  • the anti-CD 138 antibody nBT062 antibody and antibodies based thereon may have higher antibody affinity than the murine B- B4 on which they are based.
  • Fully human antibodies may also be used.
  • Those antibodies can be selected by the phage display approach, where desired TAA (e.g., CD138, CSPG4, etc.) is used to selectively bind phage expressing, for example, B-B4 variable regions.
  • TAA e.g., CD138, CSPG4, etc.
  • This approach can be advantageously coupled with an affinity maturation technique to improve the affinity of the antibody.
  • camelid antibodies are also contemplated.
  • Camelid and shark antibodies comprise a homodimeric pair of two chains of V-like and C-like domains (neither has a light chain). Since the VH region of a heavy chain dimer IgG in a camelid does not have to make hydrophobic interactions with a light chain, the region in the heavy chain that normally contacts a light chain is changed to hydrophilic amino acid residues in a camelid. VH domains of heavy-chain dimer IgGs are called VHH domains.
  • Shark Ig-NARs comprise a homodimer of one variable domain (termed a V-NAR domain) and five C-like constant domains (C-NAR domains).
  • camelids the diversity of antibody repertoire is determined by the complementary determining regions (CDR) 1, 2, and 3 in the VH or VHH regions.
  • the CDR3 in the camel VHH region is characterized by its relatively long length averaging 16 amino acids (see, e.g. , Muyldermans et al. (1994) Prog. Engin. 7(9): 1129). This is in contrast to CDR3 regions of antibodies of many other species.
  • the CDR3 of mouse VH has an average of 9 amino acids.
  • the antibody or camelid antibody has an affinity
  • KD tumor associated antigen
  • TAA tumor associated antigen
  • the chimeric constructs (targeted interferon gamma constructs) described herein can be used for the treatment or prophylaxis of cancer.
  • Illustrative cancers include any cancer or cancer cell that is responsive to treatment with interferon gamma. Additionally, interferon gamma helps turn on the immune response and can be useful even if the cancer is not directly responsive because the host anti-tumor response if turned on (e.g., upregulated). Illustrative cancers include, but are not limited to g of breast cancer, lung cancer, melanoma, pancreas cancer, liver cancer, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, AIDS-related cancers (e.g.
  • Kaposi sarcoma, lymphoma anal cancer
  • appendix cancer astrocytomas, atypical teratoid/rhabdoid tumor
  • bile duct cancer extrahepatic cancer
  • bladder cancer bone cancer (e.g. , Ewing sarcoma, osteosarcoma, malignant fibrous histiocytoma)
  • brain stem glioma brain tumors (e.g. , astrocytomas, brain and spinal cord tumors, brain stem glioma, central nervous system atypical teratoid/rhabdoid tumor, central nervous system embryonal tumors, central nervous system germ cell tumors,
  • craniopharyngioma ependymoma, burkitt lymphoma, carcinoid tumors (e.g., childhood, gastrointestinal), cardiac tumors, cervical cancer, chordoma, chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), chronic myeloproliferative disorders, colon cancer, colorectal cancer, craniopharyngioma, cutaneous t-cell lymphoma, duct cancers e.
  • bile extrahepatic
  • DCIS ductal carcinoma in situ
  • embryonal tumors endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma (olofactory neuroblastoma), extracranial germ cell tumor, extragonadal germ cell tumor, extrahepatic bile duct cancer, eye cancer (e.g.
  • intraocular melanoma intraocular melanoma, retinoblastoma), fibrous histiocytoma of bone, malignant, and osteosarcoma, gallbladder cancer, gastric (stomach) cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumors (GIST), germ cell tumors (e.g., ovarian cancer, testicular cancer, extracranial cancers, extragonadal cancers, central nervous system), gestational trophoblastic tumor, brain stem cancer, hairy cell leukemia, head and neck cancer, heart cancer, hepatocellular (liver) cancer, histiocytosis, langerhans cell cancer, Hodgkin lymphoma, hypopharyngeal cancer, intraocular melanoma, islet cell tumors, pancreatic neuroendocrine tumors, kaposi sarcoma, kidney cancer (e.g., renal cell, Wilm's tumor, and other kidney tumors), langerhans cell his
  • non-Hodgkin lymphoma non-Hodgkin lymphoma
  • cutaneous T-Cell e.g., mycosis fungoides, Sezary syndrome
  • Hodgkin non-Hodgkin
  • primary central nervous system CNS
  • macroglobulinemia Waldenstrom
  • male breast cancer malignant fibrous histiocytoma of bone and osteosarcoma
  • melanoma e.g.
  • oropharyngeal cancer osteosarcoma, ovarian cancer , pancreatic cancer, pancreatic neuroendocrine tumors (islet cell tumors), papillomatosis, paraganglioma, paranasal sinus and nasal cavity cancer, parathyroid cancer, penile cancer, pharyngeal cancer,
  • pheochromocytoma pituitary tumor, plasma cell neoplasm, pleuropulmonary blastoma, primary central nervous system (CNS) lymphoma, prostate cancer, rectal cancer, renal cell (kidney) cancer, renal pelvis and ureter, transitional cell cancer, rhabdomyosarcoma, salivary gland cancer, sarcoma (e.g., Ewing, Kaposi, osteosarcoma, rhadomyosarcoma, soft tissue, uterine), Sezary syndrome, skin cancer (e.g., melanoma, merkel cell carcinoma, basal cell carcinoma, nonmelanoma), small intestine cancer, squamous cell carcinoma, squamous neck cancer with occult primary, stomach (gastric) cancer, testicular cancer, throat cancer, thymoma and thymic carcinoma, thyroid cancer, trophoblastic tumor, ureter and renal pelvis cancer, urethral cancer, uterine cancer,
  • the chimeric constructs described herein are useful for parenteral, topical, oral, or local administration (e.g. injected into a tumor site), aerosol administration, or transdermal administration, for prophylactic, but principally for therapeutic treatment.
  • the pharmaceutical compositions can be administered in a variety of unit dosage forms depending upon the method of administration ⁇
  • unit dosage forms suitable for oral administration include powder, tablets, pills, capsules and lozenges.
  • the antibodies described herein and/or immunoconjugates thereof and pharmaceutical compositions comprising antibodies described herein and/or immunoconjugates thereof, when administered orally, are preferably protected from digestion. This can be
  • a composition e.g., a pharmaceutical composition, containing one or more chimeric constructs described herein, formulated together with a pharmaceutically acceptable carrier are provided.
  • pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion).
  • the active compound, /. ⁇ ? . , antibody, immunoconjugate may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
  • one or more chimeric constructs described herein can be administered in the "native" form or, if desired, in the form of salts, esters, amides, prodrugs, derivatives, and the like, provided the salt, ester, amide, prodrug or derivative is suitable pharmacologically, i.e., effective in the present method(s).
  • Salts, esters, amides, prodrugs and other derivatives of the active agents can be prepared using standard procedures known to those skilled in the art of synthetic organic chemistry and described, for example, by March (1992) Advanced Organic Chemistry; Reactions, Mechanisms and Structure, 4th Ed. N.Y. Wiley-Interscience, and as described above.
  • a pharmaceutically acceptable salt can be prepared for chimeric constructs described herein having a functionality capable of forming a salt.
  • a pharmaceutically acceptable salt is any salt that retains the activity of the parent compound and does not impart any deleterious or untoward effect on the subject to which it is administered and in the context in which it is administered.
  • pharmaceutically acceptable salts may be derived from organic or inorganic bases.
  • the salt may be a mono or polyvalent ion.
  • the inorganic ions lithium, sodium, potassium, calcium, and magnesium.
  • Organic salts may be made with amines, particularly ammonium salts such as mono-, di- and trialkyl amines or ethanol amines. Salts may also be formed with caffeine, tromethamine and similar molecules.
  • salts can be prepared from the free base using conventional methodology that typically involves reaction with a suitable acid.
  • a suitable acid such as methanol or ethanol
  • the base form of the drug is dissolved in a polar organic solvent such as methanol or ethanol and the acid is added thereto.
  • the resulting salt either precipitates or can be brought out of solution by addition of a less polar solvent.
  • Suitable acids for preparing acid addition salts include, but are not limited to both organic acids, e.g., acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malic acid, malonic acid, succinic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid, and the like, as well as inorganic acids, e.g., hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like.
  • organic acids e.g., acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malic acid, malonic acid, succinic acid, maleic acid, fumaric acid, tartaric acid, cit
  • An acid addition salt can be reconverted to the free base by treatment with a suitable base.
  • Certain particularly preferred acid addition salts of the active agents herein include halide salts, such as may be prepared using hydrochloric or hydrobromic acids.
  • preparation of basic salts of one or more chimeric constructs described herein are prepared in a similar manner using a pharmaceutically acceptable base such as sodium hydroxide, potassium hydroxide, ammonium hydroxide, calcium hydroxide, trimethylamine, or the like.
  • Particularly preferred basic salts include alkali metal salts, e.g., the sodium salt, and copper salts.
  • the pKa of the counterion is preferably at least about 2 pH units lower than the pKa of the drug.
  • the pKa of the counterion is preferably at least about 2 pH units higher than the pKa of the drug. This permits the counterion to bring the solution's pH to a level lower than the pH m ax to reach the salt plateau, at which the solubility of salt prevails over the solubility of free acid or base.
  • the generalized rule of difference in pKa units of the ionizable group in the active pharmaceutical ingredient (API) and in the acid or base is meant to make the proton transfer energetically favorable.
  • the counterion is a pharmaceutically acceptable counterion.
  • Suitable anionic salt forms include, but are not limited to acetate, benzoate, benzylate, bitartrate, bromide, carbonate, chloride, citrate, edetate, edisylate, estolate, fumarate, gluceptate, gluconate, hydrobromide, hydrochloride, iodide, lactate, lactobionate, malate, maleate, mandelate, mesylate, methyl bromide, methyl sulfate, mucate, napsylate, nitrate, pamoate (embonate), phosphate and diphosphate, salicylate and disalicylate, stearate, succinate, sulfate, tartrate, tosylate, triethiodide, valerate, and the like, while suitable cationic salt forms include, but are not limited to aluminum, benzathine, calcium, ethylene diamine, lysine, magnesium, meglumine, potassium, procaine, sodium, t
  • esters typically involves functionalization of hydroxyl and/or carboxyl groups that are present within the molecular structure of the chimeric constructs described herein.
  • the esters are typically acyl-substituted derivatives of free alcohol groups, /. ⁇ ? . , moieties that are derived from carboxylic acids of the formula RCOOH where R is alky, and preferably is lower alkyl.
  • Esters can be reconverted to the free acids, if desired, by using conventional hydrogenolysis or hydrolysis procedures.
  • Amides can also be prepared using techniques known to those skilled in the art or described in the pertinent literature. For example, amides may be prepared from esters, using suitable amine reactants, or they may be prepared from an anhydride or an acid chloride by reaction with ammonia or a lower alkyl amine.
  • compositions comprising one or more chimeric constructs described herein can be administered alone or in combination therapy, /. ⁇ ? ., combined with other agents.
  • the combination therapy can include one or more chimeric constructs described herein and at least one or more additional therapeutic agents.
  • the pharmaceutical compositions can also be administered in conjunction with radiation therapy and/or surgery.
  • a composition comprising one or more chimeric constructs described herein can be administered by a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results.
  • the chimeric constructs described herein can be prepared with carriers that will protect the chimeric constructs against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid.
  • administration of one or more chimeric constructs described herein may be facilitated by coating the construct(s) or co-administering the constructs with a material to prevent its inactivation.
  • the construct(s) may be administered to a subject in an appropriate carrier, for example, liposomes, or a diluent.
  • Pharmaceutically acceptable diluents include, but are not limited to, saline and aqueous buffer solutions.
  • Liposomes include, but are not limited to, water-in-oil-in-water CGF emulsions as well as conventional liposomes (Strejan et al. (1984) J. Neuroimmunol, 7: 27).
  • Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of is contemplated. Supplementary active compounds can also be incorporated into the compositions.
  • the one or more chimeric constructs described herein are typically sterile and stable under the conditions of manufacture and storage.
  • the composition(s) can be formulated as a solution, a microemulsion, in a lipid or liposome, or other ordered structure suitable to contain high drug concentration(s).
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • Sterile injectable solutions can be prepared by incorporating the construct(s) described herein in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration ⁇
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • sterile powders for the preparation of sterile injectable solutions illustrative methods of preparation include vacuum drying, and freeze drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • Dosage regimens are adjusted to provide the optimum desired response (e.g.
  • a therapeutic response For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
  • the one or more chimeric constructs described herein may be administered once or twice daily, or once or twice weekly, or once or twice monthly by subcutaneous injection.
  • Unit dosage form refers to physically discrete units suited as unitary dosages for the subjects to be treated. Each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the specifications for the unit dosage forms are dictated by and directly dependent on (a) the unique characteristics of the construct(s) and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such construct(s) for the treatment of individuals.
  • the formulation comprises a pharmaceutically acceptable anti-oxidant.
  • pharmaceutically-acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
  • water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
  • oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (
  • formulations of one or more chimeric constructs described herein include those suitable for oral, nasal, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration.
  • the formulations may conveniently be presented in unit dosage form and may be prepared by any methods known in the art of pharmacy.
  • the amount of active ingredient (chemeric construct(s)) that can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration.
  • the amount of active ingredient that can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 0.001 percent to about ninety percent of active ingredient, preferably from about 0.005 percent to about 70 percent, most preferably from about 0.01 percent to about 30 percent.
  • Formulations of one or more chimeric constructs described herein that are suitable for vaginal administration also include pessaries, tampons, creams, gels, pastes, foams or spray formulations containing such carriers as are known in the art to be appropriate.
  • Dosage forms for the topical or transdermal administration of antibodies and/or immunoconjugates described herein include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches and inhalants.
  • the active compound may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants that may be required.
  • parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and include, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrastemal injection, and infusion.
  • aqueous and nonaqueous carriers examples include, but are not limited to water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate, and the like.
  • polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
  • vegetable oils such as olive oil
  • injectable organic esters such as ethyl oleate, and the like.
  • Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents.
  • adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents.
  • adjuvants include, for example, inorganic adjuvants (such as aluminum salts, e.g. , aluminum phosphate and aluminum hydroxide), organic adjuvants (e.g., squalene), oil-based adjuvants, virosomes (e.g., virosomes that contain a membrane-bound hemagglutinin and neuraminidase derived from the influenza virus).
  • compositions may be brought about by the inclusion of agents that delay absorption such as aluminum monostearate and gelatin.
  • the antibodies and/or immunoconjugates described herein are administered as pharmaceuticals, to humans and animals, they can be given alone or as a pharmaceutical composition containing, for example, 0.001 to 90% (more preferably, 0.005 to 70%, such as 0.01 to 30%) of active ingredient in combination with a pharmaceutically acceptable carrier.
  • the antibodies and/or immunoconjugates described herein, that may be used in a suitable hydrated form, and/or the pharmaceutical compositions, are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those of skill in the art.
  • compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
  • active ingredients e.g., antibodies and/or immunoconjugates described herein
  • dosage levels of the active ingredients may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
  • the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • a physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the
  • a suitable daily dose of antibodies and/or immunoconjugates described herein will be that amount of the construct that is the lowest dose effective to produce a therapeutic effect. Such an effective dose will generally depend upon the factors described above. In certain embodiments, it is preferred that administration be intravenous, intramuscular,
  • intraperitoneal, or subcutaneous preferably administered proximal to the site of the target.
  • the effective daily dose of a therapeutic composition may be administered a single dosage, or as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms. While it is possible for antibodies and/or immunoconjugates described herein to be administered alone, it is typically preferable to administer the compound(s) as a pharmaceutical formulation (composition).
  • antibodies and/or immunoconjugates described herein can be administered with medical devices known in the art.
  • a needleless hypodermic injection device such as the devices disclosed in U.S. Pat. Nos. 5,399,163, 5,383,851, 5,312,335, 5,064,413, 4,941,880, 4,790,824, or 4,596,556.
  • Examples of useful well-known implants and modules are described for example in U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate, in U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medications through the skin, in U.S. Pat. No.
  • the antibodies and/or immunoconjugates described herein can be formulated to ensure proper distribution in vivo.
  • the blood-brain barrier excludes many highly hydrophilic compounds.
  • the therapeutic compounds of the invention cross the BBB (if desired)
  • they can be formulated, for example, in liposomes.
  • liposomes For methods of manufacturing liposomes, see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and 5,399,331.
  • the liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g. , Ranade (1989) J. Clin. Pharmacol. 29: 685).
  • Illustrative targeting moieties include, but are not limited to folate or biotin (see, e.g. , U.S. Pat. No. 5,416,016); mannosides (Umezawa et al, (1988) Biochem. Biophys. Res. Commun. 153: 1038);
  • kits are preferably designed so that the manipulations necessary to perform the desired reaction should be as simple as possible to enable the user to prepare from the kit the desired composition by using the facilities that are at his disposal. Therefore the invention also relates to a kit for preparing a composition according to this invention.
  • such a kit comprises one or more antibodies or immumoconjugates described herein.
  • the antibodies or immumoconjugates can be provided, if desired, with inert pharmaceutically acceptable carrier and/or formulating agents and/or adjuvants is/are added.
  • the kit optionally includes a solution of a salt or chelate of a suitable radionuclide (or other active agent), and (iii) instructions for use with a prescription for administering and/or reacting the ingredients present in the kit.
  • the kit to be supplied to the user may also comprise the ingredient(s) defined above, together with instructions for use, whereas the solution of a salt or chelate of the radionuclide, defined sub (ii) above, which solution has a limited shelf life, may be put to the disposal of the user separately.
  • the kit can optionally, additionally comprise a reducing agent and/or, if desired, a chelator, and/or instructions for use of the composition and/or a prescription for reacting the ingredients of the kit to form the desired product(s). If desired, the ingredients of the kit may be combined, provided they are compatible.
  • the immunoconjugate can simply be produced by combining the components in a neutral medium and causing them to react. For that purpose the effector may be presented to the antibody, for example, in the form of a chelate.
  • kit constituent(s) are used as component(s) for pharmaceutical administration (e.g. as an injection liquid) they are preferably sterile.
  • constituent(s) are provided in a dry state, the user should preferably use a sterile physiological saline solution as a solvent.
  • the constituent(s) may be stabilized in the conventional manner with suitable stabilizers, for example, ascorbic acid, gentisic acid or salts of these acids, or they may comprise other auxiliary agents, for example, fillers, such as glucose, lactose, mannitol, and the like.
  • instructional materials when present, typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention.
  • Such media include, but are not limited to electronic storage media (e.g. , magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like.
  • Such media may include addresses to internet sites that provide such instructional materials.
  • Linkers that we examined included LTEEQQEGGG (SEQ ID NO:l) and LTEEQQEGGG- IFNyTEEQQEGGG (SEQ ID NO:2) based on a report of a biologically active single-chain version of IFNy (Landar et al. (2000) J. Mol. Biol. 299: 169 ).
  • LAKLKQKTEQLQDRIAGGG (SEQ ID NOG) chosen from a linker database, the hinge of IgG3 (LELKTPLGDTTHTCP RCPEPKSCDTPPPCP RCPEPKSCDTPPPCP
  • the linkers have different properties. IgGl delta cys and lqoOE_l are similar in length (18 and 19 aa, respectively) but have different conformations (coil and alpha helix, respectively). IgG3 and IgG3 delta cys are of the same length but there are no disulfide bonds in the latter.
  • the Landar linker has a relatively short 10 aa sequence.
  • IENg was joined with the different linkers after the C H 3 domain of anti-
  • CSPG4 transiently expressed in 293T cells and protein isolated from culture supernatants using protein A Sepharose.
  • the fusion proteins were then evaluated for their ability to inhibit the proliferation of OVCAR3, an ovarian cancer, T98MG, a glioma, and A375, a melanoma ( Figure 1).
  • OVCAR3 and T98MG do not express CSPG-4, while A375 expresses it to high levels.
  • A375 expresses it to high levels.
  • OVCAR3 and T98MG we are examining the relative efficacy of untargeted fusion protein in comparison to untargeted recombinant IFNy; for A375 we are comparing anti-CSPG-4 targeted IFNy with untargeted recombinant IFNy.
  • the most effective IFNy fusion utilized the IgG3 hinge with the second most effective using the IgGl hinge A cys. Interestingly, both were more effective than this preparation of recombinant IFNy.
  • the most effective fusion protein contained the lqo0E_l linker followed closely by the fusion proteins with the IgGl hinge A cys and the IgG3 hinge which showed activity similar to that of recombinant IFNy.
  • fusion proteins containing the IgG3 hinge, IgGl hinge A cys linker and the lqo0E_l linker showed similar activity.
  • a screen of 36 different ovarian cancer cell lines by Dr. Dennis Slamon showed differential sensitivity to type I (IFNoc and IENb) and type II (IFNy) IFNs. From this panel we chose nine cell lines with differing sensitivities to IFN for analysis. These represented different cell types including two adenocarinomas (CaOV-3 and PEA2), one mucinous (EF027), two clear cells (KOC-7C) and four serous (OV177,OVCA420, OVCAR3 and OVKATE).
  • Fusion proteins were constructed with four different IFNs: IFNoc2,
  • IFNOC2 yns IFNOC14 yns , IFNOC14, and IFNy.
  • IFNoc2 was chosen for our initial fusion proteins since it is the IFN most frequently used in the clinic.
  • IFNocl4 has more potent cytotoxic activity than IFNoc2 and we also made a fusion protein containing IFNocl4. All type I IFNs are recognized by a single shared receptor composed of two transmembrane proteins, IFNAR1 and IFNAR2.
  • IENb has stronger receptor binding and more potent anti proliferative and pro-apoptotic activities than IFNoc against many cancers. Unfortunately fusion of human IENb to the heavy chain of IgG severely compromises its efficacy
  • Untargeted fusion protein was less effective than recombinant hIFNyin inhibiting the proliferation of most ovarian cancer cell lines (Figure 5). However, targeting improved the efficacy and for all cell lines targeted fusion protein was more effective than recombinant hIFNy.
  • the glioblastoma T98MG was incubated with the indicated proteins for 6 days and the amount of metabolically active cells remaining determined by MTS assay.
  • Anti- CD138-IFNy was more effective than any of the IFNoc fusion proteins ( Figure 6, top panel).
  • T98MG expresses CD138 but not CD20 and targeted fusion protein was approximately 3 logs more effective than untargeted fusion protein ( Figure 6, bottom panel).
  • Untargeted fusion protein had anti-proliferative activity comparable to recombinant hIFNy.
  • H929, MM1-144, 8226Dox40 and U266 showed little to no sensitivity to inhibition of proliferation by IFNy at the concentrations tested (Figure 7).
  • both OCI-My5 and ANBL-6 showed sensitivity to IFNy which was increased approximately 2 logs through targeting.
  • Mouse IFNy was fused to the carboxy terminus of mouse IgG2a using the
  • IgGl hingeAcys linker that was used to create fusions with human IFNy.
  • B16 cells were incubated for 24 hours with either 1.5 nM mouse IFNy (mIFNy) or 0.75 nM anti-CD20-mIFNy (B16 does not express CD20) and the expression level of H2-K b determined by flow cytometry ( Figure 8).
  • the fusion protein and recombinant mIFNy upregulated the expression of class 1 MHC to the same extent.
  • the 38C13 lymphoma was used to further analyze the properties of the fusions containing mlFNy.
  • the fusion protein was found to be somewhat less active in its ability to activate complement mediated cytolysis ( Figure 12).
  • the fusion protein was able to carry about ADCC, but was less effective than the targeted anti-huCD20 with the murine IgG2a constant region which was more effective than Rituximab. (Figure 13).
  • anti-hCD20mIgG2a-mIFNy was very effective in inhibiting tumor growth in vivo ( Figure 17) and was more effective than anti-hCD20mIgG2a ( Figure 18).
  • the MWCL-1 cell line was used for these studies.
  • the cell line was established from a bone marrow aspirate of a 73 -year-old male patient with IgM-k WM. It contains the EB V gene product EBNA1 , but does not appear to be actively replicating virus and was reported to be both CD20 and CD 138 positive.
  • MWCL-1 cells were treated with 12.5 nM of the indicated proteins for 5 days and apoptosis evaluated by flow-cytometry following staining with Annexin V and PI.
  • Overall fusion proteins targeting CD20 were more potent than those with the same IFN targeting CD138, consistent with the apparently greater expression of CD20 by the cells (Fig 20, panel A).
  • Anti-CD20oc2 YNS was the most potent, followed by anti-CD20ocl4 with anti-CD20-IFNy and anti-CD20-IFNoc2 being the least potent.
  • fusion proteins targeting CD138 only anti-CD138a2 YNS was effective.
  • the activity was primarily contributed by the anti-CD20 fusion protein with the additional targeting to CD20 contributing little to increasing the amount of apoptosis induced ( Figure 20, panel B).
  • CD20 unfused or fused to type IFN increased induction of apoptosis was seen in all combinations ( Figure 20, panels C and D).
  • more effective induction of apoptosis was seen using the anti-CD20 proteins (compare Fig. 20, panel C and panel D).
  • the most effective combination was anti-CD20-IFNy with anti-CD20oc2 YNS , in which approximately 60% of the cells were Annexin V positive following treatment.
  • Anti-CD 138-IFNy did not result in increased induction of apoptosis when used in combination with anti-CD 138 or anti-CD20. However, it did result in increased apoptosis when used in combination with any of the fusions of anti-CD 138 and anti-CD20 with type I interferon. More effective induction of apoptosis was seen when anti-CD 138- IFNywas combined with anti-CD20 proteins (compare Figure 20, panels E and F). The most effective combination was anti-CD 138-IFNy+ anti-CD20oc2 YNS .
  • MWCL-1 cells were incubated with 12.5 nM protein for 72 hours, then pulsed with 3 H-thymidine for 8 hours and proliferation measured by determining the amount of 3 H-thymidine incorporated into DNA.
  • Proteins targeting CD20 were more effective in inhibiting proliferation than those targeting CD138, with anti-CD20-IFNy and anti-CD20-IFNoc2 YNS most effective ( Figure 21, panel A).
  • Simultaneously targeting the same IFN by treating with anti-CD20- IFN + anti-CD 138-IFN did little to increase the inhibition of proliferations seen using only anti-CD20-IFN ( Figure 21, panel B).
  • Anti-CD20-IFNy was so effective in inhibiting proliferation that the addition of an anti-CD 138- or anti-CD20-type I IFN did little to increase the inhibition of proliferation observed ( Figure 21, panels C and D).
  • anti-CD 138-IFN was combined with anti-CD138 and anti-CD20 both unfused and fused with type I IFN, enhanced inhibition of proliferation was observed; however for both anti-CD 138-IFN a2TM s and anti- CD20IFNOC2 yns , the enhancement was minimal since the fusions with IFNa2TM s were so effective when used by themselves (Figure 21, panels E and F).
  • STAT activation is one of the first events following treatment with interferon.
  • MWCL1 cells were incubated with 12.5 nM of the indicated proteins for 0.5, 24 or 48 hours, extracts made and assayed by Western blot for pSTATl, total STAT1, pSTAT3 and total STAT3 ( Figure 22, panel A).
  • Treatment with anti-CD138 or anti-CD20 did not result in STAT activation.
  • Treatment with both anti-CD20 and anti-CD138 fusions with IFN-0C2, IFNOC2 YNS and IFNocl4 resulted in robust phosphorylation of STAT1 at 0.5 hours which was not longer evident at 24 hours.
  • CD138 resulted in strong phosphorylation of STATI when type I IFNs were used; this phosphorylation persisted and could still be seen 48 hours following treatment (STAT Figure 22, panel B). Phosphorylation following treatment with the IFNy fusion proteins also was evident at 24 and 48 hours following treatment when both CD20 and CD 138 were simultaneously targeted. However, when extracts from cells treated for 0.5 hours with anti- CD20IFNoc2, anti-CD 138-IFNoc2 or anti-CD20IFNcc2 + anti-CD 138-IFNcc2 were run side- by-side on the same gel, no enhanced STAT1 phosphorylation was seen when both proteins were targeted.
  • MWCL1 cells were incubated with 12.5 nM of anti-CD 138-IFN and proteins targeting CD138 or CD20 either unfused or fused to type I IFN ( Figure 22, panel C) or with 12.5 nM of anti-CD20-IFNy and proteins targeting CD 138 or CD20 either unfused or fused to type I IFN ( Figure 22, panel D).
  • Combining anti-CD 138-IFNy with anti-CD138 or anti-CD20 resulted in little increase in STAT1 phosphorylation over what was observed with only anti-CD 138-IFNy treatment.
  • anti-CD20-IFNoc2 was most protective, preventing tumor growth in all mice.
  • Anti-CD20-IFNy and anti-CD20-IFNoc2 YNS showed similar levels of protection, with 4 of 9 and 5 of 8 mice respectively remaining tumor free.
  • the sera from the surviving mice were analyzed by ELISA and found to not contain any IgM indicating that the mice were truly tumor free.
  • the experiment was repeated ( Figure 23, panel B) and similar results were obtained. Treatment with anti-CD20 provided some protection.
  • Fusions with type I IFN were more protective than fusions with IFNy; however in this case anti-CD20-IFNoc2 YNS protected more mice than did anti-CD20-IFNoc2.
  • anti-CD20 provides significant protection (p ⁇ .0001 compared with PBS) ( see, e.g., Figure 23, panel C).
  • there is no significant difference in the protection provided by the two type I IFN fusion proteins (p 0.34).
  • bortezomib showed dose-dependent inhibition of proliferation, no enhanced inhibition of proliferation as indicated by decreased incorporation of 3 H- thymidine was seen when MWCL- 1 cells were incubated with bortezomib and fusions with type I interferon (Data not shown). In contrast, increased inhibition of proliferation was seen when MWCL-1 cells were incubated different concentrations of anti-CD20-IFNy and anti-CD138-IFNy fusion proteins and bortezomib for 72 hours. In the initial experiment the bortezomib concentration was held constant at 8 nM and cells were incubated with different concentrations of fusion protein (Figure 24, panel A). Increased inhibition of proliferation was seen for both concentrations of fusion protein.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

In various embodiments targeted interferon constructs are provided. In certain embodiments the constructs comprise a full-length immunoglobulin or a camelid antibody attached to an interferon gamma (IFNγ) where said immunoglobulin or camelid antibody is an antibody that binds to a tumor associated antigen; a first interferon gamma (IFNγ) is attached to a first constant heavy region 3 (CH3) of the immunoglobulin or camelid antibody by a first proteolysis resistant peptide linker; a second interferon gamma is attached to a second constant heavy region 3 (CH3) of the immunoglobulin or camelid antibody by a second proteolysis resistant peptide linker; and the first proteolysis resistant linker and the second proteolysis linker have a length and flexibility that permits said first interferon gamma and said second interferon gamma to dimerize.

Description

TARGETED DELIVERY OF IFN GAMMA USING ANTIBODY
FUSION PROTEINS
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims benefit of and priority to USSN 62/798,994, filed on January 30, 2019, which is incorporated herein by reference in its entirety for all purposes.
STATEMENT OF GOVERNMENTAL SUPPORT
[0002] This invention was made with government support under Grant No. R01
CA200910 awarded by the National Institutes of Health. The Government has certain rights in this invention. BACKGROUND
[0003] Interferon-gamma (IFN-g) is a pleiotropic cytokine secreted by Natural
Killer (NK) cells and many T cells including NKT. It is the sole representative of Type II IFN and is often termed immune interferon. IFN-g has pleiotropic activities including: directly inhibiting cell growth, inducing an antiviral state in cells, upregulating cell surface markers such as Class I and II MHC, and regulating the activity of macrophages, NK cells, neutrophils, B-cells, and T-cells. As such, IFN-g has broad appeal for use as a cancer therapeutic.
[0004] IFN-g functions as a dimeric cytokine that binds to a heterodimeric receptor consisting of the IFN-g Receptor Chain 1 (IFNGR1), which provides binding affinity, and Receptor Chain 2 (IFNGR2), which is involved in signal transduction. Recent evidence has suggested that the receptor actually has a tetrameric structure consisting of two IFNGR2 molecules and two IFNGR1 molecules. Binding of IFN-g leads to a conformational change and subsequent signal transduction (Krause and Pestka (2007) Cytokine Growth Factor Reviews 18: 473).
[0005] The human IFNy gene encodes a polypeptide of 143 amino acid residues.
Natural forms of human IFNy are modified to contain N-linked glycosylation at two positions, and a heterogeneous C terminus. Mouse IFNy contains only 2 potential sites of N-glycosylation. However, glycosylation is not necessary for activity as recombinant IFNy produced in E. coli is active. Human IFNy has a heterogeneous carboxy-terminus and studies have shown that proteins missing 9 of the c-terminal amino acids have improved anti-viral activity. The crystal structure of human IFNy revealed an alpha-helical homodimer composed of two peptide chains. Each domain consists of six tightly associated a-helices of which four are donated from one peptide chain and the last two from the other to form intertwined or domain- swapped dimers. This dimer binds two copies of IFNGR1 in solution and the IFN-g dimer structure is important for full activity.
SUMMARY
[0006] Various embodiments contemplated herein may include, but need not be limited to, one or more of the following:
[0007] Embodiment 1 : A chimeric construct comprising a full-length
immunoglobulin or a camelid antibody attached to an interferon gamma (IENg) wherein:
[0008] said immunoglobulin or camelid antibody is an antibody that binds to a tumor associated antigen;
[0009] a first interferon gamma (IFNy) is attached to a first constant heavy region 3 (CEE) of said immunoglobulin or camelid antibody by a first proteolysis resistant peptide linker;
[0010] a second interferon gamma is attached to a second constant heavy region 3 (CEE) of said immunoglobulin or camelid antibody by a second proteolysis resistant peptide linker; and
[0011] said first proteolysis resistant linker and said second proteolysis linker have a length and flexibility that permits said first interferon gamma and said second interferon gamma to dimerize.
[0012] Embodiment 2: The construct of embodiment 1, wherein said first proteolysis resistant peptide linker and said second proteolysis peptide linker comprise amino acid sequences independently selected from the amino acid sequences of the peptide linkers shown in Table 1.
[0013] Embodiment 3: The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the Landar linker.
[0014] Embodiment 4: The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the Double landar linker. [0015] Embodiment 5: The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the lqo0E_l linker.
[0016] Embodiment 6: The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the IgG3 hinge linker.
[0017] Embodiment ?: The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the IgG3 hinge delta cys linker.
[0018] Embodiment 8: The construct of embodiment 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the IgGl hinge delta cys linker.
[0019] Embodiment 9: The construct according to any one of embodiments 1-8, wherein said interferon gamma comprises a murine interferon gamma, or a truncated and/or mutated murine interferon gamma.
[0020] Embodiment 10: The construct of embodiment 9, wherein said interferon gamma comprises a full-length murine interferon gamma.
[0021] Embodiment 11: The construct according to any one of embodiments 9-10, wherein said murine interferon gamma is not glycosylated.
[0022] Embodiment 12: The construct according to any one of embodiments 9- lOwherein said murine interferon gamma is glycosylated at Asn 38 and/or at ASN 90.
[0023] Embodiment 13: The construct according to any one of embodiments 1-8, wherein said interferon gamma comprises a human interferon gamma or a truncated and/or mutated human interferon gamma.
[0024] Embodiment 14: The construct of embodiment 13, wherein said human interferon gamma is not glycosylated.
[0025] Embodiment 15: The construct of embodiment 13, wherein said human interferon gamma comprises N-linked glycosylation at Asn-25 and/or at Asn-97.
[0026] Embodiment 16: The construct according to any one of embodiments 13-15, wherein said human interferon gamma comprises a full-length human interferon. [0027] Embodiment 17: The construct according to any one of embodiments 13-15, wherein said human interferon gamma comprises a huIFNy C-terminally truncated with 1- 15 amino acid residues, e.g. with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acid residues.
[0028] Embodiment 18: The construct according to any one of embodiments 13-15, and 17, wherein said human interferon gamma comprises a human interferon gamma N- terminally truncated with 1, 2, or 3 amino acid residues.
[0029] Embodiment 19: The construct according to any one of embodiments 13-15, wherein said human interferon gamma comprise a human interferon gamma with an N- terminai addition CYC.
[0030] Embodiment 20: The construct according to any one of embodiments 13-19, wherein said human interferon gamma comprises a cysteine substitutions at one or more of Glu8, Ser70, Alal8, Hisl l2, Lys81, Leul21, Gln49, and leu96 (relative to the amino acid sequence of SEQ ID NO: 13).
[0031] Embodiment 21 : The construct of embodiment 20, wherein said human interferon gamma comprises at least one pair of amino acids from predetermined amino acid pairs exchanged for cysteine, wherein said four amino acid pairs are Glu8 and Ser70, Alai 8 and His 112, Lys81 and Leul21, and Gln-49 and Leu96.
[0032] Embodiment 22: The construct according to any one of embodiments 1-21, wherein said antibody or camelid antibody preferentially or specifically binds to a tumor associated antigen (TAA) selected from the group consisting of CD138, CSPG4, oc- fetoprotein, 5 alpha reductase, 5T4 (or TPBG, trophoblast glycoprotein), AM-1, APC, APRIL, B7 family members, BAGE, Bcl2, bcr-abl (b3a2), CA-125, CASP-8/FLICE, Cathepsins, CD1, CD115, CD123, CD13, CD14, CD15, CD19, CD2, CD20, CD200, CD203c, CD21, CD23, CD22, CD38, CD25, CD276, CD3, CD30, CD303, CD33, CD34, CD35, CD37, CD38, CD44, CD45, CD46, CD5, CD52, CD55, CD56, CD59 (791Tgp72), CD7, CD70, CD74, CD79, CDC27, CDK4, CEA, CLL-1, c-MET (or HGFR), c-myc, Cox- 2, Cripto, DCC, DcR3, DLL3, E6/E7, EGER, EMBP, Ena78, endoplasmin, EPCAM,
EphA2, EphB3, ETBR, FcRL5, FGF8b and FGF8a, FLK-l/KDR, FOLR1, G250, GAGE- Family, gastrin 17, gastrin-releasing hormone (bombesin), GD2/GD3/GM2, glutathione S- transferase, glycosphingolipid GD2, GnRH, GnTV, gpl00/Pmell7, gp-100-in4, gpl5, gp75/TRP-l, GPNMB, hCG, Heparanase, Her2/neu, Her3, Her4, HLA-DR, HM 1.24, HMB 45, HMTV, HMW-MAA, Hsp70, hTERT (telomerase), IFN-cc, IGFR1, IL-13R, iNOS, integrin, Ki 67, KIAA0205, K-ras, H-ras„ N-ras, KSA (C017-1A), LDLR-FUT, Leu-Ml, Lewis A like carbohydrate, Lewis Y, LIV1, MAGE1, MAGE3, Mammaglobin, MAP17, Melan-A/, MART-1, mesothelin, MIC A/B, MN, Moxl, MMP2, MMP3, MMP7, MMP9, MUC16, MUC-1, MUC-2, MUC-3, MUC-4, MUC-16, MUM-1, NaPi2b, Nectin-4, NY- ESO-1, Osteonectin, pl5, pl6INK4, P170/MDR1, p53, p97/melanotransferrin, PAI-1, PDGF, plasminogen (uPA), PMSA, PRAME, Probasin, Progenipoietin, PSA (phosphatidyl serine antigen), PSM, RAGE-1, Rb, RCAS1, SART-1, SE10, SIRP.alpha., SLAM family members, SLC44A4, SSX gene, family, STAT3, STEAP-1, STn (mucin assoc.), TAG-72, TF (or tissue factor), TGF-oc, TGF-b, Thymosin b 15, TNF superfamily members, TPA,
TPI, TRP-2, Tyrosinase, VEGF, VLA, ZAG, and b-catenin.
[0033] Embodiment 23: The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to CSPG4.
[0034] Embodiment 24: The construct of embodiment 23, wherein said antibody comprises the CDRs of an antibody selected from the group consisting of 9.2.27, VF1- TP34, VF1-TP34, VF1-TP41.2, TP61.5, 149.53, 149.53, 225.28, 225.28s, 763.74, and scFv- FcC21.
[0035] Embodiment 25: The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD 138.
[0036] Embodiment 26: The construct of embodiment 25, wherein said antibody comprises the CDRs of an antibody comprises an antibody selected from the group consisting of nBT062, B-B4, BC/B-B4, B-B2, DL-101, 1 D4, MI15, 1.BB.210, 2Q1484, 5F7, 104-9, and 281-2.
[0037] Embodiment 27: The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to a member of the EGF receptor family.
[0038] Embodiment 28: The construct of embodiment 27, wherein said antibody comprises the CDRs of an antibody comprises an antibody selected from the group consisting of C6.5, C6ML3-9, C6MH3-B1, C6-B1D2, F5, HER3.A5, HER3.F4, HER3.H1, HER3.H3, HER3.E12, HER3.B12, EGFR.E12, EGFR.C10, EGFR.Bl l, EGFR.E8, HER4.B4, HER4.G4, HER4.F4, HER4.A8, HER4.B6, HER4.D4, HER4.D7, HER4.D11, HER4.D12, HER4.E3, HER4.E7, HER4.F8 and HER4.C7. [0039] Embodiment 29: The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD20.
[0040] Embodiment 30: The construct of embodiment 29, wherein said antibody comprises the CDRs of an antibody comprises an antibody selected from the group consisting of rituximab, Ibritumomab tiuxetan, and tositumomab.
[0041] Embodiment 31: The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to endoplasmin.
[0042] Embodiment 32: The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD33.
[0043] Embodiment 33: The construct of embodiment 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD276.
[0044] Embodiment 34: The construct according to any one of embodiments 1-33, wherein said antibody or camelid antibody is a full-length immunoglobulin.
[0045] Embodiment 35: The construct of embodiment 34, wherein said antibody is a human antibody.
[0046] Embodiment 36: The construct of embodiment 34, wherein said antibody is a humanized or chimeric antibody.
[0047] Embodiment 37: The construct according to any one of embodiments 1-33, wherein said antibody or camelid antibody is a camelid antibody.
[0048] Embodiment 38: A pharmaceutical formulation comprising:
[0049] a chimeric construct according to any one of embodiments 1-37; and
[0050] a pharmaceutically acceptable carrier.
[0051] Embodiment 39: The pharmaceutical formulation of embodiment 38, wherein said formulation is a unit dosage formulation.
[0052] Embodiment 40: The formulation according to any one of embodiments 38-
39, wherein said formulation is formulated for administration via a route selected from the group consisting of oral administration, nasal administration, rectal administration, intraperitoneal injection, intravascular injection, subcutaneous injection, transcutaneous administration, and intramuscular injection.
[0053] Embodiment 41 : A method of inhibiting growth and/or proliferation of a cell that expresses or overexpresses CD 138, said method comprising contacting said cell with a chimeric construct according to any of embodiments 1-36, or a formulation according to any one of embodiments 37-39 in an amount sufficient to inhibit growth or proliferation of said cell.
[0054] Embodiment 42: The method of embodiment 41, wherein said cell is a cancer cell.
[0055] Embodiment 43: The method of embodiment 42, wherein said cancer cell is a metastatic cell.
[0056] Embodiment 44: The method of embodiment 42, wherein said cancer cell is in a solid tumor.
[0057] Embodiment 45: The method of embodiment 42, wherein said cancer cell is cell produced by a cancer selected from the group consisting of multiple myeloma, ovarian carcinoma, cervical cancer, endometrial cancer, kidney carcinoma, gall bladder carcinoma, transitional cell bladder carcinoma, gastric cancer, prostate adenocarcinoma, breast cancer, prostate cancer, lung cancer, colon carcinoma, Hodgkin's and non-Hodgkin's lymphoma, chronic lymphocytic leukemia (CLL), acute lymphoblastic leukemia (ALL), acute myeloblastic leukemia (AML), a solid tissue sarcoma, colon carcinoma, non-small cell lung carcinoma, squamous cell lung carcinoma, colorectal carcinoma, hepato-carcinoma, pancreatic cancer, and head and neck carcinoma.
[0058] Embodiment 46: The method of embodiment 42, wherein said cancer cell is a cell of a multiple myeloma.
[0059] Embodiment 47: The method according to any one of embodiments 41-46, wherein said method comprises inhibiting, delaying and/or preventing the growth of a tumor and/or spread of malignant tumor cells.
[0060] Embodiment 48: The method according to any one of embodiments 41-47, wherein said contacting comprises systemically administering said construct or formulation to a mammal.
[0061] Embodiment 49: The method according to any one of embodiments 41-47, wherein said contacting comprises administering said construct or formulation directly into a tumor site.
[0062] Embodiment 50: The method according to any one of embodiments 41-47, wherein said contacting comprises administering said construct or formulation via a route selected from the group consisting of oral administration, intravenous administration, intramuscular administration, direct tumor administration, inhalation, rectal administration, vaginal administration, transdermal administration, and subcutaneous depot administration·
[0063] Embodiment 51: The method according to any one of embodiments 41-47, wherein said contacting comprises administering said construct or formulation
intravenously.
[0064] Embodiment 52: The method according to any one of embodiments 41-51, wherein said cell is a cell in a human.
[0065] Embodiment 53: The method according to any one of embodiments 41-51, wherein said cell is a cell in a non-human mammal.
[0066] Embodiment 54: The method of embodiment 41, wherein said cancer cell is a cell produced by a multiple myeloma.
[0067] Embodiment 55: The method according to any one of embodiments 41-54, wherein said method comprises co-administration of said chimeric construct with bortezomib.
[0068] Embodiment 55: The method according to any one of embodiments 41-55, wherein said method comprises co- administration of said chimeric construct with ibrutinib.
[0069] Embodiment 57: The method according to any one of embodiments 55-55, wherein said co- administration provides a synergistic effect.
DEFINITIONS
[0070] The terms "targeted interferon" as used herein refers to an interferon attached to a "targeting moiety" (e.g. , an antibody) that binds to a molecule disposed, for example, on the surface of a cell (e.g., a cancer cell). One illustrative targeted interferon comprises a chimeric moiety comprising an antibody or a camelid antibody attached to two interferon gamma molecules as described herein.
[0071] The terms "polypeptide", "peptide" and "protein" are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers. The term also includes variants on the traditional peptide linkage joining the amino acids making up the polypeptide. Preferred "peptides", "polypeptides", and
"proteins" are chains of amino acids whose alpha carbons are linked through peptide bonds. The terminal amino acid at one end of the chain (amino terminal) therefore has a free amino group, while the terminal amino acid at the other end of the chain (carboxy terminal) has a free carboxyl group. As used herein, the term "amino terminus" (abbreviated N-terminus) refers to the free a- amino group on an amino acid at the amino terminal of a peptide or to the a-amino group (imino group when participating in a peptide bond) of an amino acid at any other location within the peptide. Similarly, the term "carboxy terminus" refers to the free carboxyl group on the carboxy terminus of a peptide or the carboxyl group of an amino acid at any other location within the peptide. Peptides also include essentially any polyamino acid including, but not limited to peptide mimetics such as amino acids joined by an ether as opposed to an amide bond.
[0072] An "antibody", as used herein, refers to a protein consisting of one or more polypeptides substantially encoded by immunoglobulin genes or fragments of
immunoglobulin genes. In certain embodiments, the immunoglobulin genes are human immunoglobulin genes. Recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as myriad
immunoglobulin variable region genes. Light chains are typically classified as either kappa or lambda. Heavy chains are typically classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
[0073] A typical (native) immunoglobulin (antibody) (full-length antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light" (about 25 kD) and one "heavy" chain (about 50-70 kD). The N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The terms variable light chain (VL) and variable heavy chain (VH) refer to these regions of the light and heavy chains respectively. It is noted that immunoglobulins IgA and IgM contain multiple copies of the four chain structure.
[0074] The phrase "inhibition of growth and/or proliferation" of a cancer cell refers to decrease in the growth rate and/or proliferation rate of a cancer cell. In certain embodiments this includes death of a cancer cell (e.g. via apoptosis). In certain
embodiments this term also refers to inhibiting the growth and/or proliferation of a solid tumor and/or inducing tumor size reduction or elimination of the tumor.
[0075] The terms "tumor associated antigen", "TAA", and "cancer marker" are used interchangeably to refer to biomolecules such as proteins, carbohydrates, glycoproteins, and the like that are exclusively or preferentially or differentially expressed on a cancer cell and/or are found in association with a cancer cell and thereby provide targets preferential or specific to the cancer. In various embodiments the preferential expression can be preferential expression as compared to any other cell in the organism, or preferential expression within a particular area of the organism (e.g. within a particular organ or tissue).
[0076] The terms "subject," "individual," and "patient" may be used interchangeably and refer to a mammal, preferably a human or a non-human primate, but also domesticated mammals (e.g., canine or feline), laboratory mammals (e.g., mouse, rat, rabbit, hamster, guinea pig), and agricultural mammals (e.g., equine, bovine, porcine, ovine). In various embodiments, the subject can be a human (e.g., adult male, adult female, adolescent male, adolescent female, male child, female child) under the care of a physician or other health worker in a hospital, psychiatric care facility, as an outpatient, or other clinical context. In certain embodiments, the subject may not be under the care or prescription of a physician or other health worker.
[0077] The phrase "cause to be administered" refers to the actions taken by a medical professional (e.g., a physician), or a person controlling medical care of a subject, that control and/or permit the administration of the agent(s)/compound(s) at issue to the subject. Causing to be administered can involve diagnosis and/or determination of an appropriate therapeutic or prophylactic regimen, and/or prescribing particular
agent(s)/compounds for a subject. Such prescribing can include, for example, drafting a prescription form, annotating a medical record, and the like. Where administration is described herein, "causing to be administered" is also contemplated.
[0078] The term "exhibiting IFN gamma activity" is intended to indicate that the polypeptide has one or more of the functions of native IFNy, in particular huIFNy or rhuIFNy. Such functions include, inter alia, the capability to bind to an IFNy receptor and cause transduction of the signal transduced upon huIFNy-binding of its receptor as determined in vitro or in vivo (/.<?., in vitro or in vivo bioactivity). The IFNy receptor has been described by Aguet et al. (1988) Cell 55: 273-280) and Calderon et al. (1988) Proc. Natl. Acad. Sci. USA, 85:4837-4841. The "IFNy polypeptide" is a polypeptide exhibiting IFNy activity and is used herein about the polypeptide in monomer or dimeric form, as appropriate. For instance, when specific substitutions are indicated these are normally indicated relative to the IFNy polypeptide monomer. When reference is made to the IFNy as part of a conjugate this is normally in dimeric form (and thus, e.g., comprises two IFNy polypeptide monomers modified as described). The dimeric form of the IFNy polypeptides may be provided by the normal association of two monomers or be in the form of a single chain dimeric IFNy polypeptide. The IFNy polypeptide described herein may have an in vivo or in vitro bioactivity of the same magnitude as huJFNy or rhuIFNy or lower or higher, e.g. an in vivo or in vitro bioactivity of > 100% (e.g., 125% or greater, or 150% or greater, or 200% or greater, or 300% or greater, or 400% or greater, or 500% or greater, or 1000% (10-fold) or greater, and so forth), 1-100% of that of huIFNy or rhuIFNy, as measured under the same conditions, e.g. 1-25% or 1-50% or 25-100% or 50-100% of that of huIFNy or rhuIFNy.
BRIEF DESCRIPTION OF THE DRAWINGS
[0079] Figure 1. Inhibition of proliferation by anti-CSPG4 fusions with IFNy using different linkers. OVCAR and T98MG cells were treated for 3 days and A375 cells were treated with 4 days with the indicated fusion proteins at different concentrations and the metabolic activity of the remaining cells determined using the MTS assay.
[0080] Figure 2. Inhibition of proliferation by anti-CSPG4 fusions with IFNy using different linkers. Cells were treated for 6 days with the indicated fusion proteins at different concentrations and the metabolic activity of the remaining cells determined using the MTS assay.
[0081] Figure 3. Ovarian cancer cell lines were stained with the indicated antibodies and analyzed by flow cytometry.
[0082] Figure 4. Ovarian cancer cell lines treated with targeted anti-CD 138, anti-
CD138-IFNa2, anti-CD138-IFNal4, anti-CD138-IFNa2™s, anti-CD 138IFNy, or untargeted anti-CD20-IFNa2YNS, or anti-CD20-IFNy. Cells were treated for 6 days and proliferation analyzed by MTS.
[0083] Figure 5. Inhibition of proliferation of ovarian cell lines following treatment with hIFNy, targeted anti-CD 138 IFNy, or untargeted anti-CD20-IFNy for 6 days.
[0084] Figure 6. Inhibition of proliferation of the glioblastoma T98MG following treatment with targeted unfused anti-CD138, anti-CD138-IFNa2, anti-CD 138-IFNal4, anti- CD 138-IFNa2YNS, or anti-CD 138IFNy or untargeted anti-CD20-IFNy for 6 days. Metabolic activity of surviving cells was determined using the MTS assay.
[0085] Figure 7. Inhibition of proliferation of the multiple myeloma cell lines OCI-
My5, H929, MM1-144, ANBL-6, 8226Dox40 and U266 following treatment with targeted anti-CD 138IFNy or untargeted anti-CD20-IFNy for 3 days and metabolic activity of surviving cells was determined using the MTS assay.
[0086] Figure 8. B16 mouse myeloma cells were incubated with either 1.5 nM mouse IFNy (mlFNy) or .75 nM anti-CD20-mIFNy for 24 hours, stained with PE-labeled mouse anti-H2-Kb and analyzed by flow-cytometry. Controls included cells that were not treated with INFy (Untreated) but were stained with anti-H2-Kb and cells treated with IFNy but stained with a mouse antibody of irrelevant specificity.
[0087] Figure 9. Inhibition of proliferation of the murine melanoma B16 following treatment with untargeted mlFNy or anti-CD20-mIFNy for 4 days. Metabolic activity of surviving cells was determined using the MTS assay.
[0088] Figure 10. Inhibition of proliferation of the murine melanoma B 16 expressing human CD20 following treatment with untargeted mIFNa, mIFN or mlFNy or targeted anti-CD20-mIFNa, anti-CD20-mIFN or anti-CD20-mIFNy for 4 days. Metabolic activity of surviving cells was determined using the MTS assay.
[0089] Figure 11. Effect of treatment on in vivo tumor growth. C57/BL6 mice injected subcutaneously with B16huCD20 cells were treated on days 5, 6 and 7 with either PBS or 100 pg of anti -hC D20-m I FNy and monitored for tumor growth. Mice were sacrificed when tumors exceeded 1.5 cm in diameter per institutional guidelines.
[0090] Figure 12. Rabbit complement lysis of 38C13-huCD20.
[0091] Figure 13. ADCC of 38C13-huCD20.
[0092] Figure 14. Expression of MHCI, ICAMI, PDL-L1, CD80 and FAS in
38C13-huCD20 following 24 hours treatment with 10 nM mlFNy, anti-CD20 or anti-CD20- mIgG2a-mIFNy.
[0093] Figure 15. Inhibition of proliferation of the murine lymphoma 38C13 following treatment with untargeted mIFNy or anti-CD20-mIFNy for 4 days. Metabolic activity of surviving cells was determined using the MTS assay.
[0094] Figure 16. Inhibition of proliferation of the murine lymphoma
38C13huCD20 following treatment with the indicated proteins for 4 days. Metabolic activity of surviving cells was determined using the MTS assay.
[0095] Figure 17. Three independent experiments showing effect of treatment on tumor growth. C3H/HeJ mice injected subcutaneously with 38C13huCD20 cells were treated on days 5, 6 and 7 with either PBS or 100 mg of anti-hCD20-mIFNy and monitored for tumor growth. Mice were sacrificed when tumors exceeded 1.5 cm in diameter per institutional guidelines.
[0096] Figure 18, panels A-C: Anti-hCD20mIgG2a-mIFNy was more effective in inhibiting tumor growth in vivo than anti-hCD20mIgG2a. C3H/HeJ mice injected subcutaneously with 5000 (panels A and B) or 4000 (panel C) 38C13huCD20 cells were either treated on days 5, 6 and 7 (panel A) or on days 4, 5, 6, and 8 (panels B and C) with either PBS or 100 pg of anti - hC D20- m I FNy or an equivalent molar concentration of anti- hCD20mIgG2a and monitored for tumor growth. Mice were sacrificed when tumors exceeded 1.5 cm in diameter per institutional guidelines.
[0097] Figure 19. Higher doses of anti-hCD20mIgG2a-mIFND are more effective in inhibiting tumor growth in vivo. C3H/HeJ mice injected subcutaneously with
38C13huCD20 cells were either treated on days 5, 6 and 7 either PBS, 100 pg of anti- hCD20-mIFNy. 50 pg of anti -hCD20- m I FNy or 25 pg of anti-hCD20-mIFNy and monitored for tumor growth. Mice were sacrificed when tumors exceeded 1.5 cm in diameter per institutional guidelines.
[0098] Figure 20, panels A-F: To evaluate the ability of the fusion proteins to induce apoptosis in MWCL-1, cells were treated with 12.5 nM of the indicated proteins for 5 days and apoptosis evaluated by flow-cytometry following staining with Annexin V and PI.
[0099] Figure 21, panels A-F: To determine the ability of the proteins to inhibit proliferation, MWCL-1 cells were incubated with 12.5 nM protein for 72 hours, then pulsed with 3H-thymidine for 8 hours and proliferation measured by determining the amount of 3H- thymidine incorporated into DNA.
[0100] Figure 22, panels A-E, illustrates STAT activation (pSTATl, total STAT1, pSTAT3 and total STAT3) following treatment with the various interferon constructs.
Panel A) Comparison of STAT activation by anti-CD138, anti-CD20, anti-CD138-IFNa2, anti-CD 138-IFNy, anti-CD138-IFNal4, anti-CD20-IFNal4, anti-CD 138-IFNa2YNS, anti- CD20-IFNa2YNS, and anti-CD20-IFNy. Panel B) Comparison of STAT activation by anti- CD 138-IFNa2+anti-CD20-IFNa2, anti-CD 138-IFNal4+anti-CD20-IFNal4, anti-CD 138- IFNa2YNS+anti-CD20-IFNa2YNS. Panel C) Comparison of STAT activation by anti- CD 138-IFNy+anti-CD 138, anti-CD 138-IFNy+anti-CD 138-IFNa2, anti-CD 138-IFNy+anti- CD138-IFNal4, anti -CD 138-1 FNy+anti -C D 138- 1 FNa2YNS , anti-CD 138-IFNy+anti-CD20, anti-CD 138-IFNy+anti-CD20-IFNa2, anti-CD 138y+anti-CD20-IFNal4, anti-CDl 38y+anti- CD20-IFNa2YNS. Panel D) Comparison of STAT activation by anti -C D20- 1 FNy+anti - CD20, anti-CD20-IFNy+anti-CD138-IFNa2, anti-CD20y+anti-CD138-IFNal4, anti-CD20- IFNy+anti-CD 138-IFNa2YNS , anti-CD20-IFNy+anti-CD20, anti-CD20-IFNy+anti-CD20- IFNa2, an ti -CD20- 1 FNy+anti -C D20- 1 FN a 14, anti-CD20-IFNy+anti-CD20-IFNa2YNS.
Panel E) Comparison of STAT activation by anti-CD138IFNa2, anti-CD 138-IFNa2+anti- CD138-IFNy, anti-CD 138-IFNy; anti-CD20-IFNa2+anti-cdl38-IFNy. Anti-CD20-IFNa2, anti-CD 138- IFN a2 , anti-CD 138-IFNa2+anti-CD20-IFNy, anti-cd20-IFNy, anti- CD20IFNa2+anti-CD20-IFNy, and anti-CD20-IFNa2.
[0101] Figure 23, panels A-C, illustrates anti-proliferative activity of IFN-g fusion proteins in combination with bortezomib or ibrutinib. Panel A) First experiment. Panel B) Second experiment. Panel C) Combination of experiment 1 and experiment 2.
[0102] Figure 24, panels A-C, illustrates anti-proliferative activity of IFN-g fusion proteins in combination with bortezomib or ibrutinib. Panel A) Fusion protein
concentrations at 25,000 pM, 5,000 pM, and 1,000 pM. Panel B) Bortezomib
antiproliferative activity. Panel C) Ibrutinib antiproliferative activity.
DETAILED DESCRIPTION
[0103] In view of the requirement for dimer formation for optimal interferon gamma (IFNy) activity, we examined the use of a number of different linkers for their ability to allow functional dimer formation by two IFNy moieties joined to the carboxy termini of the IgG heavy chains of a full-length antibody. One challenge was to make sure that linkers are long enough so that different domains do not impair each other and inhibit biological activity while permitting the formation of active interferon gamma dimers. Additionally, linkers were selected to resist or avoid proteolytic cleavage (proteolysis resistant linkers). Linkers that we examined are illustrated in Table 1.
Table 1. Linker sequences.
Figure imgf000017_0001
[0104] The linkers have different properties. IgGl delta cys and lqoOE_l are similar in length (18 and 19 aa, respectively) but have different conformations (coil and alpha helix, respectively). IgG3 and IgG3 delta cys are of the same length but there are no disulfide bonds in the latter. The Landar linker has a relatively short 10 aa sequence.
[0105] IFN was joined with the different linkers after the CH3 domain of anti-
CSPG4, transiently expressed in 293T cells and protein isolated from culture supernatants. The fusion proteins were then evaluated for their ability to inhibit the proliferation of OVCAR3, an ovarian cancer, T98MG, a glioma, and A375, a melanoma (Figure 1).
OVCAR3 and T98MG do not express CSPG-4, while A375 expresses it to high levels.
Thus for OVCAR3 and T98MG we are examining the relative efficacy of untargeted fusion protein in comparison to untargeted recombinant IFNy; for A375 we are comparing anti- CSPG-4 targeted IFNy with untargeted recombinant IFNy. For OVCAR3, the most effective IFNy fusion utilized the IgG3 hinge with the second most effective using the IgGl hinge A cys. Interestingly, both were more effective than this preparation of recombinant IFNy.
[0106] In view of these, and other observations, in various embodiments, chimeric constructs are provided for the selective/specific delivery of active interferon gamma. In certain embodiments the chimeric construct(s) comprise a full-length immunoglobulin or a camelid antibody attached to an interferon gamma (IFNy) where the immunoglobulin or camelid antibody is an antibody that binds to a tumor associated antigen (TAA), a first interferon gamma (IFNy) is attached to a first constant heavy region 3 (CH3) of the immunoglobulin or camelid antibody by a first proteolysis resistant peptide linker, a second interferon gamma is attached to a second constant heavy region 3 (CH3) of the
immunoglobulin or camelid antibody by a second proteolysis resistant peptide linker; and the first proteolysis resistant linker and the second proteolysis linker have a length and flexibility that permits the first interferon gamma and the second interferon gamma to dimerize.
[0107] In certain embodiments the first proteolysis resistant peptide linker and the second proteolysis peptide linker comprise or consist of amino acid sequences
independently selected from the amino acid sequences of the peptide linkers shown in Table 1. Thus, for example, in one illustrative embodiment the linker comprises or consists of the amino acid sequence of the landar linker (SEQ ID NO:l). In another illustrative embodiment the linker comprises or consists of the amino acid sequence of the double landar linker (SEQ ID NO:2). In another illustrative embodiment the linker comprises or consists of the amino acid sequence of the lqo0E_l linker (SEQ ID NO:3). In another illustrative embodiment the linker comprises or consists of the amino acid sequence of the IgG3 hinge linker (SEQ ID NO:4). In still another illustrative embodiment the linker comprises or consists of the amino acid sequence of the IgG3 hinge delta cys (IgG3 hinge A cys) linker (SEQ ID NO: 5). In yet still another illustrative embodiment the linker comprises or consists of the amino acid sequence of the IgGl hinge delta cys (IgGl hinge A cys) linker (SEQ ID NO:6).
[0108] As described in Example 1, when these cleavage resistant linkers are utilized to couple interferon gamma to antibody (or camelid antibody) CH3 domains the interferon gamma molecules are able to form an active dimer. The construct is thereby capable of specifically ro preferentially delivering the interferon gamma activity to a cell expressing a target that is bound by the antibody or camelid antibody.
[0109] The chimeric constructs and/or pharmaceutical formulations comprising the constructs are useful in the treatment of various cancers. Interferon gamma.
[0110] In various embodiments the interferon gamma molecules used in the chimeric constructs described herein include full length human or murine interferon as well as truncated human or murine interferon and/or mutated human or murine interferon.
[0111] Interferon-gamma (IFNy) is a cytokine produced by T-lymphocytes and natural killer cells and exists as a homodimer of two noncovalently bound polypeptide subunits. The sequence of the protein encoded by the human interferon gene is:
10 20 30 40 50
MKYTSYILAF QLCIVLGSLG CYCQDPYVKE AENLKKYFNA GHSDVADNGT
60 70 80 90 100
LFLGILK WK EESDRKIMQS QIVSFYFKLF KNFKDDQSIQ KSVETIKEDM
110 120 130 140 150
NVKFFNSNKK KRDDFEKLTN YSVTDLNVQR KAIHELIQVM AELSPAAKTG
160
KRKRSQMLFR GRRASQ (SEQIDNO:13)
The first 23 amino acids are the leader sequence which is cleaved from the protein yielding a mature protein of 143 amino acids - but no methionine.
[0112] Each subunit has two potential N-glycosylation sites (Aggarwal et al. (1992)
Human Cytokines, Blackwell Scientific Publications) at positions 25 and 97. Depending on the degree of glycosylation the molecular weight of IFNy in dimer form is 34-50 kDa (Farrar et al. (1993) Ann. Rev. Immunol, 11: 571-611).
[0113] The primary sequence of wildtype human IFNy (huIFNy, aka huINFG) was reported by Gray et al. (1982) Nature 298: 859-863), Taya et al. (1982) EMBO J. 1: 953- 958; Devos et al. (1982) Nucleic Acids Res. 10: 2487-2501; and Rinderknecht et al. (1984) J. Biol. Chem. 259: 6790-6797), and in EP 77670, EP 89676 and EP 110044. The 3D structure of huIFNy was reported by Ealick et al. (1991) Science 252: 698-702, 1991).
[0114] Various naturally-occurring or mutated forms of the IFNy subunit polypeptides have been reported, including one comprising a Cys-Tyr-Cys N-terminal amino acid sequence (positions (-3)-(-l) relative to SEQ ID NO: 13), one comprising an N- terminal methionine (position -1 relative to SEQ ID NO: 13), and various C-terminally truncated forms comprising 127-134 amino acid residues. It is known that 1-15 amino acid residues may be deleted from the C-terminus without abolishing IFNy activity of the molecule. Furthermore, heterogeneity of the huIFNy C-terminus was described by Pan et al. (1987) Eur. J. Biochem. 166: 145-149. [0115] HuIFNy muteins are reported by Slodowski et al. (1991) Eur. J. Biochem.
202 : 1133-1140, 1991, Luk et al. (1990) J. Biol. Chem. 265: 13314-13319, Seelig et al., (1988) Biochemistry 27: 1981-1987, Trousdale et al. (1985) Invest. Ophthalmol. Vis. Sci.
26: 1244-1251, and in EP 146354.
[0116] WO 1992/008737 discloses IFNy variants comprising an added methionine in the N- terminal end of the full (residues 1-143) or partial (residues 1-132) amino acid sequence of wildtype human IFNG. EP 219 781 discloses partial huIFNy sequences comprising amino 10 acid residues 3-124 (of SEQ ID NO: 13)). US 4,832,959 discloses partial huIFNy sequences comprising residues 1-127, 5-146 and 5-127 of an amino acid sequence that compared to SEQ ID NO: 13 has three additional N-terminal amino acid residues (CYC). US Patent No: 5,004,689 discloses a DNA sequence encoding huIFNy without the 3 N-terminal amino acid residues CYC and its expression in E. coli. European patent EP 446582 discloses E. coli produced rhuIFNy free of an 15 N-terminal methionine. US Patent No: 6,120,762 discloses a peptide fragment of huIFNy comprising residues 95- 134 thereof (relative to SEQ ID NO: 13).
[0117] In various embodiments where interferon gamma is utilized in the constructs described herein the interferon gamma component(s) of the construct can be any polypeptide with IFNy activity, and thus be derived from any origin, e.g. a non-human mammalian origin. However, in various embodiments, it is preferred that the parent polypeptide is huIFNy, e.g. , with the amino acid sequence shown in SEQ ID NO: 13, or a variant or fragment thereof.
[0118] Examples of variants of hIFNy that can be incorporated in the constructs contemplated herein are described above, and include, but are not limited to, e.g. huIFNy with the N-terminal addition CYC, the cysteine modified variants described in US Patent No: 6,046,034, and the like. Thus, for example, in certain embodiments, the hIFNy that can be incorporated in the constructs contemplated herein comprises cysteine substitutions at on or more of Glu8, Ser70, Alal8, Hisll2, Lys81, Leul21, Gln49, and leu96 (relative to the amino acid sequence of SEQ ID NO: 13). In certain embodiments the interferon gamma differs from the monomer of recombinant human interferon gamma in that at least one pair of amino acids from four predetermined amino acid pairs is exchanged for cysteine. These four amino acid pairs are Glu8 and Ser70, Alal8 and His 112, Lys81 and Leul21, and Gln- 49 and Leu96 (see U.S. Patent No: 6,046,034). [0119] Additionally specific examples of fragments are those described above, and include, but are not limited to huIFNy C-terminally truncated with 1-15 amino acid residues, e.g. with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acid residues, and/or N- terminally truncated with 1-3 amino acid residues. In one illustrative, but non- limiting embodiment, the interferon comprises a truncated interferon consisting of the amino acid sequence:
DPYVKEAENL KKYFNAGHSD VADNGTLFLG ILKNWKEESD RKIMQSQIVS FYFKLFKNFK DDQSIQKSVE TIKEDMNVKF FNSNKKKRDD FEKLTNYSVT DLNVQRKAIH ELIQVMAELS PAAKTGKRKR SQM (SEQ ID NO:14)
[0120] In certain embodiments the use of chemically modified interferon is also contemplated. For example, in certain embodiments, the interferon is chemically modified to increase serum half-life. Thus, for example, (2-sulfo-9-fluorenylmethoxycarbonyl)7- interferon-oc2 undergoes time-dependent spontaneous hydrolysis, generating active interferon {see, e.g., Shechter et al. (2001) Proc. Natl. Acad. Sci., USA, 98(3): 1212-1217). Other modifications, include for example, N-terminal modifications in including, but not limited to the addition of PEG, protecting groups, and the like. U.S. Patent 5,824,784, for example, describing N-terminally chemically modified interferon.
[0121] The foregoing interferons gamma(s) are intended to be illustrative and not limiting. Using the teaching provided herein, other suitable modified interferon gamma can readily be identified and produced.
Antibodies (targeting moiety)
[0122] In various embodiments, the chimeric constructs described herein comprise a full-length antibody or a camelid antibody that specifically or preferentially binds a marker expressed by (e.g., on the surface of) or associated with the target cell(s). While essentially any cell can be targeted, certain preferred cells include those associated with a pathology characterized by hyperproliferation of a cell (/.<?., a hyperproliferative disorder). Illustrative hyperproliferative disorders include, but are not limited to psoriasis, neutrophilia, polycythemia, thrombocytosis, and cancer.
[0123] Hyperproliferative disorders characterized as cancer include but are not limited to solid tumors, including, but not limited to cancers of the breast, respiratory tract, brain, reproductive organs, digestive tract, urinary tract, eye, liver, skin, head and neck, thyroid, parathyroid and their distant metastases. These disorders also include lymphomas, sarcomas, and leukemias. Examples of breast cancer include, but are not limited to invasive ductal carcinoma, invasive lobular carcinoma, ductal carcinoma in situ, and lobular carcinoma in situ. Examples of cancers of the respiratory tract include, but are not limited to small-cell and non-small-cell lung carcinoma, as well as bronchial adenoma and pleuropulmonary blastoma. Examples of brain cancers include, but are not limited to brain stem and hypothalamic glioma, cerebellar and cerebral astrocytoma, medulloblastoma, ependymoma, as well as neuroectodermal and pineal tumor. Tumors of the male reproductive organs include, but are not limited to prostate and testicular cancer. Tumors of the female reproductive organs include, but are not limited to endometrial, cervical, ovarian, vaginal, and vulvar cancer, as well as sarcoma of the uterus. Tumors of the digestive tract include, but are not limited to anal, colon, colorectal, esophageal, gallbladder, gastric, pancreatic, rectal, small-intestine, and salivary gland cancers. Tumors of the urinary tract include, but are not limited to bladder, penile, kidney, renal pelvis, ureter, and urethral cancers. Eye cancers include, but are not limited to intraocular melanoma and
retinoblastoma. Examples of liver cancers include, but are not limited to hepatocellular carcinoma (liver cell carcinomas with or without fibrolamellar variant), cholangiocarcinoma (intrahepatic bile duct carcinoma), and mixed hepatocellular cholangiocarcinoma. Skin cancers include, but are not limited to squamous cell carcinoma, Kaposi's sarcoma, malignant melanoma, Merkel cell skin cancer, and non-melanoma skin cancer. Head-and- neck cancers include, but are not limited to laryngeal/ hypopharyngeal/nasopharyngeal /oropharyngeal cancer, and lip and oral cavity cancer. Lymphomas include, but are not limited to AIDS-related lymphoma, non-Hodgkin's lymphoma, cutaneous T-cell lymphoma, Hodgkin's disease, and lymphoma of the central nervous system. Sarcomas include, but are not limited to sarcoma of the soft tissue, osteosarcoma, malignant fibrous histiocytoma, lymphosarcoma, and rhabdomyosarcoma. Leukemias include, but are not limited to acute myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, chronic myelogenous leukemia, and hairy cell leukemia.
[0124] These disorders have been well characterized in humans, but also exist with a similar etiology in other mammals, and can be treated by administering the chimeric constructs described herein.
[0125] Accordingly, in certain embodiments, the antibody or camelid antibody specifically or preferentially binds a cancer marker (e.g., a tumor associated antigen). A wide variety of cancer markers are known to those of skill in the art. In certain
embodiments, the markers need not be unique to cancer cells, but can also be effective where the expression of the marker is elevated in a cancer cell (as compared to normal healthy cells) or where the marker is not present at comparable levels in surrounding tissues (especially where the chimeric construct is delivered locally).
[0126] Illustrative cancer markers (tumor associated antigen(s) include, for example, chrondroitin sulfate proteoglycan 4 (CSPG4). Chrondroitin sulfate proteoglycan 4 (CSPG4) consisting of a protein core and a chondroitin sulfate side chain is also known as high- molecular weight melanoma associated antigen (HMW-MAA) and melanoma chondroitin sulface proteoglycan (MCSP). It has been studied as a target for the treatment of melanoma. This tumor antigen is highly expressed on greater than 80% of human melanomas and has a restricted distribution in normal tissues. CSPG4 plays an important role in the biology of melanoma cells through its modulation of integrin function and enhanced growth factor receptor-regulated pathways including sustained activation of ERK 1,2. It is also expressed on cancer- initiating cells and a broad range of other tumors including breast cancer including triple negative breast cancer, glioma, squamonous cell carcinoma of head and neck, myeloid leukemic cells, pancreatic carcinoma,
chondrosarcoma, chordoma, mesothelioma, renal cell carcinoma, lung carcinoma, cancer stem cells, and ovarian carcinoma. Expression of CSPG4 is associated with the progression of many different cancers.
[0127] Another illustrative TAA is CD138 which is a marker associated with multiple myeloma (MM) cells, ovarian carcinoma, kidney carcinoma, gall bladder carcinoma, breast carcinoma, prostate cancer, lung cancer, colon carcinoma cells and cells of Hodgkin's and non-Hodgkin's lymphomas, chronic lymphocytic leukemia (CLL), acute lymphoblastic leukemia (ALL), acute myeloblastic leukemia (AML), solid tissue sarcomas, colon carcinomas as well as other hematologic malignancies and solid tumors that express CD138. Other cancers that have been shown to be positive for CD138 expression are many ovarian adenocarcinomas, transitional cell bladder carcinomas, kidney clear cell carcinomas, squamous cell lung carcinomas; breast carcinomas and uterine cancers.
[0128] Alpha-fetoprotein (ALP) is a marker for, inter alia, liver cancer and germ cell tumors, beta-2-microglobulin (B2M) is a marker for, inter alia, Multiple myeloma, chronic lymphocytic leukemia, and some lymphomas, beta-human chorionic gonadotropin (Beta-hCG) is a marker for, inter alia, choriocarcinoma and germ cell tumors, BRCA1 and BRCA2 gene mutations, are markers for, inter alia, ovarian cancer, c-kit/CD117 is a marker for, inter alia, gastrointestinal stromal tumor and mucosal melanoma, CA15-3/CA27.29 is a marker for, inter alia, breast cancer, CA19-9 is a marker for, inter alia, pancreatic cancer, gallbladder cancer, bile duct cancer, and gastric cancer, CA-125 is a marker for, inter alia, ovarian cancer, carcinoembryonic antigen (CEA) is a marker for, inter alia, colorectal cancer and some other cancers, CD20 is a marker for, inter alia, non-Hodgkin's lymphoma, chromogranin A (CgA) is a marker for, inter alia, neuroendocrine tumors, HE4 is a marker for, inter alia, ovarian cancer, HER2/neu is a marker for, inter alia, breast cancer, gastric cancer, and gastroesophageal junction adenocarcinoma, neuron-specific enolase (NSE) is a marker for, inter alia, small cell lung cancer and neuroblastoma, prostate-specific antigen (PSA) is a marker for, inter alia, prostate cancer, urokinase plasminogen activator (uPA) and plasminogen activator inhibitor (PAI-1) is a marker for, inter alia, breast cancer, and the like.
[0129] Additionally, the tumor marker recognized by the ND4 monoclonal antibody.
This marker is found on poorly differentiated colorectal cancer, as well as gastrointestinal neuroendocrine tumors (see, e.g., Tobi el al. (1998) Cancer Detection and Prevention,
22(2): 147-152). Other important targets for cancer immunotherapy are membrane bound complement regulatory glycoprotein: CD46, CD55 and CD59, which have been found to be expressed on most tumor cells in vivo and in vitro. Human mucins (e.g. MUC1) are known tumor markers as are gplOO, tyrosinase, and MAGE, which are found in melanoma. Wild- type Wilms' tumor gene WT1 is expressed at high levels not only in most of acute myelocytic, acute lymphocytic, and chronic myelocytic leukemia, but also in various types of solid tumors including lung cancer.
[0130] Acute lymphocytic leukemia has been characterized by the TAAs HLA-Dr,
CD1, CD2, CD5, CD7, CD19, and CD20. Acute myelogenous leukemia has been characterized by the TAAs HLA-Dr, CD7, CD13, CD14, CD15, CD33, and CD34. Breast cancer has been characterized by the markers EGFR, HER2, MUC1, Tag-72. Various carcinomas have been characterized by the markers MUC1, TAG-72, and CEA. Chronic lymphocytic leukemia has been characterized by the markers CD3, CD 19, CD20, CD21, CD25, and HLA-DR. Hairy cell leukemia has been characterized by the markers CD 19, CD20, CD21, CD25. Hodgkin's disease has been characterized by the Leu-Ml marker. Various melanomas have been characterized by the HMB 45 marker. Non-hodgkins lymphomas have been characterized by the CD20, CD 19, and la marker, and various prostate cancers have been characterized by the PSMA and SE10 markers.
[0131] In addition, many kinds of tumor cells display unusual antigens that are either inappropriate for the cell type and/or its environment, or are only normally present during the organisms' development (e.g. fetal antigens). Examples of such antigens include the glycosphingolipid GD2, a disialoganglioside that is normally only expressed at a significant level on the outer surface membranes of neuronal cells, where its exposure to the immune system is limited by the blood-brain barrier. GD2 is expressed on the surfaces of a wide range of tumor cells including neuroblastoma, medulloblastomas, astrocytomas, melanomas, small-cell lung cancer, osteosarcomas and other soft tissue sarcomas. GD2 is thus a convenient tumor- specific target for immunotherapies.
[0132] Other kinds of tumor cells display cell surface receptors that are rare or absent on the surfaces of healthy cells, and which are responsible for activating cellular signaling pathways that cause the unregulated growth and division of the tumor cell.
Examples include (ErbB2). HER2/n<?w, a constitutively active cell surface receptor that is produced at abnormally high levels on the surface of breast cancer tumor cells.
[0133] Other useful targets include, but are not limited to CD20, CD52, CD33, epidermal growth factor receptor and the like.
[0134] An illustrative, but not limiting list of suitable tumor markers is provided in
Table 2.
[0135] Table 2. Illustrative cancer markers and associated references, all of which are incorporated herein by reference for the purpose of identifying the referenced tumor markers.
Figure imgf000025_0001
Figure imgf000026_0001
Figure imgf000027_0001
Figure imgf000028_0001
Figure imgf000029_0001
Figure imgf000030_0001
[0136] Antibodies directed against (that preferentially or specifically bind) any of the foregoing markers can be used in the chimeric interferon gamma constructs described herein. In certain embodiments the target markers include, but are not limited to CD138, CSPG4, members of the epidermal growth factor family (e.g., HER2, HER3, EGF, HER4), CD1, CD2, CD3, CD5, CD7, CD13, CD14, CD15, CD19, CD20, CD21, CD23, CD25, CD33, CD34, CD38, 5E10, CEA, HLA-DR, HM 1.24, HMB 45, la, Leu-Ml, MUC1, PMSA, TAG-72, phosphatidyl serine antigen, and the like.
[0137] Antibodies that specifically or preferentially bind tumor markers are well known to those of skill in the art and may are commercially available or the amino acid sequences thereof are well known and can readily be used to fabricate the antibody using methods well known to those of skill in the art.
[0138] Antibodies that bind to CSPG4 include, but are not limited to VF1-TP34,
VF1-TP34, VF1-TP41.2, TP61.5, 9.2.27, 149.53, 149.53, 225.28, 225.28s, 763.74, and scFv-FcC21 (see, e.g., PCT Pub No: WO 2014/194100 (PCT/US2014/040036).
[0139] Antibodies that specifically or preferentially bind CD138 are well known to those of skill in the art and many are commercially available. For example Wijdenes et al. (1996) British J. Haematol. 94, 318-323 describe an antibody that is specific for CD138 (syndecan-1) and this antibody is commercially available from Abeam, Miltenyi Biotec, and the like. Other illustrative and non-limiting anti-CD 138 antibodies include, but are not limited to the polyclonal rabbit anti-human CD138 antibody LS-B3341 and the monoclonal mouse anti-Human CD138 Antibody LS-B4051 available from LifeSpan Biosciences, Inc., monoclonal antibody (MI15) available from Pierce Antibodies, Biotest BT-062 anti-CD138, and the like. Other anti-CD138 antibodies include, but are not limited to B-B2, 1D4, nBT062, B-B4, BC/B-B4, B-B2, DL-101, 1 D4, MI15, 1.BB.210, 2Q1484, 5F7, 104-9, and 281-2 (see, e.g., Gattei et al. (1999) British J. Haematol., 104(1): 152-162, and U.S. Patent Pub No: 2009/0175863).
[0140] Antibodies to CD33 include for example, HuM195 (see, e.g., Kossman et al.
(1999) Clin. Cancer Res. 5: 2748-2755), CMA-676 (see, e.g., Sievers el al., (1999) Blood 93: 3678-3684).
[0141] Antibodies to CD38 include for example, AT13/5 (see, e.g., Ellis et al.
(1995) J. Immunol. 155: 925-937), HB7, and the like.
[0142] Antibodies been developed against Her-2/neu, include, but are not limited to trastuzumab (e.g., HERCEPTIN®.; Former et al. (1999) Oncology (Huntingt) 13: 647-58), TAB-250 (Rosenblum et al. (1999) Clin. Cancer Res. 5: 865-874), BACH-250 (Id.), TA1 (Maier et al. (1991) Cancer Res. 51: 5361-5369), and the mAbs described in U.S. Pat. Nos. 5,772,997; 5,770,195 (mAb 4D5; ATCC CRL 10463); and U.S. Pat. No. 5,677,171.
[0143] Other fully human anti-HER2/n<?w antibodies are well known to those of skill in the art. Such antibodies include, but are not limited to the C6 antibodies such as C6.5, DPL5, G98A, C6MH3-B1, B1D2, C6VLB, C6VLD, C6VLE, C6VLF, C6MH3-D7, C6MH3-D6, C6MH3-D5, C6MH3-D3, C6MH3-D2, C6MH3-D1, C6MH3-C4, C6MH3-C3, C6MH3-B9, C6MH3-B5, C6MH3-B48, C6MH3-B47, C6MH3-B46, C6MH3-B43, C6MH3-B41, C6MH3-B39, C6MH3-B34, C6MH3-B33, C6MH3-B31, C6MH3-B27, C6MH3-B25, C6MH3-B21, C6MH3-B20, C6MH3-B2, C6MH3-B16, C6MH3-B15, C6MH3-B11, C6MH3-B1, C6MH3-A3, C6MH3-A2, and C6ML3-9. These and other anti- HER2/ft<?w antibodies are described in U.S. Patents 6,512,097 and 5,977,322, in PCT Publication WO 97/00271, in Schier et al. (1996) J Mol Biol 255: 28-43, Schier et al.
(1996) JMol Biol 263: 551-567, and the like.
[0144] Illustrative anti-MUC-1 antibodies include, but are not limited to Mc5 (see, e.g., Peterson et al. (1997) Cancer Res. 57: 1103-1108; Ozzello et al. (1993) Breast Cancer Res. Treat. 25: 265-276), and hCTMOl (see, e.g., Van Hof et al. (1996) Cancer Res. 56: 5179-5185).
[0145] Illustrative anti-TAG-72 antibodies include, but are not limited to CC49 (see, e.g., Pavlinkova et al. (1999) Clin. Cancer Res. 5: 2613-2619), B72.3 (see, e.g., Divgi et al. (1994) Nucl. Med. Biol. 21: 9-15), and those disclosed in U.S. Patent No: 5,976,531.
[0146] Illustrative anti-HM1.24 antibodies include, but are not limited to a mouse monoclonal anti-HM1.24 IgG2a/K and a humanized anti-HM1.24 IgGi/k antibody (see, e.g., Ono et al. (1999) Mol. Immunol. 36: 387-395).
[0147] Antibodies directed to various members of the epidermal growth factor receptor family include, but are not limited to anti-EGF-R antibodies as described in U.S. Patent Nos: 5,844,093 and 5,558,864, and in European Patent No. 706, 799 A). Other illustrative anti-EGFR family antibodies include, but are not limited to antibodies such as C6.5, C6ML3-9, C6MH3-B1, C6-B1D2, F5, HER3.A5, HER3.F4, HER3.H1, HER3.H3, HER3.E12, HER3.B12, EGFR.E12, EGFR.C10, EGFR.B11, EGFR.E8, HER4.B4, HER4.G4, HER4.F4, HER4.A8, HER4.B6, HER4.D4, HER4.D7, HER4.D11, HER4.D12, HER4.E3, HER4.E7, HER4.F8 and HER4.C7 and the like (see, e.g., U.S. Patent publications US 2006/0099205 Al and US 2004/0071696 Al which are incorporated herein by reference).
[0148] As described in U.S. Patents 6,512,097 and 5,977,322 other anti-EGFR family member antibodies can readily be produced by shuffling light and/or heavy chains followed by one or more rounds of affinity selection. Thus in certain embodiments, this invention contemplates the use of one, two, or three CDRs in the VL and/or VH region that are CDRs described in the above-identified antibodies and/or the above identified publications.
[0149] Anti-CD20 antibodies are well known to those of skill and include, but are not limited to rituximab, Ibritumomab tiuxetan, and tositumomab, AME-133v (Applied Molecular Evolution), Ocrelizumab (Roche), Ofatumumab (Genmab), TRU-015 (Trubion) and IMMU-106 (Immunomedics).
[0150] In certain embodiments the antibody is an anti-CD138 which comprises a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 15:
MGWS YIILFL V AT ATG VHS Q V QLQQS GS ELMMPG AS VKISCKATG YTFS NY WIEWVKQRPGHGLEWIGEILPGTGRTIYNEKFKGKATFTADISSNTVQMQLS SLTS EDS A VY Y C ARRD Y Y GNFY Y AMD YW GQGTS VT V S S (SEQ ID NO: 15) and the light chain having an amino acid sequence as set forth in SEQ ID NO: 16:
MKSQTQVFIFLLLCVSGAHGDIQMTQSTSSLSASLGDRVTISCSASQGINNYL NWY QQKPDGT VELLI Y YTS TLQS G VPS RFS GS GS GTD Y SLTIS NLEPEDIGTY Y CQQ Y S KLPRTFGGGTKLEIK (SEQ ID NO: 16).
Construction of such an antibody is described in U.S. Patent No: 9,803,021, and in PCT Publication No: WO 2014/089354 (PCT/US2013/073410), which are incorporated herein by reference for the antibodies described therein.
[0151] In certain embodiments the antibody is an anti-Her2/neu antibody which comprises the heavy chain having an amino acid sequence as set forth in SEQ ID NO: 17:
MECS WVMLFLLS VT AGVHS EV QL VES GGGL V QPGGS LRLSC A AS GFNIKD TYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYL QMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFP L APS S KSTS GGT A ALGCL VKD YFPEPVT V S WN S G ALTS G VHTFPA VLQS S G LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDG VE VHN AKTKPREEQ YNST YRV V S VLT VLHQD WLN GKE YKCKV S NKA L PAPIEKTIS KAKGQPREPQ V YTLPPS RDELTKN QV S LTCLVKGFYPS DIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK (SEQ ID NO: 17)
where amino acid residues 1-19 represent a signal peptide; and the light chain having an amino acid sequence as set forth in SEQ ID NO: 18:
MEW S C VMLFLLS VT AGVHS DIQMTQS PS SLS AS VGDR VTITCRAS QD VNT
AVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPE
DFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFEPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL S KAD YEKHKV Y ACE VTHQGLS S PVTKS FNRGEC (SEQ ID NO: 18) where amino acid residues 1-19 represent a signal peptide.
[0152] In certain embodiments, the antibody is an anti-CD20 antibody which comprises the heavy chain having an amino acid sequence as set forth in SEQ ID NO: 19:
MYLGLNCVIIVFLLKGVQSQVQLQQPGAELVKPGASVKMSCKASGYTFTS YNMHWVKQTPGRGLEWIG AIYPGN GDTS YN QKFKGKATLT ADKS S ST A YM QLS SLTS EDS A VY Y CARS TY Y GGD WYFN V W G AGTT VT VS A AS TKGPS VFP LAPS S KS TS GGT A ALGCL VKD YFPEPVT V S WN S G ALTS G VHTFPA VLQS S GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK A LPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHE ALHNH YTQKS LS LS PGK (SEQ ID NO: 19)
where amino acid residues 1-19 represent a signal peptide; and the light chain having an amino acid sequence as set forth in SEQ ID NO:20:
MKLPVRLLVLMFWIPAS S S QIVLS QS PAILS AS PGEKVTMTCR AS S S VS Y IHWFQQKPGS SPKPWI Y ATS NL AS G VP VRFS GSGSGTSYS LTISR VE AED AATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS KAD YEKHKVY ACEVTHQGLS SPVTKS FNRGEC (SEQ ID NO:20)
wherein amino acid residues 1-19 represent a signal peptide.
[0153] In certain embodiments the antibody is an anti-endoplasmin antibody which comprises the heavy chain having an amino acid sequence as set forth in SEQ ID NO:21 :
MYLGLNCVIIVFLLKGVQS QVQLV QSG AEVKKPGAS VKVSCKAS GYTFTS Y AMHWVRQ APGQRLEWMGWINAGN GNTK Y S QKFQGR VTITRDTS AST AY M ELS SLRSEDTA V Y Y C AR AHFD YW GQGTL VTV S A AS TKGPS VFPL APS S KS TS GGT A ALGCL VKD YFPEP VTVS WN S G ALTS G VHTFPA VLQS S GL Y SLS S VVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENN YKTTPPVLDS DGS FFLY S KLT VDKS RW QQGN VFSCS VMHE ALHN HYTQKSLSLSPGK (SEQ ID NO:21)
where amino acid residues 1-19 represent a signal peptide; and the light chain having an amino acid sequence as set forth in SEQ ID NO:22:
ME APAQLLFLLLLWLPDTTGEIELTQS PS S LS AS V GDR VTITCR AS QSIS S YLNW Y QQKPGKAPKLLIY A AS SLQS G VPSRFS GS GS GTDFTLTIS S LQP EDFATYYCQQSYSTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTA SVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LS KAD YEKHKV Y ACE VTHQGLS SP VTKS FNRGEC (SEQ ID NO:22) where amino acid residues 1-20 represent a signal peptide.
[0154] In certain embodiments the antibody is an anti-CD33 antibody which comprises the heavy chain having an amino acid sequence as set forth in SEQ ID NO:23:
MEWS WVFLFFLS VTTGVHSQVQLVQS GAEVKKPGS S VKVSCKAS GYTITD
SNIHWVRQAPGQSLEWIGYIYPYNGGTDYNQKFKNRATLTVDNPTNTAYM
ELS S LRSEDT AFY Y C VN GNPWL A YW GQGTL VT V S S ASTKGPS VFPL APS S
KSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP
ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV
E VHN AKTKPREEQ YN S TYR V VS VLTVLHQD WLN GKE YKCKV S NK ALP API
EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
HNHYTQKSLSLSPGK (SEQ ID NO:23)
where amino acid residues 1-19 represent a signal peptide; and the light chain having an amino acid sequence as set forth in SEQ ID NO: 24:
MSVPTQVLGLLLLWLTDARCDIQLTQSPSTLSASVGDRVTITCRASESLD NY GIRFLTWFQQKPGKAPKLLM Y A AS N QGS G VPS RFS GS GS GTEFTLTIS SLQPDDFAT Y YCQQTKE VPW S FGQGTKVE VKRTV A APS VFIFPPS DEQLK S GT AS V V CLLNNFYPREAKV QWKVDN ALQS GN S QES VTEQDS KDS T Y S LS STLTLS KAD YEKHKV Y ACE VTHQGLS SP VTKS FNRGEC (SEQ ID NO:24) where amino acid residues 1-20 represent a signal peptide. [0155] In certain embodiments the antibody is an anti-CD276 antibody that comprises a heavy chain variable region having an amino acid sequence as set forth in SEQ ID NO:25:
MNFGFRLIFLALILKGV QCEV QLVES GGGLVKPGGSLKLSCEASRFTFSS YAMSWVRQTPEKRLEWVAAISGGGRYTYYPDSMKGRFTISRDNAKNFLYL QMSSLRSEDTAMYYCARHYDGYLDYWGQGTTLTVSSAKTTAPSVYPLAPG SL (SEQ ID NO:25)
where amino acid residues 1-19 represent a signal peptide; and the light chain having an amino acid sequence as set forth in SEQ ID NO: 26:
MKSQSQVFVFVFLWLSGVDGDIVMTQFAGVDGDIVMTQSHKFMSTSVGDR VSITCKAS QD VS TTV AWY QQKPGQSPKLLIY S AS YRYTG VPDRFTGS GS G TDFTFTIS S VQAEDL A VYY CQQHY STPPTFGGGTKLEIKRAD AAPTVSIF PPSSKLG (SEQ ID NO:26)
wherein amino acid residues 1-20 represent a signal peptide.
[0156] In various embodiments the full-length antibodies (immunoglobulins) used in the chimeric constructs described herein include, but are not limited to an IgA, IgD, IgE, IgG or IgM antibody. In certain embodiments the antibody can comprise kappa (K) light chains or lambda (l) light chains. In various embodiments, the IgG antibody can be an IgGl, IgG2, IgG3 or IgG4 antibody. In certain embodiments the antibody binds to a(n) antigen target that is expressed in or on the cell membrane (e.g., on the cell surface) of a tumor cell. In certain embodiments the antibody is an IgG antibody, e.g., an IgGl antibody, more particularly, an IgGl antibody having kappa light chains.
[0157] In certain embodiments the antibodies described herein (full-length immunoglobulins) can comprise a human antibody, a humanized antibody, or a chimeric antibody. In certain embodiments the antibody can be a non-human antibody (e.g., a murine antibody).
[0158] Humanized antibodies are antibodies that contain sequences derived from a human-antibody and from a non-human antibody. Suitable methods for humanizing antibodies include CDR-grafting (complementarity determining region grafting) (EP 0 239 400; WO 91/09967; U.S. Pat. Nos. 5,530,101; and 5,585,089), veneering or resurfacing (EP 0 592 106; EP 0 519 596; Padlan (1991) Mol. Immunol., 28: 489-498.; Studnicka et al. (1994) Protein Eng., 7(6: 805-814; Roguska et al. (1994) Proc. Natl. Acad. Sci. USA, 91: 969-973; and the like), chain shuffling (U.S. Pat. No. 5,565,332) and Delmmunosation™ (Biovation, LTD). In CDR-grafting, the mouse (or other non-human species)
complementarity-determining regions (CDRs) from, for example, mAh B-B4 are grafted into human variable frameworks, which are then joined to human constant regions, to create a human B-B4 antibody (hB-B4). Several antibodies humanized by CDR-grafting are now in clinical use, including MYLOTARG (Sievers et al. (2001) J. Clin. Oncol. 19: 3244-3254) and HECEPTIN (Pegram et al. (1998) J. Clin. Oncol., 16: 2659-2671).
[0159] The resurfacing technology uses a combination of molecular modeling, statistical analysis and mutagenesis to alter the non-CDR surfaces of antibody variable regions to resemble the surfaces of known antibodies of the target host. Strategies and methods for the resurfacing of antibodies, and other methods for reducing immunogenicity of antibodies within a different host, are disclosed, for example, in U.S. Pat. No. 5,639,641. Human antibodies can be made by a variety of methods known in the art including phage display methods. See also U.S. Pat. Nos. 4,444,887, 4,716,111, 5,545,806, and 5,814,318; and international patent application publications WO 98/46645, WO 98/50433, WO 98/24893, WO 98/16654, WO 96/34096, WO 96/33735, and WO 91/10741.
[0160] Antibodies that have undergone any non-natural modification such as chimeric human/mouse antibodies or a chimeric human/monkey antibodies, humanized antibodies or antibodies that were engineered to, for example, improve their affinity to the target cells or diminish their immunogenicity are also contemplated.
[0161] Chimerized antibodies, maintain the antibody binding region of the non human antibody, e.g., the murine antibody they are based on, while any constant regions may be provided for by, e.g., a human antibody. Generally, chimerization and/or the exchange of constant regions of an antibody will not affect the affinity of an antibody because the regions of the antibody that contribute to antigen binding are not affected by this exchange. In a preferred embodiment, the engineered, in particular chimerized, antibody may have a higher binding affinity (as expressed by KD values) than the respective non-human antibody it is based on. For example, the anti-CD 138 antibody nBT062 antibody and antibodies based thereon may have higher antibody affinity than the murine B- B4 on which they are based.
[0162] In various embodiments fully human antibodies may also be used. Those antibodies can be selected by the phage display approach, where desired TAA (e.g., CD138, CSPG4, etc.) is used to selectively bind phage expressing, for example, B-B4 variable regions. This approach can be advantageously coupled with an affinity maturation technique to improve the affinity of the antibody.
[0163] In various embodiments camelid antibodies are also contemplated. Camelid and shark antibodies comprise a homodimeric pair of two chains of V-like and C-like domains (neither has a light chain). Since the VH region of a heavy chain dimer IgG in a camelid does not have to make hydrophobic interactions with a light chain, the region in the heavy chain that normally contacts a light chain is changed to hydrophilic amino acid residues in a camelid. VH domains of heavy-chain dimer IgGs are called VHH domains. Shark Ig-NARs comprise a homodimer of one variable domain (termed a V-NAR domain) and five C-like constant domains (C-NAR domains).
[0164] In camelids, the diversity of antibody repertoire is determined by the complementary determining regions (CDR) 1, 2, and 3 in the VH or VHH regions. The CDR3 in the camel VHH region is characterized by its relatively long length averaging 16 amino acids (see, e.g. , Muyldermans et al. (1994) Prog. Engin. 7(9): 1129). This is in contrast to CDR3 regions of antibodies of many other species. For example, the CDR3 of mouse VH has an average of 9 amino acids. Libraries of camelid-derived antibody variable regions, that maintain the in vivo diversity of the variable regions of a camelid, can be made by, for example, the methods disclosed in U.S. Patent Pub. No. 2005/0037421
[0165] In certain embodiments, the antibody or camelid antibody has an affinity
(KD) for the tumor associated antigen (TAA) (e.g., CSPG4, CD138, Her2/neu, etc. , of at least 1 x 10 6 M, or at least 1 x 107 M, or at least 1 x 10 8 M, or at least 1 x 10 9 M, or at least 1 x 10 10 M, or at least 1 x 10 11 M.
[0166] The foregoing antibodies for use in the chimeric constructs described herein are illustrative and non-limiting. Using the teachings provided herein, numerous other antibodies will be available to one of skill in the art.
Treatment of cancers using chimeric constructs..
[0167] In certain embodiments the chimeric constructs (targeted interferon gamma constructs) described herein can be used for the treatment or prophylaxis of cancer.
[0168] Illustrative cancers include any cancer or cancer cell that is responsive to treatment with interferon gamma. Additionally, interferon gamma helps turn on the immune response and can be useful even if the cancer is not directly responsive because the host anti-tumor response if turned on (e.g., upregulated). Illustrative cancers include, but are not limited to g of breast cancer, lung cancer, melanoma, pancreas cancer, liver cancer, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, AIDS-related cancers (e.g. , Kaposi sarcoma, lymphoma), anal cancer, appendix cancer, astrocytomas, atypical teratoid/rhabdoid tumor, bile duct cancer, extrahepatic cancer, bladder cancer, bone cancer (e.g. , Ewing sarcoma, osteosarcoma, malignant fibrous histiocytoma), brain stem glioma, brain tumors (e.g. , astrocytomas, brain and spinal cord tumors, brain stem glioma, central nervous system atypical teratoid/rhabdoid tumor, central nervous system embryonal tumors, central nervous system germ cell tumors,
craniopharyngioma, ependymoma, burkitt lymphoma, carcinoid tumors (e.g., childhood, gastrointestinal), cardiac tumors, cervical cancer, chordoma, chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), chronic myeloproliferative disorders, colon cancer, colorectal cancer, craniopharyngioma, cutaneous t-cell lymphoma, duct cancers e.g. (bile, extrahepatic), ductal carcinoma in situ (DCIS), embryonal tumors, endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma (olofactory neuroblastoma), extracranial germ cell tumor, extragonadal germ cell tumor, extrahepatic bile duct cancer, eye cancer (e.g. , intraocular melanoma, retinoblastoma), fibrous histiocytoma of bone, malignant, and osteosarcoma, gallbladder cancer, gastric (stomach) cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumors (GIST), germ cell tumors (e.g., ovarian cancer, testicular cancer, extracranial cancers, extragonadal cancers, central nervous system), gestational trophoblastic tumor, brain stem cancer, hairy cell leukemia, head and neck cancer, heart cancer, hepatocellular (liver) cancer, histiocytosis, langerhans cell cancer, Hodgkin lymphoma, hypopharyngeal cancer, intraocular melanoma, islet cell tumors, pancreatic neuroendocrine tumors, kaposi sarcoma, kidney cancer (e.g., renal cell, Wilm's tumor, and other kidney tumors), langerhans cell histiocytosis, laryngeal cancer, leukemia, acute lymphoblastic (ALL), acute myeloid (AML), chronic lymphocytic (CLL), chronic myelogenous (CML), hairy cell, lip and oral cavity cancer, liver cancer (primary), lobular carcinoma in situ (LCIS), lung cancer (e.g., childhood, non-small cell, small cell), lymphoma (e.g., AIDS-related, Burkitt (e.g. , non-Hodgkin lymphoma), cutaneous T-Cell (e.g., mycosis fungoides, Sezary syndrome), Hodgkin, non-Hodgkin, primary central nervous system (CNS)), macroglobulinemia, Waldenstrom, male breast cancer, malignant fibrous histiocytoma of bone and osteosarcoma, melanoma (e.g. , childhood, intraocular (eye)), merkel cell carcinoma, mesothelioma, metastatic squamous neck cancer, midline tract carcinoma, mouth cancer, multiple endocrine neoplasia syndromes, multiple myeloma/plasma cell neoplasm, mycosis fungoides, myelodysplastic syndromes, Myelogenous Leukemia, Chronic (CML), multiple myeloma, nasal cavity and paranasal sinus cancer, nasopharyngeal cancer, neuroblastoma, oral cavity cancer, lip and
oropharyngeal cancer, osteosarcoma, ovarian cancer , pancreatic cancer, pancreatic neuroendocrine tumors (islet cell tumors), papillomatosis, paraganglioma, paranasal sinus and nasal cavity cancer, parathyroid cancer, penile cancer, pharyngeal cancer,
pheochromocytoma, pituitary tumor, plasma cell neoplasm, pleuropulmonary blastoma, primary central nervous system (CNS) lymphoma, prostate cancer, rectal cancer, renal cell (kidney) cancer, renal pelvis and ureter, transitional cell cancer, rhabdomyosarcoma, salivary gland cancer, sarcoma (e.g., Ewing, Kaposi, osteosarcoma, rhadomyosarcoma, soft tissue, uterine), Sezary syndrome, skin cancer (e.g., melanoma, merkel cell carcinoma, basal cell carcinoma, nonmelanoma), small intestine cancer, squamous cell carcinoma, squamous neck cancer with occult primary, stomach (gastric) cancer, testicular cancer, throat cancer, thymoma and thymic carcinoma, thyroid cancer, trophoblastic tumor, ureter and renal pelvis cancer, urethral cancer, uterine cancer, endometrial cancer, uterine sarcoma, vaginal cancer, vulvar cancer, Waldenstrom macroglobulinemia, and Wilm's tumor.
Pharmaceutical formulations.
[0169] The chimeric constructs described herein are useful for parenteral, topical, oral, or local administration (e.g. injected into a tumor site), aerosol administration, or transdermal administration, for prophylactic, but principally for therapeutic treatment. The pharmaceutical compositions can be administered in a variety of unit dosage forms depending upon the method of administration· For example, unit dosage forms suitable for oral administration include powder, tablets, pills, capsules and lozenges. It is recognized that the antibodies described herein and/or immunoconjugates thereof and pharmaceutical compositions comprising antibodies described herein and/or immunoconjugates thereof, when administered orally, are preferably protected from digestion. This can be
accomplished by a number of means known to those of skill in the art, e.g., by complexing the protein with a composition to render it resistant to acidic and enzymatic hydrolysis or by packaging the protein in an appropriately resistant carrier such as a liposome. Means of protecting proteins from digestion are well known in the art.
[0170] In various embodiments a composition, e.g., a pharmaceutical composition, containing one or more chimeric constructs described herein, formulated together with a pharmaceutically acceptable carrier are provided. [0171] As used herein, "pharmaceutically acceptable carrier" includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Preferably, the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion). Depending on the route of administration, the active compound, /.<?. , antibody, immunoconjugate, may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
[0172] In certain embodiments one or more chimeric constructs described herein can be administered in the "native" form or, if desired, in the form of salts, esters, amides, prodrugs, derivatives, and the like, provided the salt, ester, amide, prodrug or derivative is suitable pharmacologically, i.e., effective in the present method(s). Salts, esters, amides, prodrugs and other derivatives of the active agents can be prepared using standard procedures known to those skilled in the art of synthetic organic chemistry and described, for example, by March (1992) Advanced Organic Chemistry; Reactions, Mechanisms and Structure, 4th Ed. N.Y. Wiley-Interscience, and as described above.
[0173] By way of illustration, a pharmaceutically acceptable salt can be prepared for chimeric constructs described herein having a functionality capable of forming a salt. A pharmaceutically acceptable salt is any salt that retains the activity of the parent compound and does not impart any deleterious or untoward effect on the subject to which it is administered and in the context in which it is administered.
[0174] In various embodiments pharmaceutically acceptable salts may be derived from organic or inorganic bases. The salt may be a mono or polyvalent ion. Of particular interest are the inorganic ions, lithium, sodium, potassium, calcium, and magnesium.
Organic salts may be made with amines, particularly ammonium salts such as mono-, di- and trialkyl amines or ethanol amines. Salts may also be formed with caffeine, tromethamine and similar molecules.
[0175] Methods of formulating pharmaceutically active agents as salts, esters, amide, prodrugs, and the like are well known to those of skill in the art. For example, salts can be prepared from the free base using conventional methodology that typically involves reaction with a suitable acid. Generally, the base form of the drug is dissolved in a polar organic solvent such as methanol or ethanol and the acid is added thereto. The resulting salt either precipitates or can be brought out of solution by addition of a less polar solvent. Suitable acids for preparing acid addition salts include, but are not limited to both organic acids, e.g., acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malic acid, malonic acid, succinic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid, and the like, as well as inorganic acids, e.g., hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like. An acid addition salt can be reconverted to the free base by treatment with a suitable base. Certain particularly preferred acid addition salts of the active agents herein include halide salts, such as may be prepared using hydrochloric or hydrobromic acids. Conversely, preparation of basic salts of one or more chimeric constructs described herein are prepared in a similar manner using a pharmaceutically acceptable base such as sodium hydroxide, potassium hydroxide, ammonium hydroxide, calcium hydroxide, trimethylamine, or the like.
Particularly preferred basic salts include alkali metal salts, e.g., the sodium salt, and copper salts.
[0176] For the preparation of salt forms of basic drugs, the pKa of the counterion is preferably at least about 2 pH units lower than the pKa of the drug. Similarly, for the preparation of salt forms of acidic drugs, the pKa of the counterion is preferably at least about 2 pH units higher than the pKa of the drug. This permits the counterion to bring the solution's pH to a level lower than the pHmax to reach the salt plateau, at which the solubility of salt prevails over the solubility of free acid or base. The generalized rule of difference in pKa units of the ionizable group in the active pharmaceutical ingredient (API) and in the acid or base is meant to make the proton transfer energetically favorable. When the pKa of the API and counterion are not significantly different, a solid complex may form but may rapidly disproportionate (/.<?., break down into the individual entities of drug and counterion) in an aqueous environment.
[0177] Preferably, the counterion is a pharmaceutically acceptable counterion.
Suitable anionic salt forms include, but are not limited to acetate, benzoate, benzylate, bitartrate, bromide, carbonate, chloride, citrate, edetate, edisylate, estolate, fumarate, gluceptate, gluconate, hydrobromide, hydrochloride, iodide, lactate, lactobionate, malate, maleate, mandelate, mesylate, methyl bromide, methyl sulfate, mucate, napsylate, nitrate, pamoate (embonate), phosphate and diphosphate, salicylate and disalicylate, stearate, succinate, sulfate, tartrate, tosylate, triethiodide, valerate, and the like, while suitable cationic salt forms include, but are not limited to aluminum, benzathine, calcium, ethylene diamine, lysine, magnesium, meglumine, potassium, procaine, sodium, tromethamine, zinc, and the like.
[0178] Preparation of esters typically involves functionalization of hydroxyl and/or carboxyl groups that are present within the molecular structure of the chimeric constructs described herein. In certain embodiments, the esters are typically acyl-substituted derivatives of free alcohol groups, /.<?. , moieties that are derived from carboxylic acids of the formula RCOOH where R is alky, and preferably is lower alkyl. Esters can be reconverted to the free acids, if desired, by using conventional hydrogenolysis or hydrolysis procedures.
[0179] Amides can also be prepared using techniques known to those skilled in the art or described in the pertinent literature. For example, amides may be prepared from esters, using suitable amine reactants, or they may be prepared from an anhydride or an acid chloride by reaction with ammonia or a lower alkyl amine.
[0180] Pharmaceutical compositions comprising one or more chimeric constructs described herein can be administered alone or in combination therapy, /.<?., combined with other agents. For example, the combination therapy can include one or more chimeric constructs described herein and at least one or more additional therapeutic agents. The pharmaceutical compositions can also be administered in conjunction with radiation therapy and/or surgery.
[0181] A composition comprising one or more chimeric constructs described herein can be administered by a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. The chimeric constructs described herein can be prepared with carriers that will protect the chimeric constructs against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art (see, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978).
[0182] In certain embodiments administration of one or more chimeric constructs described herein may be facilitated by coating the construct(s) or co-administering the constructs with a material to prevent its inactivation. For example, the construct(s) may be administered to a subject in an appropriate carrier, for example, liposomes, or a diluent. Pharmaceutically acceptable diluents include, but are not limited to, saline and aqueous buffer solutions. Liposomes include, but are not limited to, water-in-oil-in-water CGF emulsions as well as conventional liposomes (Strejan et al. (1984) J. Neuroimmunol, 7: 27).
[0183] Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of is contemplated. Supplementary active compounds can also be incorporated into the compositions.
[0184] In various embodiments the one or more chimeric constructs described herein are typically sterile and stable under the conditions of manufacture and storage. The composition(s) can be formulated as a solution, a microemulsion, in a lipid or liposome, or other ordered structure suitable to contain high drug concentration(s). In certain embodiments the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
[0185] Sterile injectable solutions can be prepared by incorporating the construct(s) described herein in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration· Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, illustrative methods of preparation include vacuum drying, and freeze drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. [0186] Dosage regimens are adjusted to provide the optimum desired response (e.g. , a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. For example, in certain embodiments, the one or more chimeric constructs described herein may be administered once or twice daily, or once or twice weekly, or once or twice monthly by subcutaneous injection.
[0187] It is especially advantageous to formulate parenteral compositions in unit dosage form for ease of administration and uniformity of dosage. Unit dosage form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated. Each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specifications for the unit dosage forms are dictated by and directly dependent on (a) the unique characteristics of the construct(s) and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such construct(s) for the treatment of individuals.
[0188] In certain embodiments the formulation comprises a pharmaceutically acceptable anti-oxidant. Examples of pharmaceutically-acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
[0189] For the therapeutic compositions, formulations of one or more chimeric constructs described herein include those suitable for oral, nasal, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration. The formulations may conveniently be presented in unit dosage form and may be prepared by any methods known in the art of pharmacy. The amount of active ingredient (chemeric construct(s)) that can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration. The amount of active ingredient that can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 0.001 percent to about ninety percent of active ingredient, preferably from about 0.005 percent to about 70 percent, most preferably from about 0.01 percent to about 30 percent.
[0190] Formulations of one or more chimeric constructs described herein that are suitable for vaginal administration also include pessaries, tampons, creams, gels, pastes, foams or spray formulations containing such carriers as are known in the art to be appropriate. Dosage forms for the topical or transdermal administration of antibodies and/or immunoconjugates described herein include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches and inhalants. In certain embodiments the active compound may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants that may be required.
[0191] The phrases "parenteral administration" and "administered parenterally" as used herein means modes of administration other than enteral and topical administration, usually by injection, and include, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrastemal injection, and infusion.
[0192] Examples of suitable aqueous and nonaqueous carriers that may be employed in the pharmaceutical compositions comprising one or more chimeric constructs described herein include, but are not limited to water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate, and the like. Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
[0193] In various embodiments these compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Particular examples of adjuvants that are well-known in the art include, for example, inorganic adjuvants (such as aluminum salts, e.g. , aluminum phosphate and aluminum hydroxide), organic adjuvants (e.g., squalene), oil-based adjuvants, virosomes (e.g., virosomes that contain a membrane-bound hemagglutinin and neuraminidase derived from the influenza virus). [0194] Prevention of presence of microorganisms in formulations may be ensured both by sterilization procedures, and/or by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable
pharmaceutical form may be brought about by the inclusion of agents that delay absorption such as aluminum monostearate and gelatin.
[0195] When the antibodies and/or immunoconjugates described herein are administered as pharmaceuticals, to humans and animals, they can be given alone or as a pharmaceutical composition containing, for example, 0.001 to 90% (more preferably, 0.005 to 70%, such as 0.01 to 30%) of active ingredient in combination with a pharmaceutically acceptable carrier.
[0196] Regardless of the route of administration selected, the antibodies and/or immunoconjugates described herein, that may be used in a suitable hydrated form, and/or the pharmaceutical compositions, are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those of skill in the art.
[0197] Actual dosage levels of the active ingredients (e.g., antibodies and/or immunoconjugates described herein) in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts. A physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the
pharmaceutical composition required. For example, the physician or veterinarian could start doses of the constructs of the invention employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved. In general, a suitable daily dose of antibodies and/or immunoconjugates described herein will be that amount of the construct that is the lowest dose effective to produce a therapeutic effect. Such an effective dose will generally depend upon the factors described above. In certain embodiments, it is preferred that administration be intravenous, intramuscular,
intraperitoneal, or subcutaneous, preferably administered proximal to the site of the target.
If desired, the effective daily dose of a therapeutic composition may be administered a single dosage, or as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms. While it is possible for antibodies and/or immunoconjugates described herein to be administered alone, it is typically preferable to administer the compound(s) as a pharmaceutical formulation (composition).
[0198] In certain embodiments the antibodies and/or immunoconjugates described herein can be administered with medical devices known in the art. For example, in a illustrative embodiment, antibodies and/or immunoconjugates described herein can be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163, 5,383,851, 5,312,335, 5,064,413, 4,941,880, 4,790,824, or 4,596,556. Examples of useful well-known implants and modules are described for example in U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate, in U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medications through the skin, in U.S. Pat. No.
4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate, in U.S. Pat. No. 4,447,224, which discloses a variable flow
implantable infusion apparatus for continuous drug delivery, in U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments, and in U.S. Pat. No. 4,475,196, which discloses an osmotic drug delivery system. Many other such implants, delivery systems, and modules are known to those skilled in the art.
[0199] In certain embodiments, the antibodies and/or immunoconjugates described herein can be formulated to ensure proper distribution in vivo. For example, the blood-brain barrier (BBB) excludes many highly hydrophilic compounds. To ensure that the therapeutic compounds of the invention cross the BBB (if desired), they can be formulated, for example, in liposomes. For methods of manufacturing liposomes, see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and 5,399,331. The liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g. , Ranade (1989) J. Clin. Pharmacol. 29: 685). Illustrative targeting moieties include, but are not limited to folate or biotin (see, e.g. , U.S. Pat. No. 5,416,016); mannosides (Umezawa et al, (1988) Biochem. Biophys. Res. Commun. 153: 1038);
antibodies (Bloeman et al. (1995) FEBS Lett. 357:140; Owais et al. (1995) Antimicrob. Agents Chemother. 39:180); surfactant protein A receptor (Briscoe et al. (1995) Am. J. Physiol. 1233:134).
Kits.
[0200] Where a radioactive, or other, effector is used as a diagnostic and/or therapeutic agent, it is frequently impossible to put the ready-for-use composition at the disposal of the user, because of the often poor shelf life of the radiolabeled compound and/or the short half-life of the radionuclide used. In such cases the user can carry out the labeling reaction with the radionuclide in the clinical hospital, physician’s office, or laboratory. For this purpose, or other purposes, the various reaction ingredients can then be offered to the user in the form of a so-called "kit". The kit is preferably designed so that the manipulations necessary to perform the desired reaction should be as simple as possible to enable the user to prepare from the kit the desired composition by using the facilities that are at his disposal. Therefore the invention also relates to a kit for preparing a composition according to this invention.
[0201] In certain embodiments, such a kit comprises one or more antibodies or immumoconjugates described herein. The antibodies or immumoconjugates can be provided, if desired, with inert pharmaceutically acceptable carrier and/or formulating agents and/or adjuvants is/are added. In addition, the kit optionally includes a solution of a salt or chelate of a suitable radionuclide (or other active agent), and (iii) instructions for use with a prescription for administering and/or reacting the ingredients present in the kit.
[0202] The kit to be supplied to the user may also comprise the ingredient(s) defined above, together with instructions for use, whereas the solution of a salt or chelate of the radionuclide, defined sub (ii) above, which solution has a limited shelf life, may be put to the disposal of the user separately.
[0203] The kit can optionally, additionally comprise a reducing agent and/or, if desired, a chelator, and/or instructions for use of the composition and/or a prescription for reacting the ingredients of the kit to form the desired product(s). If desired, the ingredients of the kit may be combined, provided they are compatible. [0204] In certain embodiments, the immunoconjugate can simply be produced by combining the components in a neutral medium and causing them to react. For that purpose the effector may be presented to the antibody, for example, in the form of a chelate.
[0205] When kit constituent(s) are used as component(s) for pharmaceutical administration (e.g. as an injection liquid) they are preferably sterile. When the
constituent(s) are provided in a dry state, the user should preferably use a sterile physiological saline solution as a solvent. If desired, the constituent(s) may be stabilized in the conventional manner with suitable stabilizers, for example, ascorbic acid, gentisic acid or salts of these acids, or they may comprise other auxiliary agents, for example, fillers, such as glucose, lactose, mannitol, and the like.
[0206] While the instructional materials, when present, typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention.
Such media include, but are not limited to electronic storage media (e.g. , magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. Such media may include addresses to internet sites that provide such instructional materials.
EXAMPLES
[0207] The following examples are offered to illustrate, but not to limit the claimed invention. Example 1
Creation of Targeted Interferon Gamma Capable of Forming IFNy Dimers
[0208] Given the requirement for dimer formation for IFNy activity, we examined the use of several different linkers for their ability to allow functional dimer formation by two IFNy moieties joined to the carboxy terminus of the IgG heavy chain. One challenge is to make sure that linkers are long enough so that different domains do not impair each other in biologic activity. Additionally, there must not be cleavage of the linkers. Linkers that we examined included LTEEQQEGGG (SEQ ID NO:l) and LTEEQQEGGG- IFNyTEEQQEGGG (SEQ ID NO:2) based on a report of a biologically active single-chain version of IFNy (Landar et al. (2000) J. Mol. Biol. 299: 169 ).,
LAKLKQKTEQLQDRIAGGG (SEQ ID NOG) chosen from a linker database, the hinge of IgG3 (LELKTPLGDTTHTCP RCPEPKSCDTPPPCP RCPEPKSCDTPPPCP
RCPEPKSCDTPPPCP RCPGG, SEQ ID NO:4), the hinge of IgG3 lacking cys (LELKTPLGDTTHTSP RSPEPKSSDTPPPSP RSPEPKSSDTPPPSP
RSPEPKSSDTPPPSP RSPGG, SEQ ID N0:5), and the hinge of IgGl lacking cys
(LEPKSSDKTHTSPPSPSGG) (Table 1). The linkers have different properties. IgGl delta cys and lqoOE_l are similar in length (18 and 19 aa, respectively) but have different conformations (coil and alpha helix, respectively). IgG3 and IgG3 delta cys are of the same length but there are no disulfide bonds in the latter. The Landar linker has a relatively short 10 aa sequence.
[0209] IENg was joined with the different linkers after the CH3 domain of anti-
CSPG4, transiently expressed in 293T cells and protein isolated from culture supernatants using protein A Sepharose. The fusion proteins were then evaluated for their ability to inhibit the proliferation of OVCAR3, an ovarian cancer, T98MG, a glioma, and A375, a melanoma (Figure 1). OVCAR3 and T98MG do not express CSPG-4, while A375 expresses it to high levels. Thus for OVCAR3 and T98MG we are examining the relative efficacy of untargeted fusion protein in comparison to untargeted recombinant IFNy; for A375 we are comparing anti-CSPG-4 targeted IFNy with untargeted recombinant IFNy. For OVCAR3, the most effective IFNy fusion utilized the IgG3 hinge with the second most effective using the IgGl hinge A cys. Interestingly, both were more effective than this preparation of recombinant IFNy. For T98MG, the most effective fusion protein contained the lqo0E_l linker followed closely by the fusion proteins with the IgGl hinge A cys and the IgG3 hinge which showed activity similar to that of recombinant IFNy. When targeted by anti-CSPG-4, fusion proteins containing the IgG3 hinge, IgGl hinge A cys linker and the lqo0E_l linker showed similar activity. All three were several orders of magnitude more effective than recombinant hlFNy. Comparison of untargeted fusion proteins in 2 additional glioblastoma cell lines that did not express CSPG-4 (DBTRG-05 and U373), showed that the fusion with the IgGl hinge A cys was more active in one (DBTRG-05), while the fusion with the IgG3 hinge was more active in the other (U373) (Figure 2).
[0210] Based on our results, initially we elected to use fusions with the IgG3 hinge and made stable transfectants of CHO cells expressing anti-CD 138-IgG3 hinge-IFNy.
However, we found that there was significant cleavage of the protein at the site of the linker during synthesis (data not shown). Therefore, we made stable transfects of CHO expressing anti-CD138- IgGl hinge A cys-IENg. With this linker the IFNyis active and the resulting fusion proteins are stable. Relative efficacy of different fusion proteins against ovarian cancer cell lines
[0211] A screen of 36 different ovarian cancer cell lines by Dr. Dennis Slamon showed differential sensitivity to type I (IFNoc and IENb) and type II (IFNy) IFNs. From this panel we chose nine cell lines with differing sensitivities to IFN for analysis. These represented different cell types including two adenocarinomas (CaOV-3 and PEA2), one mucinous (EF027), two clear cells (KOC-7C) and four serous (OV177,OVCA420, OVCAR3 and OVKATE).
[0212] Since one goal is to be able to target IFNs specifically to ovarian cancer cells, we assessed the cell lines for their surface expression of different potential antigens including CD20, CD138, HMFG1 (MUC1) and CA125. Although HMFG1 and CA125 are more traditional ovarian cancer antigens, we found that CD 138 was most consistently expressed. CD20 was not expressed by any of the cell lines and can serve as a negative control of targeting.
[0213] Fusion proteins were constructed with four different IFNs: IFNoc2,
IFNOC2yns, IFNOC14, and IFNy. IFNoc2 was chosen for our initial fusion proteins since it is the IFN most frequently used in the clinic. However, IFNocl4 has more potent cytotoxic activity than IFNoc2 and we also made a fusion protein containing IFNocl4. All type I IFNs are recognized by a single shared receptor composed of two transmembrane proteins, IFNAR1 and IFNAR2. However, IENb has stronger receptor binding and more potent anti proliferative and pro-apoptotic activities than IFNoc against many cancers. Unfortunately fusion of human IENb to the heavy chain of IgG severely compromises its efficacy
(unpublished data). As an alternative approach we made a fusion protein containing a mutant IFNoc2 (IFNOC2yns) that binds IFNAR1 with a 30-fold higher affinity and exhibits increased anti-proliferative activity that is similar to that of IENb. The anti-proliferative activity of the fusion proteins was evaluated using the panel of 9 ovarian cell lines. Anti- CD 138 served as a control for inhibition of proliferation in the absence of an attached IFN. The ovarian cancer cell lines do not express CD20 and fusions containing anti-CD20 were used to evaluate the contribution of specific targeting to the inhibition of proliferation. The results are shown in Figure 4.
[0214] For all cell lines anti-CD 138 lacking an attached IFN did not exhibit anti proliferative activity. For OVKATE and CaOV3 the fusion protein containing IFNoc2™s showed superior anti-proliferative activity. For OVCAR3 fusions with IFNoc2 YNS, IFNocl4, and IFNy showed similar activity which was superior to that of the fusion protein containing IFNoc2. However, for the other 6 cell lines the fusion protein containing IFNy showed superior anti -proliferative activity. For all cell lines greater inhibition of proliferation was seen with the targeted IFN fusion protein than with a fusion protein containing the same IFN but directed to a surface antigen not expressed by the ovarian cell line. Untargeted fusion protein was less effective than recombinant hIFNyin inhibiting the proliferation of most ovarian cancer cell lines (Figure 5). However, targeting improved the efficacy and for all cell lines targeted fusion protein was more effective than recombinant hIFNy.
Relative efficacy of different fusion proteins against the glioblastoma T98MG
[0215] To determine the relative efficacy of the fusion proteins against a different cancer, the glioblastoma T98MG was incubated with the indicated proteins for 6 days and the amount of metabolically active cells remaining determined by MTS assay. Anti- CD138-IFNy was more effective than any of the IFNoc fusion proteins (Figure 6, top panel). T98MG expresses CD138 but not CD20 and targeted fusion protein was approximately 3 logs more effective than untargeted fusion protein (Figure 6, bottom panel). Untargeted fusion protein had anti-proliferative activity comparable to recombinant hIFNy.
Efficacy of IFNy fusions against multiple myeloma
[0216] Multiple myeloma expresses CD138 but not CD20. The myeloma cell lines
H929, MM1-144, 8226Dox40 and U266 showed little to no sensitivity to inhibition of proliferation by IFNy at the concentrations tested (Figure 7). In contrast, both OCI-My5 and ANBL-6 showed sensitivity to IFNy which was increased approximately 2 logs through targeting.
Fusions with mouse IFNy
[0217] Mouse IFNy was fused to the carboxy terminus of mouse IgG2a using the
IgGl hingeAcys linker that was used to create fusions with human IFNy. To determine if the fusion was active, B16 cells were incubated for 24 hours with either 1.5 nM mouse IFNy (mIFNy) or 0.75 nM anti-CD20-mIFNy (B16 does not express CD20) and the expression level of H2-Kb determined by flow cytometry (Figure 8). The fusion protein and recombinant mIFNy upregulated the expression of class 1 MHC to the same extent.
However, when the anti-proliferative activity against B16 of mIFNy and anti-CD20-mIFNy were compared, mIFNy had greater activity than anti-CD20-mIFNy (Figure 9). [0218] Analysis of B 16huCD20, which expresses human CD20, showed that the cell line was less sensitive to mlFN than to the type I IFNs (Figure 10). Targeted anti- huCD20-mIFNy displayed similar activity to recombinant mlFNy. Targeted anti-hCD20- mlFN was not protective against tumor growth at the concentration tested (Figure 11).
[0219] The 38C13 lymphoma was used to further analyze the properties of the fusions containing mlFNy. The fusion protein was found to be somewhat less active in its ability to activate complement mediated cytolysis (Figure 12).
[0220] The fusion protein was able to carry about ADCC, but was less effective than the targeted anti-huCD20 with the murine IgG2a constant region which was more effective than Rituximab. (Figure 13).
[0221] The effects of mlFNy, anti-hCD20, and anti -hCD20-m I FN on the expression of MHCI, ICAM-1, PD-L1, FAS and CD80 by 38C13-huCD20 following 24 hours of treatment were tested (Figure 14). Both mlFNy and anti-hCD20-IFNy slightly upregulated the expression of MHC I, FAS and CD80 while anti-hCD20 downregulated their expression. Both IFNy and a n t i - h C D 20 - m I F N g strongly upregulated the expression of ICAM1 and PD-L1 while anti-hCD20 had little effect.
[0222] Untargeted anti-huCD20-mIFNy was found to be slightly more effective than mlFNyin inhibiting the growth of 38C13 (Figure 15). However, neither mlFNynor antiCD20-mIFNy were effective in inhibiting the growth of 38C13huCD20 in vitro (Figure 16).
[0223] Unexpectedly, although not effective in vitro, anti-hCD20mIgG2a-mIFNy was very effective in inhibiting tumor growth in vivo (Figure 17) and was more effective than anti-hCD20mIgG2a (Figure 18).
[0224] Higher doses of anti - hC D20 m IgG2a- m I FN were found to be more effective in inhibiting tumor growth in vivo (data not shown).
Activity of fusion proteins against Waldenstrom macroglobulinemia (WM)
[0225] The MWCL-1 cell line was used for these studies. The cell line was established from a bone marrow aspirate of a 73 -year-old male patient with IgM-k WM. It contains the EB V gene product EBNA1 , but does not appear to be actively replicating virus and was reported to be both CD20 and CD 138 positive. [0226] We confirmed that all cells were positive for the expression of both CD138 and CD20, with brighter staining seen using anti-CD20.
Ability of proteins treatment to induce apoptosis:
[0227] To evaluate the ability of the single fusion proteins to induce apoptosis in
MWCL-1, cells were treated with 12.5 nM of the indicated proteins for 5 days and apoptosis evaluated by flow-cytometry following staining with Annexin V and PI. Overall fusion proteins targeting CD20 were more potent than those with the same IFN targeting CD138, consistent with the apparently greater expression of CD20 by the cells (Fig 20, panel A). Anti-CD20oc2YNS was the most potent, followed by anti-CD20ocl4 with anti-CD20-IFNy and anti-CD20-IFNoc2 being the least potent. Using the fusion proteins targeting CD138, only anti-CD138a2YNS was effective. When fusion proteins were used that simultaneously targeted CD20 and CD138, the activity was primarily contributed by the anti-CD20 fusion protein with the additional targeting to CD20 contributing little to increasing the amount of apoptosis induced (Figure 20, panel B).
Simultaneous targeting of type I and type II IFN enhances the induction of apoptosis:
[0228] When anti-CD20-IFNy was targeted along with either anti-CD 138 or anti-
CD20 unfused or fused to type IFN, increased induction of apoptosis was seen in all combinations (Figure 20, panels C and D). However, more effective induction of apoptosis was seen using the anti-CD20 proteins (compare Fig. 20, panel C and panel D). The most effective combination was anti-CD20-IFNy with anti-CD20oc2YNS, in which approximately 60% of the cells were Annexin V positive following treatment.
[0229] Anti-CD 138-IFNy did not result in increased induction of apoptosis when used in combination with anti-CD 138 or anti-CD20. However, it did result in increased apoptosis when used in combination with any of the fusions of anti-CD 138 and anti-CD20 with type I interferon. More effective induction of apoptosis was seen when anti-CD 138- IFNywas combined with anti-CD20 proteins (compare Figure 20, panels E and F). The most effective combination was anti-CD 138-IFNy+ anti-CD20oc2YNS.
Ability of proteins to inhibit proliferation:
[0230] To determine the ability of the proteins to inhibit proliferation, MWCL-1 cells were incubated with 12.5 nM protein for 72 hours, then pulsed with 3H-thymidine for 8 hours and proliferation measured by determining the amount of 3H-thymidine incorporated into DNA. Proteins targeting CD20 were more effective in inhibiting proliferation than those targeting CD138, with anti-CD20-IFNy and anti-CD20-IFNoc2YNS most effective (Figure 21, panel A). Simultaneously targeting the same IFN by treating with anti-CD20- IFN + anti-CD 138-IFN did little to increase the inhibition of proliferations seen using only anti-CD20-IFN (Figure 21, panel B).
[0231] Anti-CD20-IFNy was so effective in inhibiting proliferation that the addition of an anti-CD 138- or anti-CD20-type I IFN did little to increase the inhibition of proliferation observed (Figure 21, panels C and D). When anti-CD 138-IFN was combined with anti-CD138 and anti-CD20 both unfused and fused with type I IFN, enhanced inhibition of proliferation was observed; however for both anti-CD 138-IFN a2™s and anti- CD20IFNOC2yns, the enhancement was minimal since the fusions with IFNa2™s were so effective when used by themselves (Figure 21, panels E and F).
Example 2
STAT activation following fusion protein treatment
[0232] STAT activation is one of the first events following treatment with interferon. To assess STAT activation following treatment with the different proteins, MWCL1 cells were incubated with 12.5 nM of the indicated proteins for 0.5, 24 or 48 hours, extracts made and assayed by Western blot for pSTATl, total STAT1, pSTAT3 and total STAT3 (Figure 22, panel A). Treatment with anti-CD138 or anti-CD20 did not result in STAT activation. Treatment with both anti-CD20 and anti-CD138 fusions with IFN-0C2, IFNOC2YNS and IFNocl4 resulted in robust phosphorylation of STAT1 at 0.5 hours which was not longer evident at 24 hours. Treatment with anti-CD20 and anti-CD 138 fused to IFN-g interferon resulted in some phosphorylation of STATI at 0.5 hours, but this was not as robust as the phosphorylation seen following treatment with fusions with type I IFNs. However, treatment with fusion with both type I and type II IFNs resulted in strong upregulation of STATI protein levels which was seen at 24 and 48 hours. No
phosphorylation of STAT3 was seen following any treatments.
[0233] Simultaneous targeting of the same interferon species to both CD20 and
CD138 resulted in strong phosphorylation of STATI when type I IFNs were used; this phosphorylation persisted and could still be seen 48 hours following treatment (STAT Figure 22, panel B). Phosphorylation following treatment with the IFNy fusion proteins also was evident at 24 and 48 hours following treatment when both CD20 and CD 138 were simultaneously targeted. However, when extracts from cells treated for 0.5 hours with anti- CD20IFNoc2, anti-CD 138-IFNoc2 or anti-CD20IFNcc2 + anti-CD 138-IFNcc2 were run side- by-side on the same gel, no enhanced STAT1 phosphorylation was seen when both proteins were targeted. The same was true when extracts from cells treated for 0.5 hours with anti- CD20-IFNy, anti -C D 138- 1 FN or anti-CD20-IFNy + anti-CD 138-IFNy were compared. As had been seen earlier, increased levels of STAT1 protein were seen at 24 and 28 hours following all fusion protein treatments and no pSTAT3 was seen.
[0234] To address the question of whether simultaneous targeting of type I and type
II interferon would influence the level of STAT activation observed, MWCL1 cells were incubated with 12.5 nM of anti-CD 138-IFN and proteins targeting CD138 or CD20 either unfused or fused to type I IFN (Figure 22, panel C) or with 12.5 nM of anti-CD20-IFNy and proteins targeting CD 138 or CD20 either unfused or fused to type I IFN (Figure 22, panel D). Combining anti-CD 138-IFNy with anti-CD138 or anti-CD20 resulted in little increase in STAT1 phosphorylation over what was observed with only anti-CD 138-IFNy treatment. However, combining anti-CD 138-IFN with fusions with type I IFN resulted in phosphorylation of STAT1 that could still be observed at 48 hours following treatment (Figure 22, panel C). In addition, side-by-side comparisons showed that more robust STAT I phosphorylation was seen when anti-CD138-IFNy was combined with either anti-CD138- IFNoc2 or anti-CD20-IFNoc2 than with any of the single treatments (Figure 22, panel E). Although no phosphorylation of STAT3 was observed increased levels of STAT3 were observed at 24 and 48 hours.
[0235] When MWCL1 cells were incubated with 12.5 nM of anti-CD20-IFNy and proteins targeting CD138 or CD20 a small increase in STAT1 phosphorylation was observed compared with only anti-CD20-IFNy treatment; notable was the fact that pSTATl was observed at 24 and 48 hours following this treatment. Moreover, combining anti- CD20-IFNy with fusions with type I IFN resulted in very robust phosphorylation of STAT1 that could still be observed at 48 hours following treatment (Figure 22, panel D). In addition, side-by-side comparisons showed that more robust STAT I phosphorylation was seen when anti-CD20-IFNy was combined with either anti-CD138-IFNoc2 or anti-CD20- IFNoc2 than with any of the single treatments (Figure 22, panel E). Again no
phosphorylation of STAT3 was observed. However, an increase in STAT3 protein levels at 24 and 48 hours was observed following all treatments (Figure 22, panel D). [0236] Extracts were also blotted for STAT5 and pSTAT5. No phosphorylation of
STAT5 was seen
In vivo protection
[0237] To investigate in vivo protection, SCID mice were injected subcutaneously with 1 x 107 WMCL1 cells. On days 14, 16 and 18 following tumor implantation at a time when tumors were palpable mice were treated i.v. with 100 pg of the indicated proteins and monitored for tumor growth. Mice were euthanized when tumors were 1.5 cm in size (Figure 23, panel A). For the initial experiment, all treatments were performed at the same time except anti-CD20, anti-CD138 and one PBS treatment which were done at a separate time and are plotted as dashed lines. Proteins targeting CD20 are much more protective than those targeting CD138. Even anti-CD20 that was not fused to interferon gave significant protection (p<0.0001 compared to PBS). Among the proteins targeting CD20, anti-CD20- IFNoc2 was most protective, preventing tumor growth in all mice. Anti-CD20-IFNy and anti-CD20-IFNoc2YNS showed similar levels of protection, with 4 of 9 and 5 of 8 mice respectively remaining tumor free. At the end of the experiment (250 days) the sera from the surviving mice were analyzed by ELISA and found to not contain any IgM indicating that the mice were truly tumor free. The experiment was repeated (Figure 23, panel B) and similar results were obtained. Treatment with anti-CD20 provided some protection.
Fusions with type I IFN were more protective than fusions with IFNy; however in this case anti-CD20-IFNoc2YNS protected more mice than did anti-CD20-IFNoc2.
[0238] Analysis of the results obtained with proteins that target CD 138 showed that the median survival time of mice treated with PBS was 71 days while the median survival of mice treated with anti-CD138 was 69 days, so unlike what was observed with anti-CD20 no survival benefit is seen with the unfused protein. A small survival benefit was seen with the anti-CD138-IFN fusion proteins: the median survival time following treatment with anti-CD138-IFNoc was 86 days (p = 0.001), following treatment with anti-CD 138-IFNa2™s it was 90 days (p = 0.0003), and following treatment with anti-CD 138-IFN it was 80 days (p =0.04).
[0239] Analysis of the results of the combined experiments showed that anti-CD20 provides significant protection (p<.0001 compared with PBS) ( see, e.g., Figure 23, panel C). However both anti-CD20-IFNy and anti-CD20-IFNoc2YNS are significantly more protective than anti-CD20 (p=.004 and <.0001 respectively). Anti-CD20-IFNoc2YNS is significantly more protective than anti-CD20-IFNy (p=0.02). However there is no significant difference in the protection provided by the two type I IFN fusion proteins (p=0.34).
Anti-proliferative activity of IFN- g fusion proteins in combination with bortezomib or ibrutinib
[0240] Although bortezomib showed dose-dependent inhibition of proliferation, no enhanced inhibition of proliferation as indicated by decreased incorporation of 3H- thymidine was seen when MWCL- 1 cells were incubated with bortezomib and fusions with type I interferon (Data not shown). In contrast, increased inhibition of proliferation was seen when MWCL-1 cells were incubated different concentrations of anti-CD20-IFNy and anti-CD138-IFNy fusion proteins and bortezomib for 72 hours. In the initial experiment the bortezomib concentration was held constant at 8 nM and cells were incubated with different concentrations of fusion protein (Figure 24, panel A). Increased inhibition of proliferation was seen for both concentrations of fusion protein. In a second experiment cells were incubated with either 9 or 8 nM bortezomib and fusion protein at different concentrations. Shown are the results for 25000 pM of fusion protein with either 9 or 8 nM of bortezomib (Figure 24, panel B). Using the data from this experiment it was possible to calculate the Cl. Although the Cl was found it to be less than 1 the results would suggest that the interactions between the fusion proteins and bortezomib are only“moderately” synergistic.
[0241] Decreased cell proliferation was also seen following treatment with ibrutinib and fusion proteins containing type II IFN (Figure 24, panel C). When fusion proteins were used at 200 nM, less proliferation was observed following combination treatment with 1 nM, 5 nM and 10 nM of ibrutinib.
[0242] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.

Claims

CLAIMS What is claimed is:
1. A chimeric construct comprising a full-length immunoglobulin or a camelid antibody attached to an interferon gamma (IFNy) wherein:
said immunoglobulin or camelid antibody is an antibody that binds to a tumor associated antigen;
a first interferon gamma (IFNy) is attached to a first constant heavy region 3 (CFF) of said immunoglobulin or camelid antibody by a first proteolysis resistant peptide linker;
a second interferon gamma is attached to a second constant heavy region 3 (CFF) of said immunoglobulin or camelid antibody by a second proteolysis resistant peptide linker; and
said first proteolysis resistant linker and said second proteolysis linker have a length and flexibility that permits said first interferon gamma and said second interferon gamma to dimerize.
2. The construct of claim 1, wherein said first proteolysis resistant peptide linker and said second proteolysis peptide linker comprise amino acid sequences independently selected from the amino acid sequences of the peptide linkers shown in Table 1.
3. The construct of claim 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the Landar linker.
4. The construct of claim 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the Double landar linker.
5. The construct of claim 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the lqo0E_l linker.
6. The construct of claim 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the IgG3 hinge linker.
7. The construct of claim 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the IgG3 hinge delta cys linker.
8. The construct of claim 2, wherein said first proteolysis resisting peptide linker and/or said second proteolysis resisting peptide linker comprise the amino acid sequence of the IgGl hinge delta cys linker.
9. The construct according to any one of claims 1-8, wherein said interferon gamma comprises a murine interferon gamma, or a truncated and/or mutated murine interferon gamma.
10. The construct of claim 9, wherein said interferon gamma comprises a full-length murine interferon gamma.
11. The construct according to any one of claims 9-10, wherein said murine interferon gamma is not glycosylated.
12. The construct according to any one of claims 9-10, wherein said murine interferon gamma is glycosylated at Asn 38 and/or at ASN 90.
13. The construct according to any one of claims 1-8, wherein said interferon gamma comprises a human interferon gamma or a truncated and/or mutated human interferon gamma.
14. The construct of claim 13, wherein said human interferon gamma is not glycosylated.
15. The construct of claim 13, wherein said human interferon gamma comprises N-linked glycosylation at Asn-25 and/or at Asn-97.
16. The construct according to any one of claims 13-15, wherein said human interferon gamma comprises a full-length human interferon.
17. The construct according to any one of claims 13-15, wherein said human interferon gamma comprises a huIFNy C-terminally truncated with 1-15 amino acid residues, e.g. with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acid residues.
18. The construct according to any one of claims 13-15, and 17, wherein said human interferon gamma comprises a human interferon gamma N-terminally truncated with 1, 2, or 3 amino acid residues.
19. The construct according to any one of claims 13-15, wherein said human interferon gamma comprise a human interferon gamma with an N-terminal addition CYC.
20. The construct according to any one of claims 13-19, wherein said human interferon gamma comprises a cysteine substitutions at one or more of Glu8, Ser70, Alal8, Hisl l2, Lys81, Leul21, Gln49, and leu96 (relative to the amino acid sequence of SEQ ID NO: 13).
21. The construct of claim 20, wherein said human interferon gamma comprises at least one pair of amino acids from predetermined amino acid pairs exchanged for cysteine, wherein said four amino acid pairs are Glu8 and Ser70, Alai 8 and His 112, Lys81 and Leul21, and Gln-49 and Leu96.
22. The construct according to any one of claims 1-21, wherein said antibody or camelid antibody preferentially or specifically binds to a tumor associated antigen (TAA) selected from the group consisting of CD138, CSPG4, oc-fetoprotein, 5 alpha reductase, 5T4 (or TPBG, trophoblast glycoprotein), AM-1, APC, APRIL, B7 family members, BAGE, Bcl2, bcr-abl (b3a2), CA-125, CASP-8/FLICE, Cathepsins, CD1,
CD115, CD123, CD13, CD14, CD15, CD19, CD2, CD20, CD200, CD203c, CD21, CD23, CD22, CD38, CD25, CD276, CD3, CD30, CD303, CD33, CD34, CD35, CD37, CD38, CD44, CD45, CD46, CD5, CD52, CD55, CD56, CD59 (791Tgp72), CD7, CD70, CD74,
CD79, CDC27, CDK4, CEA, CLL-1, c-MET (or HGFR), c-myc, Cox-2, Cripto, DCC, DcR3, DLL3, E6/E7, EGFR, EMBP, Ena78, endoplasmin, EPCAM, EphA2, EphB3,
ETBR, FcRL5, FGF8b and FGF8a, FLK-l/KDR, FOLR1, G250, GAGE-Family, gastrin 17, gastrin-releasing hormone (bombesin), GD2/GD3/GM2, glutathione S-transferase, glycosphingolipid GD2, GnRH, GnTV, gpl00/Pmell7, gp-100-in4, gpl5, gp75/TRP-l, GPNMB, hCG, Heparanase, Her2/neu, Her3, Her4, HLA-DR, HM 1.24, HMB 45, HMTV, HMW-MAA, Hsp70, hTERT (telomerase), IFN-a, IGFR1, IL-13R, iNOS, integrin, Ki 67, KIAA0205, K-ras, H-ras„ N-ras, KSA (C017-1A), LDLR-FUT, Leu-Ml, Lewis A like carbohydrate, Lewis Y, LIV1, MAGE1, MAGE3, Mammaglobin, MAP17, Melan-A/, MART-1, mesothelin, MIC A/B, MN, Moxl, MMP2, MMP3, MMP7, MMP9, MUC16, MUC-1, MUC-2, MUC-3, MUC-4, MUC-16, MUM-1, NaPi2b, Nectin-4, NY-ESO-1, Osteonectin, pl5, pl6INK4, P170/MDR1, p53, p97/melanotransferrin, PAI-1, PDGF, plasminogen (uPA), PMSA, PRAME, Probasin, Progenipoietin, PSA (phosphatidyl serine antigen), PSM, RAGE-1, Rb, RCAS1, SART-1, SE10, SIRP.alpha., SLAM family members, SLC44A4, SSX gene, family, STAT3, STEAP-1, STn (mucin assoc.), TAG-72, TF (or tissue factor), TGF-oc, TGF-b, Thymosin b 15, TNF superfamily members, TPA,
TPI, TRP-2, Tyrosinase, VEGF, VLA, ZAG, and b-catenin.
23. The construct of claim 22, wherein said antibody or camelid antibody preferentially or specifically binds to CSPG4.
24. The construct of claim 23, wherein said antibody comprises the CDRs of an antibody selected from the group consisting of 9.2.27, VF1-TP34, VF1-TP34, VF1-TP41.2, TP61.5, 149.53, 149.53, 225.28, 225.28s, 763.74, and scFv-FcC21.
25. The construct of claim 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD 138.
26. The construct of claim 25, wherein said antibody comprises the CDRs of an antibody comprises an antibody selected from the group consisting of nBT062, B-B4, BC/B-B4, B-B2, DL-101, 1 D4, MI15, 1.BB.210, 2Q1484, 5F7, 104-9, and 281-2.
27. The construct of claim 22, wherein said antibody or camelid antibody preferentially or specifically binds to a member of the EGF receptor family.
28. The construct of claim 27, wherein said antibody comprises the CDRs of an antibody comprises an antibody selected from the group consisting of C6.5, C6ML3-9, C6MH3-B1, C6-B1D2, F5, HER3.A5, HER3.F4, HER3.H1, HER3.H3, HER3.E12, HER3.B12, EGFR.E12, EGFR.C10, EGFR.B11, EGFR.E8, HER4.B4, HER4.G4, HER4.F4, HER4.A8, HER4.B6, HER4.D4, HER4.D7, HER4.D11, HER4.D12, HER4.E3, HER4.E7, HER4.F8 and HER4.C7.
29. The construct of claim 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD20.
30. The construct of claim 29, wherein said antibody comprises the CDRs of an antibody comprises an antibody selected from the group consisting of rituximab, Ibritumomab tiuxetan, and tositumomab.
31. The construct of claim 22, wherein said antibody or camelid antibody preferentially or specifically binds to endoplasmin.
32. The construct of claim 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD33.
33. The construct of claim 22, wherein said antibody or camelid antibody preferentially or specifically binds to CD276.
34. The construct according to any one of claims 1-33, wherein said antibody or camelid antibody is a full-length immunoglobulin.
35. The construct of claim 34, wherein said antibody is a human antibody.
36. The construct of claim 34, wherein said antibody is a humanized or chimeric antibody.
37. The construct according to any one of claims 1-33, wherein said antibody or camelid antibody is a camelid antibody.
38. A pharmaceutical formulation comprising:
a chimeric construct according to any one of claims 1-37; and a pharmaceutically acceptable carrier.
39. The pharmaceutical formulation of claim 38, wherein said formulation is a unit dosage formulation.
40. The formulation according to any one of claims 38-39, wherein said formulation is formulated for administration via a route selected from the group consisting of oral administration, nasal administration, rectal administration, intraperitoneal injection, intravascular injection, subcutaneous injection, transcutaneous administration, and intramuscular injection.
41. A method of inhibiting growth and/or proliferation of a cell that expresses or overexpresses CD138, said method comprising contacting said cell with a chimeric construct according to any of claims 1-36, or a formulation according to any one of claims 37-39 in an amount sufficient to inhibit growth or proliferation of said cell.
42. The method of claim 41, wherein said cell is a cancer cell.
43. The method of claim 42, wherein said cancer cell is a metastatic cell.
44. The method of claim 42, wherein said cancer cell is in a solid tumor.
45. The method of claim 42, wherein said cancer cell is cell produced by a cancer selected from the group consisting of multiple myeloma, ovarian carcinoma, cervical cancer, endometrial cancer, kidney carcinoma, gall bladder carcinoma, transitional cell bladder carcinoma, gastric cancer, prostate adenocarcinoma, breast cancer, prostate cancer, lung cancer, colon carcinoma, Hodgkin's and non-Hodgkin's lymphoma, chronic lymphocytic leukemia (CLL), acute lymphoblastic leukemia (ALL), acute myeloblastic leukemia (AML), a solid tissue sarcoma, colon carcinoma, non-small cell lung carcinoma, squamous cell lung carcinoma, colorectal carcinoma, hepato-carcinoma, pancreatic cancer, and head and neck carcinoma.
46. The method of claim 42, wherein said cancer cell is a cell of a multiple myeloma.
47. The method according to any one of claims 41-46, wherein said method comprises inhibiting, delaying and/or preventing the growth of a tumor and/or spread of malignant tumor cells.
48. The method according to any one of claims 41-47, wherein said contacting comprises systemically administering said construct or formulation to a mammal.
49. The method according to any one of claims 41-47, wherein said contacting comprises administering said construct or formulation directly into a tumor site.
50. The method according to any one of claims 41-47, wherein said contacting comprises administering said construct or formulation via a route selected from the group consisting of oral administration, intravenous administration, intramuscular administration, direct tumor administration, inhalation, rectal administration, vaginal administration, transdermal administration, and subcutaneous depot administration·
51. The method according to any one of claims 41-47, wherein said contacting comprises administering said construct or formulation intravenously.
52. The method according to any one of claims 41-51, wherein said cell is a cell in a human.
53. The method according to any one of claims 41-51, wherein said cell is a cell in a non-human mammal.
54. The method of claim 41, wherein said cancer cell is a cell produced by a multiple myeloma.
55. The method according to any one of claims 41-54, wherein said method comprises co-administration of said chimeric construct with bortezomib.
56. The method according to any one of claims 41-55, wherein said method comprises co-administration of said chimeric construct with ibrutinib.
57. The method according to any one of claims 55-56, wherein said co administration provides a synergistic effect.
PCT/US2020/015727 2019-01-30 2020-01-29 Targeted delivery of ifn gamma using antibody fusion proteins Ceased WO2020160182A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/310,279 US20220177598A1 (en) 2019-01-30 2020-01-29 Targeted delivery of ifn gamma using antibody fusion proteins

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962798994P 2019-01-30 2019-01-30
US62/798,994 2019-01-30

Publications (1)

Publication Number Publication Date
WO2020160182A1 true WO2020160182A1 (en) 2020-08-06

Family

ID=71841931

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/015727 Ceased WO2020160182A1 (en) 2019-01-30 2020-01-29 Targeted delivery of ifn gamma using antibody fusion proteins

Country Status (2)

Country Link
US (1) US20220177598A1 (en)
WO (1) WO2020160182A1 (en)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12415843B2 (en) 2018-03-19 2025-09-16 The Regents Of The University Of California Antibody-interferon fusion proteins for enhancing adoptive T cell therapies for the treatment of cancer
WO2021087462A1 (en) * 2019-10-31 2021-05-06 The Research Foundation For The State University Of New York Rage antibodies, fragments and uses thereof

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015021444A1 (en) * 2013-08-09 2015-02-12 The Trustees Of The University Of Pennsylvania Combination of ifn-gamma with anti-erbb antibody for the treatment of cancers
US20160115242A1 (en) * 2013-05-29 2016-04-28 The Regents Of The University Of California Anti-cspg4 fusions with interferon for the treatment of malignancy

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9803021B2 (en) * 2012-12-07 2017-10-31 The Regents Of The University Of California CD138-targeted interferon demonstrates potent apoptotic and anti-tumor activities

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160115242A1 (en) * 2013-05-29 2016-04-28 The Regents Of The University Of California Anti-cspg4 fusions with interferon for the treatment of malignancy
WO2015021444A1 (en) * 2013-08-09 2015-02-12 The Trustees Of The University Of Pennsylvania Combination of ifn-gamma with anti-erbb antibody for the treatment of cancers

Also Published As

Publication number Publication date
US20220177598A1 (en) 2022-06-09

Similar Documents

Publication Publication Date Title
Tsuchikama et al. Exploring the next generation of antibody–drug conjugates
US10975158B2 (en) CD138-targeted interferon demonstrates potent apoptotic and anti-tumor activities
AU2015215015B2 (en) Antibody-drug conjugates and immunotoxins
AU2015339012B2 (en) Anti-CS1 antibodies and antibody drug conjugates
US11584799B2 (en) Anti-CD30 antibodies and methods for treating CD30+ cancer
US20240123080A1 (en) Cytotoxic compounds and conjugates thereof
US20120107270A1 (en) Immunocytokines In Combination With Anti-ErbB Antibodies For The Treatment Of Cancer
KR20210008487A (en) Anti-CD24 composition and use thereof
EP4281484B1 (en) Anti-her-2/trop-2 constructs and uses thereof
US20190201541A1 (en) Anti-cd22 antibody-maytansine conjugates, combinations, and methods of use thereof
TW202122421A (en) Anti-pd-l1 antibodies and antibody-drug conjugates
TWI873167B (en) Treatment of cancers with antibody drug conjugates (adc) that bind to 191p4d12 proteins
US20180043014A1 (en) Compositions Using Antibodies Directed to GPNMB and Uses Thereof
US10112999B2 (en) Anti-PRLR antibody-drug conjugates (ADC) and uses thereof
JP2023524678A (en) Anti-c-Met antibody drug conjugate and its application
US12364777B2 (en) Homodimeric antibodies for use in treating cancers and methods of use
KR20240005722A (en) Dosing for treatment with anti-CD20/anti-CD3 bispecific antibodies
CN114746116A (en) Compositions and methods for immunotherapy
CN116744969A (en) Compositions for use in cancer therapy comprising combinations of immune checkpoint inhibitors and antibody-amanitin conjugates
CN119604314A (en) Anti-GD2 antibodies, immunoconjugates and therapeutic uses thereof
KR20220145871A (en) How to treat cancer
WO2020160182A1 (en) Targeted delivery of ifn gamma using antibody fusion proteins
US20230226206A1 (en) Methods for the use of a b7-h3 antibody-drug conjugate alone or in combination
US20210198365A1 (en) Combination product for the treatment of cancer
TW202440158A (en) Combination therapy of a pd-1 antagonist, a lag3 antagonist and an antibody drug conjugate that binds 191p4d12 protein for treating patients with cancer

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20749032

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 20749032

Country of ref document: EP

Kind code of ref document: A1