WO2020102779A1 - MONOCLONAL ANTIBODIES AGAINST IgV DOMAIN OF B7-H3 AND USES THEREOF - Google Patents
MONOCLONAL ANTIBODIES AGAINST IgV DOMAIN OF B7-H3 AND USES THEREOF Download PDFInfo
- Publication number
- WO2020102779A1 WO2020102779A1 PCT/US2019/061887 US2019061887W WO2020102779A1 WO 2020102779 A1 WO2020102779 A1 WO 2020102779A1 US 2019061887 W US2019061887 W US 2019061887W WO 2020102779 A1 WO2020102779 A1 WO 2020102779A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- antibody
- seq
- antigen
- leukemia
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- B7-H3 is a type I transmembrane protein and belongs to the B7 family.
- B7-H3 is overexpressed in human malignancies (1,2) including prostate cancer (3), liver cancer (4), melanoma (5), leukemia (6), breast cancer (7), ovarian cancer (8), pancreatic cancer (9), colorectal cancer (10), lung cancer (11), bladder cancer (12), renal cancer (13), brain cancer (14), and osteosarcoma (15).
- Several studies have correlated high B7-H3 expression levels with poor prognosis (1,2). These studies suggest that B7-H3 is an immune checkpoint used by human cancer cells to inhibit functions of immune cells (1,2).
- B7-H3 The extracellular part of B7-H3 is composed of IgV-IgC-IgV-IgC or IgV-IgC. Previous studies showed that the FG loop of the IgV domain of B7-H3 plays a critical role in B7-H3-mediated T cell suppression (16).
- the present disclosure provides a monoclonal antibody or an antigen-binding fragment thereof that specifically binds to an IgV domain of a human B7-H3.
- the antibody comprises (a) a heavy chain having complementarity determining region (CDR) 1 comprising GYTFTSYWIT (SEQ ID NO: l), CDR2 comprising DIYPGSGSTNYNEKFKS (SEQ ID NO:2), and/or HCDR3 comprising ARGGTRFSPFAY (SEQ ID NO:3) (CDR3); and/or (b) a light chain having CDR (CDR) 1 comprising RSSQSIVHSNGNTYLE (SEQ ID NO:4), CDR2 comprising KVSNRFS (SEQ ID NO:5), and/or CDR3 comprising FQGSHVPWT (SEQ ID NO:6).
- the antibody comprises a heavy chain variable domain (VH) and/or a light chain variable domain (VL) comprising amino acid sequences set forth in SEQ ID NOs: 14 and 16, respectively, without the leader sequences.
- the antibody comprises (a) a heavy chain having CDR1 comprising GYTFTSYWMH (SEQ ID NO:7), CDR2 comprising
- the antibody comprises a VH and/or a VL comprising amino acid sequences set forth in SEQ ID NOs: 18 and 20, respectively, without the leader sequences.
- the antibody comprises (a) a heavy chain having CDR1 comprising GYTFTSYWMH (SEQ ID NO:7); CDR2 comprising
- the antibody comprises a VH and/or VL comprising amino acid sequences set forth in SEQ ID NOS: 23 and 25, respectively, without the leader sequences.
- the antibody competes with the above antibody or a fragment thereof for binding to the IgV domain of human B7-H3.
- the antibody is a humanized antibody or a chimeric antibody.
- FIGs. 1A-1B FACS shows that mAh 8B12 (FIG 1A) and 12B4 (FIG IB) bind to endogenous B7-H3 expressed by human cancer lines PC3 (left) and MDA-MB231 (right). 8B12 or 12B4 50B5 (right histograms in each pair) or mouse IgG isotype controls (left histograms in each pair).
- FIG. 2. FACS shows that both dendritic cells (left) and activated T cells (right) express B7-H3. A mAh against B7-H3 (right histograms in each pair) or mouse IgG isotype control (left histograms in each pair).
- mAh 8B12 (FIG. 3A) and 12B4 (FIG. 3B) are able to regulate cytokine production from T cells in a mixed lymphocyte reaction assay.
- N 2-4.
- the invention provides a monoclonal antibody or an antigen-binding fragment thereof that binds to an IgV domain of a human B7-H3, comprising:
- GYTFTSYWIT SEQ ID NO: l
- CDR complementarity determining region
- ARGGTRFSPFAY SEQ ID NO:3 (CDR3);
- a light chain comprising one or more of:
- RSSQSIVHSNGNTYLE SEQ ID NO:4 (CDR1), or
- KVSNRFS SEQ ID NO:5 (CDR2)
- FQGSHVPWT SEQ ID NO:6 (CDR3); or
- GYTFTSYWMH SEQ ID NO:7 (CDR1), or
- MIHPNSGSTNYNEKFKS SEQ ID NO: 8 (CDR2), or
- a light chain comprising one or more of:
- SASSSVSYMH SEQ ID NO: 10 (CDR1), or
- QQRSSYPYT (SEQ ID NO: 12) (CDR3); or III) an antibody or fragment thereof that competes with the antibody or fragment of I) or II) for binding to the IgV domain of human B7-H3.
- the B7-H3 IgV domain-binding fragment can be, for example, a Fab, F(ab)2, or scFv fragment.
- the antibody or fragment comprises
- ARGGTRFSPFAY SEQ ID NO:3 (CDR3);
- FQGSHVPWT SEQ ID NO:6 (CDR3).
- the antibody or fragment comprises
- MIHPNSGSTNYNEKFKS SEQ ID NO: 8 (CDR2)
- the framework regions of the light chain and the heavy chain are human framework regions, or have 85%, 90%, 95%, 96%, 97%, 98%, or 99% or more identity thereto.
- the anti-B7-H3 antibody or B7-H3-binding fragment thereof comprises (i) a VH framework comprising the framework sequence of human germline IGHV1-46*01, IGHVl-46*02, IGHVl-46*03, IGHD1-1*01, IGHD1- 26*01, IGHD2-8*01, IGHD3-10*01, IGHD3-22*01, IGHD4-23*01, IGHJ3*01, IGHJ4*01, IGHJ4*03, IGHJ6*01, or IGHJ6*02; and/or (ii) a VL framework comprising the framework sequence of human germline IGKV2-18*01, IGKV2D-29*02, IGKV2-29
- the antibody or fragment has a human heavy chain constant domain, e.g. , a human Fc region.
- the human heavy chain constant domain is derived from a human IgG, such as IgGl, IgG2, IgG3, or IgG4.
- the antibody or fragment comprises a human kappa light chain constant domain.
- the antibody or fragment is a blocking antibody or fragment, or an inhibitory antibody or fragment and it antagonizes a biological activity of B7-H3.
- bispecific antibody comprising an antigen-binding domain of any of the anti-B7-H3 antibodies described herein, and an antigen-binding domain of a monoclonal antibody that binds to a CD3 component of a T-cell receptor (TCR) complex on T cells.
- TCR T-cell receptor
- an isolated nucleic acid or cDNA encoding a complementarity determining region of an anti-B7-H3 antibody that comprises one or more of:
- GYTFTSYWIT (SEQ ID NO: l) (heavy chain CDR1)
- ARGGTRFSPFAY SEQ ID NO:3 (heavy chain CDR3)
- RSSQSIVHSNGNTYLE (SEQ ID NO:4) (light chain CDR1)
- KVSNRFS (SEQ ID NO: 5) (light chain CDR2)
- FQGSHVPWT (SEQ ID NO:6) (light chain CDR3).
- an isolated nucleic acid or cDNA encoding a complementarity determining region of an anti-B7-H3 antibody that comprises one or more of:
- GYTFTSYWMH (SEQ ID NO: 7) (heavy chain CDR1)
- MIHPNSGSTNYNEKFKS (SEQ ID NO: 8) (heavy chain CDR2)
- SASSSVSYMH (SEQ ID NO: 10) (light chain CDR1)
- an isolated nucleic acid or cDNA encoding a complementarity determining region of an anti-B7-H3 antibody that comprises one or more of:
- GYTFTSYWMH (SEQ ID NO:7) (heavy chain CDR1)
- MIHPNSGSTNYNEKFKS (SEQ ID NO: 8) (heavy chain CDR2)
- YYGTNV (SEQ ID NO: 15) (heavy chain CDR3)
- QHIREAYT (SEQ ID NO: 16) (light chain CDR3).
- nucleic acids may be isolated.
- Nucleic acids referred to herein as“isolated” or“purified” are nucleic acids which (1) have been separated away from the nucleic acids of the genomic DNA or cellular RNA of their source of origin; and/or (2) do not occur in nature.
- a vector or host cell comprising the isolated nucleic acid (e.g., cDNA).
- a pharmacological composition comprising any of the antibodies or fragments thereof disclosed herein, and a pharmaceutically acceptable carrier.
- acceptable pharmaceutical carriers include, but are not limited to, additive solution-3 (AS-3), saline, phosphate buffered saline, Ringer's solution, lactated Ringer's solution, Locke-Ringer's solution, Krebs Ringer's solution, Hartmann's balanced saline solution, and heparinized sodium citrate acid dextrose solution.
- compositions or pharmaceutical compositions comprising the antibodies or fragments of antibodies disclosed herein preferably comprise stabilizers to prevent loss of activity or structural integrity of the protein due to the effects of denaturation, oxidation or aggregation over a period of time during storage and transportation prior to use.
- the compositions or pharmaceutical compositions can comprise one or more of any combination of salts, surfactants, pH and tonicity agents such as sugars that can contribute to overcoming aggregation problems.
- a composition or pharmaceutical composition of the present invention is used as an injection, it is desirable to have a pH value in an approximately neutral pH range. It is also advantageous to minimize surfactant levels to avoid bubbles in the formulation which are detrimental for injection into subjects.
- the composition or pharmaceutical composition is in liquid form and stably supports high concentrations of bioactive antibody in solution and is suitable for inhalational or parenteral administration.
- the pharmaceutically acceptable carrier used can depend on the route of administration.
- the pharmaceutical composition can be formulated for administration by any method known in the art.
- the composition or pharmaceutical composition is suitable for intravenous, intramuscular, intraperitoneal, intradermal and/or subcutaneous injection.
- the composition or pharmaceutical composition is in liquid form and has minimized risk of bubble formation and
- composition or pharmaceutical composition is isotonic. In some embodiments, the composition or pharmaceutical composition has a pH of 6.8 to 7.4.
- the invention also provides a method of enhancing immune function in a subject comprising administering to the subject any of the antibodies or fragments thereof disclosed herein in an amount effective to enhance immune function in a subject.
- the subject can have, for example, cancer or an infection.
- the invention further provides a method of treating cancer in a subject comprising administering to the subject any of the antibodies or fragments thereof disclosed herein in an amount effective to treat cancer in a subject.
- the cancer can be, for example, prostate cancer, liver cancer, melanoma, leukemia, breast cancer, ovarian cancer, pancreatic cancer, colorectal cancer, lung cancer, bladder cancer, renal cancer, brain cancer or osteosarcoma, Adrenal Cancer, Anal Cancer, Basal and Squamous Cell Skin Cancer, Bile Duct Cancer, Bladder Cancer, Bone Cancer, Brain and Spinal Cord Tumors, Breast Cancer, Cervical Cancer, Colorectal Cancer, Endometrial Cancer, Esophagus Cancer, Ewing Family of Tumors, Eye Cancer (Ocular Melanoma), Gallbladder Cancer, Gastrointestinal
- Neuroendocrine (Carcinoid) Tumors Gastrointestinal Stromal Tumor (GIST), Gestational Trophoblastic Disease, Kaposi Sarcoma, Kidney Cancer, Laryngeal and Hypopharyngeal Cancer, Liver Cancer, Lung Cancer, Lung Carcinoid Tumor, Malignant Mesothelioma, Melanoma Skin Cancer, Merkel Cell Skin Cancer, Nasal Cavity and Paranasal Sinuses Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Small Cell Lung Cancer, neoplasm of the central nervous system (CNS), Oral Cavity and Oropharyngeal Cancer,
- Osteosarcoma Ovarian Cancer, Pancreatic Cancer, Pancreatic Neuroendocrine Tumor (NET), Penile Cancer, Pituitary Tumors, Prostate Cancer, Retinoblastoma,
- myeloproliferative/myelodysplastic syndromes chronic myelomonocytic leukemia, atypical chronic myeloid leukemia, juvenile myelomonocytic leukemia, unclassifiable
- lymphoid neoplasms myeloproliferative/myelodysplatic syndromes, lymphoid neoplasms, precursor lymphoid neoplasms, B lymphoblastic leukemia, B lymphoblastic lymphoma, T lymphoblastic leukemia, T lymphoblastic lymphoma, mature B-cell neoplasms, diffuse large B-cell lymphoma, primary central nervous system lymphoma, primary mediastinal B-cell lymphoma, Burkitt lymphoma/leukemia, follicular lymphoma, chronic lymphocytic leukemia, small lymphocytic lymphoma, B-cell prolymphocytic leukemia,
- lymphoplasmacytic lymphoma Waldenstrom macroglobulinemia, mantle cell lymphoma, marginal zone lymphomas, post-transplant lymphoproliferative disorders, HIV-associated lymphomas, primary effusion lymphoma, intravascular large B-cell lymphoma, primary cutaneous B-cell lymphoma, hairy cell leukemia, multiple myeloma, monoclonal gammopathy of unknown significance (MGUS), smoldering multiple myeloma, or solitary plasmacytomas (solitary bone and extramedullary).
- MGUS monoclonal gammopathy of unknown significance
- the cancer may be, e.g., at an early, intermediate, late, locally advanced, or metastatic stage, and may be relapsed or refractory to other therapeutics or there may be no standard therapy available.
- to “treat” a cancer means to reduce the number of cancer cells or metastases in an organ or tissue, and/or to delay growth of a tumor, and/or to kill tumor cells, metastatic tumor cells or tumor cells that are likely to metastasize, and/or to prevent or reduce the spread of cancerous cells from an original site in the body to another site in the body, and/or to inhibit the progression of metastatic cancer, and/or to prevent the reoccurrence of metastasis, and/or to slow or decrease disease progression, and/or to increase survival.
- the invention further provides a method of treating an infection in a subject comprising administering to the subject any of the antibodies or fragments thereof disclosed herein in an amount effective to treat an infection in a subject.
- the infection can be caused, for example, by a virus, viroid, bacterium, prion, nematode, arthropod, fungus or protozoa.
- to“treat” an infection means to reduce a sign or symptom of the infection and/or to reduce the number of infectious pathogens in a subject.
- the present disclosure invention also contemplates the use of sequences (e.g., the six CDR or VH and VL sequences) of an antibody or fragment described herein in the preparation of a chimeric antigen receptor, which may be for use in CAR-T technology.
- sequences e.g., the six CDR or VH and VL sequences
- the antibodies and fragments thereof, compositions, and bi- specific binding molecules of the present invention may be used in a method of treatment as described herein, may be for use in a treatment as described herein, and/or may be for use in the manufacture of a medicament for a treatment as described herein.
- the present invention also provides kits and articles of manufacture comprising the antibodies and antigen-binding portions thereof, compositions, and bi-specific binding molecules described herein.
- any of the anti-B7-H3 antibodies or fragments thereof disclosed herein can further comprise a detectable marker conjugated thereto, such as a fluorescent or radioactive label.
- a detectable marker conjugated thereto such as a fluorescent or radioactive label.
- a method of detecting B7-H3 positive cells in a subject comprising administering the antibody or fragment (e.g., labeled with a detectable marker) to the subject in an amount effective to bind detectably to B7-H3 positive cells, and then detecting the presence of the antibody or fragment in the subject, thereby detecting B7-H3 positive cells in the subject.
- a label can be detected, for example, by imaging.
- the B7-H3 positive cells can be, for example, cancer cells.
- ADC compositions according to the present disclosure may include an antibody or fragment thereof according to the present disclosure in combination with, e.g., a cytotoxic agent and a linker.
- Cytotoxic agents that may be used include, but are not limited to, alkylating agents, bifunctional alkylators, monofunctional alkylators, anthracy dines, cytoskeletal disruptors, taxanes, epothilones, histone deacetylase inhibitors, topoisomerase I inhibitors, topoisomerase II inhibitors, kinase inhibitors, nucleotide analogs, nucleotide precursor analogs, peptide antibiotics, platinum-based agents, retinoids, vinca alkaloids and derivatives thereof, actinomycin, all-trans retinoic acid, azacytidine, azathioprine, bleomycin, bortezomib, carboplatin, capecitabine, cisplatin, chlorambucil, cyclophosphamide, cytarabine, daunorubicin, docetaxel, doxifluridine, doxorubicin, epirubicin,
- ADCs according to the present disclosure may include an antibody or a fragment thereof according to the present disclosure linked (e.g., covalently) to a small molecule or a drug.
- the term“antibody” refers to an intact antibody, /. e.. with complete Fc and Fv regions. From N-terminus to C-terminus, both the mature light and heavy chain variable domains comprise the regions FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is in accordance with the definitions of Rabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), Chothia & Lesk, J. Mol. Biol. 196:901-917 (1987), or Chothia et al, Nature 342:878-883 (1989).
- “Fragment” refers to any portion of an antibody, or portions of an antibody linked together, such as, in non-limiting examples, a Fab, F(ab)2, or a single-chain Fv (scFv), which is less than the whole antibody but which is an antigen-binding portion and which competes with the intact antibody of which it is a fragment for specific binding.
- the antigen is the human B7-H3 IgV domain.
- Such fragments can be prepared, for example, by cleaving an intact antibody or by recombinant means. See generally, Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)).
- Antigen-binding fragments may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies or by molecular biology techniques.
- a fragment is an Fab, Fab', F(ab')2, Fd, Fv,
- CDR complementarity determining region
- scFv single-chain antibody
- VL variable domain light chain
- VH variable domain heavy chain
- an Fd fragment means an antibody fragment that consists of the VH and CHI domains; an Fv fragment consists of the VI and VH domains of a single arm of an antibody; and a dAb fragment (Ward et al., Nature 341:544-546 (1989) hereby incorporated by reference in its entirety) consists of a VH domain.
- fragments are at least 5, 6, 8, or 10 amino acids long.
- the fragments are at least 14, at least 20, at least 50, or at least 70, 80, 90, 100, 150, or 200 amino acids long.
- an scFv described herein comprises a variable domain framework sequence having a sequence identical to a human variable domain FR1, FR2, FR3 and/or FR4.
- the scFv comprises a linker peptide from 5 to 30 amino acid residues long.
- the scFv comprises a linker peptide comprising one or more of glycine, serine and threonine residues.
- the linker of the scFv is 10-25 amino acids in length.
- the peptide linker comprises glycine, serine and/or threonine residues. For example, see Bird et al, Science, 242: 423-426 (1988) and Huston et al, Proc. Natl. Acad. Sci. USA, 85:5879-5883 (1988).
- the term“monoclonal antibody” as used herein refers to an antibody member of a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible mutations, e.g., naturally occurring mutations, that may be present in minor amounts.
- the modifier e.g., naturally occurring mutations, that may be present in minor amounts.
- monoclonal indicates the character of the antibody as not being a mixture of discrete antibodies.
- such a monoclonal antibody typically includes an antibody comprising a polypeptide sequence that binds a human B7-H3 IgV domain.
- each antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- monoclonal antibody preparations are advantageous in that they are typically uncontaminated by other immunoglobulins.
- an identified monoclonal antibody can be produced by non-hybridoma techniques, e.g., by appropriate recombinant means once the sequence thereof is identified.
- the antibody or fragment is isolated.
- the term“isolated antibody” or“isolated antigen-binding fragment” refers to an antibody or fragment that by virtue of its origin or source of derivation has one, two, three or four of the following properties: (1) is not associated with naturally associated components that accompany it in its native state, (2) is free of other proteins from the same species, (3) is expressed by a cell from a different species, and (4) does not occur in nature absent the hand of man.
- the antibody is humanized. “Humanized” forms of non human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
- a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from a hypervariable region (HVR) (or CDR) of the recipient are replaced by residues from a HVR (or CDR) of a non-human species (donor antibody) such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and/or capacity.
- HVR hypervariable region
- donor antibody such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and/or capacity.
- the antibody has 1, 2, 3, 4, 5, or all 6 CDRs (CDRl-3 of both the heavy and light chain) of the murine antibodies described herein.
- framework (FR) residues of the murine mAh are replaced with corresponding human immunoglobulin variable domain framework (FR) residues.
- FR immunoglobulin variable domain framework
- humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. In some embodiments, the humanized antibodies do not comprise residues that are not found in the recipient antibody or in the donor antibody.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all, or in embodiments substantially all, of the hypervariable loops correspond to those of a non human immunoglobulin, and all, or in embodiments substantially all, of the FRs are those of a human immunoglobulin sequence.
- the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. See, e.g., Jones et al, Nature 321:522-525 (1986); Riechmann et al, Nature 332:323-329 (1988); Presta, Curr. Op. Struct. Biol.
- the Fc regions of the antibodies may be modified as described in WO 99/58572, the content of which is hereby incorporated by reference in its entirety.
- the antibody constant region can be engineered such that it is immunologically inert (e.g., does not trigger complement lysis). See, e.g., PCT Publication No. W099/58572; UK Patent Application No. 9809951.8.
- Other methods of humanizing antibodies that may also be utilized are disclosed by Daugherty et al, Nucl. Acids Res. 19: 2471-2476 (1991) and in U.S. Pat. Nos. 6,180,377; 6,054,297; 5,997,867; 5,866,692;
- the antibodies or fragments herein can be produced recombinantly; for example, antibodies expressed using a recombinant expression vector transfected into a host cell, antibodies isolated from a recombinant, combinatorial human antibody library, antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes, etc.
- K d is intended to refer to the dissociation constant of an antibody-antigen interaction.
- the affinity constant is the inverted dissociation constant.
- One way of determining the Kd or binding affinity of antibodies to the B7-H3 IgV domain is by measuring binding affinity of monofunctional Fab fragments of the antibody.
- an antibody for example, IgG
- an antibody can be cleaved with papain or expressed recombinantly.
- the affinity of a fragment of an anti-human B7-H3 IgV domain antibody can be determined, for example, by surface plasmon resonance
- CM5 chips can be activated with N-ethyl-N’-(3-dimethylaminopropyl)-carbodiinide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions.
- EDC N-ethyl-N’-(3-dimethylaminopropyl)-carbodiinide hydrochloride
- NHS N-hydroxysuccinimide
- the antigen can be diluted into 10 mM sodium acetate pH 4.0 and injected over the activated chip at a concentration of 0.005 mg/mL.
- two ranges of antigen density can be achieved: 100-200 response units (RU) for detailed kinetic studies and 500-600 RU for screening assays.
- An antibody or a polypeptide that“specifically binds” to an epitope is a term well understood in the art, and methods to determine such specific or preferential binding are also well known in the art.
- a molecular entity is said to exhibit“specific binding” or “preferential binding” if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances.
- An antibody“specifically binds” or“preferentially binds” to a target if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances.
- an antibody that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target.
- “specific binding” or“preferential binding” does not necessarily require (although it can include) exclusive binding.
- an antibody is said to specifically bind to an antigen when the Kd is ⁇ 1 mM, preferably ⁇ 100 nM.
- antibodies can be assigned to different classes.
- the antibody or fragment can be, e.g., any of an IgG, IgD, IgE, IgA or IgM antibody or fragment thereof, respectively.
- the antibody is an immunoglobulin G.
- the antibody fragment is a fragment of an immunoglobulin G.
- the antibody is an IgGl, IgG2, IgG2a, IgG2b, IgG3 or IgG4.
- the antibody comprises sequences from a human IgGl, human IgG2, human IgG2a, human IgG2b, human IgG3 or human IgG4.
- a combination of any of these antibody subtypes can also be used.
- One consideration in selecting the type of antibody to be used is the desired serum half-life of the antibody.
- an IgG generally has a serum half-life of 23 days, IgA 6 days, IgM 5 days, IgD 3 days, and IgE 2 days. (Abbas AK, Lichtman AH, Pober JS. Cellular and Molecular Immunology, 4th edition, W.B. Saunders Co., Philadelphia, 2000, hereby incorporated by reference in its entirety).
- The“variable region” or“variable domain” of an antibody refers to the amino- terminal domain of the heavy or light chain of the antibody.
- the variable domain of the heavy chain may be referred to as“VH.”
- the variable domain of the light chain may be referred to as“VL.” These domains are generally the most variable parts of an antibody and contain the antigen-binding sites.
- the term“variable” refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions (HVRs) (or CDRs) both in the light chain and the heavy chain variable domains.
- HVRs hypervariable regions
- variable domains The more highly conserved portions of variable domains are called the framework regions (FR).
- the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
- the CDRs in each chain are held together in close proximity by the FR regions, and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Rabat et al, Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md.
- The“light chains” of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains.
- “Framework” or“FR” residues are those variable domain residues other than the HVR residues as herein defined.
- hypervariable region or“HVR” or“CDR” when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
- antibodies comprise six CDRs; three in the VH (HI, H2, H3) and three in the VL (LI, L2, L3).
- H3 and L3 display the most diversity of the six CDRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies.
- the Rabat Complementarity Determining Regions are based on sequence variability and are the most commonly used (Rabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991) hereby incorporated by reference in its entirety). There are CDRs 1, 2, and 3 for each of the heavy and light chains. Chothia refers instead to the location of the structural loops (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). The AbM CDRs represent a compromise between the Rabat CDRs and Chothia structural loops and are used by Oxford Molecular’s AbM antibody modeling software.
- CDRs are based on an analysis of the available complex crystal structures.
- CDRs may comprise“extended CDRs” as follows: 24-36 or 24- 34 (LI), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (HI), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH.
- the variable domain residues are numbered according to Rabat et al., supra, for each of these definitions.
- the term“Fc region” herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
- the C- terminal lysine of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, an intact antibody as used herein may be an antibody with or without the otherwise C-terminal lysine.
- the subject can be any mammal and is preferably a human.
- human B7-H3 has the following amino acid sequence
- IgV domain is the functional domain of B7-H3
- human B7-H3 IgV-Ig fusion protein was generated by fusing the B7-H3 IgV coding region (E35-A139) to a human IgGl Fc tag of plasmid pMT/BiP as previously described (17).
- the fusion protein was expressed in a S2 system and then purified. Mice were immunized with the B7-H3 IgV-Ig fusion protein, and hybridomas were generated by standard techniques from splenocytes fused to NSO myeloma cells. Characterization of mAbs 8B12 and 12B4
- Monoclonal antibodies (mAbs) 8B12 and 12B4 were generated.
- 8B12 is an IgG3 with a kappa light chain
- 12B4 is an IgG2b with a kappa light chain.
- 8B12 was sequenced and found to have unique VH and VL sequences.
- the polypeptide and coding sequences of 8B12 are listed below:
- 8B12 heavy chain VH Leader sequence-FRl -CDR1 -FR2-CDR2-FR3 -CDR3 -FR4 (Leader sequence bolded, CDRsl-3 underlined):
- Amino acid sequence (139 aa; SEQ ID NO: 19)
- Amino acid sequence (138 aa; SEQ ID NO:21)
- polypeptide and coding sequences of 12B4 are listed below:
- Amino acid sequence (138 aa; SEQ ID NO:23) MGWSCIMFFLVATATGVHSOVOLOOPGAELVKPGASVKLSCKASGYTFTS
- Amino acid sequence (131 aa; SEQ ID NO:25)
- polypeptide and coding sequences of 24D12 are listed below:
- 24D12 heavy chain VH Leader sea uence-FRl-CDRl -FR2-CDR2-FR3 -CDR3 -FR4 (Leader sequence bolded, CDRsl-3 underlined):
- Amino acid sequence (133 aa; SEQ ID NO:27)
- Amino acid sequence (132 aa; SEQ ID NO:29)
- Zhao, R., et al. HHLA2 is a member of the B7 family and inhibits human CD4 and CD8 T-cell function. Proc Natl Acad Sci U S A 110, 9879-9884 (2013).
Landscapes
- Health & Medical Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Life Sciences & Earth Sciences (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present disclosure provides monoclonal antibodies that bind to an IgV domain of human B7-H3. Also provided are methods of using these antibodies in treating cancer and infection and in imaging B7-H3 positive cells.
Description
MONOCLONAL ANTIBODIES AGAINST IgV DOMAIN OF B7-H3
AND USES THEREOF
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application claims the benefit of U.S. Provisional Patent Application No. 62/768,128, filed on November 16, 2018, the contents of which are herein incorporated by reference in their entirety into the present application.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on November 15, 2019, is named SequenceListing.txt and is 19,181 bytes in size.
BACKGROUND OF THE INVENTION
[0003] Throughout this application, various publications are referred to in parentheses. Full citations for these references may be found at the end of the specification. The disclosures of these publications are hereby incorporated by reference in their entirety into the subject application to more fully describe the art to which the subject invention pertains.
[0004] B7-H3 is a type I transmembrane protein and belongs to the B7 family. B7-H3 is overexpressed in human malignancies (1,2) including prostate cancer (3), liver cancer (4), melanoma (5), leukemia (6), breast cancer (7), ovarian cancer (8), pancreatic cancer (9), colorectal cancer (10), lung cancer (11), bladder cancer (12), renal cancer (13), brain cancer (14), and osteosarcoma (15). Several studies have correlated high B7-H3 expression levels with poor prognosis (1,2). These studies suggest that B7-H3 is an immune checkpoint used by human cancer cells to inhibit functions of immune cells (1,2). The extracellular part of B7-H3 is composed of IgV-IgC-IgV-IgC or IgV-IgC. Previous studies showed that the FG loop of the IgV domain of B7-H3 plays a critical role in B7-H3-mediated T cell suppression (16).
[0005] Cancers and infection are serious public health problems in the U.S. and other countries. The present invention provides antibodies that may be used in treating these diseases.
SUMMARY OF THE INVENTION
[0006] The present disclosure provides a monoclonal antibody or an antigen-binding fragment thereof that specifically binds to an IgV domain of a human B7-H3.
[0007] In some embodiments, the antibody comprises (a) a heavy chain having complementarity determining region (CDR) 1 comprising GYTFTSYWIT (SEQ ID NO: l), CDR2 comprising DIYPGSGSTNYNEKFKS (SEQ ID NO:2), and/or HCDR3 comprising ARGGTRFSPFAY (SEQ ID NO:3) (CDR3); and/or (b) a light chain having CDR (CDR) 1 comprising RSSQSIVHSNGNTYLE (SEQ ID NO:4), CDR2 comprising KVSNRFS (SEQ ID NO:5), and/or CDR3 comprising FQGSHVPWT (SEQ ID NO:6). In further embodiments, the antibody comprises a heavy chain variable domain (VH) and/or a light chain variable domain (VL) comprising amino acid sequences set forth in SEQ ID NOs: 14 and 16, respectively, without the leader sequences.
[0008] In some embodiments, the antibody comprises (a) a heavy chain having CDR1 comprising GYTFTSYWMH (SEQ ID NO:7), CDR2 comprising
MIHPNSGSTNYNEKFKS (SEQ ID NO: 8), and/or CDR3 comprising YYYGSSYAMDY (SEQ ID NO:9) (CDR3); and/or (b) a light chain having CDR1 comprising SASSSVSYMH (SEQ ID NO: 10), CDR2 comprising STSNLAS (SEQ ID NO: 11), and/or CDR3 comprising QQRSSYPYT (SEQ ID NO: 12). In further embodiments, the antibody comprises a VH and/or a VL comprising amino acid sequences set forth in SEQ ID NOs: 18 and 20, respectively, without the leader sequences.
[0009] In some embodiments, the antibody comprises (a) a heavy chain having CDR1 comprising GYTFTSYWMH (SEQ ID NO:7); CDR2 comprising
MIHPNSGSTNYNEKFKS (SEQ ID NO: 8), and/or CRD3 comprising YYGTNV (SEQ ID NO: 15); and/or (b) a light chain having CDR1 comprising KSVSTSGYSYMH (SEQ ID NO: 13), CDR2 comprising LVSNLES (SEQ ID NO: 14), and/or CDR3 comprising QHIREAYT (SEQ ID NO: 16). In further embodiments, the antibody comprises a VH and/or VL comprising amino acid sequences set forth in SEQ ID NOS: 23 and 25, respectively, without the leader sequences.
[0010] In some embodiments, the antibody competes with the above antibody or a fragment thereof for binding to the IgV domain of human B7-H3.
[0011] In certain embodiments, the antibody is a humanized antibody or a chimeric antibody.
[0012] Also provided are uses of the antibody or fragment for treating cancers and infections and imaging B7-H3 positive cells.
BRIEF DESCRIPTION OF THE DRAWINGS
[0013] FIGs. 1A-1B. FACS shows that mAh 8B12 (FIG 1A) and 12B4 (FIG IB) bind to endogenous B7-H3 expressed by human cancer lines PC3 (left) and MDA-MB231 (right). 8B12 or 12B4 50B5 (right histograms in each pair) or mouse IgG isotype controls (left histograms in each pair).
[0014] FIG. 2. FACS shows that both dendritic cells (left) and activated T cells (right) express B7-H3. A mAh against B7-H3 (right histograms in each pair) or mouse IgG isotype control (left histograms in each pair).
[0015] FIGs. 3A-3B. mAh 8B12 (FIG. 3A) and 12B4 (FIG. 3B) are able to regulate cytokine production from T cells in a mixed lymphocyte reaction assay. N= 2-4.
DETAILED DESCRIPTION OF THE INVENTION
[0016] The invention provides a monoclonal antibody or an antigen-binding fragment thereof that binds to an IgV domain of a human B7-H3, comprising:
I) a) a heavy chain comprising one or more of:
GYTFTSYWIT (SEQ ID NO: l) (complementarity determining region (CDR), CDR1), or
DIYPGSGSTNYNEKFKS (SEQ ID NO:2) (CDR2), or
ARGGTRFSPFAY (SEQ ID NO:3) (CDR3); and
b) a light chain comprising one or more of:
RSSQSIVHSNGNTYLE (SEQ ID NO:4) (CDR1), or
KVSNRFS (SEQ ID NO:5) (CDR2), or
FQGSHVPWT (SEQ ID NO:6) (CDR3); or
II) a) a heavy chain comprising one or more of:
GYTFTSYWMH (SEQ ID NO:7) (CDR1), or
MIHPNSGSTNYNEKFKS (SEQ ID NO: 8) (CDR2), or
YYYGSSYAMDY (SEQ ID NO:9) (CDR3); and
b) a light chain comprising one or more of:
SASSSVSYMH (SEQ ID NO: 10) (CDR1), or
STSNLAS (SEQ ID NO: 11) (CDR2), or
QQRSSYPYT (SEQ ID NO: 12) (CDR3); or
III) an antibody or fragment thereof that competes with the antibody or fragment of I) or II) for binding to the IgV domain of human B7-H3.
[0017] The B7-H3 IgV domain-binding fragment can be, for example, a Fab, F(ab)2, or scFv fragment.
[0018] In some embodiments, the antibody or fragment comprises
a heavy chain comprising
GYTFTSYWIT (SEQ ID NO: l) (CDR1),
DIYPGSGSTNYNEKFKS (SEQ ID NO:2) (CDR2), and
ARGGTRFSPFAY (SEQ ID NO:3) (CDR3); and
a light chain comprising
RSSQSIVHSNGNTYLE (SEQ ID NO:4) (CDR1),
KVSNRFS (SEQ ID NO:5) (CDR2), and
FQGSHVPWT (SEQ ID NO:6) (CDR3).
[0019] In some embodiments, the antibody or fragment comprises
a) a heavy chain comprising
GYTFTSYWMH (SEQ ID NO: 7) (CDR1),
MIHPNSGSTNYNEKFKS (SEQ ID NO: 8) (CDR2), and
YYYGSSYAMDY (SEQ ID NO:9) (CDR3); and
b) a light chain comprising
SASSSVSYMH (SEQ ID NOTO) (CDR1),
STSNLAS (SEQ ID NO: 11) (CDR2), and
QQRSSYPYT (SEQ ID NO: 12) (CDR3).
[0020] In certain embodiments, the framework regions of the light chain and the heavy chain are human framework regions, or have 85%, 90%, 95%, 96%, 97%, 98%, or 99% or more identity thereto. In certain embodiments, the anti-B7-H3 antibody or B7-H3-binding fragment thereof comprises (i) a VH framework comprising the framework sequence of human germline IGHV1-46*01, IGHVl-46*02, IGHVl-46*03, IGHD1-1*01, IGHD1- 26*01, IGHD2-8*01, IGHD3-10*01, IGHD3-22*01, IGHD4-23*01, IGHJ3*01, IGHJ4*01, IGHJ4*03, IGHJ6*01, or IGHJ6*02; and/or (ii) a VL framework comprising the framework sequence of human germline IGKV2-18*01, IGKV2D-29*02, IGKV2-29*03, IGKV3- 11*01, IGKV3-15*01, IGKV3-20*02, IGKJ1*01, IGKJ2*01, IGKJ4*01, or IGKJ4*02.
[0021] In certain embodiments, the antibody or fragment has a human heavy chain constant domain, e.g. , a human Fc region. In some embodiments, the human heavy chain
constant domain is derived from a human IgG, such as IgGl, IgG2, IgG3, or IgG4. In some embodiments, the antibody or fragment comprises a human kappa light chain constant domain.
[0022] In particular embodiments, the antibody or fragment is a blocking antibody or fragment, or an inhibitory antibody or fragment and it antagonizes a biological activity of B7-H3.
[0023] Also provided is a bispecific antibody comprising an antigen-binding domain of any of the anti-B7-H3 antibodies described herein, and an antigen-binding domain of a monoclonal antibody that binds to a CD3 component of a T-cell receptor (TCR) complex on T cells.
[0024] Also provided is an isolated nucleic acid or cDNA encoding a complementarity determining region of an anti-B7-H3 antibody that comprises one or more of:
GYTFTSYWIT (SEQ ID NO: l) (heavy chain CDR1),
DIYPGSGSTNYNEKFKS (SEQ ID NO:2) (heavy chain CDR2),
ARGGTRFSPFAY (SEQ ID NO:3) (heavy chain CDR3),
RSSQSIVHSNGNTYLE (SEQ ID NO:4) (light chain CDR1),
KVSNRFS (SEQ ID NO: 5) (light chain CDR2), and
FQGSHVPWT (SEQ ID NO:6) (light chain CDR3).
[0025] Also provided is an isolated nucleic acid or cDNA encoding a complementarity determining region of an anti-B7-H3 antibody that comprises one or more of:
GYTFTSYWMH (SEQ ID NO: 7) (heavy chain CDR1),
MIHPNSGSTNYNEKFKS (SEQ ID NO: 8) (heavy chain CDR2),
YYYGSSYAMDY (SEQ ID NO:9) (heavy chain CDR3),
SASSSVSYMH (SEQ ID NO: 10) (light chain CDR1),
STSNLAS (SEQ ID NO: 11) (light chain CDR2), and
QQRSSYPYT (SEQ ID NO: 12) (light chain CDR3).
[0026] Also provided is an isolated nucleic acid or cDNA encoding a complementarity determining region of an anti-B7-H3 antibody that comprises one or more of:
GYTFTSYWMH (SEQ ID NO:7) (heavy chain CDR1),
KSVSTSGYSYMH (SEQ ID NO: 13) (light chain CDR1),
MIHPNSGSTNYNEKFKS (SEQ ID NO: 8) (heavy chain CDR2),
LVSNLES (SEQ ID NO: 14) (light chain CDR2),
YYGTNV (SEQ ID NO: 15) (heavy chain CDR3), and
QHIREAYT (SEQ ID NO: 16) (light chain CDR3).
[0027] In any of the above embodiments, the nucleic acids may be isolated. Nucleic acids referred to herein as“isolated” or“purified” are nucleic acids which (1) have been separated away from the nucleic acids of the genomic DNA or cellular RNA of their source of origin; and/or (2) do not occur in nature.
[0028] Also provided is a vector or host cell comprising the isolated nucleic acid (e.g., cDNA).
[0029] Also provided is method of producing an anti-B7-H3 IgV domain antibody or B7-H3 IgV domain-binding fragment thereof, comprising culturing the host cell described herein, under conditions wherein the anti-B7-H3 IgV domain antibody or B7-H3 IgV domain-binding fragment is produced by the host cell.
[0030] Still further provided is a pharmacological composition comprising any of the antibodies or fragments thereof disclosed herein, and a pharmaceutically acceptable carrier. Examples of acceptable pharmaceutical carriers include, but are not limited to, additive solution-3 (AS-3), saline, phosphate buffered saline, Ringer's solution, lactated Ringer's solution, Locke-Ringer's solution, Krebs Ringer's solution, Hartmann's balanced saline solution, and heparinized sodium citrate acid dextrose solution.
[0031] Compositions or pharmaceutical compositions comprising the antibodies or fragments of antibodies disclosed herein preferably comprise stabilizers to prevent loss of activity or structural integrity of the protein due to the effects of denaturation, oxidation or aggregation over a period of time during storage and transportation prior to use. The compositions or pharmaceutical compositions can comprise one or more of any combination of salts, surfactants, pH and tonicity agents such as sugars that can contribute to overcoming aggregation problems. Where a composition or pharmaceutical composition of the present invention is used as an injection, it is desirable to have a pH value in an approximately neutral pH range. It is also advantageous to minimize surfactant levels to avoid bubbles in the formulation which are detrimental for injection into subjects. In some embodiments, the composition or pharmaceutical composition is in liquid form and stably supports high concentrations of bioactive antibody in solution and is suitable for inhalational or parenteral administration.
[0032] The pharmaceutically acceptable carrier used can depend on the route of administration. The pharmaceutical composition can be formulated for administration by any method known in the art. In some embodiments, the composition or pharmaceutical
composition is suitable for intravenous, intramuscular, intraperitoneal, intradermal and/or subcutaneous injection. In some embodiments, the composition or pharmaceutical composition is in liquid form and has minimized risk of bubble formation and
anaphylactoid side effects. In some embodiments, the composition or pharmaceutical composition is isotonic. In some embodiments, the composition or pharmaceutical composition has a pH of 6.8 to 7.4.
[0033] The invention also provides a method of enhancing immune function in a subject comprising administering to the subject any of the antibodies or fragments thereof disclosed herein in an amount effective to enhance immune function in a subject. The subject can have, for example, cancer or an infection.
[0034] The invention further provides a method of treating cancer in a subject comprising administering to the subject any of the antibodies or fragments thereof disclosed herein in an amount effective to treat cancer in a subject. The cancer can be, for example, prostate cancer, liver cancer, melanoma, leukemia, breast cancer, ovarian cancer, pancreatic cancer, colorectal cancer, lung cancer, bladder cancer, renal cancer, brain cancer or osteosarcoma, Adrenal Cancer, Anal Cancer, Basal and Squamous Cell Skin Cancer, Bile Duct Cancer, Bladder Cancer, Bone Cancer, Brain and Spinal Cord Tumors, Breast Cancer, Cervical Cancer, Colorectal Cancer, Endometrial Cancer, Esophagus Cancer, Ewing Family of Tumors, Eye Cancer (Ocular Melanoma), Gallbladder Cancer, Gastrointestinal
Neuroendocrine (Carcinoid) Tumors, Gastrointestinal Stromal Tumor (GIST), Gestational Trophoblastic Disease, Kaposi Sarcoma, Kidney Cancer, Laryngeal and Hypopharyngeal Cancer, Liver Cancer, Lung Cancer, Lung Carcinoid Tumor, Malignant Mesothelioma, Melanoma Skin Cancer, Merkel Cell Skin Cancer, Nasal Cavity and Paranasal Sinuses Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Small Cell Lung Cancer, neoplasm of the central nervous system (CNS), Oral Cavity and Oropharyngeal Cancer,
Osteosarcoma, Ovarian Cancer, Pancreatic Cancer, Pancreatic Neuroendocrine Tumor (NET), Penile Cancer, Pituitary Tumors, Prostate Cancer, Retinoblastoma,
Rhabdomyosarcoma, Salivary Gland Cancer, Skin Cancer, Small Cell Lung Cancer, Small Intestine Cancer, Soft Tissue Sarcoma, Stomach Cancer, Testicular Cancer, Thymus Cancer, Thyroid Cancer, Uterine Sarcoma, Vaginal Cancer, Vulvar Cancer, Waldenstrom Macroglobulinemia, Wilms Tumor, squamous cell cancer, environmentally induced cancers, combinations of the cancers, metastatic lesions of cancers, myeloid neoplasm, acute myeloid leukemia (AML), AML with recurrent genetic abnormalities, AML with
myelodysplasia-related changes, therapy-related AML, acute leukemias of ambiguous lineage, myeloproliferative neoplasm, essential thrombocythemia, polycythemia vera, myelofibrosis (MF), primary myelofibrosis, systemic mastocytosis, myelodysplastic syndromes (MDS), myeloproliferative/myelodysplastic syndromes, chronic myeloid leukemia, chronic neutrophilic leukemia, chronic eosinophilic leukemia, myelodysplastic syndromes (MDS), refractory anemia with ringed sideroblasts, refractory cytopenia with multilineage dysplasia, refractory anemia with excess blasts (type 1), refractory anemia with excess blasts (type 2), MDS with isolated del (5q), unclassifiable MDS,
myeloproliferative/myelodysplastic syndromes, chronic myelomonocytic leukemia, atypical chronic myeloid leukemia, juvenile myelomonocytic leukemia, unclassifiable
myeloproliferative/myelodysplatic syndromes, lymphoid neoplasms, precursor lymphoid neoplasms, B lymphoblastic leukemia, B lymphoblastic lymphoma, T lymphoblastic leukemia, T lymphoblastic lymphoma, mature B-cell neoplasms, diffuse large B-cell lymphoma, primary central nervous system lymphoma, primary mediastinal B-cell lymphoma, Burkitt lymphoma/leukemia, follicular lymphoma, chronic lymphocytic leukemia, small lymphocytic lymphoma, B-cell prolymphocytic leukemia,
lymphoplasmacytic lymphoma, Waldenstrom macroglobulinemia, mantle cell lymphoma, marginal zone lymphomas, post-transplant lymphoproliferative disorders, HIV-associated lymphomas, primary effusion lymphoma, intravascular large B-cell lymphoma, primary cutaneous B-cell lymphoma, hairy cell leukemia, multiple myeloma, monoclonal gammopathy of unknown significance (MGUS), smoldering multiple myeloma, or solitary plasmacytomas (solitary bone and extramedullary). The cancer may be, e.g., at an early, intermediate, late, locally advanced, or metastatic stage, and may be relapsed or refractory to other therapeutics or there may be no standard therapy available. As used herein, to “treat” a cancer means to reduce the number of cancer cells or metastases in an organ or tissue, and/or to delay growth of a tumor, and/or to kill tumor cells, metastatic tumor cells or tumor cells that are likely to metastasize, and/or to prevent or reduce the spread of cancerous cells from an original site in the body to another site in the body, and/or to inhibit the progression of metastatic cancer, and/or to prevent the reoccurrence of metastasis, and/or to slow or decrease disease progression, and/or to increase survival.
[0035] The invention further provides a method of treating an infection in a subject comprising administering to the subject any of the antibodies or fragments thereof disclosed herein in an amount effective to treat an infection in a subject. The infection can be caused,
for example, by a virus, viroid, bacterium, prion, nematode, arthropod, fungus or protozoa. As used herein, to“treat” an infection means to reduce a sign or symptom of the infection and/or to reduce the number of infectious pathogens in a subject.
[0036] The present disclosure invention also contemplates the use of sequences (e.g., the six CDR or VH and VL sequences) of an antibody or fragment described herein in the preparation of a chimeric antigen receptor, which may be for use in CAR-T technology.
[0037] It is understood that the antibodies and fragments thereof, compositions, and bi- specific binding molecules of the present invention may be used in a method of treatment as described herein, may be for use in a treatment as described herein, and/or may be for use in the manufacture of a medicament for a treatment as described herein. The present invention also provides kits and articles of manufacture comprising the antibodies and antigen-binding portions thereof, compositions, and bi-specific binding molecules described herein.
[0038] Any of the anti-B7-H3 antibodies or fragments thereof disclosed herein can further comprise a detectable marker conjugated thereto, such as a fluorescent or radioactive label. Also provided is a method of detecting B7-H3 positive cells in a subject comprising administering the antibody or fragment (e.g., labeled with a detectable marker) to the subject in an amount effective to bind detectably to B7-H3 positive cells, and then detecting the presence of the antibody or fragment in the subject, thereby detecting B7-H3 positive cells in the subject. A label can be detected, for example, by imaging. The B7-H3 positive cells can be, for example, cancer cells.
[0039] Any of the anti-B7-H3 antibodies or fragments thereof disclosed herein can further be included in an antibody-drug conjugate (“ADC”). ADC compositions according to the present disclosure may include an antibody or fragment thereof according to the present disclosure in combination with, e.g., a cytotoxic agent and a linker. Cytotoxic agents that may be used include, but are not limited to, alkylating agents, bifunctional alkylators, monofunctional alkylators, anthracy dines, cytoskeletal disruptors, taxanes, epothilones, histone deacetylase inhibitors, topoisomerase I inhibitors, topoisomerase II inhibitors, kinase inhibitors, nucleotide analogs, nucleotide precursor analogs, peptide antibiotics, platinum-based agents, retinoids, vinca alkaloids and derivatives thereof, actinomycin, all-trans retinoic acid, azacytidine, azathioprine, bleomycin, bortezomib, carboplatin, capecitabine, cisplatin, chlorambucil, cyclophosphamide, cytarabine, daunorubicin, docetaxel, doxifluridine, doxorubicin, epirubicin, epothilone, etoposide, fluorouracil, gemcitabine, hydroxyurea, idarubicin, imatinib, irinotecan, mechlorothamine,
mercaptopurine, methotrexate, mitoxantrone, oxaliplatin, paclitaxel, pemetrexed, teniposide, tioguanine, topotecan, valrubicin, vemurafenib, vinblastine, vincristine, or Fvindesine.
ADCs according to the present disclosure may include an antibody or a fragment thereof according to the present disclosure linked (e.g., covalently) to a small molecule or a drug.
[0040] As used herein, the term“antibody” refers to an intact antibody, /. e.. with complete Fc and Fv regions. From N-terminus to C-terminus, both the mature light and heavy chain variable domains comprise the regions FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is in accordance with the definitions of Rabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), Chothia & Lesk, J. Mol. Biol. 196:901-917 (1987), or Chothia et al, Nature 342:878-883 (1989). “Fragment” refers to any portion of an antibody, or portions of an antibody linked together, such as, in non-limiting examples, a Fab, F(ab)2, or a single-chain Fv (scFv), which is less than the whole antibody but which is an antigen-binding portion and which competes with the intact antibody of which it is a fragment for specific binding. In this case, the antigen is the human B7-H3 IgV domain. Such fragments can be prepared, for example, by cleaving an intact antibody or by recombinant means. See generally, Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)). Antigen-binding fragments may be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies or by molecular biology techniques.
[0041] In some embodiments, a fragment is an Fab, Fab', F(ab')2, Fd, Fv,
complementarity determining region (CDR) fragment, single-chain antibody (scFv), or a variable domain light chain (VL) and a variable domain heavy chain (VH) linked via a peptide linker, or a polypeptide that contains at least a portion of an antibody that is sufficient to confer human B7-H3 IgV domain specific antigen binding on the polypeptide, including a diabody. As used herein, an Fd fragment means an antibody fragment that consists of the VH and CHI domains; an Fv fragment consists of the VI and VH domains of a single arm of an antibody; and a dAb fragment (Ward et al., Nature 341:544-546 (1989) hereby incorporated by reference in its entirety) consists of a VH domain. In some embodiments, fragments are at least 5, 6, 8, or 10 amino acids long. In other embodiments, the fragments are at least 14, at least 20, at least 50, or at least 70, 80, 90, 100, 150, or 200 amino acids long.
[0042] In some embodiments, an scFv described herein comprises a variable domain framework sequence having a sequence identical to a human variable domain FR1, FR2, FR3 and/or FR4. In some embodiments, the scFv comprises a linker peptide from 5 to 30 amino acid residues long. In some embodiments, the scFv comprises a linker peptide comprising one or more of glycine, serine and threonine residues. In some embodiments, the linker of the scFv is 10-25 amino acids in length. In certain embodiments, the peptide linker comprises glycine, serine and/or threonine residues. For example, see Bird et al, Science, 242: 423-426 (1988) and Huston et al, Proc. Natl. Acad. Sci. USA, 85:5879-5883 (1988).
[0043] The term“monoclonal antibody” as used herein refers to an antibody member of a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible mutations, e.g., naturally occurring mutations, that may be present in minor amounts. Thus, the modifier
“monoclonal” indicates the character of the antibody as not being a mixture of discrete antibodies. In certain embodiments, such a monoclonal antibody typically includes an antibody comprising a polypeptide sequence that binds a human B7-H3 IgV domain. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. In addition to their specificity, monoclonal antibody preparations are advantageous in that they are typically uncontaminated by other immunoglobulins. Thus, an identified monoclonal antibody can be produced by non-hybridoma techniques, e.g., by appropriate recombinant means once the sequence thereof is identified.
[0044] In some embodiments disclosed herein, the antibody or fragment is isolated. As used herein, the term“isolated antibody” or“isolated antigen-binding fragment” refers to an antibody or fragment that by virtue of its origin or source of derivation has one, two, three or four of the following properties: (1) is not associated with naturally associated components that accompany it in its native state, (2) is free of other proteins from the same species, (3) is expressed by a cell from a different species, and (4) does not occur in nature absent the hand of man.
[0045] In certain embodiments, the antibody is humanized. “Humanized” forms of non human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. In some embodiments, a humanized antibody is
a human immunoglobulin (recipient antibody) in which residues from a hypervariable region (HVR) (or CDR) of the recipient are replaced by residues from a HVR (or CDR) of a non-human species (donor antibody) such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and/or capacity. In an embodiment, the antibody has 1, 2, 3, 4, 5, or all 6 CDRs (CDRl-3 of both the heavy and light chain) of the murine antibodies described herein. In certain embodiments, framework (FR) residues of the murine mAh are replaced with corresponding human immunoglobulin variable domain framework (FR) residues. These may be modified further in embodiments to further refine antibody performance. Furthermore, in particular embodiments, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. In some embodiments, the humanized antibodies do not comprise residues that are not found in the recipient antibody or in the donor antibody. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all, or in embodiments substantially all, of the hypervariable loops correspond to those of a non human immunoglobulin, and all, or in embodiments substantially all, of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. See, e.g., Jones et al, Nature 321:522-525 (1986); Riechmann et al, Nature 332:323-329 (1988); Presta, Curr. Op. Struct. Biol. 2:593-596 (1992); Vaswani and Hamilton, Ann. Allergy, Asthma & Immunol. 1: 105-115 (1998); Harris, Biochem. Soc. Transactions 23:1035-1038 (1995); Hurle and Gross, Curr. Op. Biotech. 5:428-433 (1994); and U.S. Pat. Nos. 6,982,321 and 7,087,409, both of which are hereby incorporated by reference in their entirety. In some embodiments where the humanized antibodies do comprise residues that are not found in the recipient antibody or in the donor antibody, the Fc regions of the antibodies may be modified as described in WO 99/58572, the content of which is hereby incorporated by reference in its entirety.
[0046] Techniques to humanize a monoclonal antibody are well known and are described in, for example, U.S. Pat. Nos. 4,816,567; 5,807,715; 5,866,692; 6,331,415; 5,530,101; 5,693,761; 5,693,762; 5,585,089; and 6,180,370, all of which are hereby incorporated by reference in their entirety. A number of“humanized” antibody molecules comprising an antigen-binding site derived from a non-human immunoglobulin have been described, including antibodies having rodent or modified rodent V regions and their associated complementarity determining regions (CDRs) fused to human constant domains.
See, e.g., Winter et al. Nature 349: 293-299 (1991), Lobuglio et al. Proc. Nat. Acad. Sci. USA 86: 4220-4224 (1989); Shaw et al. J. Immunol. 138: 4534-4538 (1987); Brown et al. Cancer Res. 47: 3577-3583 (1987). Other references describe rodent hypervariable regions or CDRs grafted into a human supporting framework region (FR) prior to fusion with an appropriate human antibody constant domain. See, e.g., Riechmann et al, Nature 332: 323- 327 (1988); Verhoeyen et al, Science 239: 1534-1536 (1988); Jones et al, Nature 321 : 522- 525 (1986). Another reference describes rodent CDRs supported by recombinantly veneered rodent framework regions - European Patent Publication No. 0519596
(incorporated by reference in its entirety). These“humanized” molecules are designed to minimize unwanted immunological response toward rodent anti-human antibody molecules which limits the duration and effectiveness of therapeutic applications of those moieties in human recipients. The antibody constant region can be engineered such that it is immunologically inert (e.g., does not trigger complement lysis). See, e.g., PCT Publication No. W099/58572; UK Patent Application No. 9809951.8. Other methods of humanizing antibodies that may also be utilized are disclosed by Daugherty et al, Nucl. Acids Res. 19: 2471-2476 (1991) and in U.S. Pat. Nos. 6,180,377; 6,054,297; 5,997,867; 5,866,692;
6,210,671; and 6,350,861; and in PCT Publication No. WO 01/27160 (all of which are incorporated by reference in their entirety).
[0047] In some embodiments, the antibodies or fragments herein can be produced recombinantly; for example, antibodies expressed using a recombinant expression vector transfected into a host cell, antibodies isolated from a recombinant, combinatorial human antibody library, antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes, etc.
[0048] The term“Kd”, as used herein, is intended to refer to the dissociation constant of an antibody-antigen interaction. The affinity constant is the inverted dissociation constant. One way of determining the Kd or binding affinity of antibodies to the B7-H3 IgV domain is by measuring binding affinity of monofunctional Fab fragments of the antibody. To obtain monofunctional Fab fragments, an antibody (for example, IgG) can be cleaved with papain or expressed recombinantly. The affinity of a fragment of an anti-human B7-H3 IgV domain antibody can be determined, for example, by surface plasmon resonance
(BIAcore3000™ surface plasmon resonance (SPR) system, BIAcore Inc., Piscataway N.J.). CM5 chips can be activated with N-ethyl-N’-(3-dimethylaminopropyl)-carbodiinide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's
instructions. The antigen can be diluted into 10 mM sodium acetate pH 4.0 and injected over the activated chip at a concentration of 0.005 mg/mL. Using variable flow time across the individual chip channels, two ranges of antigen density can be achieved: 100-200 response units (RU) for detailed kinetic studies and 500-600 RU for screening assays. Serial dilutions (0.1-lOx estimated Kd) of purified Fab samples are injected for 1 min at 100 microliters/min and dissociation times of up to 2 h are allowed. The concentrations of the Fab proteins are determined by ELISA and/or SDS-PAGE electrophoresis using a Fab of known concentration (as determined by amino acid analysis) as a standard. Kinetic association rates (kon) and dissociation rates (k0ff) are obtained simultaneously by fitting the data to a 1 : 1 Langmuir binding model (Karlsson, R. Roos, H. Fagerstam, L. Petersson, B. (1994). Methods Enzymology 6. 99-110, the content of which is hereby incorporated in its entirety) using the BIA evaluation program. Equilibrium dissociation constant (Kd) values are calculated as k0ff/k0n. This protocol is suitable for use in determining binding affinity of an antibody or fragment to any antigen. Other protocols known in the art may also be used (for example, ELISA).
[0049] An antibody or a polypeptide that“specifically binds” to an epitope is a term well understood in the art, and methods to determine such specific or preferential binding are also well known in the art. A molecular entity is said to exhibit“specific binding” or “preferential binding” if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances. An antibody“specifically binds” or“preferentially binds” to a target if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances. For example, an antibody that specifically or
preferentially binds to a human B7-H3 IgV domain is an antibody that binds this epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other B7-H3 epitopes or non-B7-H3 epitopes. It is also understood by reading this definition that, for example, an antibody (or moiety or epitope) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target. As such,“specific binding” or“preferential binding” does not necessarily require (although it can include) exclusive binding. In some embodiments, an antibody is said to specifically bind to an antigen when the Kd is < 1 mM, preferably < 100 nM.
[0050] Depending on the amino acid sequences of the constant domains of their heavy chains, antibodies (immunoglobulins) can be assigned to different classes. The antibody or
fragment can be, e.g., any of an IgG, IgD, IgE, IgA or IgM antibody or fragment thereof, respectively. In some embodiments the antibody is an immunoglobulin G. In some embodiments, the antibody fragment is a fragment of an immunoglobulin G. In some embodiments, the antibody is an IgGl, IgG2, IgG2a, IgG2b, IgG3 or IgG4. In some embodiments, the antibody comprises sequences from a human IgGl, human IgG2, human IgG2a, human IgG2b, human IgG3 or human IgG4. A combination of any of these antibody subtypes can also be used. One consideration in selecting the type of antibody to be used is the desired serum half-life of the antibody. For example, an IgG generally has a serum half-life of 23 days, IgA 6 days, IgM 5 days, IgD 3 days, and IgE 2 days. (Abbas AK, Lichtman AH, Pober JS. Cellular and Molecular Immunology, 4th edition, W.B. Saunders Co., Philadelphia, 2000, hereby incorporated by reference in its entirety).
[0051] The“variable region” or“variable domain” of an antibody refers to the amino- terminal domain of the heavy or light chain of the antibody. The variable domain of the heavy chain may be referred to as“VH.” The variable domain of the light chain may be referred to as“VL.” These domains are generally the most variable parts of an antibody and contain the antigen-binding sites. The term“variable” refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions (HVRs) (or CDRs) both in the light chain and the heavy chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions, and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Rabat et al, Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md.
(1991)). The constant domains are not involved directly in the binding of an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
[0052] The“light chains” of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (□) and lambda (□), based on the amino acid sequences of their constant domains.
[0053] “Framework” or“FR” residues are those variable domain residues other than the HVR residues as herein defined.
[0054] The term“hypervariable region” or“HVR” or“CDR” when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops. Generally, antibodies comprise six CDRs; three in the VH (HI, H2, H3) and three in the VL (LI, L2, L3). In native antibodies, H3 and L3 display the most diversity of the six CDRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies. See, e.g., Xu et al., Immunity 13:37-45 (2000); Johnson and Wu, in Methods in Molecular Biology 248: 1-25 (Lo, ed., Human Press, Totowa, N.J., 2003). Indeed, naturally occurring camelid antibodies consisting of a heavy chain only are functional and stable in the absence of light chain. See, e.g., Hamers- Casterman et al, Nature 363:446-448 (1993); Sheriff et al., Nature Struct. Biol. 3:733-736 (1996). A number of CDR delineations are in use and are encompassed herein. The Rabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (Rabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991) hereby incorporated by reference in its entirety). There are CDRs 1, 2, and 3 for each of the heavy and light chains. Chothia refers instead to the location of the structural loops (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). The AbM CDRs represent a compromise between the Rabat CDRs and Chothia structural loops and are used by Oxford Molecular’s AbM antibody modeling software. The“contact” CDRs are based on an analysis of the available complex crystal structures. CDRs may comprise“extended CDRs” as follows: 24-36 or 24- 34 (LI), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (HI), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH. The variable domain residues are numbered according to Rabat et al., supra, for each of these definitions.
[0055] The term“Fc region” herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. The C-
terminal lysine of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, an intact antibody as used herein may be an antibody with or without the otherwise C-terminal lysine.
[0056] The subject can be any mammal and is preferably a human.
[0057] In some embodiments, human B7-H3 has the following amino acid sequence
(GenBank: CAE47548.1, SEQ ID NO: 17), wherein the IgV domain is underlined:
1 MLRRRGSPGM GVHVGAALGA L WF CLTGALE VOVPEDPWA LVGTDATLCC SFSPEPGFSL 61 AOLNLIWOLT DTKOLVHSFA EGODOGSAYA NRTALFPDLL AOGNASLRLO RVRVADEGSF 121 TCFVSIRDFG SAAVSLOYAA PYSKPSMTLE PNKDLRPGDT VTITCSSYQG YPEAEWWQD 181 GQGWLTGNV TTSQMANEQG LFDVHSILRV VLGANGTYSC LVRNPVLQQD AHSSVTITPQ 241 RSPTGAVEVQ VPEDPWALV GTDATLRCSF SPEPGFSLAQ LNLIWQLTDT KQLVHSFTEG 301 RDQGSAYANR TALFPDLLAQ GNASLRLQRV RVADEGSFTC FVSIRDFGSA AVSLQVAAPY 361 SKPSMTLEPN KDLRPGDTVT ITCSSYRGYP EAEVFWQDGQ GVPLTGNVTT SQMANEQGLF 421 DVHSVLRWL GANGTYSCLV RNPVLQQDAH GSVTITGQPM TFPPEALWVT VGLSVCLIAL 481 LVALAFVCWR KIKQSCEEEN AGAEDQDGEG EGSKTALQPL KHSDSKEDDG QEIA.
[0058] “And/or” as used herein, for example, with option A and/or option B, encompasses the separate embodiments of (i) option A, (ii) option B, and (iii) option A plus option B.
[0059] All combinations of the various elements described herein, including all subsets, are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
[0060] This invention will be better understood from the Experimental Details, which follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
EXPERIMENTAL DETAILS
Generation of mAbs against the IgV domain of human B7-H3 and mouse B7-H3
[0061] As the IgV domain is the functional domain of B7-H3, human B7-H3 IgV-Ig fusion protein was generated by fusing the B7-H3 IgV coding region (E35-A139) to a human IgGl Fc tag of plasmid pMT/BiP as previously described (17). The fusion protein was expressed in a S2 system and then purified. Mice were immunized with the B7-H3 IgV-Ig fusion protein, and hybridomas were generated by standard techniques from splenocytes fused to NSO myeloma cells.
Characterization of mAbs 8B12 and 12B4
[0062] Monoclonal antibodies (mAbs) 8B12 and 12B4 were generated. 8B12 is an IgG3 with a kappa light chain, whereas 12B4 is an IgG2b with a kappa light chain.
[0063] By the Surface Plasmon Resonance method, it was determined that the binding affinities (Kd) of mAb 8B12 for human B7-H3 and mouse B7-H3 was 0.30 nM and 4.01 nM, respectively, and that the binding affinities (Kd) of mAb 12B4 for human B7-H3 and mouse B7-H3 was 8.23 nM and 15.38 nM, respectively (Table 1). Both 8B12 and 12B4 strongly bound to endogenous B7-H3 expressed by human cancer lines PC3 and MDA- MB231 (FIG. 1).
[0064] Since both dendritic cells and activated T cells express B7-H3 (FIG. 2), a mixed lymphocyte reaction was performed to determine the antagonistic activity of 8B12 and 12B4. Mature dendritic cells, which were differentiated from monocytes isolated from PBMC from one donor, were incubated with purified T cells, which were from PBMC from another donor, for four days in the presence of 8B12, 12B4, or control mouse IgG. 8B12 and 12B4 were able to regulate cytokine production by T cells (FIGs. 3A and 3B).
Table 1. Kinetic parameters from Surface Plasmon Resonance of 8B12, 12B4, and 24D12.
Sequences of mAbs 8B12, 12B4, and 24D12
[0065] 8B12 was sequenced and found to have unique VH and VL sequences. The polypeptide and coding sequences of 8B12 are listed below:
8B12 heavy chain VH: Leader sequence-FRl -CDR1 -FR2-CDR2-FR3 -CDR3 -FR4 (Leader sequence bolded, CDRsl-3 underlined):
DNA sequence (419 bp; SEQ ID NO: 18)
ATGGAATGGAGCTGGGTCATCCTCATTTTGGTAGCAGCAGCTACAG
GTGTCCACTCCCAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTTGTGAA
GCCTGGGGCTTCAGTGAAGATGTCCTGCAAGGCTTCTGGCTACACCTTCA
CCAGCTACTGGATAACCTGGGTGAAGCAGAGGCCTGGACAAGGCCTTGA
GT GGATTGGAGAT ATTT ATCCT GGT AGT GGTAGT ACT AACT AC AAT GAG
AAGTTCAAGAGCAAGGCCACTCTGACTGTAGACACATCCTCCAGCACAG
CCTACATGCAGCTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTAC
TGTGCAAGAGGGGGTACTAGATTCAGCCCCTTTGCTTACTGGGGCCAAG
GGACTCTGGTCACTGTCTCTGCAGCTAC;
Amino acid sequence (139 aa; SEQ ID NO: 19)
MEWSWVILILVAAATGVHSOVOLOOPGAELVKPGASVKMSCKASGYTFT SYWITWVK Q R PGQG LEWI GDIYPGSGSTNYNEKFKSKATLTV DTSSSTAYM OLSSLTSEDSAVYYCARGGTRFSPFAYWGOGTLVTVSAA.
8B12 light chain VL: Leader seauence-FRl-CDRl-FR2-CDR2-FR3-CDR3-FR4
(Leader sequence bolded, CDRsl-3 underlined):
DNA sequence (405 bp; SEQ ID NO:20)
ATGAAGATGCCTGTTAGGCTGTTGGTGCTGATGTTCTGGATTCCTGC
TTCCAGCAGTGATGTTTTGATGACCCAAACTCCACTCTCCCTGCCTGTCA
GTCTT GGAGAT C AAGC CTCC AT CTCTT GC AGATCTAGT C AGAGC ATT GT A
CATAGTAATGGAAACACCTATTTAGAATGGTACCTGCAGAAACCAGGCC
AGTCTCCAAAGCTCCTGATCTACAAAGTTTCCAACCGATTTTCTGGGGTC
C C AGAC AGGTT C AGT GGC AGT GGATC AGGGAC AGATTT C AC ACT C AAGA
TCAGCAGAGTGGAGGCTGAGGATCTGGGAGTTTATTACTGCTTTCAAGG
TTCACATGTTCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAA
CGGGCTGATGCT;
Amino acid sequence (138 aa; SEQ ID NO:21)
MKMPVRLLVLMLWIPASSSDVLMTOTPLSLPVSLGDOASISCRSSOSIVHS N GNTYLEWYLOKP GO SPKLLI YKV SNRF S GVPDRF S GS GS GTDFTLKIS RVE AEDLGVYY CFOGSHVP WTF GGGTKLEIKRAD A.
[0066] The polypeptide and coding sequences of 12B4 are listed below:
12B4 heavy chain VH: Leader seauence-FRl -CDR1 -FR2-CDR2-FR3 -CDR3 -FR4 (Leader sequence bolded, CDRsl-3 underlined):
DNA sequence (416 bp; SEQ ID NO:22)
ATGGGATGGAGCTGTATCATGTTCTTTTTGGTAGCAACAGCTACAGG
TGTCCACTCCCAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTGGTAAAG
CCTGGGGCTTCAGTGAAGTTGTCCTGCAAGGCTTCTGGCTACACTTTCACC
AGCT ACT GGAT GC ACT GGGT GAAGC AGAGGCCT GGAC AAGGCCTTGAGT
GGATTGGAATGATTCATCCTAATAGTGGTAGTACTAACTACAATGAGAAG
TTCAAGAGCAAGGCCACACTGACTGTAGACAAATCCTCCAGCACAGCCTA
CATGCAACTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTG
CAAGATATTACTACGGTAGTAGCTATGCTATGGACTACTGGGGTCAAGGA
ACCTCAGTCACCGTCTCTCA;
Amino acid sequence (138 aa; SEQ ID NO:23)
MGWSCIMFFLVATATGVHSOVOLOOPGAELVKPGASVKLSCKASGYTFTS
YWMHWVKORPGOGLEWIGMIHPNSGSTNYNEKFKSKATLTVDKSSSTAYM
OLSSLTSEDSAVYYCARYYYGSSYAMDYWGOGTSVTVS.
12B4 light chain VL: Leader seauence-FRl-CDRl-FR2-CDR2-FR3-CDR3-FR4 (Leader sequence bolded, CDRsl-3 underlined):
DNA sequence (394 bp; SEQ ID NO:24)
ATGGATTTTCAGGTGCAGATTTTCAGCTTCCTGCTAATCAGTGCCTC
AGTCATAATGTCCAGAGGACAAATTGTTCTCACCCAGTCTCCAGCAATC
ATGTCTGCATCTCCAGGGGAGAAGGTCACCATAACCTGCAGTGCCAGCT
CAAGTGTAAGTTACATGCACTGGTTCCAGCAGAAGCCAGGCACTTCTCC
CAAACTCTGGATTTATAGCACATCCAACCTGGCTTCTGGAGTCCCTGCTC
GCTTCAGTGGCAGTGGATCTGGGACCTCTTACTCTCTCACAATCAGCCGA
ATGGAGGCTGAAGATGCTGCCACTTATTACTGCCAGCAAAGGAGTAGTT
ACCCGTACACGTTCGGAGGGGGGACCAAGCTGGAAATAAAACGGGCTG
ATG;
Amino acid sequence (131 aa; SEQ ID NO:25)
MDFOVOIFSFLLISASVIMSRGOIVLTOSPAIMSASPGEKVTITCSASSSVSY MHWF OOKPGTS PKL WI Y S TSNL AS GYP ARF S GS GS GTS Y SLTI S RME AED AA TYY C QQRSSYPYTF GGGTKLEIKRAD .
[0067] The polypeptide and coding sequences of 24D12 are listed below:
24D12 heavy chain VH: Leader sea uence-FRl-CDRl -FR2-CDR2-FR3 -CDR3 -FR4 (Leader sequence bolded, CDRsl-3 underlined):
DNA sequence (399 bp; SEQ ID NO:26)
ATGGGATGGAGCTGTATCATGTTCTTTTTGGTAGCAACAGCTACAGG
TGTCCACTCCCAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTGGTAAA
GC CT GGGGCTT C AGT GAAGTTGTCCT GC AAGGCTT CT GGCT AC ACTTT C A
CCAGCTACTGGATGCACTGGGTGAAGCAGAGGCCTGGACAAGGCCTTGA
GTGGATTGGAATGATTCATCCTAATAGTGGTAGTACTAACTACAATGAG
AAGTT C AAGAGC AAGGC C AC ACTGACT GT AGAC A AATC CTC C AGC AC AG
CCTACATGCAACTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTAC
TGTGCAAATTACTACGGTACTAATGTCTGGGGCACAGGGACCACGGTCA
CCGTCTCT;
Amino acid sequence (133 aa; SEQ ID NO:27)
MGWSCIMFFLVATATGVHSOVOLOOPGAELVKPGASVKLSCKASGYTFT S YWMHWVKORPGOGLEWIGMIHPN S GSTNYNEKFKSKATLTVDKS S STAY MOLSSLTSEDSAVYYCANYYGTNVWGTGTTVTVS.
24D12 light chain VL: Leader seauence-FRl -CDR1 -FR2-CDR2-FR3 -CDR3 -FR4 (Leader sequence bolded, CDRsl-3 underlined):
DNA sequence (387 bp; SEQ ID NO:28)
ATGGAGACAGACACACTGCTGCTATGGGTACTGCTGCTCTGGGTTC
CAGGTTCCACTGGTGACATTGTGCTGACACAGTCTCCTGCTTCCTTAGC
TGTATCTCTGGGGCAGAGGGCCACCATCTCATACAGGGCCAGCAAAAGT
GTCAGTACATCTGGCTATAGTTATATGCACTGGAACCAACAGAAACCAG
GACAGCCACCCAGACTCCTCATCTATCTTGTATCCAACCTAGAATCTGGG
GTCCCTGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACCCTCA
ACATCCATCCTGTGGAGGAGGAGGATGCTGCAACCTATTACTGTCAGCA
CATTAGGGAAGCTTACACGTTCGGAAGGGGGGACCAAAGCTGGAAA;
Amino acid sequence (132 aa; SEQ ID NO:29)
METDTLLLWVLLLWVPGSTGDIVLTOSPASLAV SLGORATISYRASKSY ST
SGYSYMHWNOOKPGOPPRLLIYLVSNLESGVPARFSGSGSGTDFTLNIHPVE
EEDAATYYCOHIREAYTFGRGDOSWK.
REFERENCES
E Picarda, E., Ohaegbulam, K.C. & Zang, X. Molecular Pathways: Targeting B7-H3 (CD276) for Human Cancer Immunotherapy. Clin Cancer Res 22, 3425-3431 (2016).
2. Zang, X. & Allison, J.P. The B7 family and cancer therapy: costimulation and coinhibition. Clin Cancer Res 13, 5271-5279 (2007).
3. Zang, X., et al. B7-H3 and B7x are highly expressed in human prostate cancer and associated with disease spread and poor outcome. Proc Natl Acad Sci U S A 104, 19458- 19463 (2007).
4. Sun, T.W., et al. B7-H3 is expressed in human hepatocellular carcinoma and is associated with tumor aggressiveness and postoperative recurrence. Cancer Immunol Immunother 61, 2171-2182 (2012).
5. Wang, I, et al. B7-H3 associated with tumor progression and epigenetic regulatory activity in cutaneous melanoma. J Invest Dermatol 133, 2050-2058 (2013).
6. Hu, Y., et al. Expression of costimulatory molecule B7-H3 and its prognostic implications in human acute leukemia. Hematology 20, 187-195 (2015).
7. Sun, J., et al. B7-H3 expression in breast cancer and upregulation of VEGF through gene silence. Onco Targets Ther 7, 1979-1986 (2014).
8. Zang, X., et al. Tumor associated endothelial expression of B7-H3 predicts survival in ovarian carcinomas. Mod Pathol 23, 1104-1112 (2010).
9. Chen, Y., et al. The coexpression and clinical significance of costimulatory molecules B7-H1, B7-H3, and B7-H4 in human pancreatic cancer. Onco Targets Ther 7, 1465-1472 (2014).
10. Ingebrigtsen, V.A., et al. B7-H3 expression in colorectal cancer: associations with clinicopathological parameters and patient outcome. BMC Cancer 14, 602 (2014).
11. Sun, Y., et al. B7-H3 and B7-H4 expression in non-small-cell lung cancer. Lung Cancer 53, 143-151 (2006).
12. Xylinas, E., et al. Association of T-cell co-regulatory protein expression with clinical outcomes following radical cystectomy for urothelial carcinoma of the bladder. Eur J Surg Oncol 40, 121-127 (2014).
13. Qin, X., et al. B7-H3 is a new cancer-specific endothelial marker in clear cell renal cell carcinoma. Onco Targets Ther 6, 1667-1673 (2013).
14. Baral, A., Ye, H.X., Jiang, P.C., Yao, Y. & Mao, Y. B7-H3 and B7-H1 expression in cerebral spinal fluid and tumor tissue correlates with the malignancy grade of glioma patients. Oncol Lett 8, 1195-1201 (2014).
15. Wang, L., et al. B7-H3 is overexpressed in patients suffering osteosarcoma and associated with tumor aggressiveness and metastasis. PLoS One 8, e70689 (2013).
16. Vigdorovich, V., et al. Structure and T cell inhibition properties of B7 family member, B7-H3. Structure 21, 707-717 (2013).
17. Zhao, R., et al. HHLA2 is a member of the B7 family and inhibits human CD4 and CD8 T-cell function. Proc Natl Acad Sci U S A 110, 9879-9884 (2013).
Claims
1. An antibody or an antigen-binding fragment thereof that specifically binds to an IgV domain of a B7-H3 protein.
2. The antibody or the antigen-binding fragment thereof of claim 1, comprising:
(a) a VH region comprising (i) CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: l and 7, (ii) CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:2 and 8, and (iii) CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:3, 9, and 15; and
(b) a VL region comprising (i) CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:4, 10, and 13, (ii) CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:5, 11, and 14, and (iii) CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:6, 12, and 16.
3. The antibody or the antigen-binding fragment thereof of claim 1, comprising:
(a) a VH region comprising at least one CDR that is at least 80% identical to an amino acid sequence selected from SEQ ID NOs: 1, 2, 3, 7, 8, 9, or 15; and
(b) a VL region comprising at least one CDR that is at least 80% identical to an amino acid sequence of SEQ ID NOs: 4, 5, 6, 10, 11, 12, 13, 14, or 16.
4. The antibody or the antigen-binding fragment thereof of claim 3, wherein the antibody is a monoclonal antibody.
5. The antibody or the antigen-binding fragment thereof of claim 3, wherein the antibody is a chimeric antibody, a human antibody, or a humanized antibody.
6. The antibody or the antigen-binding fragment thereof of claim 2, comprising an amino acid sequence selected from:
(a) residues 20-139 of SEQ ID NO: 19;
(b) residues 20-135 of SEQ ID NO:21;
(c) residues 20-138 of SEQ ID NO: 23;
(d) residues 23-131 of SEQ ID NO: 25;
(e) residues 20-133 of SEQ ID NO:27; or
(f) residues 21-129 of SEQ ID NO:29.
7. The antibody of claim 4, wherein the antibody is monoclonal 8B12, monoclonal 12B4, or monoclonal 24D12.
8. The antibody of claim 5, wherein the antibody is humanized 8B12, humanized 12B4, or humanized 24D12.
9. The antibody of claim 3, wherein
(a) the heavy chain comprises a human germline framework sequence selected from
IGHV 1-46*01, IGHVl-46*02, IGHVl-46*03, IGHD1-1*01, IGHD1-26*01, IGHD2-8*01, IGHD3-10*01, IGHD3-22*01, IGHD4-23*01, IGHJ3*01, IGHJ4*01, IGHJ4*03, IGHJ6*01, or IGHJ6*02; or
(b) the light chain comprises a human germline framework sequence selected from
IGKV2-18*01, IGKV2D-29*02, IGKV2-29*03, IGKV3-11*01, IGKV3- 15*01, IGKV3-20*02, IGKJ1*01, IGKJ2*01, IGKJ4*01, or IGKJ4*02.
10. The antibody or the antigen-binding fragment thereof of claim 3, further comprising an antigen-binding fragment of a monoclonal antibody that binds to a CD3 component of a T-cell receptor (TCR) complex on T cells.
11. The antibody or the antigen-binding fragment thereof of claim 3, further comprising a detectable marker.
12. The antibody or the antigen-binding fragment thereof of claim 3, further comprising a cytotoxic agent conjugated thereto.
13. The antigen or the antigen-binding fragment thereof of claim 3 for use in the manufacture of a medicament.
14. A composition comprising an isolated nucleic acid comprising a nucleotide sequence that encodes a CDR of the antibody or the antigen-binding fragment thereof of claim 2
15. The composition of claim 14, further comprising a host cell or a vector comprising the isolated nucleic acid of claim 14.
16. A method of treating a subj ect having a condition comprising administering to the subject a therapeutically effective amount of the antibody or the immunogenic fragment thereof of claim 2, wherein the condition is a condition that would benefit from enhancing immune function in the subject.
17. The method of claim 16, wherein the condition is cancer.
18. The method of claim 17, wherein the cancer is selected from the group consisting of prostate cancer, liver cancer, melanoma, leukemia, breast cancer, ovarian cancer, pancreatic cancer, colorectal cancer, lung cancer, bladder cancer, renal cancer, brain cancer, osteosarcoma, Adrenal Cancer, Anal Cancer, Basal and Squamous Cell Skin Cancer, Bile Duct Cancer, Bladder Cancer, Bone Cancer, Brain and Spinal Cord Tumors, Breast Cancer, Cervical Cancer, Colorectal Cancer, Endometrial Cancer, Esophagus Cancer, Ewing Family of Tumors, Eye Cancer (Ocular Melanoma), Gallbladder Cancer, Gastrointestinal Neuroendocrine (Carcinoid) Tumors, Gastrointestinal Stromal Tumor (GIST), Gestational Trophoblastic Disease, Kaposi Sarcoma, Kidney Cancer, Laryngeal and Hypopharyngeal Cancer, Liver Cancer, Lung Cancer, Lung Carcinoid Tumor, Malignant Mesothelioma, Melanoma Skin Cancer, Merkel Cell Skin Cancer, Nasal Cavity and Paranasal Sinuses Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Small Cell Lung Cancer, neoplasm of the central nervous system (CNS), Oral Cavity and Oropharyngeal Cancer, Osteosarcoma, Ovarian Cancer, Pancreatic Cancer, Pancreatic Neuroendocrine Tumor (NET), Penile Cancer, Pituitary Tumors, Prostate Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer, Skin Cancer, Small Cell Lung Cancer, Small Intestine Cancer, Soft Tissue Sarcoma, Stomach Cancer, Testicular Cancer, Thymus Cancer, Thyroid Cancer, Uterine Sarcoma, Vaginal Cancer, Vulvar Cancer, Waldenstrom Macroglobulinemia, Wilms Tumor, squamous cell cancer, environmentally induced cancers, combinations of the cancers, metastatic lesions
of cancers, myeloid neoplasm, acute myeloid leukemia (AML), AML with recurrent genetic abnormalities, AML with myelodysplasia-related changes, therapy-related AML, acute leukemias of ambiguous lineage, myeloproliferative neoplasm, essential thrombocythemia, polycythemia vera, myelofibrosis (MF), primary myelofibrosis, systemic mastocytosis, myelodysplastic syndromes (MDS), myeloproliferative/myelodysplastic syndromes, chronic myeloid leukemia, chronic neutrophilic leukemia, chronic eosinophilic leukemia, myelodysplastic syndromes (MDS), refractory anemia with ringed sideroblasts, refractory cytopenia with multilineage dysplasia, refractory anemia with excess blasts (type 1), refractory anemia with excess blasts (type 2), MDS with isolated del (5q), unclassifiable MDS, myeloproliferative/myelodysplastic syndromes, chronic myelomonocytic leukemia, atypical chronic myeloid leukemia, juvenile myelomonocytic leukemia, unclassifiable myeloproliferative/myelodysplatic syndromes, lymphoid neoplasms, precursor lymphoid neoplasms, B lymphoblastic leukemia, B lymphoblastic lymphoma, T lymphoblastic leukemia, T lymphoblastic lymphoma, mature B-cell neoplasms, diffuse large B-cell lymphoma, primary central nervous system lymphoma, primary mediastinal B-cell lymphoma, Burkitt lymphoma/leukemia, follicular lymphoma, chronic lymphocytic leukemia, small lymphocytic lymphoma, B-cell prolymphocytic leukemia, lymphoplasmacytic lymphoma, Waldenstrom macroglobulinemia, mantle cell lymphoma, marginal zone lymphomas, post-transplant lymphoproliferative disorders, HIV-associated lymphomas, primary effusion lymphoma, intravascular large B-cell lymphoma, primary cutaneous B-cell lymphoma, hairy cell leukemia, multiple myeloma, monoclonal gammopathy of unknown significance (MGUS), smoldering multiple myeloma, or solitary plasmacytomas (solitary bone and extramedullary).
19. The method of claim 16, wherein the condition is an infection.
20. The method of claim 19, wherein the infection is caused by a virus, viroid, bacterium, prion, nematode, arthropod, fungus, or protozoa.
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP19885550.4A EP3880712A4 (en) | 2018-11-16 | 2019-11-15 | MONOCLONAL ANTIBODIES AGAINST IgV DOMAIN OF B7-H3 AND USES THEREOF |
CN201980089456.0A CN113330034A (en) | 2018-11-16 | 2019-11-15 | Monoclonal antibodies directed against the IgV domain of B7-H3 and uses thereof |
US17/294,560 US20220010018A1 (en) | 2018-11-16 | 2019-11-15 | MONOCLONAL ANTIBODIES AGAINST IgV DOMAIN OF B7-H3 AND USES THEREOF |
JP2021526660A JP2022513053A (en) | 2018-11-16 | 2019-11-15 | Monoclonal antibody against IgV domain of B7-H3 and its use |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201862768128P | 2018-11-16 | 2018-11-16 | |
US62/768,128 | 2018-11-16 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2020102779A1 true WO2020102779A1 (en) | 2020-05-22 |
Family
ID=70731685
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2019/061887 WO2020102779A1 (en) | 2018-11-16 | 2019-11-15 | MONOCLONAL ANTIBODIES AGAINST IgV DOMAIN OF B7-H3 AND USES THEREOF |
Country Status (5)
Country | Link |
---|---|
US (1) | US20220010018A1 (en) |
EP (1) | EP3880712A4 (en) |
JP (1) | JP2022513053A (en) |
CN (1) | CN113330034A (en) |
WO (1) | WO2020102779A1 (en) |
Cited By (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022081888A1 (en) * | 2020-10-15 | 2022-04-21 | The Regents Of The University Of California | Anti-cancer inhibitory antibodies |
CN114380910A (en) * | 2022-01-07 | 2022-04-22 | 苏州旭光科星抗体生物科技有限公司 | Humanized monoclonal antibody targeting human B7-H3 molecule and application thereof |
WO2022170971A1 (en) | 2021-02-09 | 2022-08-18 | 苏州宜联生物医药有限公司 | Bioactive substance conjugate, preparation method therefor and use thereof |
WO2022200525A1 (en) | 2021-03-26 | 2022-09-29 | Innate Pharma | Multispecific proteins comprising an nkp46-binding site, a cancer antgienge binding site fused to a cytokine for nk cell engaging |
WO2022258691A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkg2d, a cytokine receptor, a tumour antigen and cd16a |
WO2022258662A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkp46, a cytokine receptor, a tumour antigen and cd16a |
WO2022258678A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkp30, a cytokine receptor, a tumour antigen and cd16a |
WO2024106939A1 (en) * | 2022-11-15 | 2024-05-23 | 주식회사 셀랩메드 | Antibody specifically binding to b7-h3 |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN113527493B (en) * | 2021-07-20 | 2023-10-27 | 广州爱思迈生物医药科技有限公司 | B7-H3 antibody and application thereof |
CN116063521B (en) * | 2022-10-31 | 2024-05-14 | 北京奇迈永华生物科技有限公司 | Antibodies targeting BCMA and chimeric antigen receptor composed thereof |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2003046204A2 (en) * | 2001-11-26 | 2003-06-05 | Cell-Matrix, Inc. | Humanized collagen antibodies and related methods |
WO2010133893A1 (en) * | 2009-05-21 | 2010-11-25 | Royal Holloway And Bedford New College | Method of producing a binding molecule |
WO2015032906A2 (en) * | 2013-09-05 | 2015-03-12 | Bionovion Holding B.V. | Cd70-binding peptides and method, process and use relating thereto |
US20180009899A1 (en) * | 2016-07-11 | 2018-01-11 | Corvus Pharmaceuticals, Inc. | Anti-cd73 antibodies |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006117910A1 (en) * | 2005-04-28 | 2006-11-09 | Mochida Pharmaceutical Co., Ltd. | Monoclonal antibody against platelet membrane glycoprotein vi |
KR20180084772A (en) * | 2015-10-08 | 2018-07-25 | 마크로제닉스, 인크. | Combination Therapy for Cancer Treatment |
PE20190353A1 (en) * | 2016-04-15 | 2019-03-07 | Macrogenics Inc | NOVELTY B7-H3 JOINT MOLECULES, ANTIBODY-DRUG CONJUGATES OF THE SAME AND METHODS OF USE OF THE SAME |
WO2017189959A1 (en) * | 2016-04-29 | 2017-11-02 | Voyager Therapeutics, Inc. | Compositions for the treatment of disease |
-
2019
- 2019-11-15 WO PCT/US2019/061887 patent/WO2020102779A1/en unknown
- 2019-11-15 EP EP19885550.4A patent/EP3880712A4/en active Pending
- 2019-11-15 JP JP2021526660A patent/JP2022513053A/en active Pending
- 2019-11-15 CN CN201980089456.0A patent/CN113330034A/en active Pending
- 2019-11-15 US US17/294,560 patent/US20220010018A1/en active Pending
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2003046204A2 (en) * | 2001-11-26 | 2003-06-05 | Cell-Matrix, Inc. | Humanized collagen antibodies and related methods |
WO2010133893A1 (en) * | 2009-05-21 | 2010-11-25 | Royal Holloway And Bedford New College | Method of producing a binding molecule |
WO2015032906A2 (en) * | 2013-09-05 | 2015-03-12 | Bionovion Holding B.V. | Cd70-binding peptides and method, process and use relating thereto |
US20180009899A1 (en) * | 2016-07-11 | 2018-01-11 | Corvus Pharmaceuticals, Inc. | Anti-cd73 antibodies |
Non-Patent Citations (2)
Title |
---|
AHMED ET AL.: "Humanized Affinity-matured Monoclonal Antibody 8H9 Has Potent Antitumor Activity and Binds to FG Loop of Tumor Antigen B7-H3", J. BIOL. CHEM., vol. 290, no. 50, 11 December 2015 (2015-12-11), pages 30018 - 30029, XP055396132, DOI: 10.1074/jbc.M115.679852 * |
See also references of EP3880712A4 * |
Cited By (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022081888A1 (en) * | 2020-10-15 | 2022-04-21 | The Regents Of The University Of California | Anti-cancer inhibitory antibodies |
WO2022170971A1 (en) | 2021-02-09 | 2022-08-18 | 苏州宜联生物医药有限公司 | Bioactive substance conjugate, preparation method therefor and use thereof |
WO2022200525A1 (en) | 2021-03-26 | 2022-09-29 | Innate Pharma | Multispecific proteins comprising an nkp46-binding site, a cancer antgienge binding site fused to a cytokine for nk cell engaging |
WO2022258691A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkg2d, a cytokine receptor, a tumour antigen and cd16a |
WO2022258662A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkp46, a cytokine receptor, a tumour antigen and cd16a |
WO2022258678A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkp30, a cytokine receptor, a tumour antigen and cd16a |
CN114380910A (en) * | 2022-01-07 | 2022-04-22 | 苏州旭光科星抗体生物科技有限公司 | Humanized monoclonal antibody targeting human B7-H3 molecule and application thereof |
WO2024106939A1 (en) * | 2022-11-15 | 2024-05-23 | 주식회사 셀랩메드 | Antibody specifically binding to b7-h3 |
Also Published As
Publication number | Publication date |
---|---|
CN113330034A (en) | 2021-08-31 |
EP3880712A4 (en) | 2022-11-16 |
EP3880712A1 (en) | 2021-09-22 |
JP2022513053A (en) | 2022-02-07 |
US20220010018A1 (en) | 2022-01-13 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220010018A1 (en) | MONOCLONAL ANTIBODIES AGAINST IgV DOMAIN OF B7-H3 AND USES THEREOF | |
US10781256B2 (en) | Anti SIRP-α antibodies and bi-specific macrophage enhancing antibodies | |
JP6273214B2 (en) | Antibody against integrin αvβ6 and use thereof for treating cancer | |
JP6817674B2 (en) | Anti-NTB-A antibody and related compositions and methods | |
JP2024059872A (en) | Novel anti-CCR8 antibody | |
DK2817338T3 (en) | DLL3 modulators and methods of use | |
KR20210109520A (en) | Antibodies and their uses | |
AU2018218753A1 (en) | Anti-GPRC5D antibody and molecule containing same | |
CN112166125B (en) | Fully human anti-LAG-3 antibodies and uses thereof | |
EP3988568A1 (en) | Combination treatment | |
CN114181310B (en) | anti-TIGIT antibody, and pharmaceutical composition and use thereof | |
JP7290568B2 (en) | Multispecific antibodies in combination therapy for cancer immunotherapy | |
US20230312742A1 (en) | CD38 antibodies for the treatment of human diseases | |
JP2023524102A (en) | Antibodies specific for ABCB5 and uses thereof | |
US20230116037A1 (en) | ANTAGONIST ANTIBODIES AGAINST HUMAN IMMUNE CHECKPOINT CEACAM1 (CD66a) AND FORMULATIONS, KITS, AND METHODS OF USE THEREOF | |
CN117940453A (en) | Protein capable of specifically binding to PD-1 and medical application thereof | |
KR20230157951A (en) | Anti-ALPP/ALPPL2 antibodies and antibody-drug conjugates | |
JP2020508636A (en) | IFN-γ-induced regulatory T cell converting anti-cancer (IRTCA) antibody and use thereof | |
JP2023530766A (en) | Bispecific antibody and use thereof | |
JP2023516195A (en) | C19 C38 bispecific antibody | |
AU2020315775A1 (en) | Composition and methods of targeting the pre-B cell receptor for the treatment of leukemias and lymphomas | |
JP2022550364A (en) | Novel anti-PD-L1/anti-LAG-3 bispecific antibodies and uses thereof | |
CN116997356A (en) | anti-ALPP/ALPPL 2 antibodies and antibody-drug conjugates | |
JP2024517760A (en) | Anti-5T4 antibodies and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19885550 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2021526660 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2019885550 Country of ref document: EP Effective date: 20210616 |