WO2020102210A1 - Plant vectors, compositions and uses relating thereto - Google Patents

Plant vectors, compositions and uses relating thereto Download PDF

Info

Publication number
WO2020102210A1
WO2020102210A1 PCT/US2019/060945 US2019060945W WO2020102210A1 WO 2020102210 A1 WO2020102210 A1 WO 2020102210A1 US 2019060945 W US2019060945 W US 2019060945W WO 2020102210 A1 WO2020102210 A1 WO 2020102210A1
Authority
WO
WIPO (PCT)
Prior art keywords
plant
rna
cyvav
vector
citrus
Prior art date
Application number
PCT/US2019/060945
Other languages
French (fr)
Inventor
Anne Elizabeth SIMON
Jinguan LIU
Georgios Vidalakis
Sun-Jung KWON
Sohrab BODAGHI
Original Assignee
University Of Maryland, College Park
The Regents Of The University Of California
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2021549930A priority Critical patent/JP2022509553A/en
Priority to KR1020217017524A priority patent/KR20210101227A/en
Application filed by University Of Maryland, College Park, The Regents Of The University Of California filed Critical University Of Maryland, College Park
Priority to BR112021009192-0A priority patent/BR112021009192A2/en
Priority to AU2019381736A priority patent/AU2019381736A1/en
Priority to CN201980088371.0A priority patent/CN113302308A/en
Priority to US17/291,431 priority patent/US20220002746A1/en
Priority to MX2021005555A priority patent/MX2021005555A/en
Priority to EP19884145.4A priority patent/EP3880828A4/en
Publication of WO2020102210A1 publication Critical patent/WO2020102210A1/en
Priority to PCT/US2020/060228 priority patent/WO2021097086A1/en
Priority to BR112022009127A priority patent/BR112022009127A2/en
Priority to AU2020381450A priority patent/AU2020381450A1/en
Priority to CN202080093354.9A priority patent/CN115052979A/en
Priority to MX2022005644A priority patent/MX2022005644A/en
Priority to US17/096,593 priority patent/US20210130837A1/en
Priority to EP20886307.6A priority patent/EP4058568A4/en
Priority to ZA2021/03058A priority patent/ZA202103058B/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8271Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
    • C12N15/8279Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
    • C12N15/8281Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance for bacterial resistance
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01HNEW PLANTS OR NON-TRANSGENIC PROCESSES FOR OBTAINING THEM; PLANT REPRODUCTION BY TISSUE CULTURE TECHNIQUES
    • A01H6/00Angiosperms, i.e. flowering plants, characterised by their botanic taxonomy
    • A01H6/78Rutaceae, e.g. lemons or limes
    • A01H6/785Citrus, e.g. lemons or limes
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N63/00Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
    • A01N63/60Isolated nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/64General methods for preparing the vector, for introducing it into the cell or for selecting the vector-containing host
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8201Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
    • C12N15/8202Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation by biological means, e.g. cell mediated or natural vector
    • C12N15/8203Virus mediated transformation
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8216Methods for controlling, regulating or enhancing expression of transgenes in plant cells
    • C12N15/8218Antisense, co-suppression, viral induced gene silencing [VIGS], post-transcriptional induced gene silencing [PTGS]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8243Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
    • C12N15/8245Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine involving modified carbohydrate or sugar alcohol metabolism, e.g. starch biosynthesis
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8271Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
    • C12N15/8279Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance
    • C12N15/8283Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for biotic stress resistance, pathogen resistance, disease resistance for virus resistance
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y204/00Glycosyltransferases (2.4)
    • C12Y204/01Hexosyltransferases (2.4.1)
    • C12Y204/010341,3-Beta-glucan synthase (2.4.1.34)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/00041Use of virus, viral particle or viral elements as a vector
    • C12N2770/00043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/38011Tombusviridae
    • C12N2770/38041Use of virus, viral particle or viral elements as a vector
    • C12N2770/38043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • the present disclosure relates to a single stranded RNA vector suitable for introducing a therapeutic agent, such as a peptide, a protein or a small RNA, into a host plant, wherein movement thereof is substantially limited to the phloem and targeted to control or manage a plant disease or condition.
  • a therapeutic agent such as a peptide, a protein or a small RNA
  • HLB Huanglongbing
  • Candidatus Liberibacter spp. asiaticus, africanus, and americanus
  • ACP Asian citrus psyllid
  • African citrus psyllid Trioza erytreae, Del Guercio
  • HLB is graft-transmissible and spreads naturally when a bacteria-containing psyllid feeds on a citrus tree and deposits the pathogenic bacteria into the phloem where the bacteria reproduce.
  • RNAs small ribonucleic acids
  • proteins proteins
  • peptides and hormones which are required for a large number of developmental processes and responses to biotic and abiotic stress (Fig. 1) (Lee, J.Y. and Frank, M. (2016), Plasmodesmata in phloem: different gateways for different cargoes, Curr Opin Plant Biol 43: 119-124; Tugeon, R. and Wolf, S.
  • mRNAs messenger RNAs
  • mRNAs comprise a portion of these signaling molecules, and thousands of companion cell mRNAs can be isolated from neighboring enucleated sieve elements, where they are transported bidirectionally by osmotically generated hydrostatic pressure from source (sugar generating) tissue to sink (sugar utilizing) tissue such as roots and shoot tips (Folimonova, S. Y. and Tilsner, J. (2016), Hitchhikers, highway tools and roadworks: the interactions of plant viruses with the phloem, Curr Opin Plant Biol 43:82-88; Ham, B.K. and Lucas, W.J.
  • RNA movement literature Confusion in the mRNA movement literature is pervasive. Some studies have indicated that the major determinant of RNA mobility is their abundance in companion cells (Kim, G. et al. (2014), Genomic-scale exchange of mRNA between a parasitic plant and its hosts, Science 345:808-811; Thieme, C.J. et al. (2015), Endogenous Arabidopsis messenger RNAs transported to distant tissues, Nature Plants 1(4): 15025; Yang, Y. et al. (2015), Messenger RNA exchange between scions and rootstocks in grafted grapevines, BMC Plant Biol 15, 251).
  • Plant viruses many of which move through the plant as a ribonucleoprotein complex (vRNP), have evolved to use the same pathway as used by endogenous RNA movement. Plant viruses can accumulate in substantial amounts, and most initiate infection in epidermal or mesophyll cells and then move cell-to-cell through highly selective intercellular connectors called plasmodesmata, which allow for continuity between the cytoplasm of neighboring cells (Fig. 1; see also Lee, J.Y. and Frank, M. (2018), Plasmodesmata in phloem: different gateways for different cargoes, Curr Opin Plant Biol 43: 119-124; Schoelz, J.E. etal.
  • Fig. 1 see also Lee, J.Y. and Frank, M. (2018), Plasmodesmata in phloem: different gateways for different cargoes, Curr Opin Plant Biol 43: 119-124; Schoelz, J.E. etal.
  • vRNPs For viruses that transit through the phloem as vRNPs, movement is similar to that of host mRNAs. All plant viruses encode at least one movement protein necessary for movement, which bind to viral RNA and also dilate plasmodesmata. Thus, host mRNA movement also likely requires similar host-encoded movement proteins. Movement proteins are non-specific RNA binding proteins. However, questions remain with regard to how vRNPs load into the phloem and unload in distal tissues, although reprograming companion cell gene expression may be required (Collum, T.D. et al.
  • RNA viruses require their own encoded movement proteins. Some researchers have suggested that RNA viruses require movement proteins if moving as preformed replication complexes that include a large RNA-dependent RNA polymerase (Heinlein, M. (2015), Plant virus replication and movement, Virology 479:657- 671), which is beyond the size-exclusion limit ( ⁇ 70 kDa) of companion cell plasmodesmata.
  • phloem-limited Closteroviruses have at least 5 movement proteins, and phloem-limitation can be relieved by over-expressing the silencing suppressor and downregulating host defenses (Folimonova, S.Y. and Tilsner, J. (2016), Hitchhikers, highway tolls and roadworks: the interactions of plant viruses with the phloem, Curr Opin Plant Biol 43:82-88), suggesting that phloem-limitation is a complex process for some viruses. Phloem-limitation can also be an active process (as opposed to lack of a cell-to-cell movement protein).
  • a direct connection between host movement of mRNAs and vRNP movement was established when the origin of plant virus movement proteins was solved.
  • a pumpkin protein (RPB50) related to the Cucumber mosaic virus movement protein was discovered that was capable of transporting its own mRNA, as well as other mRNAs, into the phloem (Xoconostle- Cazares, B. el at. ( 1999), Plant paralog to viral movement protein that potentiates transport of mRNA into the phloem, Science (New York, NY) 283:94-98; Ham, B.K. et al.
  • NCAPs non-cell-autonomous proteins
  • Umbravirus- encoded proteins both stabilize heterologous viral RNA and mediate its systemic movement in some plant species, Virology 288:391-400).
  • closteroviruses such as Citrus tristeza vims contain three movement proteins. However, for most viruses, all movement activities are thought to be associated with a single movement protein.
  • Delivering engineered therapeutic agents into plants for combating diseases, insects or other adverse conditions (e.g., such as HLB and/or the carrier insects) using virus vectors is an established means of introducing traits such as resistance to pathogens or other desired properties into plants for research purposes.
  • Various methods of providing vectors to plants are known in the art. This is often achieved by delivery of the virus vector into a plant cell’s nucleus by Agrobacteria tumefactions -mediated“agroinfiltration,” which may result in a modification of that cell’s genome, or by delivering the virus vector directly into a cell’s cytoplasm, which results in infection without a requirement for genomic modification.
  • the cDNA of the viral genome is introduced into T-DNA, which is then provided to the plants.
  • T-DNA comprises further regulatory DNA components, which allow transcription of the genome.
  • a DNA insert is attached to a virus cDNA vector that is able to infect the targeted plant. If the virus is an RNA virus, the virus and insert are transcribed into RNA within the plant cells, after which the virus behaves as a normal RNA virus (amplification and movement).
  • a virus should be engineered to accept inserts without disabling its functionality and to ensure that the engineered virus is able to accumulate systemically in the host to a level sufficient to deliver and in some cases express the insert(s).
  • inserts whether open reading frames (ORFs) that will be translated into proteins or RNAs that will be used for a beneficial function, should be delivered into the targeted tissue in a manner that is effective and sufficiently non-toxic to the host or to any downstream consumption of the host or the environment.
  • ORFs open reading frames
  • RNAs RNAs that will be used for a beneficial function
  • RNA or DNA therapies on a broad basis is substantially limited with existing technologies.
  • Over 1,000 plant viruses have been identified with many plants subject to infection by multiple viruses.
  • citrus trees are subject to Citrus leaf blotch virus, Citrus leaf rugose virus, Citrus leprosis virus C, Citrus psorosis virus, Citrus sudden death-associated virus, Citrus tristeza virus (CTV), Citrus variegation virus, Citrus vein enation virus and Citrus yellow mosaic virus, among others.
  • CTV the causal agent of catastrophic citrus diseases such as quick decline and stem pitting, is currently the only virus that has been developed as a vector for delivering agents into citrus phloem.
  • CTV is a member of the genus Clostero virus. It has a flexuous rod-shaped virion composed of two capsid proteins with dimensions of 2000 nm long and 12 nm in diameter. With a genome of over 19 kb, CTV (and other Clostero viruses) are the largest known RNA viruses that infect plants. It is a virulent pathogen that is responsible for killing or rendering useless millions of citrus trees worldwide, although the engineered vector form is derived from a less virulent strain, at least for Florida citrus trees (still highly virulent in California trees). Prior studies have purportedly demonstrated CTV-based vectors to express engineered inserts in plant cells (US 8389804; US 20100017911 Al). However, it has not been commercialized due to its inconsistent ability to accumulate in plants and achieve its targeted beneficial outcome. It is thought that CTV’s inability to replicate to sufficiently high levels and heat sensitivity limits its ability to generate a sufficient quantity of RNA for treatment.
  • CTV-based vectors have a very limited ability to deliver an effective beneficial payload where needed. Moreover, CTV is difficult to work with due to its large size. CTV is also subject to superinfection exclusion, wherein a CTV-based vector is unable to infect a tree already infected with CTV. CTV is also highly transmissible from plant to plant via several aphid species, a property disliked by regulators concerned with uncontrolled escape into the environment where it might mutate or interact with other hosts in undesirable ways. In addition, strains suitable for one region (e.g., Florida) are unsuitable for varieties of trees in another region (e.g., California). Despite such problems, CTV is the only viral vector platform available for citrus trees.
  • CTV is the only viral vector platform available for citrus trees.
  • the present disclosure relates to a novel infectious agent(s) capable of delivering an exogenous insert(s) into a plant, compositions comprising a plant infected by the disclosed agent(s), and methods and uses relating thereto.
  • the disclosed agents are sometimes referred to herein as“independently mobile RNAs” or“iRNAs.”
  • iRNAs independently mobile RNAs
  • iRNAs are not viruses given they do not code for any movement protein(s) or RNA silencing suppressors, which are key characteristics of all known plant viruses.
  • iRNAs unlike virtually all plant RNA viruses, with the exception of umbraviruses, iRNAs also do not encode a coat protein for encapsidating the RNA into virions, which is a requirement for vectored movement of viruses from plant to plant. Despite the lack of movement protein expression, iRNAs are able to move systemically within the phloem in a host plant.
  • iRNAs As compared to viruses, iRNAs have additional advantageous properties, such as: the ability to accumulate to levels exceeding those of most known plant viruses; relatively small size, e.g., being only about two-thirds the size of the smallest plant RNA virus and thus much easier to work with compared to such conventional plant RNA viruses; and the inability to spread on their own to other plants (given their inability to encode for any coat protein).
  • an infectious agent comprises an iRNA- based vector containing an engineered insert, which triggers in a plant expression of a targeted peptide, protein(s) and/or produces targeted small RNAs that are cleaved from the vector for beneficial application.
  • aspects of the present disclosure include: an iRNA-based vector for delivery of targeted anti-pathogenic agents; an anti-bacterial enzybiotic targeted at bacteria infecting a plant or bacteria required by the insect vector; an enzybiotic that is generated from the TEV IRES; incorporation of siRNAs into the iRNA genome; incorporation of inserts into a lock and dock structure to stabilize the base of a scaffold that supports the inserts; incorporation of siRNAs from a iRNA genome that has been modified to enhance the stability of the local region to precisely counter the destabilizing effects of the inserts; incorporation of an siRNA that disrupts or kills a targeted insect vector; incorporation of an siRNA that mitigates the negative impacts of a tree’s callose production; incorporation of an siRNA that mitigates the plant’s recognition of the pathogen; and incorporation of an insert that triggers a particular plant trait (e.g., dwarfism).
  • the infectious agents and compositions disclosed herein possess superior and advantageous properties as compared to conventional technologies.
  • the iRNA-based vectors of the present disclosure are suitable for use as a general platform for expression of various proteins and/or delivery of small RNAs into the phloem of citrus and other host plants.
  • a CYVaV-based vector is provided, which accumulates to massive levels in companion cell and phloem parenchyma cell.
  • the vectors of the present disclosure may be utilized to examine the effects of silencing specific gene expression in the phloem of trees.
  • CYV aV may be developed into a model system for examining long-distance movement of mRNAs through sieve elements. Since CYVaV is capable of infecting virtually all varieties of citrus, with few if any symptoms generated in the infected plants, movement of RNAs within woody plants may be readily examined.
  • the present disclosure is directed to a plus- sense single stranded ribonucleic acid (RNA) vector comprising a replication element(s) and a heterologous segment(s), wherein the RNA vector lacks a functional coat protein(s) open reading frame (ORF) and a functional movement protein(s) ORF.
  • the RNA vector comprises a 3’ Cap Independent Translation Enhancer (3’ CITE) comprising the nucleic acid sequence(s) of SEQ ID NO: 4 and/or SEQ ID NO: 5.
  • the 3’ CITE comprises the nucleic acid sequence of SEQ ID NO: 3.
  • the replication element(s) of the RNA vector comprises one or more conserved polynucleotide sequence(s) having the nucleic acid sequence of: SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, and/or SEQ ID NO: 14.
  • the replication element(s) additionally or alternatively comprises one of more conserved polynucleotide sequence(s) having the nucleic acid sequence of: SEQ ID NO: 15 and/or SEQ ID NO: 16.
  • the RNA vector is derived from citrus yellow vein virus (SEQ ID NO: 1) or an iRNA relative thereof.
  • the RNA vectors of the present disclosure are capable of systemic and phloem-limited movement and replication within a host plant.
  • the RNA vectors of the present disclosure are functionally stable for replication, movement and/or translation within the host plant for at least one month after infection thereof.
  • the heterologous segment(s) of the RNA vector of the present disclosure comprises a polynucleotide that encodes at least one polypeptide selected from the group consisting of a reporter molecule, a peptide, and a protein.
  • the polypeptide is an insecticide, an antibacterial, an antiviral, or an antifungal.
  • the antibacterial is an enzybiotic.
  • the antibacterial targets a bacterium Candidatus Liberibacter species, e.g. Candidate Liberibacter asiaticus (CLas).
  • the heterologous segment(s) of the RNA vector of the present disclosure comprises a small non-coding RNA molecule and/or an RNA interfering molecule.
  • the small non-coding RNA molecule and/or the RNA interfering molecule targets an insect vector, a virus, or a fungus.
  • the small non-coding RNA molecule and/or the RNA interfering molecule targets a nucleic acid of the insect vector, the virus, or said fungus.
  • targeted virus is selected from the group consisting of Citrus vein enation virus (CVEV) and Citrus tristeza virus (CTV).
  • the RNA vector may include multiple heterologous segments, each providing for the same or different functionality.
  • the heterologous segment(s) is a first heterologous segment, wherein the RNA vector further comprising a second heterologous segment(s), wherein the replication element(s) is intermediate the first and second heterologous segments.
  • the heterologous segment(s) of the RNA vector of the present disclosure comprises a polynucleotide that encodes for a protein or peptide that alters a phenotypic trait.
  • the phenotypic trait is selected from the group consisting of pesticide tolerance, herbicide tolerance, insect resistance, reduced callose production, increased growth rate, and dwarfism.
  • the present disclosure is also directed to a host plant comprising the RNA vector of the present disclosure.
  • the host plant may be a whole plant, a plant organ, a plant tissue, or a plant cell.
  • the host plant is in a genus selected from the group consisting of citrus, vitis, ficus and olea.
  • the host plant is a citrus tree or a citrus tree graft.
  • the present disclosure also relates to a composition
  • a composition comprising a plant, a plant organ, a plant tissue, or a plant cell infected with the RNA vector of the present disclosure.
  • the plant is in a genus selected from the group consisting of citrus, vitis, ficus and olea.
  • the plant is a citrus tree or a citrus tree graft.
  • the present disclosure also relates to a method for introducing a heterologous segment(s) into a host plant comprising introducing into the host plant the RNA vector of the present disclosure.
  • the step of introducing the heterologous segment(s) into the host plant comprises grafting a plant organ or plant tissue of a plant that comprises the RNA vector of the present disclosure to a plant organ or plant tissue of another plant that does not comprise the RNA vector prior to said introduction.
  • the RNA vectors of the present disclosure are capable of systemically infecting the host plant.
  • the present disclosure is also directed to a process of producing in a plant, a plant organ, a plant tissue, or a plant cell a heterologous segment(s), comprising introducing into said plant, said plant tissue or said plant cell the RNA vector of the present disclosure.
  • the plant is in a genus selected from the group consisting of citrus, vitis, ficus and olea.
  • the present disclosure also relates to a kit comprising the RNA vector of the present disclosure.
  • the present disclosure is also directed to use of the RNA vector(s) of the present disclosure for introducing the heterologous segment(s) into a plant, a plant organ, a plant tissue, or a plant cell.
  • the present disclosure is also directed to use of the host plant(s) of the present disclosure, or use of the composition(s) of the present disclosure, for introducing the RNA vector(s) into a plant organ or plant tissue that does not, prior to said introducing, comprise the RNA vector.
  • the step of introducing the RNA vector comprises grafting a plant organ or plant tissue of a plant that comprises the RNA vector to a plant organ or plant tissue of another plant that does not comprise the RNA vector.
  • the present disclosure is also directed to a method of making a vector for use with a plant comprising the steps of inserting one or more heterologous segment(s) into an RNA, wherein the RNA is selected from the group consisting of: CYV aV ; a relative of CYV aV ; other RNA vectors having at least 70% RdRp identity with CYVaV; and another iRNA.
  • the present disclosure also relates to a vector produced by the disclosed method(s).
  • the present disclosure also relates to the use of an RNA molecule as a vector, wherein the RNA is selected from the group consisting of: CYVaV; a relative of CYVaV; other RNA vectors having at least 70% RdRp identity with CYVaV; and, another iRNA.
  • the RNA is used in the treatment of a plant, for example the treatment of a viral or bacterial infection of a plant, for example the treatment of CTV infection or Citrus greening in a Citrus plant.
  • the RNA is modified with one or more inserted heterologous segment(s), for example an enzybiotic.
  • the present disclosure is also directed to the use an RNA molecule characterized by being in the manufacture of a medicament to treat a disease or condition of a plant, wherein the RNA is selected from the group consisting of: CYVaV; a relative of CYVaV; other RNA vectors having at least 70% RdRp identity with CYVaV; and, another iRNA.
  • the disease or condition is a viral or bacterial infection of a plant, for example CTV or Citrus greening in a Citrus plant.
  • the present disclosure is also directed to an RNA molecule for use as a medicament or in the treatment of a disease or condition of a plant, wherein the RNA is selected from the group consisting of: CYVaV; a relative of CYVaV; other RNA vectors having at least 70% RdRp identity with CYVaV; and, another iRNA.
  • FIG. 1 illustrates schematically the movement pathways through the vascular system of plants (Lee, J.Y. and Frank, M. (2016), Plasmodesmata in phloem: different gateways for different cargoes, Curr Opin Plant Biol 43: 119-124).
  • Fig. 2 is a phylogenic tree showing relatedness of the CYVaV with some viruses in the family Tombusviridae.
  • FIG. 3 illustrates schematically the genome organization of CYVaV and similar RNA molecules (Panel A).
  • ORFs encoding for proteins involved in replication are identified in darker grey (p33 and p94 for PEMV2; p21 and p81 for CYVaV; p35 and p86 for PMeV2-ES; p31 and p85 for PUV; p29 and p89 for TBTVa).
  • Umbravirus PEMV2 also possesses ORFs encoding for proteins p26 and p27 involved in movement (identified in light grey boxes). Frameshifting ribosome recording site (FS) and readthrough ribosome recoding site (RT) are also identified.
  • FS frameshifting ribosome recording site
  • RT readthrough ribosome recoding site
  • CYVaV plus (+) strands in infiltrated N. benthamiana leaves Panel B, top
  • systemic leaves Panel B, bottom
  • levels of the RNA-dependent RNA polymerase (RdRp) synthesized by frameshifting in vitro in wheat germ extracts of full-length CYVaV and PEMV2 are shown (Panel C).
  • the difference in levels of p94 from PEMV2 as compared to p81 polymerase produced by CYVaV is significant.
  • the frameshifting site of CYVaV is one of the strongest known in virology and believed to be responsible for its exceptionally high accumulation.
  • Fig. 4 illustrates schematically the genome organization of additional iRNAs and close relatives of CYVaV identified in Opuntia, Fig trees, and Ethiopian com.
  • the iRNA relatives all have inserts in the 3’UTR and other nucleotide changes that result in the generation of an ORE that encodes for a protein (p21.2) of unknown function.
  • Fig. 5 shows RNA levels from agro-infiltrated leaves of Nicotiana benthamiana.
  • CVEV (lanes 1-2), CVEV+CYVaV (lanes 3-5) and CYVaV (lanes 5-8) in leaves of Nicotiana benthamiana.
  • Accumulation of CYVaV increased substantially in the presence of putative helper virus CVEV. Plus-strands are shown above.
  • rRNA loading controls are shown below. pl4 silencing suppressor was co-infiltrated in all leaves.
  • Fig. 6 shows RNA levels from another experiment with agroinfiltrated leaves of Nicotiana benthamiana.
  • CYVaV or CVEV or CYVaV + CVEV agroinfiltrated into leaves of N. benthamiana.
  • CYVaV was encapsidated in virions of CVEV, and virions were isolated one week later and the encapsidated RNAs subjected to PCR analysis.
  • Fig. 7 shows yellowing symptoms of CYVaV (Panel A) and CYVaV + CVEV (Panel B), which are limited to citron (pictured), lemon, and lime.
  • Fig. 8 shows the systemic and phloem-limited movement of CYVaV in N. benthamiana, wherein CYVaV is confined to the transport tissues of the plant.
  • FISH Flu
  • Fig. 9 illustrates schematically the full-length secondary structure of CYVaV as determined by SHAPE structure probing and phylogenetic comparisons with the CYVaV relatives in Opuntia, fig and com.
  • the recoding frameshift site (see Fig. 10) is identified by boxed single solid line region, and the ISS-like (I-shaped structure) 3’CITE (see Fig. 11) is identified by boxed dashed line region.
  • boxed dashed line region For example, a region for accommodating inserted hairpin(s) is shown by boxed double line region.
  • Fig. 10 illustrates schematically the structure of the recoding frameshift sites in CYVaV and PEMV2 (Panel A).
  • CYVaV has multiple conformations of the structures in this region (see Fig. 9) with only one shown.
  • Slippery site is identified by boxed dashed line, and stop codon bases are in black circles.
  • Bases identified by boxed solid line engage in long-distance interaction with the 3’ end.
  • Fig. 11 illustrates schematically the ISS-like 3’ Cap Independent Translation Enhancer (3’CITE) of CYVaV.
  • the structure of the 3’ end of CYVaV is shown.
  • the 3’CITE is illustrated at the left-most portion shown and with bases circled. Sequence identified by boxed solid line engages in the long-distance RNA:RNA interaction with the recoding site.
  • Fig. 12 illustrates results from a trans-inhibition assay.
  • Full-length CYVaV was translated in vitro in the presence of 10-fold molar excess of a truncated version of the ISS (ISSs) or full-sized ISS (ISSL).
  • ISSs truncated version of the ISS
  • ISSL full-sized ISS
  • Fig. 13 demonstrates that CYVaV does not encode a silencing suppressor.
  • N. benthamiana 16C plants were agroinfiltrated with a construct expressing GFP (which is silenced in these plants) and either constructs expressing CYVaV p21 or p81, or constructs expressing known silencing suppressors pl9 (from TBSV) or p38 (from TCV). Only pl9 and p38 suppress the silencing of GFP, allowing the green fluorescence to be expressed (infiltrated regions identified by circled dashed line in Panel B).
  • Panel C northern blot probed with GFP oligonucleotide showed that GFP RNA is still silenced in the presence of p21 or p81.
  • Fig. 14 demonstrates replication of CYVaV in Arabidopsis protoplasts.
  • An infectious clone of CYVaV was generated. Wild-type RNA transcripts (CYVaV) or transcripts containing a mutation in the recoding slippery site that eliminates the synthesis of the RdRp (CYVaV -fsm), and thus doesn’t replicate, were inoculated onto Arabidopsis protoplasts. RNA was extracted and a Northern blot performed 30 hours later. Note that inoculated transcripts of CYVaV -fsm were still present in the protoplasts at 30 hours (whereas in a traditional virus they would be undetectable after 4 hours). Plus strands are shown in Panel A, and minus strand replication intermediate is shown in Panel B.
  • Fig. 15 demonstrates replication of CYVaV in N. benthaminana.
  • Panel A the level of CYVaV accumulating in the infiltrated leaves of N. benthamiana as determined by Northern blot is shown.
  • Panel B plants infiltrated with CYVaV sporadically showed systemic symptoms (see Fig. 16). These plants accumulated high levels of CYVaV.
  • Panel C the level of CYVaV in individual leaves of a systemically infected plant is shown. Leaves 4 and 5 were agroinfiltrated with CYVaV. Note the substantial accumulation of CYVaV in the youngest leaves.
  • Fig. 16 show symptoms of N. benthamiana systemically infected with CYVaV. Leaves 4 and 5 were agroinfiltrated with CYVaV. The first sign of a systemically infected plant is a “cupped” leaf (Panel A), which was nearly always leaf 9. In the following few weeks, leaf galls emerged at the apical meristem and each node of the plant (Panel B). An uninfected plant (Panel C, left) and an infected plant (Panel C, right) of the same age are shown. Systemically infected plants also had root galls (Panel D), containing a substantial amount of CYVaV as evidenced by Northern plant blot (Panel E).
  • Fig. 17 is an image of a tomato plant at 53 days post-infection (left) with a plant of the same age (right), and demonstrating the exceptional host range of CYVaV. Sap from a sy stemically-infected N. benthamiana plant was inj ected into the petiole of a tomato plant. One of four plants showed very strong symptoms and was positive for CYVaV by PCR analysis.
  • Fig. 18 demonstrates that CYVaV binds to a highly abundant protein extracted from the phloem of cucumber.
  • Panel A labeled full-length CYVaV bound to a prominent protein in this northwestern blot. Proteins were renatured after SDS gel electrophoresis. This protein is believed to be a known, highly conserved RNA binding protein containing an RRM motif that is known to chaperone RNAs from companion cells into sieve elements in the phloem of cucumber.
  • Panel B no binding was seen when the proteins remained denatured after electrophoresis.
  • Fig. 19 demonstrates that CYVaV is capable of expressing an extra protein from its 3’UTR using a TEV IRES.
  • TEV Tobacco etch virus
  • IRES internal ribosome entry site
  • Fig. 20 illustrates a stable hairpin insert at position 2250.
  • a schematic representation of CY2250sfPDS60 is shown in Panel A.
  • the location of the insert in the secondary structure of CYVaV is shown in Panel B, which location corresponds to a region for accommodating inserted hairpins, such as shown by double line box in Fig. 9.
  • Data from wheat germ extract in-vitro translation assay of T7 transcripts from CYVaV-wt, and CYVaV VIGS vectors containing different amounts of sequence at position 2250 are shown in Panel C.
  • construct sfPDS60 demonstrated excellent systemic movement in plants.
  • CYVaV-GDD negative control is shown in Panel D. (+) represents plus-strands and (-) are minus strand replication intermediates.
  • An image of N. benthamiana infected by CY2250sfPDS60 is shown in Panel E.
  • RT-PCR products from local leaf and systemic leaf are shown in Panel F.
  • the primer set amplify positions 1963-2654 in the 3’ region of CYVaV.
  • the sequence of the insertion region (underlined) of the vector collected from systemic leaf is shown in Panel G, with dashed line boxed sequences on either side of the insert forming the stem of the hairpin.
  • Fig. 21 illustrates a stable hairpin insert at position 2301.
  • a schematic representation of CY2301sfPDS60 is shown in Panel A.
  • the location of the insert in the secondary structure of CYVaV is shown in Panel B, and corresponds to a region for accommodating inserted hairpins, such as shown by double line box in Fig. 9.
  • Data from wheat germ extract in-vitro translation assay of T7 transcripts from CYVaV-wt, and CYVaV VIGS vectors containing different amounts of sequence at positions 2301 and 2319 are shown in Panel C.
  • construct PDS60 demonstrated excellent systemic movement in plants.
  • thaliana protoplasts infected by CYVaV wt and CYVaV VIGS vectors CYVaV-GDD and negative control is shown in Panel D. (+) represents plus-strands and (-) are minus strand replication intermediates.
  • An image of N. benthamiana infected by CY2301sfPDS60 is show in Panel E.
  • RT-PCR products from local leaf and systemic leaf are shown in Panel F.
  • the primer set amplify positions 1963-2654 in the 3’ region of CYVaV.
  • the sequence of the insertion region of the virus vector collected from systemic leaf is shown in Panel G, with dashed line boxed sequences forming the stem of the hairpin.
  • Fig. 22 illustrates a stable hairpin insert at position 2319.
  • a schematic representation of CY2319sfPDS60 is shown in Panel A.
  • the location of the insert in the secondary structure of CYVaV is shown in Panel B, and corresponds to the region for accommodating inserted hairpins shown by double line box in Fig. 9.
  • Data from wheat germ extract in-vitro translation assay of T7 transcripts from CYVaV-wt, and CYVaV VIGS vectors containing different amounts of sequence at position 2301 and 2319 are shown in Fig. 21, Panel C. Northern blot analysis of total RNA isolated from A. thaliana protoplasts infected by CYVaV wt and CYVaV VIGS vectors.
  • CYVaV-GDD and negative control is also shown in Fig. 21, Panel D.
  • An image of N. benthamiana infected by CY2319sfPDS60 is shown in Panel C.
  • RT-PCR products from local leaf and systemic leaf is shown in Panel D.
  • the primer set amplify positions 1963-2654 in the 3’ region of CYVaV.
  • Fig. 23 illustrates the location of a 60 nt insertion (non-hairpin) onto the ORF of the RdRp of CYVaV (Panel A). The location of the insert is indicated by the black arrow. A stop codon, indicated by the black hexagon, was engineered just upstream of the insert to truncate the RdRp. Northern blot of plus-strand RNA levels in Arabidopsis protoplasts is shown in Panel B. CYVaV-GDD is a non-replicating control.
  • Fig.24 illustrates a lock and dock sequence for stabilizing the base of inserts.
  • tetraloop GNRA GAA
  • Panel B tetraloop GNRA
  • Panel C a unique lock and dock structure is shown. Inserts (hairpins or non hairpin sequences) may be added to the restriction site (as identified by dashed line box). Circled bases in the sequences are the docking sequences for the GAAA tetraloop.
  • Fig. 25 illustrates that stabilizing the local 3’UTR structure is highly detrimental, but insertion of a destabilizing insert nearby restores viability.
  • Panel A a schematic representation of CYVaV-wt.
  • CYVaV-wt 3’stb is the parental stabilized construct containing 6 nt changes converting G:U pairs to G:C pairs.
  • Two insertions of 60 nucleotides were added to the stabilized parental construct at positions 2319 and 2330 forming CY2319PDS60 _3’stb and CY2330PDS60_3’stb.
  • Nucleotide changes made to stabilize the structure and generate CYVaV-wt 3’stb are circled in Panel B.
  • Insertion sites are indicated by the arrows for each constructs: left arrow in Panel A indicting insertion site for construct CY2319PDS60_3’stb; right arrow in Panel A indicating insertion site for construct CY2330PDS60_3’stb.
  • Panel C data is shown from wheat germ extract in-vitro translation assay of T7 transcripts from the constructs shown in Panel A. Note that p81 levels (the frame-shift product) is strongly affected by stabilizing this region.
  • Panel D northern blot analysis of total RNA isolated from A.
  • CYVaV-wt CYVaV-wt 3’stb
  • CY2330PDS60_3’stb CYVaV-GDD (non-replicating control)
  • (+) represents plus-strands
  • (-) are minus strand replication intermediates.
  • the present disclosure relates to novel infectious agents for use as vectors for plants, compositions comprising a plant infected by the disclosed agent(s), and uses and methods relating thereto.
  • the infectious agents of the present disclosure are sometimes referred to herein as“independently mobile RNAs” or“iRNAs” and exhibit superior characteristics as compared to conventional viral vectors.
  • the iRNAs are RNA molecules capable of infecting plants and encoding for an RNA polymerase to sustain their own replication, but lacking the ability to encode for any movement protein or coat protein.
  • iRNAs do not code for any RNA silencing suppressors.
  • a“host” refers to a cell, tissue or organism capable of being infected by and capable of replicating a nucleic acid.
  • a host may include a whole plant, a plant organ, plant tissue, a plant protoplast, and a plant cell.
  • a plant organ refers to a distinct and visibly differentiated part of a plant, such as root, stem, leaf, seed, graft or scion.
  • Plant tissue refers to any tissue of a plant in whole or in part.
  • Protoplast refers to an isolated cell without cell walls, having the potency for regeneration into cell culture, tissue or whole plant.
  • Plant cell refers to the structural and physiological unit of plants, consisting of a protoplast and the cell wall.
  • nucleic acid sequence As used herein,“nucleic acid sequence,”“polynucleotide,”“nucleotide” and “oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length. Polynucleotides may have any three-dimensional structure, and may perform any function.
  • A“gene” refers to a polynucleotide containing at least one open reading frame that is capable of encoding a particular polypeptide sequence. “Expression” refers to the process by which a polynucleotide is transcribed into mRNA and/or the process by which the transcribed mRNA is translated into peptides, polypeptides, or proteins.
  • a vector“derived from” a particular molecule means that the vector contains genetic elements or sequence portions from such molecule.
  • the vector comprises a replicase open reading frame (ORF) from such molecule (e.g., iRNA).
  • ORF replicase open reading frame
  • One or more heterologous segment(s) may be added as an additional sequence to the vectors of the present disclosure.
  • said heterologous segment(s) is added such that high level expression (e.g., of a particular protein or small RNA) is achieved.
  • the resulting vector is capable of replicating in plant cells by forming further RNA vector molecules by RNA-dependent RNA polymerization using the RNA vector as a template.
  • An iRNA vector may be constructed from the RNA molecule from which it is derived (e.g., CYVaV).
  • an“infection” or“capable of infecting” includes the ability of a vector to transfer or introduce its nucleic acid into a host, such that the nucleic acid or portion(s) thereof is replicated and/or proteins or other agents are synthesized or delivered in the host. Infection also includes the ability of a selected nucleic acid sequence to integrate into a genome of a target host.
  • a“phenotypic trait” refers to an observable, measurable or detectable characteristic or property resulting from the expression or suppression of a gene or genes. Phenotype includes observable traits as well as biochemical processes.
  • heterologous refers to a polypeptide, nucleic acid or gene that is expressed by a host.
  • heterologous refers to a polypeptide, nucleic acid or gene that is not naturally expressed by a host.
  • A“functional heterologous ORF” refers to an open reading frame (ORF) that is not present in the respective unmodified or native molecule and which can be expressed to yield a particular agent such as a peptide, protein or small RNA.
  • ORF open reading frame
  • the vector comprising a functional heterologous ORF comprises one or more subgenomic promoters or other sequence(s) required for expression.
  • Various assays are known in the art for determining expression of a particular product, including but not limited to: hybridization assays (e.g. Northern blot analysis), amplification procedures (e.g. RT-PCR), and array-based technologies. Expression may also be determined using techniques known in the art for examining the protein product, including but not limited to: radioimmunoassay, ELISA (enzyme linked immunoradiometric assays), sandwich immunoassays, immunoradiometric assays, in situ immunoassays, western blot analysis, immunoprecipitation assays, immunofluorescent assays, GC-Mass Spec, and SDS- PAGE.
  • hybridization assays e.g. Northern blot analysis
  • amplification procedures e.g. RT-PCR
  • array-based technologies e.g., array-based technologies. Expression may also be determined using techniques known in the art for examining the protein product, including but not limited to: radioimmunoassay,
  • An“exogenous RNA segment” refers to a segment of RNA inserted into a native molecule, whereby the source of the exogenous RNA segment is different from the native molecule.
  • the source may be another virus, a living organism such as a plant, animal, bacteria, virus or fungus, a chemically synthesized material, or a combination thereof.
  • the exogenous RNA segment may provide any function appropriate for a particular application, including but not limited to: a non-coding function RNA, a coding function in which the RNA acts as a messenger RNA encoding a sequence which, translated by the host cell, results in synthesis of a peptide (e.g., a molecule comprising between about 2 and 50 amino acids) or a protein (e.g. a molecule comprising 50 or more amino acid) having useful or desired properties.
  • a non-coding function RNA e.g., a coding function in which the RNA acts as a messenger RNA encoding a sequence which, translated by the host cell, results in synthesis of a peptide (e.g., a molecule comprising between about 2 and 50 amino acids) or a protein (e.g. a molecule comprising 50 or more amino acid) having useful or desired properties.
  • movement protein refers to a protein(s) required for cell-to-cell and/or long distance movement.
  • Coat protein refers to protein(s) comprising or building the virus coat.
  • iRNAs do not possess a functional coat protein(s) ORF and/or otherwise encode for any coat protein.
  • the RNA polymerase of iRNAs is similar to that of umbraviruses.
  • iRNAs do not possess a functional movement protein(s) ORF and/or otherwise encode for any cell-to-cell movement protein(s) or any long-distance movement protein(s) that serves as a stabilization protein for countering nonsense mediated decay.
  • RNA silencing defense system Conventional viruses lacking coat proteins are generally less stable inside a plant cell given their genomes are vulnerable to the host RNA silencing defense system.
  • iRNAs are surprisingly stable in the intracellular environment, which is an important characteristic for an effective vector. iRNAs are also restricted to the inoculated host plant in the absence of a specific helper virus, since without associated virions they are not transmissible by an insect vector. It is believed that iRNAs are encapsidated into virions only when in the presence of a specific helper virus, e.g., such as an enamovirus, including Citrus vein enation virus (CVEY), which is a rarely seen virus in the United States.
  • CVEY Citrus vein enation virus
  • RNA vector that comprises a replication element(s) and a heterologous segment(s).
  • the RNA vectors of the present disclosure are capable of accumulating to high levels in phloem, and are capable of delivering a therapeutic agent(s) such as a protein, a peptide, an antibacterial and/or an insecticide (e.g . , siRNAs) directly into the plant tissue.
  • the RNA vector is derived from an iRNA molecule, which lacks the ability to encode for any coat protein(s) or movement protein(s).
  • the vector is derived from and/or includes structural elements of the iRNA molecule known as Citrus yellow vein associated virus (CYVaV), an unclassified molecule associated with yellow-vein disease of citrus.
  • CYVaV Citrus yellow vein associated virus
  • kits and/or mixtures comprising an iRNA-based (e.g. a CYVaV-based) vector(s).
  • iRNA-based e.g. a CYVaV-based
  • Such mixtures may be in a solid form, such as a dried or freeze-dried solid, or in a liquid, e.g. as aqueous solution, suspension or dispersion, or as gels.
  • Such mixtures can be used to infect a plant, plant tissue or plant cell.
  • kits and mixtures may be used for successfully infecting a plant(s) or plant cell(s) with the iRNA-based vectors of the present disclosure and/or for expression of heterologous proteins or delivery of other therapeutic agents to such plant or plant cell(s).
  • the present disclosure also relates to a plant, plant tissue, or plant cell comprising said iRNA-based vector as disclosed herein, and/or a plant, plant tissue, or plant cell comprising a therapeutic agent or heterologous polypeptide encoded or delivered by said vector.
  • the present disclosure also provides for methods of isolating such heterologous polypeptide from the plant, plant tissue, or plant cell. Methods for isolating proteins from a plant, plant tissue or plant cell are well known to those of ordinary skill in the art.
  • CYVaV was found in four limequat trees in the 1950s independent of any helper virus (Weathers, L. (1957), A vein-yellowing disease of citrus caused by a graft-transmissible virus, Plant Disease Reporter 41:741-742; Weathers, L.G. (1960), Yellow-vein disease of citrus and studies of interactions between yellow-vein and other viruses of citrus, Virology 11 : 753-764; Weathers, L.G. (1963), Use of synergy in identification of strain of Citrus yellow vein virus, Nature 200:812-813). Further analysis and sequencing of CYVaV was conducted years later by Georgios Vidalakis (University of California, Davis, CA; GenBank: JX101610). Dr.
  • Vidalakis s lab conducted analysis on samples collected from previously established tree sources (Weathers, L.G. (1963), Use of synergy in identification of strain of Citrus yellow vein virus, Nature 200:812-813) and maintained in the disease bank of the Citrus Clonal Protection Program (CCPP). Studies by the Vidalakis lab to characterize CYVaV were inconclusive. However, many of the infected samples containing CYVaV also contained the enamo virus citrus vein enation virus (CVEV); it was relatively common in the 1950s through 1980s for CCPP personnel to mix infect plants with yellow-vein and vein enation for symptom enhancement.
  • CVEV enamo virus citrus vein enation virus
  • CYVaV is a small ( ⁇ 2.7 kb) iRNA molecule composed of a single, positive sense strand of RNA. It replicates to extremely high levels, is very stable, is limited to the phloem, and has no known mechanism of natural spread. As such, CYVaV is ideal as a vector platform for introducing an agent(s) into a plant host, e.g., such as a small RNA (e.g., non-coding RNA molecule of about 50 to about 250 nt in length) and/or proteins for disease and/or pest management.
  • a small RNA e.g., non-coding RNA molecule of about 50 to about 250 nt in length
  • proteins for disease and/or pest management.
  • proteins that bolster (or silence) defenses, antimicrobial peptides that target bacterium, and/or small RNAs that target plant gene expression or the insect vectors of disease agents provide an effective management strategy.
  • the proteins and small RNAs should be produced in sufficient quantities and accumulate to sufficient levels in the phloem, particularly small RNAs designed to be taken up by targeted insects or fungal pathogens.
  • CYVaV is only transmissible from tree to tree by grafting, but has been shown to infect nearly all varieties of citrus with the exception of hearty orange, including but not limited to infecting citron, rough lemon, calamondin, sweet orange, sour orange, grapefruit, Rangpur and West Indian lime, lemon, varieties of mandarin, varieties of tangelo, and kumquat. It produces a yellowing of leaf veins in the indicator citron tree and has no or very mild yellow vein symptoms in sweet orange and other citrus with no reported impact on fruit quality, or otherwise causing harm to trees.
  • Fig. 2 Genome organization of CYVaV and similar RNA molecules is illustrated in Fig. 3, Panel A, including PEMV2, PMeV2-ES (GenBank: KT921785), PUV (GenBank: KP165407.1), and TBTVa (GenBank: EF529625.1).
  • the RdRp of CYVaV is most closely related to the umbravirus Pea enation mosaic virus RNA2 (PEMV2).
  • PET2 umbravirus Pea enation mosaic virus RNA2
  • Examination of 5’ and 3’ sequences of CYVaV revealed considerable similarity to those of umbraviruses, confirming that CYVaV is indeed a complete infectious agent.
  • CYVaV has a plus-sense single stranded RNA genome that only encodes two proteins involved in replication: p21, a replicase- associated protein in related molecules; and p81, the RNA-dependent RNA polymerase (RdRp) that is synthesized by a ribosome recoding (frameshift) event (Fig. 3, Panel A).
  • RdRp RNA-dependent RNA polymerase
  • FIG. 3, Panel A levels of the RNA-dependent RNA polymerase (RdRp) synthesized by frameshifting in vitro are shown for PEMV2 and CYVaV.
  • the difference in levels of p94 (RdRp) from PEMV2 as compared to p81 from CYVaV is significant (Fig. 3, Panel C).
  • the frameshifting site of CYVaV is one of the strongest known in virology and believed to be responsible for its exceptionally high accumulation.
  • the 3’ end (and 3’ CITE) of CYVaV comprises the following conserved polynucleotide sequence(s) (bolded and underlined above): auagcacug (SEQ ID NO: 4); and/or
  • amino acid sequence of protein p21 is presented below (SEQ ID NO:7): MDPSSLPRACWHHARQVFRASTSFSREWRAARRWVTMPTSRHAYDFSTSLGIVIAEPAARLRRRLPS
  • amino acid sequence of protein p81 is presented below (SEQ ID NO:9):
  • the replication element of CYVaV (e.g., that encodes for protein p81) comprises the following conserved polynucleotide sequence(s) (highlighted and underlined above): cguuc (SEQ ID NO: 10);
  • ggag SEQ ID NO: 13
  • aaauggga SEQ ID NO: 14
  • CYVaV may additionally comprise the following conserved polynucleotide sequence(s) (highlighted and underlined above): ucgacg (SEQ ID NO: 15); and/or
  • iRNA relative 3 The polynucleotide sequence of an iRNA identified in maize (sometimes referred to herein as“iRNA relative 3” or“iRNA r3”) is presented below (SEQ ID NO: 22): gggguaaauauggagaaccagcacacccauguuugcccacggucguuccugcgaaccugcagggcgau ccucgcggcuccagccaacuacggucgugauguggucaaaaucgccuacaaugggcaucacgaaacc ccgcaccgcccccgaaguguccgagaauccaucggggucguugucggaagcgcuguggacuucuug agcgcuccucgcaagcguuuagaagaccgcgcagagcaguuggugcaagacgaccgggucgaccggau cguccgcgagugggagcuaggaaccgc
  • iRNA relatives may comprise conserved polynucleotide sequence(s) (bolded and underlined above): auagcacug (SEQ ID NO: 4); and/or gauuuguga (SEQ ID NO: 5).
  • the iRNA molecule comprises both of conserved polynucleotide sequence(s): auagcacug (SEQ ID NO: 4); and gauuuguga (SEQ ID NO: 5).
  • iRNA relatives may comprise conserved polynucleotide sequence(s) (bolded and underlined above): cguuc (SEQ ID NO: 10); gaacg (SEQ ID NO: 11); gguuca (SEQ ID NO: 12); ggag (SEQ ID NO: 13); and/or aaauggga (SEQ ID NO: 14).
  • the iRNA molecule comprises all of conserved polynucleotide sequence(s): cguuc (SEQ ID NO: 10); gaacg (SEQ ID NO: 11); gguuca (SEQ ID NO: 12); ggag (SEQ ID NO: 13); and aaauggga (SEQ ID NO: 14)
  • iRNA relatives may comprise conserved polynucleotide sequence(s) (bolded and underlined above): ucgacg (SEQ ID NO: 15); and/or cuccga (SEQ ID NO: 16).
  • the iRNA molecule may comprise both conserved polynucleotide sequence(s): ucgacg (SEQ ID NO: 15); and cuccga (SEQ ID NO: 16).
  • the iRNA molecule are highly related to CYVaV (or to iRNA rl, iRNA r2, or iRNA r3), and comprise a polynucleotide sequence having 70% or more identity for the recoding site for synthesis of RdRp thereof, e.g., 75% or 85% or 90% or 95% or 98% identify of the RdRp of CYVaV (or of iRNA rl, iRNA r2, or iRNA r3).
  • an RNA vector (e.g., derived from an iRNA molecule) comprises a frameshift ribosome recoding site for synthesis of the RNA-dependent RNA polymerase (RdRp).
  • the RNA vector may include a 3’ end comprising a polynucleotide sequence that terminates with three cytidylates (... CCC).
  • the penultimate 3’ end hairpin may also contains three guanylates in the terminal loop (... GGG... ).
  • the 3’ CITE includes an extended hairpin or portion thereof that binds to Eukaryotic translation initiation factor 4 G (eIF4G) and/or Eukaryotic initiation factor 4F (eIF4F).
  • an RNA vector comprises a 3’CITE comprising conserved sequences auagcacug (SEQ ID NO: 4) and gauuuguga (SEQ ID NO: 5).
  • the RNA vector may also comprise one or more of the following polynucleotide sequences (conserved sequences of identified iRNA molecules): cguuc (SEQ ID NO: 10) and gaacg (SEQ ID NO: 11); and/or gguuca (SEQ ID NO: 12) and ggag (SEQ ID NO: 13); and/or aaauggga (SEQ ID NO: 14).
  • the RNA vector may comprise one or both of the following polynucleotide sequences (conserved sequences of identified iRNA molecules): ucgacg (SEQ ID NO: 15) and cuccga (SEQ ID NO: 16).
  • iRNAs such as CYVaV from any plant virus (Fig. 2) are differentiating characteristic of iRNAs that do not encode any movement protein(s), which is characteristic of all known plant viruses including umbraviruses.
  • iRNAs such as CYVaV require any helper virus for systemic movement through plants, including tested citrus and Nicotiana benthamiana (a laboratory model plant).
  • PEMV2 encodes for two movement proteins: p26 (long-distance movement) and p27 (cell-to-cell movement) (Fig. 3, Panel A).
  • p26 is also a stabilization protein that protects the genome from nonsense mediated decay, and is required for accumulation at detectable levels of PEMV2 in single cell protoplasts (Gao, F. and Simon, A.E. (2017), Differential use of 3 ' CITEs by the subgenomic RNA of Pea enation mosaic virus 2, Virology 510: 194-204).
  • Umbraviruses are unusual viruses as they do not encode a coat protein or RNA silencing suppressor, but rather rely on a helper virus for these functions.
  • the helper virus is the enamovirus PEMV1.
  • PEMV2 polynucleotide sequence of PEMV2 is presented below (SEQ ID NO:23): ggguauuuau agagaucagu augaacugug ucgcuaggau caagcggugg uucacaccug acuucacccc uggcgagggc gugaagucua gagcucaacu ggaaagagag cuggauccca ccugggcgcu ucucgugugc caagaacgag cgcgucguga ugcugacagu auugcuaaug agugguacga gggcagcaug gagugcaacc uccuuauccc ucggcccaca accgaggaug uauuuggccc cuccaucgcccccugagccug uggcucuagu ggaggaaacu acccguuccc gcgcguguggcucuagu gga
  • CYVaV unexpectedly replicates very efficiently in Arabidopsis thaliana protoplasts despite not encoding p26 (or any other movement protein), which is required for accumulation of PEMV2 because of its ability to also counter NMD.
  • CYVaV was unusually stable, much more stable than most traditional viruses. CYVaV also produced an astonishingly high level of p81 in wheat germ extracts, at least 50-fold more than the p94 orthologue from PEMV2 (Fig. 3, Panel C).
  • CYVaV was agro-infiltrated into leaves of Nicotiana benthamiana, it replicated in the infiltrated tissue but accumulation was relatively weak (Fig. 3, Panel B, top; Fig. 5, lanes 6-8). No replication was achieved with manual inoculation.
  • CYVaV was co-infiltrated with the enamo virus Citrus vein enation virus (CVEV), accumulation improved substantially in these cells (Fig. 5, lanes 3-5; see also Fig. 6).
  • yellowing symptoms of CYVaV + CVEV (Fig. 7, Panel B) were more vibrant as compared to symptoms exhibited by CYVaV alone (Fig. 7, Panel A).
  • CYVaV had no synergistic effect with any other combination of citrus virus tested. Additional studies showed that CVEV may be utilized as a helper virus for CYVaV in order to allow for transmission from tree to tree. CVEV was likely responsible for the presence of CYVaV in the original limequat trees; however, CVEV is known to be very heat sensitive and thus was likely lost from the limequat trees during a hot summer.
  • CYVaV moved sporadically into upper, uninoculated leaves and accumulated at extremely high levels, sometimes visible by ethidium staining on gels. Symptoms that began in the ninth leaf of the major bolt comprised stunting, leaf curling, and deformation of floral tissue. Leaves in axillary stems also began showing similar symptoms around the same time. This astonishing result demonstrated that CYVaV moves systemically in the absence of any encoded movement protein(s), which is not possible by traditional plant viruses. Experiments showed that CYVaV moves systemically in N. benthamiana and is strictly confined to the phloem, replicating only in companion cells and phloem parenchyma cells. In citrus, CYVaV is 100% graft-transmissible, but difficult to transmit in other forms.
  • Fluorescence in situ hybridization (FISH) of symptomatic leaf tissue and roots confirmed that CYVaV is confined to phloem parenchyma cells, companion cells and sieve elements (Fig. 8, Panels A-G), which is characteristic of a phloem-limited virus.
  • CYVaV levels were extremely high in the petioles of symptomatic tissue and sometimes visible in ethidium- stained gels of total RNA.
  • symptoms are more severe in N. benthamiana, CYVaV has been found to be virtually symptomless in all varieties of citrus tested. Indeed, the most severe symptom was found on citron, the indicator tree for citrus viruses, and consisted of very minor gold flecking on leaves scattered throughout the tree.
  • Phloem-limited movement of CYVaV explains why it is readily graft- transmissible, but not transmissible by any other means.
  • CYVaV lacks any encoded movement protein(s) as noted above. Instead, CYVaV utilizes the host plant’s endogenous movement protein(s) and pathway for transiting between companion cells, phloem parenchyma cells, and sieve elements.
  • host range is believed to involve compatible interactions between viral movement proteins and host plasmodesmata-associated proteins, it is believed that CYVaV is capable of transiting through the phloem of numerous other woody and non- woody host plants using such host’s endogenous movement protein(s).
  • CYVaV provides an exceptional model system for examining RNA movement (e.g., in N. benthamiana and/or citrus) and for use as a vector for numerous applications.
  • RNA movement e.g., in N. benthamiana and/or citrus
  • CYVaV moves systemically in a host plant and is limited to the phloem, and is readily graft- transmissible but not transmissible in other forms.
  • Citrus trees have a complex reproductive biology due to apomixis and sexual incompatibility between varieties. Coupled with a long juvenile period that can exceed six years, genetic improvement by traditional breeding methods is complex and time consuming.
  • the present disclosure overcomes such problems by providing an iRNA-based (e.g., CYVaV - based) vector engineered to include therapeutic inserts using RNAi and CRISPR/Cas9.
  • iRNAs such as CYVaV are unique among infectious agents given they encodes a polymerase yet move like a viroid using host movement proteins, and thus are capable of transiting through plants other than citrus.
  • the iRNA-based vectors of the present disclosure may be developed for other woody plants (e.g., trees and legumes), and in particular olive trees and grapevines.
  • CYVaV is utilized in the development of a vector for delivery of small RNAs and proteins into citrus seedlings and N. benthamiana.
  • the procedure utilized for CYVaV vector development was similar to that utilized by the present inventors for engineering betacarmovirus TCV to produce small RNAs (see Aguado, L.C. et al. (2017), RNase III nucleases from diverse kingdoms serve as antiviral effectors, Nature 547: 114-117). Exemplary and advantageous sites for adding one, two, three, or more small RNA inserts designed to be excised by RNase Ill-type exonucleases were identified.
  • a small reporter RNA was expressed directly from the genome that targets phytoene desaturase, which turns the targeted tissue white.
  • vectors disclosed herein may include small RNAs with various functionality including: small RNAs that target an essential fungal mRNA; small RNAs that target an insect vector(s) for death or sterility; and small RNAs that target CVEV (as this virus together with CYVaV cause enhanced yellow-vein symptoms).
  • the disclosed vectors may include other small RNAs and/or therapeutic agents known in the art.
  • a phloem-restricted iRNA-based vector may be engineered to produce small RNAs that have anti-fungal and/or anti-insect and/or anti -viral properties, which provides for a superior treatment and management strategy compared to current methodologies.
  • CYVaV vectors may be applied manually to infected or uninfected trees by cutting into the phloem and depositing the vector either as RNA, or by agroinfiltration, or after encapsidation in the coat protein of CVEV, following citrus inoculation procedures well known to those of skill in the art, e.g. such as procedures developed and used routinely under the Citrus Clonal Protection Program (CCPP). Such procedures are routine for inoculation of CTV and other graft-transmissible pathogens of citrus. Since CYVaV does not encode a capsid protein, no virions are made and thus no natural tree-to-tree transmission of CYVaV is possible. When CYVaV is encapsidated in CVEV coat protein, no other component of CVEV is present.
  • CCPP Citrus Clonal Protection Program
  • CYVaV has only two ORFs: a 5’ proximal ORE that encodes replication-required protein p21; and a frame-shifting, ribosome recoding element that allows ribosomes to continue translation, extending p21 to produce p81, the RNA-dependent RNA polymerase.
  • the organization of these two ORFs is similar to the organization of similar ORFs in viruses in the Tombusviridae and Luteoviridae. However, all viruses in these families, and indeed in all known plant RNA viruses, encode movement proteins or are associated with a secondary virus that encodes a movement protein(s).
  • host phloem protein(s) 25 kDa phloem protein 2 (PP2) and/or 26 kDa Cucumis sativus phloem protein 2-like
  • PP2 phloem protein 2
  • PP2 phloem protein 2
  • Cucumis sativus phloem protein 2-like known to traffic host RNAs into sieve elements
  • RNAs of similar size and that encode a polymerase may be utilized in the develop of similarly structured iRNA-based vectors (see, e.g., Chin, L.S. et al. (1993).
  • the beet western yellows virus ST9 -associated RNA shares structural and nucleotide sequence homology with Tombusviruses. Virology 192(2):473-482; Passmore, B.K. et al. (1993). Beet western yellows virus-associated RNA: an independently replicating RNA that stimulates virus accumulation.
  • PNAS 90(31): 10168-10172 are independently replicating RNA that stimulates virus accumulation.
  • iRNA relatives e.g., iRNA rl, iRNA r2, and iRNA r3, identified in Opuntia, Fig trees, and Ethiopian com, respectively
  • iRNA rl e.g., iRNA rl, iRNA r2, and iRNA r3, identified in Opuntia, Fig trees, and Ethiopian com, respectively
  • iRNA r3 e.g., iRNA rl, iRNA r2, and iRNA r3, identified in Opuntia, Fig trees, and Ethiopian com, respectively
  • encode proteins p21 and p81 Fig. 4
  • CYVaV is present in the GenBank database (GenBank: JX101610)
  • iRNAs do not belong to any known classification of virus given they lack cistrons that encode movement proteins.
  • iRNAs dependent on a helper vims for systemic movement within a host.
  • iRNAs lack cistrons that encode coat proteins.
  • iRNAs are also dissimilar to viroids, although both are capable of systemic movement in the absence of encoded movement proteins.
  • Viroids are circular single stranded RNAs that have no coding capacity and replicate in the nucleus or chloroplast using a host DNA-dependent RNA polymerase.
  • RNA-dependent RNA polymerase RdRp
  • iRNAs may be categorized in two classes: a first class is characterized by a frameshift requirement to generate the RdRp and RNA structures proximal to the 3’ end that resemble those of umbraviruses. A second class is characterized by a readthrough requirement to generate the RdRp and 3’ RNA structures that resemble those of Tombusviruses. CYVaV is a member of the first class with properties similar to umbraviruses including a frameshifting recoding site and similar structures at the 3’ end, and similar sequences at the 5’ end. iRNA members of the second class have always been discovered in association with a helper virus.
  • iRNAs provide a number of benefits as compared to conventional viral vectors. For example, iRNAs are relatively small, making them easier to structurally and functionally map and genetically manipulate. In contrast, viruses such as CTV are 8-fold larger, making them more cumbersome to use as a vector. iRNAs can replicate and accumulate to unexpectedly high levels (e.g., visible by ethidium staining on gels and 4% of reads by RNAseq), which is critical for the vector’s ability to deliver a sufficient amount of therapeutic agent(s) into the target plant. In addition, iRNAs are much more stable than many viruses despite not encoding a coat protein or silencing suppressor (Fig. 13), which allows for a long lifespan in the host plant and thus provides benefit over an extended period.
  • Fig. 13 coat protein or silencing suppressor
  • iRNAs are also limited to the host’s phloem, which is especially useful for targeting pathogens that either reside in, or whose carriers feed from, or whose symptoms accumulate in, the phloem since the payload will be targeted to where it is most needed.
  • iRNAs are able to transit within a broader range of hosts, thereby increasing the applicability of a single vector platform.
  • iRNAs are also virtually benign to their hosts, unlike viruses like CTV whose isolates can be highly pathogenic.
  • a common virus as a vector such as CTV, runs the risk of superinfection exclusion, where trees previously infected and/or exposed to that virus are not able to be additionally infected by the same virus acting as the vector (e.g., most citrus trees in the USA are infected with CTV).
  • avoiding superinfection exclusion at a minimum, requires additional steps to the process that makes it more expensive and cumbersome.
  • the present disclosure also provides for novel therapeutic, prophylactic, or trait enhancing inserts that are engineered into the iRNA vector.
  • inserts are provided, including inserts that target a particular pathogen, an insect vector, or a manifestation of the disease(s).
  • inserts are provided that strengthen or improve plant health and/or enhance desired characteristics of the plant.
  • the disclosed infectious agents are capable of accumulation and systemic movement throughout the host plant, and can thus deliver therapies throughout a host over a substantial time period. Characteristics of the disclosed agents are therefore highly beneficial for treating numerous specific diseases.
  • Using an infectious agent composed of either RNA or DNA has an additional advantage of being able to code for therapeutic proteins or peptides that would be expressed within infected cells and/or by engineering the infectious agent to contain a specific sequence or cleavable portion of its genetic material to serve as an RNA-based therapeutic agent.
  • Products with antimicrobial properties against plant pathogens can take a number of formats and are produced through ribosomal (defensins and small bacteriocins) or non-ribosomal synthesis (peptaibols, cyclopeptides and pseudopeptides).
  • ribosomal defensins and small bacteriocins
  • non-ribosomal synthesis preptaibols, cyclopeptides and pseudopeptides.
  • the best known are over 900 cationic antimicrobial peptides (CAPs), such as lactoferrin or defensin, which are generally less than 50 amino acids and whose antimicrobial properties are well known in the art.
  • CAPs are non-specific agents that target cell walls generally, with reported effects against bacteria and fungi.
  • CTV engineered with an insert designed to express defensin has received approval for release by the USD A in Florida, but its widespread efficacy is unknown. Moreover, the isolate of CTV used for the vector makes it unsuitable for trees growing in some regions (e.g., California).
  • RNA therapies that target viral pathogens are also in widespread development in plants. These therapies use non-coding small interfering RNAs (siRNAs), which are generated from the genome of the plant, and thus include genetic modification of the host.
  • siRNAs non-coding small interfering RNAs
  • the length of time to generate genetically modified trees is measured in decades and may ultimately not have the same attributes (texture/color/taste) as varieties developed over decades, and thus is not a solution to current, time sensitive agricultural diseases, in addition to being very expensive to develop and potentially impacting the quality of the fruit.
  • an iRNA vector is provided that includes a non-coding RNA insert that can be translated into an anti-bacterial protein like an enzybiotic.
  • an iRNA vector that includes an RNA insert that interferes with the functionality of the insect vector at issue.
  • Insects have an RNA silencing system similar to plants; small RNAs ingested by insects are taken up into cells and target critical mRNAs for degradation or blockage of translation within the insect.
  • a targeted insert is provided that is capable of silencing a critical reproductive function of the insect vector, resulting in sterilization of the insect.
  • phloem-feeding insects that transmit phloem-limited pathogens, where a non-coding RNA insert into a phloem-limited vector is readily taken up by feeding insects.
  • an iRNA vector includes a non coding RNA insert that targets a plant response to a pathogen.
  • bacteria inserted by an insect vector does not directly damage the tree.
  • the host tree produces excessive callose in their phloem in order to isolate the bacteria, which can ultimately restrict the flow of photoassimilates and kill the tree.
  • the RNA insert silences and/or depresses such callose production.
  • CYVaV Structure Full length structure of CYVaV was determined by SHAPE structure probing and phylogenetic comparisons with the CYVaV relatives in Opuntia, Fig and Com (Fig. 9).
  • the recoding site see Fig. 10
  • the ISS-like (I-shaped structure) 3’CITE see Fig. 11
  • a region for accommodating an insert is, for example, shown by boxed double line region and discussed in further detail with regard to exemplary locations for inserts.
  • CYVaV The genome organization of CYVaV exhibits some similarities to other RNA molecules, particular PEMV2 (Fig. 3, Panel A). However, umbravirus PEMV2 also possesses ORFs encoding for proteins p26 and p27 involved in movement. Levels of CYVaV plus (+) strands in infiltrated N. benthamiana leaves and systemic leaves are shown in Fig. 3, Panel B. Levels of the RNA-dependent RNA polymerase (RdRp) synthesized by frameshifting in vitro in wheat germ extracts of full-length CYVaV and PEMV2 are also shown (Fig. 3, Panel C). Note the significant difference in levels of p94 from PEMV2 as compared to p81 polymerase produced by CYVaV. The frameshifting site of CYVaV is one of the strongest known in virology and believed to be responsible for its exceptionally high accumulation.
  • RdRp RNA-dependent RNA polymerase
  • CYVaV is encapsidated in virions of CVEV.
  • CYVaV or CVEV or CYVaV + CVEV were agroinfiltrated into leaves of N. benthamiana.
  • CYVaV was encapsidated in virions of CVEV, and virions were isolated one week later and the encapsidated RNAs subjected to PCR analysis (see Figs. 5 and 6).
  • Accumulation of CYVaV increased substantially in the presence of putative helper virus CVEV. rRNA loading controls are shown below.
  • pl4 silencing suppressor was co-infiltrated in all leaves. Yellowing symptoms were slightly more severe in leaves with CYVaV + CVEV (Fig. 7, Panel B).
  • CYVaV is phloem-limited. Fluorescence in situ hybridization (FISH) imaging clearly detected plus strands of CYVaV, which was completely restricted to the SE, CC and PPC (Fig. 8).
  • FISH Fluorescence in situ hybridization
  • CYVaV does not encode a silencing suppressor.
  • N. benthamiana 16C plants were agroinfiltrated with a construct expressing GFP (which is silenced in these plants) and either constructs expressing CYVaV p21 or p81, or constructs expressing known silencing suppressors pl9 (from TBSV) or p38 (from TCV) (Fig. 13, Panel A). Only p!9 and p38 suppress the silencing of GFP, allowing the green fluorescence to be expressed (Fig. 13, Panel B). Northern blot probed with GFP oligonucleotide showed that GFP RNA is still silenced in the presence of p21 or p81 (Fig. 13, Panel C).
  • Symptoms of N. benthamiana systemically infected with CYVaV Leaves 4 and 5 were agroinfiltrated with CYVaV. The first sign of a systemically infected plant is a “cupped” leaf (Fig. 16), which was nearly always leaf 9. In the following few weeks, leaf galls emerged at the apical meristem and each node of the plant. Systemically infected plants also had root galls containing a substantial amount of CYVaV as evidenced by Northern plant blot.
  • CYVaV demonstrates an exceptional host range. Sap from a systemically- infected N. benthamiana plant was injected into the petiole of tomato (Fig. 17). One of four plants showed very strong symptoms and was positive for CYVaV by PCR. Plant shown is at 53 days post-infection with a plant of the same age.
  • CYVaV binds to a highly abundant protein extracted from the phloem of cucumber. Labelled full-length CYVaV binds to a prominent protein as demonstrated in the Northwestern blot (Fig. 18). Proteins were renatured after SDS gel electrophoresis. This protein is believed to be a known, highly conserved RNA binding protein containing an RRM motif known to chaperone RNAs from companion cells into sieve elements in the phloem of cucumber. No binding was seen when the proteins remained denatured after electrophoresis.
  • CYVaV can express an extra protein from its 3’UTR using a TEV IRES.
  • RNA transcripts of the constructs shown in (A) were transformed into protoplasts. 18 hours later, total protein was extracted and nanoluciferase activity measured in a luminometer.
  • Exemplary locations for stable hairpin inserts at positions 2250, 2301 and 2319 were evaluated. The location for each of the inserts falls within an exemplary region noted above (see Fig. 9). Wheat germ extract in-vitro translation assay of T7 transcripts from CYVaV-wt, and CYVaV VIGS vectors containing different amounts of sequence at position 2250 was conducted (Fig. 20). For example, construct sfPDS60 demonstrated excellent systemic movement in plants. Wheat germ extract in-vitro translation assay of T7 transcripts from CYVaV-wt, and CYVaV VIGS vectors containing different amounts of sequence at positions 2301 and 2319 was conducted (Fig. 21). Northern blot analysis of total RNA isolated from A.
  • thaliana protoplasts infected by CYVaV wt and CYVaV VIGS vectors CYVaV-GDD and negative control was conducted (Fig. 20, Panel D).
  • CYVaV-GDD and negative control was conducted (Fig. 21, Panel D). Constructs CY2250sfPDS60, CY2301PDS60, CY2301sfPDS60, CY2319sfPDS60 (including inserts at positions 2250, 2301, 2319, respectively) all demonstrated excellent systemic movement with insertion.
  • constructs CY2331PDS60 (including inserts at position 2331) also demonstrated the ability to move systemically throughout the host.
  • an iRNA-based vector for treating disease in the citrus industry caused by CLas bacteria (HLB).
  • An isolate of CYVaV is utilized as a vector to target both the bacteria and the psyllid insects that deliver the bacteria into the trees.
  • CYVaV is limited to the phloem where it replicates and accumulates to extremely high levels comparable to the best plant viruses.
  • its relatively small size makes it exceptionally easy to genetically engineer.
  • the structure of the 3’UTR of CYVaV was determined based on SHAPE RNA structure mapping (Fig. 9).
  • a number of replication and translation elements were identified based on biochemical assays, as well as phylogenetic conservation (with umbraviruses) of their sequence and/or structure and position (Fig. 19, Panel A).
  • An I-shaped element was also identified that serves as a cap-independent translation enhancer (3’CITE).
  • a series of long-distance kissing-loop interactions double arrows were also identified, which are believed to be involved in stabilizing the RNA and accumulation in the absence of a silencing suppressor. Based on this structure, a number of areas were identified as suitable locations for sequence insertion, which should not disturb the surrounding structure.
  • insert locations were identified wherein replication or translation properties of the vector were not significantly reduced or eliminated. Insert locations adversely affecting such properties (likely due to disrupting the RNA structure or other important aspect of the CYVaV vector) were not pursued further.
  • Four exemplary insert locations on the CYVaV-based vector were identified at positions 2250, 2301, 2319 and 2331. 50 nt hairpin inserts were successfully deployed in these locations with no disruption to translation in vitro or replication in protoplasts and CYVaV was able to move systemically in N. benthamiana.
  • CYVaV has no additional ORFs
  • genomic (g)RNA and a subgenomic (sg)RNA of about 500 nt are detectable using probes to plus- and minus-strands.
  • Investigation of the region that should contain an sgRNA promoter revealed an element with significant similarity to the highly conserved sgRNA promoter of umbraviruses and to a minimal but highly functional sgRNA promoter of carmovirus TCV.
  • similar RNAs that also only express the RdRp and are related to Tombus viruses all generate a similar sized subgenomic RNA, and may simplify expression of peptides and proteins.
  • heterologous sequences of different lengths were inserted therein to evaluate CYVaV functionality with an extended 3’ UTR.
  • Such investigation aids in determining maximal insert length to ensure that such insert will be tolerated by the CYVaV-based vector while still accumulating to robust levels and engaging in systemic movement. It is believed that the CYVaV-based vector may be able to accommodate an insert having a size of up to 2 kb.
  • the nearest related viruses are 1 to 2 kb larger, with all of the additional sequence length expanding their 3’ UTRs (Quito- Avila, D.F. et al. (2015). Detection and partial genome sequence of a new umbra-like virus of papaya discovered in Ecuador. Eur J Plant Pathol 143: 199-204).
  • Various size sequence fragments were evaluated, beginning at 50 nt (the size of an inserted hairpin for small RNA production), up to about 600 nt (the size of an enzybiotic ORF).
  • Initial small RNA fragments include a reporter for knock down of phytoene desaturase, which turns tissue white.
  • the longer size fragments include nano luciferase and GFP ORFs, which may also be used as reporters for examining expression level.
  • Inserts are made in constructs containing the wild-type (WT) sgRNA promoter and the enhanced sgRNA promoter.
  • a scaffold comprising a docked tetraloop as a crystallography scaffold is provided (Fig. 24, Panel B).
  • the sequence shown in Fig. 24, Panel B, is presented below: cauuagcuaaggaugaaagucuaugcuaaug (SEQ ID NO: 32)
  • FIG. 24 A lock and dock structure in accordance with disclosed embodiments is shown in Fig. 24, Panel C. Inserts (hairpins or non-hairpin sequences) may be added to the restriction site at the identified additional insert location. Circled bases are docking sequences for the tetraloop. The sequence shown in Fig. 24, Panel C, is presented below: gcaccuaaggcgucagggucuagacccugcucaggggaaacuuugucgcuauggugc (SEQ ID NO: 33)
  • CYVaV-wt 3’stb is the parental stabilized construct containing 6 nt changes converting G:U pairs to G:C pairs.
  • Two insertions of 60 nucleotides were added to the stabilized parental construct at positions 2319 and 2330 forming CY2319PDS60_3’stb and CY2330PDS60_3’stb.
  • Nucleotide changes made to stabilize the structure and generate CYVaV-wt 3’stb are circled in Panel B.
  • ggcuaguuaaucucauucgugggauggacaggcagccugacguugac SEQ ID NO: 34
  • guuaauguaggugucuuuccguaucuaguc SEQ ID NO: 35
  • An anti-biotic insert for delivery by the disclosed vector comprises either an enzybiotic or small peptide engineered to destroy the CLas bacterium.
  • Enzybiotics prefer sugar rich, room temperature environments such as found in the plant phloem.
  • the enzybiotic is translated in companion cells during the engineered CYVaV infection cycle. Proteins produced in the cytoplasm of the phloem are naturally able to exit into the sieve element (the default pathway for translated proteins), where CLas and other plant pathogenic bacteria take up residence.
  • the enzyme molecules move with the photo-assimilate up and down the trunk and lyse any bacteria upon contact.
  • enzybiotics are targeted towards a specific class of bacteria, they preferably do not disturb the microbiome of the host tree.
  • Various agents that target CLas have been developed (e.g., Hailing Jin, University of California, Riverside, CA).
  • numerous inserts that target CLas bacterium are known in the art and may be utilized with the CYVaV vectors of the present disclosure.
  • the disclosed vectors include the enzybiotic and/or peptides described above, as well as inserts that trigger the production of siRNAs that interfere with either gene expression of the tree or the disease-carrying psyllid.
  • the RNA could kill the vector or render it wingless and thus harmless.
  • a vector comprising an RNA insert is provided that triggers the reduction of callose production and build-up in a host tree.
  • a sufficiently large amount of the gene that produces callose in the phloem in response to bacteria is silenced via insertion of an siRNA sequence that is excised by the plant.
  • CYVaV-based vector may be utilized as a virus-induced gene-silencing (VIGS) vector to down-regulate expression of callose synthase in the phloem.
  • VIGS virus-induced gene-silencing
  • VIGS has been widely used to down-regulate gene expression in mature plants to examine plant functional genomics (Senthil-Kumar el al. (2008). Virus-induced gene silencing and its application in characterizing genes involved in water-deficit-stress tolerance. J Plant Physiol 165(13): 1404-1421).
  • a complementary sequence is inserted into CYVaV at a suitable location as identified above (either anti-sense or a RNase Ill-cleavable hairpin).
  • Callose is a b 1,3-glucan that is synthesized in various tissues during development and biotic and abiotic stress (Chen, X.Y. and Kim, J.Y. (2009). Callose synthesis in higher plants. Plant Sig Behav 4(6):489-492). Deposition of callose in the sieve plates of sieve elements inhibits photoassimilate flow in the phloem, leading to over accumulation of callose in chloroplasts, which contributes to the death of trees during bacterial infections such as HLB (Koh, H. et al. (2012).
  • CalS7 encodes a callose synthase responsible for callose deposition in the phloem. Plant J 65(1): 1- 14). Complete inhibition of GSL7 impacted both normal phloem transport and inflorescence development in Arabidopsis (Barratt et al. (2011). Callose Synthase GSL7 Is Necessary for Normal Phloem Transport and Inflorescence Growth in Arabidopsis. Plant Physiol 155(1):328- 341).
  • a CYVaV-based vector is utilized to down-regulate the N. benthamiana and orange tree orthologues of CalS7 in mature plants in order to investigate the consequences of reduced (but not eliminated) sieve plate callose deposition.
  • the vector provides for an insert that expresses a callose-degrading enzyme.
  • an insert that targets one or more virus and/or fungal pathogen.
  • a hairpin insert is provided that generates an siRNA that directly targets CVEV, since CVEV is known to slightly intensify the yellowing impacts of CYVaV and to enable transport of CYVaV between trees.
  • a hairpin insert is provided that targets CTV, since CTV is a highly destructive viral pathogen of citrus (second only to CLas).
  • an insert is provided that targets another citrus (or other) virus.
  • an insert is provided that targets a fungal pathogen(s), given such pathogen(s) is able to take up siRNAs from the phloem.
  • the CYVaV-based (or other iRNA) vector includes an insert(s) engineered to modify a phenotypic property of a plant that emanates from gene expression in companion cells.
  • an insert is provided that triggers dwarfism, so that the fruit is easier to harvest and growth space requirements are reduced. Additional and/or other traits may also be targeted as desired.
  • the iRNA vectors of the present disclosure comprising 1, 2, 3 or more inserts demonstrate stability and functionality.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Chemical & Material Sciences (AREA)
  • Wood Science & Technology (AREA)
  • Organic Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Virology (AREA)
  • Environmental Sciences (AREA)
  • Nutrition Science (AREA)
  • Dentistry (AREA)
  • Pest Control & Pesticides (AREA)
  • Agronomy & Crop Science (AREA)
  • Natural Medicines & Medicinal Plants (AREA)
  • Developmental Biology & Embryology (AREA)
  • Botany (AREA)
  • Physiology (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Agricultural Chemicals And Associated Chemicals (AREA)

Abstract

The present disclosure relates to a single stranded RNA vector suitable for introducing a therapeutic agent, such as a peptide, a protein or a small RNA, into a host plant. The vector does not encode for any movement protein or coat protein, but is capable of capable of systemic and phloem-limited movement and replication within the host plant.

Description

Plant Vectors, Compositions And Uses Relating Thereto
Cross-Reference to Related Applications:
[0001] This application is based on U.S Provisional Patent Application Serial No.
62/760,098, entitled“Vectors Useful for Treating Plant Diseases and Method of Using the Same,” filed November 13, 2018, which application is incorporated herein by reference in its entirety and to which priority is claimed.
Reference to Sequence Listing:
[0002] This application includes one or more Sequence Listings pursuant to 37 C.F.R. 1.821 et seq., which are disclosed in computer-readable media (file name: 2105_0071PCT_ST25, created on November 12, 2019, and having a size of 37,755 bytes), which file is herein incorporated by reference in its entirety.
Statement Regarding Federally Sponsored Research or Development:
[0003] This invention was made with government support under Grant No. AP17PPQS and T00C118 awarded by the United States Department of Agriculture (USDA), and under Grant No. 1411836 awarded by the National Science Foundation (NSF). The United States government has certain rights in this invention.
Field of the Invention:
[0004] The present disclosure relates to a single stranded RNA vector suitable for introducing a therapeutic agent, such as a peptide, a protein or a small RNA, into a host plant, wherein movement thereof is substantially limited to the phloem and targeted to control or manage a plant disease or condition.
Background of the Invention:
[0005] Both general and highly targeted anti-microbial agents have been developed for animals ( e.g . , humans) whose circulatory systems provide a delivery system for widespread application throughout the animal. In contrast, much less research has been conducted to develop general or targeted therapeutic agents for non-genetically modified plants since lack of a simplified circulatory system complicates delivery throughout the host plant. This is especially problematic in large, long-lived trees (e.g., citrus), where injection of anti-microbial agents may be rapidly diluted. As a result, few solutions exist for treating systemic plant infections or conditions beyond external application of pesticides, e.g., to control the target insert or other vector during the growing season, foliar applications to strengthen a plant’s health in general, or expensive, short-duration injection of agents targeting the pathogen or vector.
[0006] Particularly concerning are diseases and conditions affecting the citrus industry. Huanglongbing (HLB), also known as Citrus Greening, is one of the most serious citrus diseases globally. HLB is associated with three species of the bacterium Candidatus Liberibacter spp. (asiaticus, africanus, and americanus) and is transmitted by two psyllid species, Asian citrus psyllid (ACP) (Diaphorina citri, Kuwayama) and African citrus psyllid (Trioza erytreae, Del Guercio). HLB is graft-transmissible and spreads naturally when a bacteria-containing psyllid feeds on a citrus tree and deposits the pathogenic bacteria into the phloem where the bacteria reproduce. Once a tree is infected, there is no cure. While the diseased fruit pose no health threat to humans, HLB has devastated millions of acres of citrus crops throughout the world. In the United States alone, ACP and CL asiaticus (CLas) have decimated the Florida citrus industry, causing billions of dollars of crop losses within a very short time span. Moreover, HLB has spread into every citrus producing region in the United States. Most infected trees die within a few years from infection, and fruit develops misshapen and off flavored and thus is unsuitable for consumption. According to the United States Department of Agriculture (USD A), the entire citrus industry is at substantial risk.
[0007] Consideration of plant physiology aids in the development and implementation of strategies for managing plant diseases and conditions. The vascular system of plants is the key conduit for sugars and amino acids, as well as signaling molecules such as small ribonucleic acids (RNAs), proteins, peptides and hormones, which are required for a large number of developmental processes and responses to biotic and abiotic stress (Fig. 1) (Lee, J.Y. and Frank, M. (2018), Plasmodesmata in phloem: different gateways for different cargoes, Curr Opin Plant Biol 43: 119-124; Tugeon, R. and Wolf, S. (2009), Phloem Transport: Cellular Pathways and Molecular Trafficking, Ann Rev Plant Biol 60:207-221). Messenger RNAs (mRNAs) comprise a portion of these signaling molecules, and thousands of companion cell mRNAs can be isolated from neighboring enucleated sieve elements, where they are transported bidirectionally by osmotically generated hydrostatic pressure from source (sugar generating) tissue to sink (sugar utilizing) tissue such as roots and shoot tips (Folimonova, S. Y. and Tilsner, J. (2018), Hitchhikers, highway tools and roadworks: the interactions of plant viruses with the phloem, Curr Opin Plant Biol 43:82-88; Ham, B.K. and Lucas, W.J. (2017), Phloem-Mobile RNAs as Systemic Signaling Agents , Annual Rev Plant Biol 68: 173-195). As much as 50% of the companion cell transcriptome is believed to be engaged in movement (Kim, G. etal. (2014), Genomic-scale exchange of mRNA between a parasitic plant and its hosts, Science 345:808- 811; Thieme, C.J. et al. (2015), Endogenous Arabidopsis messenger RNAs transported to distant tissues, Nature Plants 1(4): 15025; Yang, Y. et al. (2015), Messenger RNA exchange between scions and rootstocks in grafted grapevines, BMC Plant Biol 15, 251), which raises various questions with regard to how and why such a substantial subset of mRNAs are moving long-distances. For example, how selective is the process of RNA movement? If there is selection, how is it facilitated? Are transiting RNAs modified ( e.g ., methylated)? Are transiting RNAs found in any particular subcellular location before exiting into the SE? Are there“zip codes” for transiting RNAs? Are transiting RNAs bound by specific proteins and are there specific interacting sequences? How much of the flow of mRNAs is biologically meaningful and how much is non-selective, since sink cells are presumably capable of transcribing the same mRNAs?
[0008] Confusion in the mRNA movement literature is pervasive. Some studies have indicated that the major determinant of RNA mobility is their abundance in companion cells (Kim, G. et al. (2014), Genomic-scale exchange of mRNA between a parasitic plant and its hosts, Science 345:808-811; Thieme, C.J. et al. (2015), Endogenous Arabidopsis messenger RNAs transported to distant tissues, Nature Plants 1(4): 15025; Yang, Y. et al. (2015), Messenger RNA exchange between scions and rootstocks in grafted grapevines, BMC Plant Biol 15, 251). Mathematical modeling has been used to propose a non-selective, Brownian diffusion model for mRNA movement based mainly on their abundance, with half-life and transcript length also playing roles (Calderwood, A. et al. (2016), Transcript Abundance Explains mRNA Mobility Data in Arabidopsis thaliana, Plant Cell 28:610-615). However, other studies reached opposing conclusions, finding that mRNA abundance in companion cells does not correlate with movement (Xia, C. et al. (2018), Elucidation of the Mechanisms of Long-Distance mRNA Movement in a Nicotiana benthamiana/Tomato Heterograft System, Plant Physiol 177:745- 758). In addition, while it is generally assumed that the phloem does not contain RNases that target the transiting RNAs (Morris, R.J. (2018), On the selectivity, specificity and signaling potential of the long-distance movement of messenger RNA, Curr Opin Plant Biol 43: 1-7), Xia et al. also found that most mobile mRNAs are degraded and never reach the root or upper stem. Other studies found that the presence of a predicted tRNA-like structure is associated with over 11% of mobile mRNAs (Zhang, W.N. etal. (2016), tRNA-Related Sequences Trigger Systemic mRNA Transport in Plants, Plant Cell 28: 1237-1249), suggesting that mobile mRNAs might harbor specific“zip-codes”. However, other abundant mRNAs containing similar tRNA-like motifs were not mobile (Xia, C. etal. (2018), Elucidation of the Mechanisms of Long-Distance mRNA Movement in a Nicotiana benthamiana/Tomato Heterograft System, Plant Physiol 177:745-758). Thus, prior studies have failed to identify and develop a model system consisting of a highly abundant, mobile RNA whose movement is traceable in living tissue under different cellular conditions.
[0009] Plant viruses, many of which move through the plant as a ribonucleoprotein complex (vRNP), have evolved to use the same pathway as used by endogenous RNA movement. Plant viruses can accumulate in substantial amounts, and most initiate infection in epidermal or mesophyll cells and then move cell-to-cell through highly selective intercellular connectors called plasmodesmata, which allow for continuity between the cytoplasm of neighboring cells (Fig. 1; see also Lee, J.Y. and Frank, M. (2018), Plasmodesmata in phloem: different gateways for different cargoes, Curr Opin Plant Biol 43: 119-124; Schoelz, J.E. etal. (2011), Intracellular transport of plant viruses: finding the door out of the cell, Mol Plant 4: 813-831). Long-distance systemic movement (leaf-to-leal) requires that the virus enters companion cells, where replication takes place, followed by progeny exit into sieve elements by transiting through the specialized, branched plasmodesmata that connect companion cells and sieve elements. Once tubular sieve elements are reached, viruses move passively with the phloem photoassimilate stream and establish systemic infections upon exiting (Folimonova, S.Y. and Tilsner, J. (2018), Hitchhikers, highway tolls and roadworks: the interactions of plant viruses with the phloem, Curr Opin Plant Biol 43:82-88).
[0010] For viruses that transit through the phloem as vRNPs, movement is similar to that of host mRNAs. All plant viruses encode at least one movement protein necessary for movement, which bind to viral RNA and also dilate plasmodesmata. Thus, host mRNA movement also likely requires similar host-encoded movement proteins. Movement proteins are non-specific RNA binding proteins. However, questions remain with regard to how vRNPs load into the phloem and unload in distal tissues, although reprograming companion cell gene expression may be required (Collum, T.D. et al. (2016), Tobacco mosaic virus-directed reprogramming of auxin/indole acetic acid protein transcriptional responses enhances virus phloem loading, Proc Natl Acad Sci USA 113:E2740-E2749). If mRNA trafficking is so widespread and non specific, it has remained unclear why RNA viruses require their own encoded movement proteins. Some researchers have suggested that RNA viruses require movement proteins if moving as preformed replication complexes that include a large RNA-dependent RNA polymerase (Heinlein, M. (2015), Plant virus replication and movement, Virology 479:657- 671), which is beyond the size-exclusion limit (~70 kDa) of companion cell plasmodesmata. It has also remained unclear why and how some viruses are phloem-limited. For example, phloem-limited Closteroviruses have at least 5 movement proteins, and phloem-limitation can be relieved by over-expressing the silencing suppressor and downregulating host defenses (Folimonova, S.Y. and Tilsner, J. (2018), Hitchhikers, highway tolls and roadworks: the interactions of plant viruses with the phloem, Curr Opin Plant Biol 43:82-88), suggesting that phloem-limitation is a complex process for some viruses. Phloem-limitation can also be an active process (as opposed to lack of a cell-to-cell movement protein). For example, altering a domain of the Potato leaf role virus movement protein conferred the ability to exit the phloem (Bendix, C., and Lewis, J.D. (2018), The enemy within: phloem-limited pathogens, Mo Plant Path 19:238-254).
[0011] A direct connection between host movement of mRNAs and vRNP movement was established when the origin of plant virus movement proteins was solved. A pumpkin protein (RPB50) related to the Cucumber mosaic virus movement protein was discovered that was capable of transporting its own mRNA, as well as other mRNAs, into the phloem (Xoconostle- Cazares, B. el at. ( 1999), Plant paralog to viral movement protein that potentiates transport of mRNA into the phloem, Science (New York, NY) 283:94-98; Ham, B.K. et al. (2009), A polypyrimidine tract binding protein, pumpkin RBP50, forms the basis of a phloem-mobile ribonucleoprotein complex, Plant Cell 21 : 197-215). A complex population of these endogenous movement proteins, known as non-cell-autonomous proteins (NCAPs), have been proposed as being responsible for the long-distance phloem trafficking of mRNAs (Gaupels, F. et al. (2008), Nitric oxide generation in Vicia faba phloem cells reveals them to be sensitive detectors as well as possible systemic transducers of stress signals, New Phytol 178:634-646; Gomez, G. et al. (2005), Identification of translocatable RNA-binding phloem proteins from melon, potential components of the long-distance RNA transport system, Plant J 41 : 107-116; Kim, M. et al. (2001), Developmental changes due to long-distance movement of a homeobox fusion transcript in tomato, Science (New York, NY) 293:287-289; Pallas, V. and Gomez, G. (2013), Phloem RNA-binding proteins as potential components of the long-distance RNA transport system, Front Plant Sci 4: 130; Yoo, B.C. et al. (2004), A systemic small RNA signaling system in plants, Plant Cell 16: 1979-2000).
[0012] Since their discovery (Deom, C.M. et al. (1987), The 30-kilodalton gene product of tobacco mosaic virus potentiates virus movement, Science (New York, NY) 237:389-394), a number of viral movement proteins have been identified that are responsible for intracellular trafficking of vRNPs to the plasmodesmata, as well as for cell-to-cell and long-distance movement (Tilsner, J. (2014), Techniques for RNA in vivo imaging in plants, J Microscopy 258(1): 1-5). For some viruses (e.g., umbraviruses), cell-to-cell and long-distance movement are associated with multiple movement proteins (Ryabov, E.V. et al. (2001), Umbravirus- encoded proteins both stabilize heterologous viral RNA and mediate its systemic movement in some plant species,, Virology 288:391-400). For example, closteroviruses such as Citrus tristeza vims contain three movement proteins. However, for most viruses, all movement activities are thought to be associated with a single movement protein.
[0013] Delivering engineered therapeutic agents into plants for combating diseases, insects or other adverse conditions (e.g., such as HLB and/or the carrier insects) using virus vectors is an established means of introducing traits such as resistance to pathogens or other desired properties into plants for research purposes. Various methods of providing vectors to plants are known in the art. This is often achieved by delivery of the virus vector into a plant cell’s nucleus by Agrobacteria tumefactions -mediated“agroinfiltration,” which may result in a modification of that cell’s genome, or by delivering the virus vector directly into a cell’s cytoplasm, which results in infection without a requirement for genomic modification. In the case of agroinfiltration, the cDNA of the viral genome is introduced into T-DNA, which is then provided to the plants. Such T-DNA comprises further regulatory DNA components, which allow transcription of the genome. A DNA insert is attached to a virus cDNA vector that is able to infect the targeted plant. If the virus is an RNA virus, the virus and insert are transcribed into RNA within the plant cells, after which the virus behaves as a normal RNA virus (amplification and movement). Thus, to act as an effective vector, a virus should be engineered to accept inserts without disabling its functionality and to ensure that the engineered virus is able to accumulate systemically in the host to a level sufficient to deliver and in some cases express the insert(s). These inserts, whether open reading frames (ORFs) that will be translated into proteins or RNAs that will be used for a beneficial function, should be delivered into the targeted tissue in a manner that is effective and sufficiently non-toxic to the host or to any downstream consumption of the host or the environment. However, only a limited number of viral vectors exist that meet the above criteria and are available for only certain plants (e.g., Tobacco rattle virus for tobacco). Unfortunately, there is either no known suitable viral vector, or only suboptimal viral vectors, for most plants, particularly for long lived trees and vines.
[0014] Thus, the ability to implement RNA or DNA therapies on a broad basis is substantially limited with existing technologies. Over 1,000 plant viruses have been identified with many plants subject to infection by multiple viruses. For example, citrus trees are subject to Citrus leaf blotch virus, Citrus leaf rugose virus, Citrus leprosis virus C, Citrus psorosis virus, Citrus sudden death-associated virus, Citrus tristeza virus (CTV), Citrus variegation virus, Citrus vein enation virus and Citrus yellow mosaic virus, among others. However, CTV, the causal agent of catastrophic citrus diseases such as quick decline and stem pitting, is currently the only virus that has been developed as a vector for delivering agents into citrus phloem.
[0015] CTV is a member of the genus Clostero virus. It has a flexuous rod-shaped virion composed of two capsid proteins with dimensions of 2000 nm long and 12 nm in diameter. With a genome of over 19 kb, CTV (and other Clostero viruses) are the largest known RNA viruses that infect plants. It is a virulent pathogen that is responsible for killing or rendering useless millions of citrus trees worldwide, although the engineered vector form is derived from a less virulent strain, at least for Florida citrus trees (still highly virulent in California trees). Prior studies have purportedly demonstrated CTV-based vectors to express engineered inserts in plant cells (US 8389804; US 20100017911 Al). However, it has not been commercialized due to its inconsistent ability to accumulate in plants and achieve its targeted beneficial outcome. It is thought that CTV’s inability to replicate to sufficiently high levels and heat sensitivity limits its ability to generate a sufficient quantity of RNA for treatment.
[0016] Thus, CTV-based vectors have a very limited ability to deliver an effective beneficial payload where needed. Moreover, CTV is difficult to work with due to its large size. CTV is also subject to superinfection exclusion, wherein a CTV-based vector is unable to infect a tree already infected with CTV. CTV is also highly transmissible from plant to plant via several aphid species, a property disliked by regulators concerned with uncontrolled escape into the environment where it might mutate or interact with other hosts in undesirable ways. In addition, strains suitable for one region (e.g., Florida) are unsuitable for varieties of trees in another region (e.g., California). Despite such problems, CTV is the only viral vector platform available for citrus trees. [0017] Accordingly, there is a need for an infectious agent that solves some or all of the above- noted problems, and which is capable of introducing a desirable property and/or delivering a therapeutic agent(s) into a plant, particularly a long-lived plant such as a tree or vine.
Summary:
[0018] The present disclosure relates to a novel infectious agent(s) capable of delivering an exogenous insert(s) into a plant, compositions comprising a plant infected by the disclosed agent(s), and methods and uses relating thereto. The disclosed agents are sometimes referred to herein as“independently mobile RNAs” or“iRNAs.” Despite being infectious single- stranded RNAs, iRNAs are not viruses given they do not code for any movement protein(s) or RNA silencing suppressors, which are key characteristics of all known plant viruses. In addition, unlike virtually all plant RNA viruses, with the exception of umbraviruses, iRNAs also do not encode a coat protein for encapsidating the RNA into virions, which is a requirement for vectored movement of viruses from plant to plant. Despite the lack of movement protein expression, iRNAs are able to move systemically within the phloem in a host plant. As compared to viruses, iRNAs have additional advantageous properties, such as: the ability to accumulate to levels exceeding those of most known plant viruses; relatively small size, e.g., being only about two-thirds the size of the smallest plant RNA virus and thus much easier to work with compared to such conventional plant RNA viruses; and the inability to spread on their own to other plants (given their inability to encode for any coat protein).
[0019] In accordance with disclosed embodiments, an infectious agent comprises an iRNA- based vector containing an engineered insert, which triggers in a plant expression of a targeted peptide, protein(s) and/or produces targeted small RNAs that are cleaved from the vector for beneficial application. Aspects of the present disclosure include: an iRNA-based vector for delivery of targeted anti-pathogenic agents; an anti-bacterial enzybiotic targeted at bacteria infecting a plant or bacteria required by the insect vector; an enzybiotic that is generated from the TEV IRES; incorporation of siRNAs into the iRNA genome; incorporation of inserts into a lock and dock structure to stabilize the base of a scaffold that supports the inserts; incorporation of siRNAs from a iRNA genome that has been modified to enhance the stability of the local region to precisely counter the destabilizing effects of the inserts; incorporation of an siRNA that disrupts or kills a targeted insect vector; incorporation of an siRNA that mitigates the negative impacts of a tree’s callose production; incorporation of an siRNA that mitigates the plant’s recognition of the pathogen; and incorporation of an insert that triggers a particular plant trait (e.g., dwarfism). Thus, the infectious agents and compositions disclosed herein possess superior and advantageous properties as compared to conventional technologies.
[0020] The iRNA-based vectors of the present disclosure are suitable for use as a general platform for expression of various proteins and/or delivery of small RNAs into the phloem of citrus and other host plants. In some implementations, a CYVaV-based vector is provided, which accumulates to massive levels in companion cell and phloem parenchyma cell. The vectors of the present disclosure may be utilized to examine the effects of silencing specific gene expression in the phloem of trees. In addition, CYV aV may be developed into a model system for examining long-distance movement of mRNAs through sieve elements. Since CYVaV is capable of infecting virtually all varieties of citrus, with few if any symptoms generated in the infected plants, movement of RNAs within woody plants may be readily examined.
[0021] In accordance with disclosed embodiments, the present disclosure is directed to a plus- sense single stranded ribonucleic acid (RNA) vector comprising a replication element(s) and a heterologous segment(s), wherein the RNA vector lacks a functional coat protein(s) open reading frame (ORF) and a functional movement protein(s) ORF. In some implementations, the RNA vector comprises a 3’ Cap Independent Translation Enhancer (3’ CITE) comprising the nucleic acid sequence(s) of SEQ ID NO: 4 and/or SEQ ID NO: 5. In some embodiments, the 3’ CITE comprises the nucleic acid sequence of SEQ ID NO: 3.
[0022] In some embodiments, the replication element(s) of the RNA vector comprises one or more conserved polynucleotide sequence(s) having the nucleic acid sequence of: SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, and/or SEQ ID NO: 14. In some implementations, the replication element(s) additionally or alternatively comprises one of more conserved polynucleotide sequence(s) having the nucleic acid sequence of: SEQ ID NO: 15 and/or SEQ ID NO: 16.
[0023] In some embodiments, the RNA vector is derived from citrus yellow vein virus (SEQ ID NO: 1) or an iRNA relative thereof. The RNA vectors of the present disclosure are capable of systemic and phloem-limited movement and replication within a host plant. The RNA vectors of the present disclosure are functionally stable for replication, movement and/or translation within the host plant for at least one month after infection thereof.
[0024] In some embodiments, the heterologous segment(s) of the RNA vector of the present disclosure comprises a polynucleotide that encodes at least one polypeptide selected from the group consisting of a reporter molecule, a peptide, and a protein. In some implementations, the polypeptide is an insecticide, an antibacterial, an antiviral, or an antifungal. In some implementations, the antibacterial is an enzybiotic. In some implementations, the antibacterial targets a bacterium Candidatus Liberibacter species, e.g. Candidate Liberibacter asiaticus (CLas).
[0025] In some embodiments, the heterologous segment(s) of the RNA vector of the present disclosure comprises a small non-coding RNA molecule and/or an RNA interfering molecule. In some implementations, the small non-coding RNA molecule and/or the RNA interfering molecule targets an insect vector, a virus, or a fungus. In some implementations, the small non-coding RNA molecule and/or the RNA interfering molecule targets a nucleic acid of the insect vector, the virus, or said fungus. In some implementations, targeted virus is selected from the group consisting of Citrus vein enation virus (CVEV) and Citrus tristeza virus (CTV).
[0026] It should be understood that the RNA vector may include multiple heterologous segments, each providing for the same or different functionality. In some embodiments, the heterologous segment(s) is a first heterologous segment, wherein the RNA vector further comprising a second heterologous segment(s), wherein the replication element(s) is intermediate the first and second heterologous segments.
[0027] In some embodiments, the heterologous segment(s) of the RNA vector of the present disclosure comprises a polynucleotide that encodes for a protein or peptide that alters a phenotypic trait. In some implementations, the phenotypic trait is selected from the group consisting of pesticide tolerance, herbicide tolerance, insect resistance, reduced callose production, increased growth rate, and dwarfism.
[0028] The present disclosure is also directed to a host plant comprising the RNA vector of the present disclosure. The host plant may be a whole plant, a plant organ, a plant tissue, or a plant cell. In some implementations, the host plant is in a genus selected from the group consisting of citrus, vitis, ficus and olea. In some implementations, the host plant is a citrus tree or a citrus tree graft.
[0029] The present disclosure also relates to a composition comprising a plant, a plant organ, a plant tissue, or a plant cell infected with the RNA vector of the present disclosure. In some implementations, the plant is in a genus selected from the group consisting of citrus, vitis, ficus and olea. In some implementations, the plant is a citrus tree or a citrus tree graft.
[0030] The present disclosure also relates to a method for introducing a heterologous segment(s) into a host plant comprising introducing into the host plant the RNA vector of the present disclosure. In some embodiments, the step of introducing the heterologous segment(s) into the host plant comprises grafting a plant organ or plant tissue of a plant that comprises the RNA vector of the present disclosure to a plant organ or plant tissue of another plant that does not comprise the RNA vector prior to said introduction. The RNA vectors of the present disclosure are capable of systemically infecting the host plant.
[0031] The present disclosure is also directed to a process of producing in a plant, a plant organ, a plant tissue, or a plant cell a heterologous segment(s), comprising introducing into said plant, said plant tissue or said plant cell the RNA vector of the present disclosure. In some embodiments, the plant is in a genus selected from the group consisting of citrus, vitis, ficus and olea.
[0032] The present disclosure also relates to a kit comprising the RNA vector of the present disclosure.
[0033] The present disclosure is also directed to use of the RNA vector(s) of the present disclosure for introducing the heterologous segment(s) into a plant, a plant organ, a plant tissue, or a plant cell. The present disclosure is also directed to use of the host plant(s) of the present disclosure, or use of the composition(s) of the present disclosure, for introducing the RNA vector(s) into a plant organ or plant tissue that does not, prior to said introducing, comprise the RNA vector. In some implementations, the step of introducing the RNA vector comprises grafting a plant organ or plant tissue of a plant that comprises the RNA vector to a plant organ or plant tissue of another plant that does not comprise the RNA vector.
[0034] The present disclosure is also directed to a method of making a vector for use with a plant comprising the steps of inserting one or more heterologous segment(s) into an RNA, wherein the RNA is selected from the group consisting of: CYV aV ; a relative of CYV aV ; other RNA vectors having at least 70% RdRp identity with CYVaV; and another iRNA. The present disclosure also relates to a vector produced by the disclosed method(s).
[0035] The present disclosure also relates to the use of an RNA molecule as a vector, wherein the RNA is selected from the group consisting of: CYVaV; a relative of CYVaV; other RNA vectors having at least 70% RdRp identity with CYVaV; and, another iRNA. In some implementations, the RNA is used in the treatment of a plant, for example the treatment of a viral or bacterial infection of a plant, for example the treatment of CTV infection or Citrus greening in a Citrus plant. The RNA is modified with one or more inserted heterologous segment(s), for example an enzybiotic.
[0036] The present disclosure is also directed to the use an RNA molecule characterized by being in the manufacture of a medicament to treat a disease or condition of a plant, wherein the RNA is selected from the group consisting of: CYVaV; a relative of CYVaV; other RNA vectors having at least 70% RdRp identity with CYVaV; and, another iRNA. In some implementations, the disease or condition is a viral or bacterial infection of a plant, for example CTV or Citrus greening in a Citrus plant.
[0037] The present disclosure is also directed to an RNA molecule for use as a medicament or in the treatment of a disease or condition of a plant, wherein the RNA is selected from the group consisting of: CYVaV; a relative of CYVaV; other RNA vectors having at least 70% RdRp identity with CYVaV; and, another iRNA.
Brief Description of the Drawings:
[0038] Fig. 1 illustrates schematically the movement pathways through the vascular system of plants (Lee, J.Y. and Frank, M. (2018), Plasmodesmata in phloem: different gateways for different cargoes, Curr Opin Plant Biol 43: 119-124).
[0039] Fig. 2 is a phylogenic tree showing relatedness of the CYVaV with some viruses in the family Tombusviridae.
[0040] Fig. 3 illustrates schematically the genome organization of CYVaV and similar RNA molecules (Panel A). ORFs encoding for proteins involved in replication are identified in darker grey (p33 and p94 for PEMV2; p21 and p81 for CYVaV; p35 and p86 for PMeV2-ES; p31 and p85 for PUV; p29 and p89 for TBTVa). Umbravirus PEMV2 also possesses ORFs encoding for proteins p26 and p27 involved in movement (identified in light grey boxes). Frameshifting ribosome recording site (FS) and readthrough ribosome recoding site (RT) are also identified. Levels of CYVaV plus (+) strands in infiltrated N. benthamiana leaves (Panel B, top) and systemic leaves (Panel B, bottom) are shown. Levels of the RNA-dependent RNA polymerase (RdRp) synthesized by frameshifting in vitro in wheat germ extracts of full-length CYVaV and PEMV2 are shown (Panel C). The difference in levels of p94 from PEMV2 as compared to p81 polymerase produced by CYVaV is significant. The frameshifting site of CYVaV is one of the strongest known in virology and believed to be responsible for its exceptionally high accumulation.
[0041] Fig. 4 illustrates schematically the genome organization of additional iRNAs and close relatives of CYVaV identified in Opuntia, Fig trees, and Ethiopian com. The iRNA relatives all have inserts in the 3’UTR and other nucleotide changes that result in the generation of an ORE that encodes for a protein (p21.2) of unknown function.
[0042] Fig. 5 shows RNA levels from agro-infiltrated leaves of Nicotiana benthamiana. CVEV (lanes 1-2), CVEV+CYVaV (lanes 3-5) and CYVaV (lanes 5-8) in leaves of Nicotiana benthamiana. Accumulation of CYVaV increased substantially in the presence of putative helper virus CVEV. Plus-strands are shown above. rRNA loading controls are shown below. pl4 silencing suppressor was co-infiltrated in all leaves.
[0043] Fig. 6 shows RNA levels from another experiment with agroinfiltrated leaves of Nicotiana benthamiana. CYVaV or CVEV or CYVaV + CVEV agroinfiltrated into leaves of N. benthamiana. CYVaV was encapsidated in virions of CVEV, and virions were isolated one week later and the encapsidated RNAs subjected to PCR analysis.
[0044] Fig. 7 shows yellowing symptoms of CYVaV (Panel A) and CYVaV + CVEV (Panel B), which are limited to citron (pictured), lemon, and lime.
[0045] Fig. 8 shows the systemic and phloem-limited movement of CYVaV in N. benthamiana, wherein CYVaV is confined to the transport tissues of the plant. Fluorescence in situ hybridization (FISH) imaging detecting plus strands of CYVaV were stained pink (with areas generally shown herein with dashed white lines and circles) are shown in Panels A-G, including longitudinal and cross-sectional views of petioles (Panels A-D) and root tissue (Panels E-G). Tissue was stained with DAPI. Companion cells (CC), phloem parenchyma cells (PPC) and sieve elements (SE), and xylem (XL) are identified. Note that the iRNA is completely restricted to the SE, CC and PPC. Blue (shown herein as dark grey or black areas) is from DAPI staining of endogenous DNA. CYVaV is symptomless in virtually all tested citrus.
[0046] Fig. 9 illustrates schematically the full-length secondary structure of CYVaV as determined by SHAPE structure probing and phylogenetic comparisons with the CYVaV relatives in Opuntia, fig and com. The recoding frameshift site (see Fig. 10) is identified by boxed single solid line region, and the ISS-like (I-shaped structure) 3’CITE (see Fig. 11) is identified by boxed dashed line region. For example, a region for accommodating inserted hairpin(s) is shown by boxed double line region.
[0047] Fig. 10 illustrates schematically the structure of the recoding frameshift sites in CYVaV and PEMV2 (Panel A). CYVaV has multiple conformations of the structures in this region (see Fig. 9) with only one shown. Slippery site is identified by boxed dashed line, and stop codon bases are in black circles. Bases identified by boxed solid line engage in long-distance interaction with the 3’ end.
[0048] Fig. 11 illustrates schematically the ISS-like 3’ Cap Independent Translation Enhancer (3’CITE) of CYVaV. The structure of the 3’ end of CYVaV is shown. The 3’CITE is illustrated at the left-most portion shown and with bases circled. Sequence identified by boxed solid line engages in the long-distance RNA:RNA interaction with the recoding site.
[0049] Fig. 12 illustrates results from a trans-inhibition assay. Full-length CYVaV was translated in vitro in the presence of 10-fold molar excess of a truncated version of the ISS (ISSs) or full-sized ISS (ISSL).
[0050] Fig. 13 demonstrates that CYVaV does not encode a silencing suppressor. Referring to Panels A and B, N. benthamiana 16C plants were agroinfiltrated with a construct expressing GFP (which is silenced in these plants) and either constructs expressing CYVaV p21 or p81, or constructs expressing known silencing suppressors pl9 (from TBSV) or p38 (from TCV). Only pl9 and p38 suppress the silencing of GFP, allowing the green fluorescence to be expressed (infiltrated regions identified by circled dashed line in Panel B). Referring to Panel C, northern blot probed with GFP oligonucleotide showed that GFP RNA is still silenced in the presence of p21 or p81.
[0051] Fig. 14 demonstrates replication of CYVaV in Arabidopsis protoplasts. An infectious clone of CYVaV was generated. Wild-type RNA transcripts (CYVaV) or transcripts containing a mutation in the recoding slippery site that eliminates the synthesis of the RdRp (CYVaV -fsm), and thus doesn’t replicate, were inoculated onto Arabidopsis protoplasts. RNA was extracted and a Northern blot performed 30 hours later. Note that inoculated transcripts of CYVaV -fsm were still present in the protoplasts at 30 hours (whereas in a traditional virus they would be undetectable after 4 hours). Plus strands are shown in Panel A, and minus strand replication intermediate is shown in Panel B.
[0052] Fig. 15 demonstrates replication of CYVaV in N. benthaminana. Referring to Panel A, the level of CYVaV accumulating in the infiltrated leaves of N. benthamiana as determined by Northern blot is shown. Referring to Panel B, plants infiltrated with CYVaV sporadically showed systemic symptoms (see Fig. 16). These plants accumulated high levels of CYVaV. Referring to Panel C, the level of CYVaV in individual leaves of a systemically infected plant is shown. Leaves 4 and 5 were agroinfiltrated with CYVaV. Note the substantial accumulation of CYVaV in the youngest leaves.
[0053] Fig. 16 show symptoms of N. benthamiana systemically infected with CYVaV. Leaves 4 and 5 were agroinfiltrated with CYVaV. The first sign of a systemically infected plant is a “cupped” leaf (Panel A), which was nearly always leaf 9. In the following few weeks, leaf galls emerged at the apical meristem and each node of the plant (Panel B). An uninfected plant (Panel C, left) and an infected plant (Panel C, right) of the same age are shown. Systemically infected plants also had root galls (Panel D), containing a substantial amount of CYVaV as evidenced by Northern plant blot (Panel E).
[0054] Fig. 17 is an image of a tomato plant at 53 days post-infection (left) with a plant of the same age (right), and demonstrating the exceptional host range of CYVaV. Sap from a sy stemically-infected N. benthamiana plant was inj ected into the petiole of a tomato plant. One of four plants showed very strong symptoms and was positive for CYVaV by PCR analysis.
[0055] Fig. 18 demonstrates that CYVaV binds to a highly abundant protein extracted from the phloem of cucumber. Referring to Panel A, labeled full-length CYVaV bound to a prominent protein in this northwestern blot. Proteins were renatured after SDS gel electrophoresis. This protein is believed to be a known, highly conserved RNA binding protein containing an RRM motif that is known to chaperone RNAs from companion cells into sieve elements in the phloem of cucumber. Referring to Panel B, no binding was seen when the proteins remained denatured after electrophoresis.
[0056] Fig. 19 demonstrates that CYVaV is capable of expressing an extra protein from its 3’UTR using a TEV IRES. The location of three separate inserts (in three separate constructs) of nanoluciferase downstream of the Tobacco etch virus (TEV) internal ribosome entry site (IRES) are shown (Panel A). In vitro translation was measured in wheat germ extracts for the three constructs (Panel B). Note the location of the nanoluciferase protein (Nluc) is near the bottom of the gel. Expression of nanoluciferase was measured in protoplasts in vivo (Panel C). Full-length RNA transcripts of the constructs (Panel A) were transformed into protoplasts; 18 hours later, total protein was extracted and nanoluciferase activity measured in a luminometer.
[0057] Fig. 20 illustrates a stable hairpin insert at position 2250. A schematic representation of CY2250sfPDS60 is shown in Panel A. The location of the insert in the secondary structure of CYVaV is shown in Panel B, which location corresponds to a region for accommodating inserted hairpins, such as shown by double line box in Fig. 9. Data from wheat germ extract in-vitro translation assay of T7 transcripts from CYVaV-wt, and CYVaV VIGS vectors containing different amounts of sequence at position 2250 are shown in Panel C. For example, construct sfPDS60 demonstrated excellent systemic movement in plants. Northern blot analysis of total RNA isolated from A. thaliana protoplasts infected by CYVaV wt and CYVaV VIGS vectors. CYVaV-GDD negative control is shown in Panel D. (+) represents plus-strands and (-) are minus strand replication intermediates. An image of N. benthamiana infected by CY2250sfPDS60 is shown in Panel E. RT-PCR products from local leaf and systemic leaf are shown in Panel F. The primer set amplify positions 1963-2654 in the 3’ region of CYVaV. The sequence of the insertion region (underlined) of the vector collected from systemic leaf is shown in Panel G, with dashed line boxed sequences on either side of the insert forming the stem of the hairpin.
[0058] Fig. 21 illustrates a stable hairpin insert at position 2301. A schematic representation of CY2301sfPDS60 is shown in Panel A. The location of the insert in the secondary structure of CYVaV is shown in Panel B, and corresponds to a region for accommodating inserted hairpins, such as shown by double line box in Fig. 9. Data from wheat germ extract in-vitro translation assay of T7 transcripts from CYVaV-wt, and CYVaV VIGS vectors containing different amounts of sequence at positions 2301 and 2319 are shown in Panel C. For example, construct PDS60 demonstrated excellent systemic movement in plants. Northern blot analysis of total RNA isolated from A. thaliana protoplasts infected by CYVaV wt and CYVaV VIGS vectors. CYVaV-GDD and negative control is shown in Panel D. (+) represents plus-strands and (-) are minus strand replication intermediates. An image of N. benthamiana infected by CY2301sfPDS60 is show in Panel E. RT-PCR products from local leaf and systemic leaf are shown in Panel F. The primer set amplify positions 1963-2654 in the 3’ region of CYVaV. The sequence of the insertion region of the virus vector collected from systemic leaf is shown in Panel G, with dashed line boxed sequences forming the stem of the hairpin.
[0059] Fig. 22 illustrates a stable hairpin insert at position 2319. A schematic representation of CY2319sfPDS60 is shown in Panel A. The location of the insert in the secondary structure of CYVaV is shown in Panel B, and corresponds to the region for accommodating inserted hairpins shown by double line box in Fig. 9. Data from wheat germ extract in-vitro translation assay of T7 transcripts from CYVaV-wt, and CYVaV VIGS vectors containing different amounts of sequence at position 2301 and 2319 are shown in Fig. 21, Panel C. Northern blot analysis of total RNA isolated from A. thaliana protoplasts infected by CYVaV wt and CYVaV VIGS vectors. CYVaV-GDD and negative control is also shown in Fig. 21, Panel D. An image of N. benthamiana infected by CY2319sfPDS60 is shown in Panel C. RT-PCR products from local leaf and systemic leaf is shown in Panel D. The primer set amplify positions 1963-2654 in the 3’ region of CYVaV.
[0060] Fig. 23 illustrates the location of a 60 nt insertion (non-hairpin) onto the ORF of the RdRp of CYVaV (Panel A). The location of the insert is indicated by the black arrow. A stop codon, indicated by the black hexagon, was engineered just upstream of the insert to truncate the RdRp. Northern blot of plus-strand RNA levels in Arabidopsis protoplasts is shown in Panel B. CYVaV-GDD is a non-replicating control.
[0061] Fig.24 illustrates a lock and dock sequence for stabilizing the base of inserts. Referring to Panel A, tetraloop GNRA (GAAA) docking with its docking sequence generates an extremely stable structure, and represents a basic lock and dock sequence. Referring to Panel B, use of a scaffold consisting of a docked tetraloop as a crystallography scaffold is shown. Referring to Panel C, a unique lock and dock structure is shown. Inserts (hairpins or non hairpin sequences) may be added to the restriction site (as identified by dashed line box). Circled bases in the sequences are the docking sequences for the GAAA tetraloop.
[0062] Fig. 25 illustrates that stabilizing the local 3’UTR structure is highly detrimental, but insertion of a destabilizing insert nearby restores viability. Referring to Panel A, a schematic representation of CYVaV-wt. CYVaV-wt 3’stb is the parental stabilized construct containing 6 nt changes converting G:U pairs to G:C pairs. Two insertions of 60 nucleotides were added to the stabilized parental construct at positions 2319 and 2330 forming CY2319PDS60 _3’stb and CY2330PDS60_3’stb. Nucleotide changes made to stabilize the structure and generate CYVaV-wt 3’stb are circled in Panel B. Insertion sites are indicated by the arrows for each constructs: left arrow in Panel A indicting insertion site for construct CY2319PDS60_3’stb; right arrow in Panel A indicating insertion site for construct CY2330PDS60_3’stb. Referring to Panel C, data is shown from wheat germ extract in-vitro translation assay of T7 transcripts from the constructs shown in Panel A. Note that p81 levels (the frame-shift product) is strongly affected by stabilizing this region. Referring to Panel D, northern blot analysis of total RNA isolated from A. thaliana protoplast infected by CYVaV-wt, CYVaV-wt 3’stb, C Y 2319PD S 60_3’ stb, CY2330PDS60_3’stb, and CYVaV-GDD (non-replicating control) is shown. (+) represents plus-strands and (-) are minus strand replication intermediates.
Detailed Description of Embodiments:
[0063] The present disclosure relates to novel infectious agents for use as vectors for plants, compositions comprising a plant infected by the disclosed agent(s), and uses and methods relating thereto. The infectious agents of the present disclosure are sometimes referred to herein as“independently mobile RNAs” or“iRNAs” and exhibit superior characteristics as compared to conventional viral vectors. In accordance with disclosed embodiments, the iRNAs are RNA molecules capable of infecting plants and encoding for an RNA polymerase to sustain their own replication, but lacking the ability to encode for any movement protein or coat protein. In addition, iRNAs do not code for any RNA silencing suppressors.
[0064] As used herein, a“host” refers to a cell, tissue or organism capable of being infected by and capable of replicating a nucleic acid. A host may include a whole plant, a plant organ, plant tissue, a plant protoplast, and a plant cell. A plant organ refers to a distinct and visibly differentiated part of a plant, such as root, stem, leaf, seed, graft or scion. Plant tissue refers to any tissue of a plant in whole or in part. Protoplast refers to an isolated cell without cell walls, having the potency for regeneration into cell culture, tissue or whole plant. Plant cell refers to the structural and physiological unit of plants, consisting of a protoplast and the cell wall.
[0065] As used herein,“nucleic acid sequence,”“polynucleotide,”“nucleotide” and “oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length. Polynucleotides may have any three-dimensional structure, and may perform any function. A“gene” refers to a polynucleotide containing at least one open reading frame that is capable of encoding a particular polypeptide sequence. “Expression” refers to the process by which a polynucleotide is transcribed into mRNA and/or the process by which the transcribed mRNA is translated into peptides, polypeptides, or proteins.
[0066] A vector“derived from” a particular molecule means that the vector contains genetic elements or sequence portions from such molecule. In some embodiments, the vector comprises a replicase open reading frame (ORF) from such molecule (e.g., iRNA). One or more heterologous segment(s) may be added as an additional sequence to the vectors of the present disclosure. In some implementations, said heterologous segment(s) is added such that high level expression (e.g., of a particular protein or small RNA) is achieved. The resulting vector is capable of replicating in plant cells by forming further RNA vector molecules by RNA-dependent RNA polymerization using the RNA vector as a template. An iRNA vector may be constructed from the RNA molecule from which it is derived (e.g., CYVaV).
[0067] As used herein, an“infection” or“capable of infecting” includes the ability of a vector to transfer or introduce its nucleic acid into a host, such that the nucleic acid or portion(s) thereof is replicated and/or proteins or other agents are synthesized or delivered in the host. Infection also includes the ability of a selected nucleic acid sequence to integrate into a genome of a target host.
[0068] As used herein, a“phenotypic trait” refers to an observable, measurable or detectable characteristic or property resulting from the expression or suppression of a gene or genes. Phenotype includes observable traits as well as biochemical processes.
[0069] As used herein,“endogenous” refers to a polypeptide, nucleic acid or gene that is expressed by a host. “Heterologous” refers to a polypeptide, nucleic acid or gene that is not naturally expressed by a host. A“functional heterologous ORF” refers to an open reading frame (ORF) that is not present in the respective unmodified or native molecule and which can be expressed to yield a particular agent such as a peptide, protein or small RNA. For being expressible from the vector in a plant, plant tissue or plant cell, the vector comprising a functional heterologous ORF comprises one or more subgenomic promoters or other sequence(s) required for expression.
[0070] Various assays are known in the art for determining expression of a particular product, including but not limited to: hybridization assays (e.g. Northern blot analysis), amplification procedures (e.g. RT-PCR), and array-based technologies. Expression may also be determined using techniques known in the art for examining the protein product, including but not limited to: radioimmunoassay, ELISA (enzyme linked immunoradiometric assays), sandwich immunoassays, immunoradiometric assays, in situ immunoassays, western blot analysis, immunoprecipitation assays, immunofluorescent assays, GC-Mass Spec, and SDS- PAGE.
[0071] An“exogenous RNA segment” refers to a segment of RNA inserted into a native molecule, whereby the source of the exogenous RNA segment is different from the native molecule. The source may be another virus, a living organism such as a plant, animal, bacteria, virus or fungus, a chemically synthesized material, or a combination thereof. The exogenous RNA segment may provide any function appropriate for a particular application, including but not limited to: a non-coding function RNA, a coding function in which the RNA acts as a messenger RNA encoding a sequence which, translated by the host cell, results in synthesis of a peptide (e.g., a molecule comprising between about 2 and 50 amino acids) or a protein (e.g. a molecule comprising 50 or more amino acid) having useful or desired properties.
[0072] As used herein,“movement protein” refers to a protein(s) required for cell-to-cell and/or long distance movement. “Coat protein” refers to protein(s) comprising or building the virus coat.
[0073] Similar to umbraviruses, iRNAs do not possess a functional coat protein(s) ORF and/or otherwise encode for any coat protein. In addition, the RNA polymerase of iRNAs is similar to that of umbraviruses. However, unlike umbraviruses, iRNAs do not possess a functional movement protein(s) ORF and/or otherwise encode for any cell-to-cell movement protein(s) or any long-distance movement protein(s) that serves as a stabilization protein for countering nonsense mediated decay.
[0074] Conventional viruses lacking coat proteins are generally less stable inside a plant cell given their genomes are vulnerable to the host RNA silencing defense system. However, iRNAs are surprisingly stable in the intracellular environment, which is an important characteristic for an effective vector. iRNAs are also restricted to the inoculated host plant in the absence of a specific helper virus, since without associated virions they are not transmissible by an insect vector. It is believed that iRNAs are encapsidated into virions only when in the presence of a specific helper virus, e.g., such as an enamovirus, including Citrus vein enation virus (CVEY), which is a rarely seen virus in the United States.
[0075] In disclosed embodiments, a recombinant plus-sense single stranded RNA vector is provided that comprises a replication element(s) and a heterologous segment(s). The RNA vectors of the present disclosure are capable of accumulating to high levels in phloem, and are capable of delivering a therapeutic agent(s) such as a protein, a peptide, an antibacterial and/or an insecticide ( e.g . , siRNAs) directly into the plant tissue. In certain implementations, the RNA vector is derived from an iRNA molecule, which lacks the ability to encode for any coat protein(s) or movement protein(s). For example, the vector is derived from and/or includes structural elements of the iRNA molecule known as Citrus yellow vein associated virus (CYVaV), an unclassified molecule associated with yellow-vein disease of citrus.
[0076] Thus, disclosed embodiments provide for an iRNA-based vector built on or derived from a plus-sense single-stranded RNA molecule using genetic components from an iRNA molecule, e.g., CYVaV. In addition, the present disclosure is directed to kits and/or mixtures comprising an iRNA-based (e.g. a CYVaV-based) vector(s). Such mixtures may be in a solid form, such as a dried or freeze-dried solid, or in a liquid, e.g. as aqueous solution, suspension or dispersion, or as gels. Such mixtures can be used to infect a plant, plant tissue or plant cell. Such kits and mixtures may be used for successfully infecting a plant(s) or plant cell(s) with the iRNA-based vectors of the present disclosure and/or for expression of heterologous proteins or delivery of other therapeutic agents to such plant or plant cell(s).
[0077] The present disclosure also relates to a plant, plant tissue, or plant cell comprising said iRNA-based vector as disclosed herein, and/or a plant, plant tissue, or plant cell comprising a therapeutic agent or heterologous polypeptide encoded or delivered by said vector. The present disclosure also provides for methods of isolating such heterologous polypeptide from the plant, plant tissue, or plant cell. Methods for isolating proteins from a plant, plant tissue or plant cell are well known to those of ordinary skill in the art.
[0078] CYVaV was found in four limequat trees in the 1950s independent of any helper virus (Weathers, L. (1957), A vein-yellowing disease of citrus caused by a graft-transmissible virus, Plant Disease Reporter 41:741-742; Weathers, L.G. (1960), Yellow-vein disease of citrus and studies of interactions between yellow-vein and other viruses of citrus, Virology 11 : 753-764; Weathers, L.G. (1963), Use of synergy in identification of strain of Citrus yellow vein virus, Nature 200:812-813). Further analysis and sequencing of CYVaV was conducted years later by Georgios Vidalakis (University of California, Davis, CA; GenBank: JX101610). Dr. Vidalakis’s lab conducted analysis on samples collected from previously established tree sources (Weathers, L.G. (1963), Use of synergy in identification of strain of Citrus yellow vein virus, Nature 200:812-813) and maintained in the disease bank of the Citrus Clonal Protection Program (CCPP). Studies by the Vidalakis lab to characterize CYVaV were inconclusive. However, many of the infected samples containing CYVaV also contained the enamo virus citrus vein enation virus (CVEV); it was relatively common in the 1950s through 1980s for CCPP personnel to mix infect plants with yellow-vein and vein enation for symptom enhancement.
[0079] CYVaV is a small (~2.7 kb) iRNA molecule composed of a single, positive sense strand of RNA. It replicates to extremely high levels, is very stable, is limited to the phloem, and has no known mechanism of natural spread. As such, CYVaV is ideal as a vector platform for introducing an agent(s) into a plant host, e.g., such as a small RNA (e.g., non-coding RNA molecule of about 50 to about 250 nt in length) and/or proteins for disease and/or pest management. The production of proteins that bolster (or silence) defenses, antimicrobial peptides that target bacterium, and/or small RNAs that target plant gene expression or the insect vectors of disease agents provide an effective management strategy. To be efficacious, the proteins and small RNAs should be produced in sufficient quantities and accumulate to sufficient levels in the phloem, particularly small RNAs designed to be taken up by targeted insects or fungal pathogens.
[0080] CYVaV is only transmissible from tree to tree by grafting, but has been shown to infect nearly all varieties of citrus with the exception of hearty orange, including but not limited to infecting citron, rough lemon, calamondin, sweet orange, sour orange, grapefruit, Rangpur and West Indian lime, lemon, varieties of mandarin, varieties of tangelo, and kumquat. It produces a yellowing of leaf veins in the indicator citron tree and has no or very mild yellow vein symptoms in sweet orange and other citrus with no reported impact on fruit quality, or otherwise causing harm to trees.
[0081] The polynucleotide sequence (bases 1 to 2692) of CYVaV is presented below (SEQ ID NO: 1):
ggguaaauau ggauccuuca ucuuugcccc gugccuguug gcaucaugcc 50
agacaggugu uucgagcauc aacuagcuuc ucaagagagg ugguucgcgc 100
ugcucguaga uggguuacca ugcccaccag ucgccaugca uaugacuuuu 150
caacgagucu aggcauugug auugcugagc cugcagcucg uuuacgacgc 200
cgucugcccu cuguacgaaa gugcgcagag aaguuaguag uccacaagca 250
agucgacacu uugguggacg aauggugcuc uggaauuccc aacccugaua 300
ucguagaagu ugguugggca cuccgucuga gggaccguuu cggucuuccu 350
cccgcuucug agccuacccg gcucaguggu gagagauggg ugcucaaaca 400
acucaauggg guagauccug agucauggaa ugcugaucuu gguaggucag 450 uucauaucca aggagacuac gccccaggga ggaaugccca uaucgcucag 500
gucgcggcga ccuugugguu aacuaggacc uugcaugaca aggccuuggc 550
ucgccaccag gguuuucgcg auuugcagug auuggggucg acgggcuaga 600
ggcaaaagca gugccucuag cuucuggacu ccgacugcuu ccgguuccgc 650
gacccggaca aagucgacga cugucucaga ccuuguuacu uccaacaccu 700
cgugcucaau ucgugaauca cgcgugcucg gcuaacaacc uuggacgugu 750
gaugaccaca cguguguugc aguacaaggg ccgagauccg auccuucccu 800
cuucugaagc ccuucaccga cuuaaccuuc ggauagcuga gcuauauagg 850
ucuagaccuu cuaccgucua uccauuaagu uaugaagggu uucucaauug 900
cuaugaaggc cgacagcgua cucguuacgc ccaagccguc gagcaguuga 950
ugcgguccac ucuugagccg aaagaugcgc gaguugaaac guucauuaag 1000
aacgagaaau uugacugggc guugaaaggg gaggaggcug auccucgagc 1050
aauccaacca aggaagccga aauauuuggc ugagguugga cggugguuca 1100
aaccuuugga gcgaaucauc uacaaggauc ucaguaaaag guuguauggu 1150
gagggugcug agccguguau cgccaaaggc cuaaaugcau uagaaucugg 1200
agcgacuuug aggcgcaaau gggagaaguu uucuucucca guuugcguuu 1250
cucucgacgc uuccagguuc gaccugcaug uaagcguugg caugcuaaag 1300
uucacacaca agcuauauga cuauuacugu aagucuccca cucuccagcg 1350
cuaucucaaa uggacacucc gcaaccaugg cgucgccucc ugcaaagaau 1400
ugucauauga guaugagguu guuggccgga gaaugagugg ugacauggac 1450
acugcauugg gcaacugcgu cauuaugucg auacuuacau gguuuaugcu 1500
uagugaacuu ggcauuaagc augaauuauu cgauaauggu gacgauuguu 1550
uguucauuug cgagucucac gacgucccca gccccgaggu aauuacaaac 1600
ugguuuucgg acuuuggguu ugugguuagg uuggaaggcg ucacguccgu 1650
guuugagcgu auugaguuuu gccaaacuuc cccaguaugg acugagaggg 1700
guuggcugau guguaggaau auuaagucau ugaguaaaga ccuuacgaau 1750
guuaauucgu gcacgggcuc cacgauugaa uauacccacu gguugaaagc 1800
agugggaaag ugcgggucaa uacucaaugc ugguguaccu auauuucagu 1850
ccuuucacaa caugcuggaa aggcuuggca cuaacucucg uauugaucga 1900
gggguuuucu ucaaaucagg gcuaguuaau cucauucgug ggauggacag 1950
gcagccugac guugacauca cuacuuccgc ucggcuuucu uucgaagugg 2000
cauucgggau aacacccggg augcaauugg cuauugaacg guacuaugac 2050
ucugucaugg gcucgcugag uaaaauagaa acaacuaagu ggccaauuga 2100
acuaagaaag gaauacgaac acggaaguga gugguacgag gacuuaggcg 2150
uccuaggaug aauaggguca uugguuuacc gaugauaccu guucagaaua 2200
ggauugcucg agcuucguug guuaggguaa cucacauacc uucuuccaua 2250
acuggaaaag gucgugugag caaccuaacc aguuaaugua ggugucuuuc 2300
cguaucuagu cacgauggua agcaacccgu uuaucuguac ggcgcucacc 2350
cguggguagg aaggugaagg uuuugugucc uuuaggucuu ggacagucug 2400
cgggcuuggg aacgacgccc cgcuagcaac guacugcucu ccuaccggac 2450
ugguagcuua auugucaucu uggagcgaua gcacuguggg ccucacccuu 2500
cgcgcguugg acguguugcg ugccccccac agauuuguga aacucuaugg 2550
agcaguuccg cgagccagaa gggaggaugg ccgccuggcg uaauccagga 2600
gcucuggggg gcuuguacuc agaguagcau ucugcuuuag acuguuaacu 2650
uuaugaacca cgcgugucac guggggagag uuaacagcgc cc 2692
[0082] Relatedness of CYVaV with other viruses including Tombusviridae viruses is shown in Fig. 2. Genome organization of CYVaV and similar RNA molecules is illustrated in Fig. 3, Panel A, including PEMV2, PMeV2-ES (GenBank: KT921785), PUV (GenBank: KP165407.1), and TBTVa (GenBank: EF529625.1). The RdRp of CYVaV is most closely related to the umbravirus Pea enation mosaic virus RNA2 (PEMV2). Examination of 5’ and 3’ sequences of CYVaV revealed considerable similarity to those of umbraviruses, confirming that CYVaV is indeed a complete infectious agent. CYVaV has a plus-sense single stranded RNA genome that only encodes two proteins involved in replication: p21, a replicase- associated protein in related molecules; and p81, the RNA-dependent RNA polymerase (RdRp) that is synthesized by a ribosome recoding (frameshift) event (Fig. 3, Panel A). Levels of the RNA-dependent RNA polymerase (RdRp) synthesized by frameshifting in vitro are shown for PEMV2 and CYVaV. The difference in levels of p94 (RdRp) from PEMV2 as compared to p81 from CYVaV is significant (Fig. 3, Panel C). The frameshifting site of CYVaV is one of the strongest known in virology and believed to be responsible for its exceptionally high accumulation.
[0083] The polynucleotide sequence of the 3’ end of CYVaV (bases 2468 to 2692) is presented below (SEQ ID NO: 2):
ucu uqqaqcqaua gcacuguqqq ccucacccuu cgcgcguugg acguguugcg ugccccccac agauuuguga aacucuaugg agcaguuccg cgagccagaa gggaggaugg ccgccuggcg uaauccagga gcucuggggg gcuuguacuc agaguagcau ucugcuuuag acuguuaacu uuaugaacca cgcgugucac guggggagag uuaacagcgc cc
[0084] The polynucleotide sequence of the 3’ Cap Independent Translation Enhancer (3’ CITE) of CYVaV (bases 2468 to 2551) is presented below (SEQ ID NO: 3): ucu uqqaqcqaua gcacuguqqq ccucacccuuc gcgcguugg acguguugcg ugccccccac agauuuguga aacucuauqq a
[0085] The 3’ end (and 3’ CITE) of CYVaV comprises the following conserved polynucleotide sequence(s) (bolded and underlined above): auagcacug (SEQ ID NO: 4); and/or
gauuuguga (SEQ ID NO: 5).
[0086] The polynucleotide sequence of CYVaV that encodes for protein p21 (bases 9 to 578) is presented below (SEQ ID NO: 6):
au ggauccuuca ucuuugcccc gugccuguug gcaucaugcc agacaggugu uucgagcauc aacuagcuuc ucaagagagg ugguucgcgc ugcucguaga uggguuacca ugcccaccag ucgccaugca uaugacuuuu caacgagucu aggcauugug auugcugagc cugcagcucg uuuacgacgc cgucugcccu cuguacgaaa gugcgcagag aaguuaguag uccacaagca agucgacacu uugguggacg aauggugcuc uggaauuccc aacccugaua ucguagaagu ugguugggca cuccgucuga gggaccguuu cggucuuccu cccgcuucug agccuacccg gcucaguggu gagagauggg ugcucaaaca acucaauggg guagauccug agucauggaa ugcugaucuu gguaggucag uucauaucca aggagacuac gccccaggga ggaaugccca uaucgcucag gucgcggcga ccuugugguu aacuaggacc uugcaugaca aggccuuggc ucgccaccag gguuuucgcg auuugcag
[0087] The amino acid sequence of protein p21 is presented below (SEQ ID NO:7): MDPSSLPRACWHHARQVFRASTSFSREWRAARRWVTMPTSRHAYDFSTSLGIVIAEPAARLRRRLPS
VRKCAEKLWHKQVDTLVDEWCSGIPNPDIVEVGWALRLRDRFGLPPASEPTRLSGERWVLKQLNGVD
PESWNADLGRSVHIQGDYAPGRNAHIAQVAATLWLTRTLHDKALARHQGFRDLQ
[0088] The polynucleotide sequence of CYVaV that encodes for protein p81 (bases 752 to 2158) is presented below (SEQ ID NO: 8): augaccaca cguguguugc aguacaaggg ccgagauccg auccuucccu cuucugaagc ccuucaccga cuuaaccuuc ggauagcuga gcuauauagg ucuagaccuu cuaccgucua uccauuaagu uaugaagggu uucucaauug cuaugaaggc cgacagcgua cucguuacgc ccaagccguc gagcaguuga ugcgguccac ucuugagccg aaagaugcgc qaquuqaaac guucauuaag aacgaqaaau uugacugggc guugaaaggg gaggaggcug auccucgagc aauccaacca aggaagccga aauauuuggc ugagguugga cggugguuca aaccuuugga gcqaaucauc uacaaggauc ucaguaaaag guuguauggu gagggugcug agccguguau cgccaaaggc cuaaaugcau uagaaucugg agcgacuuug aqqcqcaaau gggaqaaquu uucuucucca guuugcguuu cucucgacgc uuccagguuc gaccugcaug uaagcguugg caugcuaaag uucacacaca agcuauauga cuauuacugu aagucuccca cucuccagcg cuaucucaaa uggacacucc gcaaccaugg cgucgccucc ugcaaagaau ugucauauga guaugagguu guuggccgga gaaugagugg ugacauggac acugcauugg gcaacugcgu cauuaugucg auacuuacau gguuuaugcu uagugaacuu ggcauuaagc augaauuauu cgauaauggu gacgauuguu uguucauuug cgagucucac gacgucccca gccccgaggu aauuacaaac ugguuuucgg acuuuggguu ugugguuagg uuggaaggcg ucacguccgu guuugagcgu auugaguuuu gccaaacuuc cccaguaugg acugagaggg guuggcugau guguaggaau auuaagucau ugaguaaaga ccuuacgaau guuaauucgu gcacgggcuc cacgauugaa uauacccacu gguugaaagc agugggaaag ugcgggucaa uacucaaugc ugguguaccu auauuucagu ccuuucacaa caugcuggaa aggcuuggca cuaacucucg uauugaucga gggguuuucu ucaaaucagg gcuaguuaau cucauucgug ggauggacag gcagccugac guugacauca cuacuuccgc ucggcuuucu uucgaagugg cauucgggau aacacccggg augcaauugg cuauugaacg guacuaugac ucugucaugg gcucgcugag uaaaauagaa acaacuaagu ggccaauuga acuaagaaag gaauacgaac acggaaguga gugguacgag gacuuaggcg uccuagga
[0089] The amino acid sequence of protein p81 is presented below (SEQ ID NO:9):
MTTRVLQYKGRDPILPSSEALHRLNLRIAELYRSRPSTVYPLSYEGFLNCYEGRQRTRYAQAVEQLMR STLEPKDARVETFIKNEKFDWALKGEEADPRAIQPRKPKYLAEVGRWFKPLERI IYKDLSKRLYGEGA EPCIAKGLNALESGATLRRKWEKFSSPVCVSLDASRFDLHVSVGMLKFTHKLYDYYCKSPTLQRYLKW TLRNHGVASCKELSYEYEWGRRMSGDMDTALGNCVIMSILTWFMLSELGIKHELFDNGDDCLFICES HDVPSPEVITNWFSDFGFWRLEGVTSVFERIEFCQTSPVWTERGWLMCRNIKSLSKDLTNVNSCTGS TIEYTHWLKAVGKCGSILNAGVPIFQSFHNMLERLGTNSRIDRGVFFKSGLVNLIRGMDRQPDVDITT SARLSFEVAFGITPGMQLAIERYYDSVMGSLSKIETTKWPIELRKEYEHGSEWYEDLGVLG
[0090] The replication element of CYVaV (e.g., that encodes for protein p81) comprises the following conserved polynucleotide sequence(s) (highlighted and underlined above): cguuc (SEQ ID NO: 10);
gaa cg (SEQ ID NO: 11);
gguuca (SEQ ID NO: 12);
ggag (SEQ ID NO: 13); and/or aaauggga (SEQ ID NO: 14).
[0091] In addition, CYVaV may additionally comprise the following conserved polynucleotide sequence(s) (highlighted and underlined above): ucgacg (SEQ ID NO: 15); and/or
cuccga (SEQ ID NO: 16).
[0092] The polynucleotide sequences of recoding frameshift sites of CYVaV (see also Fig. 10) is presented below: ucgcucaggucgcggcgaccuugugguuaacuaggaccuugcaugacaaggccuuggcucgc caccaggguuuucgcgauuugcagugauuggggucgacgggcuagaggcaaaagcagugccu cuagcuucuggacuccgacugcuuccgguuccgcgacccgga (SEQ ID NO:17) caaagucgacgacugucucagaccu (SEQ ID NO:18) aggucuuggacagucugcgggcuugggaacgacg (SEQ ID NO:19)
[0093] Highly similar iRNAs have also been found in Opuntia (GenBank: MH579715), fig trees, and Ethiopian com (Fig. 4), suggesting an unusually large or possibly even unlimited host range for the RNA vectors disclosed herein.
[0094] The polynucleotide sequence of a similar iRNA identified in a fig tree (sometimes referred to herein as“iRNA relative 1” or“iRNA rl”) is presented below (SEQ ID NO: 20): aaauauggauucgauaucaaugcccgucgccugcuggucaaaagccaggcaggucuugcguacaccag cuaacuuuuccaaagggguagugaaggcugcguaccggugggucaacaugcccagagccaaauauguc agagaugucuccacgagucuuggcauaguugucgcugagccuguugcugccgugcgccguuagaugcc uucgauaagcagccuugcggaggaguugguaacacgccagagcgucgacacucugguggacgauuggu gucucggacuuuccaacccugacaacaacguggagguugguugggcacuucgucugagggaccgcuuu ggucuuccucccgccucugagcccacaaggcucaguggugagagaugggugcuuaaacaacucaaugg gguagacccggagucguggaauguugaucugcaaagcguuuucgaagacgcucaggaugacuuccauc gggacuacgccccaaggaggaaugcccaaaucgcucaaauugcggcaacccuauggcuuacaaagacc uuagucgauaaggcuuuagcacgccaucaggauuuucgcaguuugcagugauuggggucgacgggcua gaggcuaaagcagugccucuggcugcuggacuccgacugcuuccgguuccgcggcccggacaaagccg acggcugucucaaaccuugcuacucccuacuccccgugcucaauuugucaaucacgcuaacucaggua auaauuuggggcguguuuugaccacacgggugaugcaauacaaaggccgagacccgauacuacccucc caggaagcccugcgcaaacuuaaccuucggauaggacaguuguauaagucuagaccauccacugucua uccccugaguuaugauggguuucuuaauuguuaugauggccgacagcguacucgcuacgcucaugccg ucqaqcaauuqauqqquqccqcucuqaccccaaaaqauqcqcqaquuqaqacguucauuaagaacgaq aaguuugauugguuguugaagggagacgaggcugauccucgugcaauccaaccuaggaagccgaaaua uuuggccgagguuggucgaugguucaaaccguuggagcgaaucaucuacaaggaucucaguuugcguu uguacggugauaacgcugaaccuugcauugccaaaggcuuaaaugcauuggaaucaggggcuacguug agacguaaaugggaaaaguucgcuaauccuguuuguguuucauuggaugcuucucguuucgaccugca cguaaguguuggcuuguuaaaguucacgcauaaauuguacaacuauuacugcaagucucccacucuuc aacgauaucucaaauggacacuccgcaacuccgguaucgccuccuguaaggaaaaaucauaugcguau gagguugaaggccguagaaugaguggcgacauggacaccgcauuaggcaacuguaucaucaugagauu auuaacuugguuuaugcuuagcgaacuuggcgugcggcaugagcuuuucgauaauggugaugacuguu uguuuauuugugaaaaagaagacguuccuagugcugagguaaucacgaacugguuuacggauuuuggg uuugugguuaagcuagaaggcgucacguccguguuugagcgcauugaguucugucagaccucaccagu auggacugcgaggggauggcugauguguagaaacaucaagucauugaguaaagauuuaacgaauguua auucgugcacugguucugccguugaauacacucauugguugaaggcggugggcaaguguggaucuaua cucaaugcuggugugcccauauuucaguccuuucacaacauguuggucagguugggcacgaauucgcg uauagaucgcgggguauucuuuagguguggacuuguuaaucucauucugggauggacagacaaccuga aaguugagaucacuacuuccgcucgucuuucuuuugaaguggcauucgggaucacucccggcaugcaa uuggcuauugagcaauuuuaugacucagucgugggcccucuggguaaaauaaaaucuguaaaauggcc aauagaucuaagaaaggaauacgauuacggaagcgcgugguucgaagaccaaggcguccuagggugaa caaggaacucggauuaccgaugacaccuguucaaacuagaaugguucggucaacguugaccaaggaga ccaacauaccuucuacugcaaauagcggucgggaggcuguuugggcuuguuggccaaucaacuuuagu gucuuuccgcaacuagccucacucgugaauaaaccguuauacuggcguguguccagugugcaaguugc aauggagccggcgaugucuacuuccacccaacauuguggaguuggucucaguucuucuggggccuuca cuaacqquqauqqquucqquaacqucuuuaaqcucuuqcguucuuquaacuauacqcqqcqcucuccc gugggaggaaacgugauggucaaauggcccaucugcaugcccuucauucuuaacgaugaugcgcacaa gaacacaggauuaaccgccugugugaucauugcagucaccaauacuggugugcuaacuggucaaucuu qqacqqaqauucuuuuqaauquqqaquauquaquqqquqcauaqacaqucuqcqqqcuuqqgaacgac gccccgcuagcaacguacugcucuccuaccggacugguagccguuuaguuaucuuggagcgauagcac uguqaqccucacucaacqcqcqauqqacquqqcqaquqccccucaqagauuugugaaacucuauaqaq cuauuucgcgagccagaagggaggauggccaccugguguaagccagguauccccggggggcuuguacu cggggucgcauuacugcuuagaccacaagguaggguucgcaucuuggaacugacccuaugaccuugug ggugcccuaaccggacugguagccguuuaauaucuuggagcgauuagcacgugugagcccucacucaa cggcgcgauuggacguggcgagugccccucagaguaaucugcagagcuccggcagucgugggaggcaa ggca
[0095] The polynucleotide sequence of an iRNA identified in another fig tree (sometimes referred to herein as“iRNA relative 2” or“iRNA r2”) is presented below (SEQ ID NO: 21): cucccacgacugccggagcucugcagaauuccaccggggguaccuggcuuacaccagguggccauccu cccuucuggcucgcggaauagcucuauagaguuucacaaaucucugaggggcacucgccacguccauc gcgcguugagugaggcucacagugcuaucgcucccagaauucgggauaaauauggaagaaacuucuuu gcccaaagccugcuggaucaaaagccaggcaggucuugcguacaccagcuaacuuuuccaaaggggua gugaaggcugcguaccggugggucaacaugcccagagccaaauaugucagagaugucuccacgagucu uggcauaguugucgcugagccuguugcugccgugcgccgucagaugccuucgauaagcagccuugcgg aggaguugguaacacgccagagcgucgacacucugguggacgauuggugucucggacuuuccaacccu gacaacaacguggagguugguugggcacuucgucugagggaccgcuuuggucucccucccgccucuga gcccacaaggcucaguggugagagaugggugcuuaaacaacucaauggaguagacccggaaucuugga augacgacuaugcguucgaagacgcucaggaggauuuucaacgggaauacgucccgggaaggaaugcc cauauugcugcaacugcggcaacucuauggcugacaaagaccuuguaugacaaggcuuuaguucgcca ucaqqquuuucqcaquuuqcaquqauuqqqqucgacgqqcuqqaqqcuaaaqcaquqccuccaqcuqc uqqacuccgacuqcuuccqquuccqcqqcccqqacaaaqccqacqqcuqucucaqaccuuacuacuuc cuacuccccgugcuacuuuugucaaucaugcaaauucaggcaauaaucuugagcguguuuugaccaca cgggugaugcaauacaaaggccgagacccgauacuacccucccaggaagcccugcgcaaacuuaaccu ucggauaggacaguuguauaagucuagaccauccacugucuauccccugaguuaugauggguuucuua auuguuaugauggccgacagcguacucgcuacgcucaugccgucgagcaauugaugggugccgcucug accccaaaagaugcgcgaguugagacguucauuaagaacgagaaguuugauugguuguugaagggaga cgaggcugauccucgugcaauccaaccuaggaagccgaaauauuuggccgagguuggucgaugguuca aaccguuggagcgaaucaucuacaaggaucucaguuugcguuuguacggugauaacgcugaaccuugc auugccaaaggcuuaaaugcauuggaaucaggggcuacguugagacguaaaugggaaaaguucgcuaa uccuguuuguguuucauuggaugcuucucguuucgaccugcacguaaguguuggcuuguuaaaguuca cgcauaaauuguacgacuauuacugcaagucucccacucuucaacgauaucucaaauggacacuccgc aacuccgguaucgccuccuguaaggaaaaaucauaugcguaugagguugaaggccguagaaugagugg cgacauggacaccgcauuaggcaacuguaucaucaugacgauauuaacuugguuuaugcuuagcgaac uuggcgugcggcaugagcuuuucgauaauggugaugauuguuuguucauuugcgaagaaaaagacgua ccuagccccgagacgaucaugaacugguuugcggauuuuggguuugugguuagguuagaaggcgucgu guccguguuugagcgcauugaguucugccaaacaucgccuauauggacugaucgagguuggcugaugu guagaaacaucaagucuuugaguaaggaucuuacgaacguuaauucgugcacuggcuccacuguugaa uacacccauugguugaaagcaguuggaaaguguggaucggugcucaaugcgggugugccuauauuuca gucauuucacaacauguugaugcgauuggguacgaauucgcguauagaucgcgggguauucuuuaggu guggacuuguuaaucucauucgugggauggacagacaaccugaaguugagaucacuacuuccgcucgu cuuucuuuugaaguggcauucgggaucacucccggcaugcaauuggcuauugagcaauuuuaugacuc agucgugggcccucuggguaaaauaaaaucuguaaaauggccaauagaucuaagaaaggaauacgauu acggaagcgcgugguucgaagaccaaggcguccuagggugaacaaggaacucggauuaccgaugacac cuguucaaacuagaaugguucggucaacguugaccaaggagaccaacauaccuucuacugcaaauagc ggucgggaggcuguuugggcuuguuggccaaucaacuuuagugucuuuccgcaacuagccucacucgu gaauaaaccguuauacuggcguguguccagugugcaaguugcaauggagccugcaaugucuucuucca cccaacauugugguguuggucucaguucuucuggggccuucacauaacggugauggguucgguaacgu cuuuaagcucuugcguucuuguaacuauacgcggcgcucucccgugggaggaaacgugauggucaaau ggccuaucugcaugcccuucauucuuaacgaugaugcgcacaagaacacaggauuaaccgccugugug aucauugcagucaccaauacuggugugcuaacuggucaaucuuggacggagauucuguugaaugugga guauacgccccgcuagcaucguacugcucuccuaccggacugguagccguuuaguuaucuuggaguga uagcacuguqqqqccacauuuqacqcqcauuqqacqcaqacaauqucccuccacagauuugugaaucu cuauggagcuguaaccucggucucucuauagcuuguccgaacaggaaauggacauaaaauaauugcug uuccaacacguuguguugguaaagaaguuauagauguggugcgccagacaaguggauggcaaccugga guaauccaggcgcucuggggggcuuauacucggagugcauuacugcuuuagaccguuaaucucaagaa ccaugugugucgcauggggaggauuaacggcgcccaauucccuuguuaguuuagguacgccuuggucu ucgaaccacgc
[0096] The polynucleotide sequence of an iRNA identified in maize (sometimes referred to herein as“iRNA relative 3” or“iRNA r3”) is presented below (SEQ ID NO: 22): gggguaaauauggagaaccagcacacccauguuugcccacggucguuccugcgaaccugcagggcgau ccucgcggcuccagccaacuacggucgugauguggucaaaaucgccuacaaaugggcaucacgaaacc ccgccaccgccccccgaaguguccgagaauccaucggggucguugucggaagcgcuguggacuucuug agcgcuccucgcaagcguuuagaagaccgcgcagagcaguuggugcaagacgaccgggucgaccggau cguccgcgagugggagcuaggaaccgcugacucccgaauuccggaaguugagugggcauaccgucugc gcgaccgcuucggcgucguguccgccagcgagccugcuaggcaaacuggugagaggugggugcucaag caacuagagggauuggaggggggggaguuccgcugcauacccauugagccauucuuuggugaugcacc ggcccccguccauagcccugggagcaacagcgugauugcugcuauugcggcgacccuuuggaugacgc cuacccqccuuqaccqqqcquuqaqacqucaccaqqquuuucqcaacuaqcqquqaucqqaqucgacg qaququcuqcuuuaqcqquqcaqqcaucuucuqaacuccgaccqcuacqqquuqqqcqaccccqucaa agucgacgucguucguggucucugacuaugccagcacccaaguccuguuucgugaaccacgcuaacuc ugaccacaaucucaaaacggucauggaaaacagggugcucaaguacaaaggccaagaacccgcaaagc cccqqquaqaaqccuauaaqcaqcucuauqaaaqqauacqaccqcqauaucguucucuaccuqacacq gucuauccucuaucauaugauggcuuccucaagugcuacuccggacguaggcgaacacgauacgaaca ggccguccaggaguugagaaacgcgccacucacacccgaagaugcugucguuuccacguucaucaaga acgaqaaauucqauuqqcuccaaaaqaaaqaacuuqcqqaucccaqaqcuauccaaccucqqaaaccq aaauaccuqqccqaaquuqqqaqqugguucaaqccucuqqaqcacauaauquauaaaqacuuqqcaaa acgguuguacggucaggaugcguugccuugcauagcgaaagggcugaacgcuagagaaacggcugaag uqcuccgaqccaaauqqqacaaquucqcuucucccquuuqcqucucqcuqqauqccaqucqquucqau cugcauguaaguccugacgcauugcgguuuacgcaccgccuguaccacaaguauugccaaagucggca acuccgcaaguaccuagaauggacgcugagaaacgcuggcgucgccucauguccugaaagcgcuuauc aguaugagguugaggggagacgcaugaguggcgacauggacaccgcacucggcaacugcguacuuaug cucugcuugacauggaacuuccucgaucaacauaacaucaagcaugagauaauggacaacggagauga cugcuuguucaucugugaagcugccgaugugccaaccgacaagcaaaucauggacuacuaccucgacu uuggguucgugguucgguuggaaggaaaggugucuguguucgagcgaauagaguucugucaaaccagu ccgguguugacugcuaauggauggcguaugguuagaaauuugaaguccauugcgaaggaccucugcaa ugugaacauggcgacugggucacucagugaauacacugcguggcuuaaagccgugggaaucuguggua gaauccugaacgaugggguuccaaucuucuccgccuuccacaacaugcuggugcgacauggaacgaac ucacgaauagauagagcgguguucugggaauguggacugacaaacuugaucaaaggcaugaguuucga gcaacuggaaaucacugucgcugcgcgcgaguccuuuuaucuggcauacgguaucacaccggcgagac aacucgcgauugaagaguauuacgacucacuccagggcccgguggguaaaauacaacuucaugaaugg ccacuacaacucaaagaggaauacgcgugcggcgccgagugguucgaaggagacggcgagcgggcuug aggcccgcuggcuugcccuucgugcccggcagcucucgcacgguucggacugcgcucguccucgagaa ccacuugccgauguccucggcacaguugggucaagaggccguugcguauucuaucccgugcaauguuc gaaacaugccuacgauccugacucucgccaccacuccgcucuauuggcguaucaccgccaucacuguc gcgauggagccugcaaaguccacaucgacccaaauugccgguguggggaaugcugauucauuucaguc uqccaccuacaacqquuuuqqgaacguquuuaaqaaaauqcqcqcuuuqaauuucquqaqacqcucqq cgcccggaggcaaucuucagguacgcuggccuaucaauauggacuggaucuccgcauccgacacggac aaggauagcacaaaagugcccucgcuauucuuugccgugaccaacccaggugugaucgaaaccaaaca aqqqqacaquqaqqccuqquuqqaauqqqaquuqqaqcuqqaquacauaquuqqaqqcuaqgaacgac ugcccgcuugagaucgacucucccguggugagguaccacccacucagcugugucagccgguuggagaa acucuqquqcqauagcacuguuqqccccuqccuaqcququqcuquqqqaaaqccccaacagauuugug aaacacuggaguugucgacccgcgagacgugcggcucgaguugucgcuuccccgugaggggggcugcc gggggguagagaaauauucccgguauuuauccgcuaagaccuacgcgcgacgaaacuggcg
[0097] Note that iRNA relatives (e.g., iRNA rl, iRNA r2, and iRNA r3) may comprise conserved polynucleotide sequence(s) (bolded and underlined above): auagcacug (SEQ ID NO: 4); and/or gauuuguga (SEQ ID NO: 5). For example, the iRNA molecule comprises both of conserved polynucleotide sequence(s): auagcacug (SEQ ID NO: 4); and gauuuguga (SEQ ID NO: 5).
[0098] In addition, iRNA relatives (e.g., iRNA rl, iRNA r2, and iRNA r3) may comprise conserved polynucleotide sequence(s) (bolded and underlined above): cguuc (SEQ ID NO: 10); gaacg (SEQ ID NO: 11); gguuca (SEQ ID NO: 12); ggag (SEQ ID NO: 13); and/or aaauggga (SEQ ID NO: 14). For example, the iRNA molecule comprises all of conserved polynucleotide sequence(s): cguuc (SEQ ID NO: 10); gaacg (SEQ ID NO: 11); gguuca (SEQ ID NO: 12); ggag (SEQ ID NO: 13); and aaauggga (SEQ ID NO: 14)
[0099] Further, iRNA relatives (e.g., iRNA rl, iRNA r2, and iRNA r3) may comprise conserved polynucleotide sequence(s) (bolded and underlined above): ucgacg (SEQ ID NO: 15); and/or cuccga (SEQ ID NO: 16). The iRNA molecule may comprise both conserved polynucleotide sequence(s): ucgacg (SEQ ID NO: 15); and cuccga (SEQ ID NO: 16). In some embodiments, the iRNA molecule are highly related to CYVaV (or to iRNA rl, iRNA r2, or iRNA r3), and comprise a polynucleotide sequence having 70% or more identity for the recoding site for synthesis of RdRp thereof, e.g., 75% or 85% or 90% or 95% or 98% identify of the RdRp of CYVaV (or of iRNA rl, iRNA r2, or iRNA r3).
[00100] Thus, in accordance with disclosed embodiments, an RNA vector (e.g., derived from an iRNA molecule) comprises a frameshift ribosome recoding site for synthesis of the RNA-dependent RNA polymerase (RdRp). In addition, the RNA vector may include a 3’ end comprising a polynucleotide sequence that terminates with three cytidylates (... CCC). The penultimate 3’ end hairpin may also contains three guanylates in the terminal loop (... GGG... ). Further, the 3’ CITE includes an extended hairpin or portion thereof that binds to Eukaryotic translation initiation factor 4 G (eIF4G) and/or Eukaryotic initiation factor 4F (eIF4F).
[00101] in certain embodiments, an RNA vector comprises a 3’CITE comprising conserved sequences auagcacug (SEQ ID NO: 4) and gauuuguga (SEQ ID NO: 5). The RNA vector may also comprise one or more of the following polynucleotide sequences (conserved sequences of identified iRNA molecules): cguuc (SEQ ID NO: 10) and gaacg (SEQ ID NO: 11); and/or gguuca (SEQ ID NO: 12) and ggag (SEQ ID NO: 13); and/or aaauggga (SEQ ID NO: 14). Alternatively, or in addition, the RNA vector may comprise one or both of the following polynucleotide sequences (conserved sequences of identified iRNA molecules): ucgacg (SEQ ID NO: 15) and cuccga (SEQ ID NO: 16).
[00102] Identified iRNA relatives all have inserts in the 3’UTR and other nucleotide changes that result in the generation of an ORF that encodes a protein (p21.2) of unknown function. One differentiating characteristic of iRNAs such as CYVaV from any plant virus (Fig. 2) is that iRNAs do not encode any movement protein(s), which is characteristic of all known plant viruses including umbraviruses. Nor do iRNAs such as CYVaV require any helper virus for systemic movement through plants, including tested citrus and Nicotiana benthamiana (a laboratory model plant).
[00103] In contrast, PEMV2, as with all umbraviruses, encodes for two movement proteins: p26 (long-distance movement) and p27 (cell-to-cell movement) (Fig. 3, Panel A). p26 is also a stabilization protein that protects the genome from nonsense mediated decay, and is required for accumulation at detectable levels of PEMV2 in single cell protoplasts (Gao, F. and Simon, A.E. (2017), Differential use of 3 ' CITEs by the subgenomic RNA of Pea enation mosaic virus 2, Virology 510: 194-204). Umbraviruses are unusual viruses as they do not encode a coat protein or RNA silencing suppressor, but rather rely on a helper virus for these functions. For PEMV2, the helper virus is the enamovirus PEMV1.
[00104] The polynucleotide sequence of PEMV2 is presented below (SEQ ID NO:23): ggguauuuau agagaucagu augaacugug ucgcuaggau caagcggugg uucacaccug acuucacccc uggcgagggc gugaagucua gagcucaacu ggaaagagag cuggauccca ccugggcgcu ucucgugugc caagaacgag cgcgucguga ugcugacagu auugcuaaug agugguacga gggcagcaug gagugcaacc uccuuauccc ucggcccaca accgaggaug uauuuggccc cuccaucgcc ccugagccug uggcucuagu ggaggaaacu acccguuccc gcgcgccgug cguggauguc ccugccgagg aguccuguaa gucagcggag auugauccug uugaucucgc caaguucgac ucccuccauc gucgccuguu ggcugaagcc aacccuugca gggaaauggu ucugugggug ccuccuggcc uaccagcaga gcgcgacguc cugcccaggg cacguggggu gauaaugauc cccgaagucc cugccucugc acauaccuug uccgugaagg uuauggaggc ugugcgguug gcacaggaag ucuuggcauc ccuugccaag agggccuuag agaaaagguc uacaccaacc cuuaccgccc aggcccagcc agaggcuacc cugucggggu gcgacuaccc guaucaggag acuggagcag cagccgcgug gauaacgccu ggcugcauug ccauggagcu cagagccaaa uuuggcgucu gcaaacgcac ccccgcaaac uuagagaugg ggagucgcgu cgcccgcgag cuccugcggg auaacugugu cacuugcagg gagaccacgu gguacaccag ugccauugcu guggaccugu gguugacccc gaccgucguc gaccuggccu guggccggcg agcggcggau uuuugguagg ggcugugcug ccucggcugg gggaagacac cagugugcgg uuugacaacc ugcaccccag caucgaggua aucaaggcgg cuaggccccg cccaacccag aggaugucgu uccaaaucga cguugugcgu ccucuuggag auuuuggugu gcacaacaac ucccuuguua accuagccag gggaauuaau gaaagggugu ucuacacgga caaugcuagg acagaacccc uccagccuaa gguucccuuc cccucaucac gggagcuaaa aaccuucaga gucaccccuu ggaccaugga uaggguugug gagaguuaca caggguccca gcgcacucgc uaugcuaacg cgcgggacag cauauuaucc aacccucuga gucccaaaga ugcgcggguc aagacguuug ucaaagcuga aaagauaaau uucacagcca aaccugaccc cgccccucgu gugauacagc cuagggaucc acgauucaac auuguccugg cuaaauacau caagccuuug gagccaaugu uguacaaagc acuggggaaa cuuuacaagu accccgcagu ugcuaagggg uuuaacgcgg uugagacggg ggagaucauc gccggcaagu ggcggugcuu caaagauccu gucgucgugg gauuagacgc uucccgauuu gaucagcaug uaucugucga ggcguugcag uucacccacg cgguguacag aggguucauc aagucacggg aguuuaacaa ccuccuacag augauguaca ccaaccgugg ccuagggucc gcuaaggacg gauucguccg uuacaagguu aaagguagac gcaugagcgg ugacauggac accuccuugg gcaacugugu gcucauggug uugcucacca ggaaccuuug caagguucua ggcaucccgc acgagcucuu caacaauggu gaugauugca ucgucuuuuu cgaucguugc cacuuggaga aguucaacaa ugcugucaag acuuauuuug cggaccuagg guuuaagaug aagguggaac cgccgguuga cguguuggag aaaauagagu ucugccaaac gcagccuauc uaugacgggg agaaguggcg caccgugcgu ugcaucucga guaucggaaa agauugcuca uccguuauua guugggacca auuggagggg ugguggaaug ccaucgccca gaguggucug gcugugugug gcggaaugcc gauauacacg ucguucuacc gguggcuagc acgggccggu aagaguggga ccaaguguca gucacacccc uuguggaaaa acgagggguu gaauugguac aggaugggga uggaccuuuc ucaugagguu aauguuaccc cucaggcgcg ccugucuuuc uucgcggguu uugguauuuc ccccccgaug caggucgcca uugaggcgcu guaugacaag cugccuccac cgucccccca ccaugguccu ccgguuaagg cuguaacaca gcgaguguuc accaauuauu ucacgccgga aagcgccugu guuagcauga gcacgaauga agacaacaaa ucugacuuug cuguuuacgg cccugugccu acagugaugu cucuuugugc ucaguguuag gcucuuaaau uuuagcgaug gcgugacacg guuacacccu gaauugacag gguacagauc aagggaagcc ggggagucac caacccaccc ugaaucgaca gggcaaaaag ggaagccggg caccgcccac guggaaucga ccacgucacc uuuucgcguc gacuaugccg ucaacacccu uucggcccgc cagccuagga caauggcggu agggaaauau augacqauaa ucauuaaugu caauaacgac gagcgcaagc aaccagaagg agcuacuggc agcucuguac ggcgagguga caauaaaaga acucgaggaa acaaaccucg gagucaucac cccgguucgc gcgaacgaaa agguuacaau caccccucuc cuacccccaa aaacucaaag cagggucagc uccguacuga agcgguucag gagcacccga aacacggggg gacugcuuuc cguagagaaa guggugguag uguucacccc ucacaucccc gacgacgugc uaggagaggu ggagauaugg cuccacgaca gcauccuccc ccaccucggg agcgucggac caagacugaa acucaagcug agcgaagggc ccaagcucuu agcguucuac ccacccuacu cgauugcauu gggggacucg aucucgggcc agccgagguc cuucuccauu gucaccgagc uguucgaagg caacuucgca ccggggugca gcccauucag ccuguuccuc auguggaguc cacgcaucga agcagugacc cacaacuacu ugagucgucc accacgugcu cugccaauuu gcagaacgau ggugcgggac gcguuaucgg agguggcauc ccaacagcaa uaccugaagg gagcgauguc gaacagguau gccaugccuc ucacuacggg ugauggccag cauagagcca ugaagggggc ucccagugcc cuuccaccaa cgggggugug uacccaggcu ucuaagugag gcuucgcuuc ccgccggaag accgcggcgg uucuguuccu cccacaggag uacggcaaca acccaccuug ggaaaguggg gaccccagca cuaacuccuu uaacuaggcg ggcguguugg uuacaguagg aggggacagu gcgcaucgaa acugagcccc accacaacuc ucauccacgg ggugguuggg acgcaggugu cggagggauc gccagcccuc aggauaguga gcucccgcag agggauaagc uaucucccug cgacguagug guagaacacg ugggauaggg gaugaccuug ucgaccgguu aucggucccc ugcuccuucg agcuggcaag gcgcucacag guucuacacu gcuacuaaag uugguggugg augucucgcc caaaaagauc acaaacgcgc gggacaaggu cccuuccacc uucgccgggu aaggcuagag ucagcgcugc augacuauaa cuugcggccg auccaguugc acgacuggug gucccccuca gugucucggu ugucugccga gugggcggug gucggauucc accacacccu gccacgaggu gcguggagac uuggccaguc uaggcucguc guaauuaguu gcagcgacgu uaaucaaccc guccgggcau auaauaggac cgguugugcu ucuuccuccc uucuuagcca ggugguuacc ucccuggcgc cc
[00105] The polynucleotide sequence of the intergenic plus region of PEMV2 (bolded and underlined above) is presented below (SEQ ID NO:24): guuagcauga gcacgaauga agacaacaaa ucugacuuug cuguuuacgg cccugugccu acagugaugu cucuuugugc ucaguguuag gcucuuaaau uuuagcgaug gcgugacacg guuacacccu gaauugacag gguacagauc aagggaagcc ggggagucac caacccaccc ugaaucgaca gggcaaaaag ggaagccggg caccgcccac guggaaucga ccacgucacc uuuucgcguc gacuaugccg ucaacacccu uucggcccgc cagccuagga caauggcggu agggaaauau aug
[00106] The polynucleotide sequences of recoding frameshift sites of PEMV2 (bases 881 to 1019; see also Fig. 10) is presented below (SEQ ID NO: 25): gaccgucgucgaccuggccuguggccggcgagcggcggauuuuugguaggggcugugcugccucggcu gggggaagacaccagugugcgguuugacaaccugcaccccagcaucgagguaaucaaggcggcuaggc ccc [00107] CYVaV unexpectedly replicates very efficiently in Arabidopsis thaliana protoplasts despite not encoding p26 (or any other movement protein), which is required for accumulation of PEMV2 because of its ability to also counter NMD. Indeed, CYVaV was unusually stable, much more stable than most traditional viruses. CYVaV also produced an astonishingly high level of p81 in wheat germ extracts, at least 50-fold more than the p94 orthologue from PEMV2 (Fig. 3, Panel C). When CYVaV was agro-infiltrated into leaves of Nicotiana benthamiana, it replicated in the infiltrated tissue but accumulation was relatively weak (Fig. 3, Panel B, top; Fig. 5, lanes 6-8). No replication was achieved with manual inoculation. However, when CYVaV was co-infiltrated with the enamo virus Citrus vein enation virus (CVEV), accumulation improved substantially in these cells (Fig. 5, lanes 3-5; see also Fig. 6). However, yellowing symptoms of CYVaV + CVEV (Fig. 7, Panel B) were more vibrant as compared to symptoms exhibited by CYVaV alone (Fig. 7, Panel A).
[00108] CYVaV had no synergistic effect with any other combination of citrus virus tested. Additional studies showed that CVEV may be utilized as a helper virus for CYVaV in order to allow for transmission from tree to tree. CVEV was likely responsible for the presence of CYVaV in the original limequat trees; however, CVEV is known to be very heat sensitive and thus was likely lost from the limequat trees during a hot summer.
[00109] CYVaV moved sporadically into upper, uninoculated leaves and accumulated at extremely high levels, sometimes visible by ethidium staining on gels. Symptoms that began in the ninth leaf of the major bolt comprised stunting, leaf curling, and deformation of floral tissue. Leaves in axillary stems also began showing similar symptoms around the same time. This astonishing result demonstrated that CYVaV moves systemically in the absence of any encoded movement protein(s), which is not possible by traditional plant viruses. Experiments showed that CYVaV moves systemically in N. benthamiana and is strictly confined to the phloem, replicating only in companion cells and phloem parenchyma cells. In citrus, CYVaV is 100% graft-transmissible, but difficult to transmit in other forms.
[00110] Fluorescence in situ hybridization (FISH) of symptomatic leaf tissue and roots confirmed that CYVaV is confined to phloem parenchyma cells, companion cells and sieve elements (Fig. 8, Panels A-G), which is characteristic of a phloem-limited virus. CYVaV levels were extremely high in the petioles of symptomatic tissue and sometimes visible in ethidium- stained gels of total RNA. Although symptoms are more severe in N. benthamiana, CYVaV has been found to be virtually symptomless in all varieties of citrus tested. Indeed, the most severe symptom was found on citron, the indicator tree for citrus viruses, and consisted of very minor gold flecking on leaves scattered throughout the tree.
[00111] Phloem-limited movement of CYVaV explains why it is readily graft- transmissible, but not transmissible by any other means. CYVaV lacks any encoded movement protein(s) as noted above. Instead, CYVaV utilizes the host plant’s endogenous movement protein(s) and pathway for transiting between companion cells, phloem parenchyma cells, and sieve elements. In addition, since host range is believed to involve compatible interactions between viral movement proteins and host plasmodesmata-associated proteins, it is believed that CYVaV is capable of transiting through the phloem of numerous other woody and non- woody host plants using such host’s endogenous movement protein(s). As such, CYVaV provides an exceptional model system for examining RNA movement (e.g., in N. benthamiana and/or citrus) and for use as a vector for numerous applications. Experiments confirmed that CYVaV moves systemically in a host plant and is limited to the phloem, and is readily graft- transmissible but not transmissible in other forms.
[00112] Citrus trees have a complex reproductive biology due to apomixis and sexual incompatibility between varieties. Coupled with a long juvenile period that can exceed six years, genetic improvement by traditional breeding methods is complex and time consuming. The present disclosure overcomes such problems by providing an iRNA-based (e.g., CYVaV - based) vector engineered to include therapeutic inserts using RNAi and CRISPR/Cas9. iRNAs such as CYVaV are unique among infectious agents given they encodes a polymerase yet move like a viroid using host movement proteins, and thus are capable of transiting through plants other than citrus. Thus, in addition to citrus, the iRNA-based vectors of the present disclosure may be developed for other woody plants (e.g., trees and legumes), and in particular olive trees and grapevines.
[00113] In accordance with disclosed embodiments, CYVaV is utilized in the development of a vector for delivery of small RNAs and proteins into citrus seedlings and N. benthamiana. The procedure utilized for CYVaV vector development was similar to that utilized by the present inventors for engineering betacarmovirus TCV to produce small RNAs (see Aguado, L.C. et al. (2017), RNase III nucleases from diverse kingdoms serve as antiviral effectors, Nature 547: 114-117). Exemplary and advantageous sites for adding one, two, three, or more small RNA inserts designed to be excised by RNase Ill-type exonucleases were identified. A small reporter RNA was expressed directly from the genome that targets phytoene desaturase, which turns the targeted tissue white.
[00114] In accordance with disclosed embodiments, vectors disclosed herein may include small RNAs with various functionality including: small RNAs that target an essential fungal mRNA; small RNAs that target an insect vector(s) for death or sterility; and small RNAs that target CVEV (as this virus together with CYVaV cause enhanced yellow-vein symptoms). In addition, the disclosed vectors may include other small RNAs and/or therapeutic agents known in the art. Thus, a phloem-restricted iRNA-based vector may be engineered to produce small RNAs that have anti-fungal and/or anti-insect and/or anti -viral properties, which provides for a superior treatment and management strategy compared to current methodologies.
[00115] CYVaV vectors may be applied manually to infected or uninfected trees by cutting into the phloem and depositing the vector either as RNA, or by agroinfiltration, or after encapsidation in the coat protein of CVEV, following citrus inoculation procedures well known to those of skill in the art, e.g. such as procedures developed and used routinely under the Citrus Clonal Protection Program (CCPP). Such procedures are routine for inoculation of CTV and other graft-transmissible pathogens of citrus. Since CYVaV does not encode a capsid protein, no virions are made and thus no natural tree-to-tree transmission of CYVaV is possible. When CYVaV is encapsidated in CVEV coat protein, no other component of CVEV is present.
[00116] As noted above, CYVaV has only two ORFs: a 5’ proximal ORE that encodes replication-required protein p21; and a frame-shifting, ribosome recoding element that allows ribosomes to continue translation, extending p21 to produce p81, the RNA-dependent RNA polymerase. The organization of these two ORFs is similar to the organization of similar ORFs in viruses in the Tombusviridae and Luteoviridae. However, all viruses in these families, and indeed in all known plant RNA viruses, encode movement proteins or are associated with a secondary virus that encodes a movement protein(s). The ability to encode movement proteins, or associate with a second virus that encodes a movement protein(s), had long been considered a requirement for movement from cell-to-cell and also for transiting through the phloem to establish a systemic infection. As such, the use of iRNAs as vectors had not been proposed, and indeed iRNA molecules were previously considered unsuitable for use as an independent vector due to the lack of any encoded movement protein and belief that they were not independently mobile.
[00117] As such, the capacity for independent systemic movement of iRNAs throughout a plant’s phloem despite not coding for or depending on any exogenous movement protein(s) is thus quite surprising. The CYVaV-based vectors of the present disclosure unambiguously and repeatedly demonstrated (via fluorescence in situ hybridization and other techniques) systemic movement without the aid of any helper virus. Y oung, un-infiltrated (systemic) tissue displayed highly visible symptoms on N. benthamiana, including leaf galls and root galls. The disclosed vectors utilize endogenous host movement protein(s) for mobility. In this regard, host phloem protein(s) (25 kDa phloem protein 2 (PP2) and/or 26 kDa Cucumis sativus phloem protein 2-like) known to traffic host RNAs into sieve elements (see Balachandran, S. el al. (1997), Phloem sap proteins from Cucurbita maxima andRicinus communis have the capacity to traffic cell to cell through plasmodesmata, PNAS 94(25): 14150-14155; Gomez, G. and Pallas, V. (2004), A long-distance translocatable phloem protein from cucumber forms a ribonucleoprotein complex in vivo with Hop stunt viroid RNA, J Virol 78(18): 10104- 10110) were likely shown to interact with CYVaV using Northwestern blots. Thus, since known plant viruses encode (or are dependent on) a movement protein, iRNAs are quite different structurally and functionally from traditional plant viruses.
[00118] In addition to CYVaV, other RNAs of similar size and that encode a polymerase may be utilized in the develop of similarly structured iRNA-based vectors (see, e.g., Chin, L.S. et al. (1993). The beet western yellows virus ST9 -associated RNA shares structural and nucleotide sequence homology with Tombusviruses. Virology 192(2):473-482; Passmore, B.K. et al. (1993). Beet western yellows virus-associated RNA: an independently replicating RNA that stimulates virus accumulation. PNAS 90(31): 10168-10172). As noted above, other iRNA relatives (e.g., iRNA rl, iRNA r2, and iRNA r3, identified in Opuntia, Fig trees, and Ethiopian com, respectively) and that encode proteins p21 and p81 (Fig. 4) may be utilized for vector development.
[00119] Although CYVaV is present in the GenBank database (GenBank: JX101610), iRNAs do not belong to any known classification of virus given they lack cistrons that encode movement proteins. Nor are iRNAs dependent on a helper vims for systemic movement within a host. Moreover, iRNAs lack cistrons that encode coat proteins. iRNAs are also dissimilar to viroids, although both are capable of systemic movement in the absence of encoded movement proteins. Viroids are circular single stranded RNAs that have no coding capacity and replicate in the nucleus or chloroplast using a host DNA-dependent RNA polymerase. The vast majority of the tiny viroid genome, typically including about 300 to 400 nucleotides (nt), is needed for the viroid’s unusual existence. In addition, viroids do not code for any proteins, which makes them unsuitable for use as vectors. In contrast, iRNAs code for their own RNA-dependent RNA polymerase (RdRp).
[00120] iRNAs may be categorized in two classes: a first class is characterized by a frameshift requirement to generate the RdRp and RNA structures proximal to the 3’ end that resemble those of umbraviruses. A second class is characterized by a readthrough requirement to generate the RdRp and 3’ RNA structures that resemble those of Tombusviruses. CYVaV is a member of the first class with properties similar to umbraviruses including a frameshifting recoding site and similar structures at the 3’ end, and similar sequences at the 5’ end. iRNA members of the second class have always been discovered in association with a helper virus.
[00121] iRNAs provide a number of benefits as compared to conventional viral vectors. For example, iRNAs are relatively small, making them easier to structurally and functionally map and genetically manipulate. In contrast, viruses such as CTV are 8-fold larger, making them more cumbersome to use as a vector. iRNAs can replicate and accumulate to unexpectedly high levels (e.g., visible by ethidium staining on gels and 4% of reads by RNAseq), which is critical for the vector’s ability to deliver a sufficient amount of therapeutic agent(s) into the target plant. In addition, iRNAs are much more stable than many viruses despite not encoding a coat protein or silencing suppressor (Fig. 13), which allows for a long lifespan in the host plant and thus provides benefit over an extended period.
[00122] iRNAs are also limited to the host’s phloem, which is especially useful for targeting pathogens that either reside in, or whose carriers feed from, or whose symptoms accumulate in, the phloem since the payload will be targeted to where it is most needed. By moving independent of movement proteins (whose interactions with specific host proteins is the primary factor for determining host range), iRNAs are able to transit within a broader range of hosts, thereby increasing the applicability of a single vector platform. Given the lack of coat protein expression and the dispensability of a helper virus for systemic plant infection, iRNAs cannot be vectored from plant-to-plant and instead must be introduced directly into the phloem via grafting. The lack of a coat protein prevents formation of infectious particles and thus unintended reversion to wild type infectious agents into the environment. This is particularly beneficial for streamlining regulatory approval as regulators are often concerned with the possible uncontrolled transmission of introduced biological agents. [00123] iRNAs are also virtually benign to their hosts, unlike viruses like CTV whose isolates can be highly pathogenic. Using a common virus as a vector, such as CTV, runs the risk of superinfection exclusion, where trees previously infected and/or exposed to that virus are not able to be additionally infected by the same virus acting as the vector (e.g., most citrus trees in the USA are infected with CTV). Thus, avoiding superinfection exclusion, at a minimum, requires additional steps to the process that makes it more expensive and cumbersome.
[00124] The present disclosure also provides for novel therapeutic, prophylactic, or trait enhancing inserts that are engineered into the iRNA vector. A variety of inserts are provided, including inserts that target a particular pathogen, an insect vector, or a manifestation of the disease(s). Alternatively, or in addition, inserts are provided that strengthen or improve plant health and/or enhance desired characteristics of the plant.
[00125] The disclosed infectious agents are capable of accumulation and systemic movement throughout the host plant, and can thus deliver therapies throughout a host over a substantial time period. Characteristics of the disclosed agents are therefore highly beneficial for treating numerous specific diseases. Using an infectious agent composed of either RNA or DNA has an additional advantage of being able to code for therapeutic proteins or peptides that would be expressed within infected cells and/or by engineering the infectious agent to contain a specific sequence or cleavable portion of its genetic material to serve as an RNA-based therapeutic agent.
[00126] Products with antimicrobial properties against plant pathogens can take a number of formats and are produced through ribosomal (defensins and small bacteriocins) or non-ribosomal synthesis (peptaibols, cyclopeptides and pseudopeptides). The best known are over 900 cationic antimicrobial peptides (CAPs), such as lactoferrin or defensin, which are generally less than 50 amino acids and whose antimicrobial properties are well known in the art. CAPs are non-specific agents that target cell walls generally, with reported effects against bacteria and fungi. CTV engineered with an insert designed to express defensin has received approval for release by the USD A in Florida, but its widespread efficacy is unknown. Moreover, the isolate of CTV used for the vector makes it unsuitable for trees growing in some regions (e.g., California).
[00127] RNA therapies that target viral pathogens are also in widespread development in plants. These therapies use non-coding small interfering RNAs (siRNAs), which are generated from the genome of the plant, and thus include genetic modification of the host. In addition to negative viewpoints of some growers and consumers to genetic modification of citrus trees, the length of time to generate genetically modified trees is measured in decades and may ultimately not have the same attributes (texture/color/taste) as varieties developed over decades, and thus is not a solution to current, time sensitive agricultural diseases, in addition to being very expensive to develop and potentially impacting the quality of the fruit.
[00128] Recently, highly targeted anti-bacterial enzymes have been developed for use in animals and humans as a replacement for current antibiotics. These enzymes are engineered from bacteriophage lysis proteins and are known as enzybiotics. As with the parental bacteriophage proteins, enzybiotics can lyse bacterial cell walls on contact, but are designed to be used external to both gram positive and gram negative bacteria. Enzybiotics are engineered to lyse only targeted bacterium, leaving other members of the microbiome unaffected. In some implementations, an iRNA vector is provided that includes a non-coding RNA insert that can be translated into an anti-bacterial protein like an enzybiotic.
[00129] In some implementations, an iRNA vector is provided that includes an RNA insert that interferes with the functionality of the insect vector at issue. Insects have an RNA silencing system similar to plants; small RNAs ingested by insects are taken up into cells and target critical mRNAs for degradation or blockage of translation within the insect. In some embodiments, a targeted insert is provided that is capable of silencing a critical reproductive function of the insect vector, resulting in sterilization of the insect. Of particular relevance are phloem-feeding insects that transmit phloem-limited pathogens, where a non-coding RNA insert into a phloem-limited vector is readily taken up by feeding insects.
[00130] In some implementations, an iRNA vector is provided that includes a non coding RNA insert that targets a plant response to a pathogen. In some cases, bacteria inserted by an insect vector does not directly damage the tree. However, the host tree produces excessive callose in their phloem in order to isolate the bacteria, which can ultimately restrict the flow of photoassimilates and kill the tree. Thus, the RNA insert silences and/or depresses such callose production.
[00131] Additional characteristics and features of the present disclosure will be further understood through reference to the following additional examples and discussion, which are provided by way of further illustration and are not intended to be limiting of the present disclosure.
[00132] CYVaV Structure. Full length structure of CYVaV was determined by SHAPE structure probing and phylogenetic comparisons with the CYVaV relatives in Opuntia, Fig and Com (Fig. 9). The recoding site (see Fig. 10) and the ISS-like (I-shaped structure) 3’CITE (see Fig. 11) are identified, along with a region for accommodating an insert is, for example, shown by boxed double line region and discussed in further detail with regard to exemplary locations for inserts.
[00133] The genome organization of CYVaV exhibits some similarities to other RNA molecules, particular PEMV2 (Fig. 3, Panel A). However, umbravirus PEMV2 also possesses ORFs encoding for proteins p26 and p27 involved in movement. Levels of CYVaV plus (+) strands in infiltrated N. benthamiana leaves and systemic leaves are shown in Fig. 3, Panel B. Levels of the RNA-dependent RNA polymerase (RdRp) synthesized by frameshifting in vitro in wheat germ extracts of full-length CYVaV and PEMV2 are also shown (Fig. 3, Panel C). Note the significant difference in levels of p94 from PEMV2 as compared to p81 polymerase produced by CYVaV. The frameshifting site of CYVaV is one of the strongest known in virology and believed to be responsible for its exceptionally high accumulation.
[00134] CYVaV is encapsidated in virions of CVEV. CYVaV or CVEV or CYVaV + CVEV were agroinfiltrated into leaves of N. benthamiana. CYVaV was encapsidated in virions of CVEV, and virions were isolated one week later and the encapsidated RNAs subjected to PCR analysis (see Figs. 5 and 6). Accumulation of CYVaV increased substantially in the presence of putative helper virus CVEV. rRNA loading controls are shown below. pl4 silencing suppressor was co-infiltrated in all leaves. Yellowing symptoms were slightly more severe in leaves with CYVaV + CVEV (Fig. 7, Panel B).
[00135] CYVaV is phloem-limited. Fluorescence in situ hybridization (FISH) imaging clearly detected plus strands of CYVaV, which was completely restricted to the SE, CC and PPC (Fig. 8).
[00136] CYVaV does not encode a silencing suppressor. N. benthamiana 16C plants were agroinfiltrated with a construct expressing GFP (which is silenced in these plants) and either constructs expressing CYVaV p21 or p81, or constructs expressing known silencing suppressors pl9 (from TBSV) or p38 (from TCV) (Fig. 13, Panel A). Only p!9 and p38 suppress the silencing of GFP, allowing the green fluorescence to be expressed (Fig. 13, Panel B). Northern blot probed with GFP oligonucleotide showed that GFP RNA is still silenced in the presence of p21 or p81 (Fig. 13, Panel C).
[00137] Replication of CYVaV in Arabidopsis protoplasts. An infectious clone of CYVaV was generated. Wild-type RNA transcripts (CYVaV) or transcripts containing a mutation in the recoding slippery site that eliminates the synthesis of the RdRp (CYVaV-fsm), and thus doesn’t replicate, were inoculated onto Arabidopsis protoplasts. RNA was extracted and a Northern blot performed 30 hours later. Note that inoculated transcripts of CYVaV -fsm were still present in the protoplasts at 30 hours (whereas in a traditional virus they would be undetectable after 4 hours).
[00138] Replication of CYVaV in N. benthaminana. Level of CYVaV accumulating in the infiltrated leaves of N. benthamiana was determined by Northern blot (Fig. 15, Panel A). Plants infiltrated with CYVaV sporadically showed systemic symptoms (Fig. 15, Panel B; see also Fig. 16). These plants accumulated high levels of CYVaV. Level of CYVaV in individual leaves of a systemically infected plant was determined (Fig. 15, Panel C). Leaves 4 and 5 were agroinfiltrated with CYVaV. Note the substantial accumulation of CYVaV in the youngest leaves.
[00139] Symptoms of N. benthamiana systemically infected with CYVaV. Leaves 4 and 5 were agroinfiltrated with CYVaV. The first sign of a systemically infected plant is a “cupped” leaf (Fig. 16), which was nearly always leaf 9. In the following few weeks, leaf galls emerged at the apical meristem and each node of the plant. Systemically infected plants also had root galls containing a substantial amount of CYVaV as evidenced by Northern plant blot.
[00140] CYVaV demonstrates an exceptional host range. Sap from a systemically- infected N. benthamiana plant was injected into the petiole of tomato (Fig. 17). One of four plants showed very strong symptoms and was positive for CYVaV by PCR. Plant shown is at 53 days post-infection with a plant of the same age.
[00141] CYVaV binds to a highly abundant protein extracted from the phloem of cucumber. Labelled full-length CYVaV binds to a prominent protein as demonstrated in the Northwestern blot (Fig. 18). Proteins were renatured after SDS gel electrophoresis. This protein is believed to be a known, highly conserved RNA binding protein containing an RRM motif known to chaperone RNAs from companion cells into sieve elements in the phloem of cucumber. No binding was seen when the proteins remained denatured after electrophoresis.
[00142] CYVaV can express an extra protein from its 3’UTR using a TEV IRES.
Location of three separate inserts of nanoluciferase downstream of the Tobacco etch virus (TEV) internal ribosome entry site (IRES) were identified (Fig. 19). Invitro translation in wheat germ extracts of the three constructs was evaluated. Location of the nanoluciferase protein (Nluc) is near the bottom of the gel. Expression of nanoluciferase in protoplasts in vivo was investigated (Fig. 19, Panel C). Full-length RNA transcripts of the constructs shown in (A) were transformed into protoplasts. 18 hours later, total protein was extracted and nanoluciferase activity measured in a luminometer.
[00143] Exemplary locations for stable hairpin inserts at positions 2250, 2301 and 2319 were evaluated. The location for each of the inserts falls within an exemplary region noted above (see Fig. 9). Wheat germ extract in-vitro translation assay of T7 transcripts from CYVaV-wt, and CYVaV VIGS vectors containing different amounts of sequence at position 2250 was conducted (Fig. 20). For example, construct sfPDS60 demonstrated excellent systemic movement in plants. Wheat germ extract in-vitro translation assay of T7 transcripts from CYVaV-wt, and CYVaV VIGS vectors containing different amounts of sequence at positions 2301 and 2319 was conducted (Fig. 21). Northern blot analysis of total RNA isolated from A. thaliana protoplasts infected by CYVaV wt and CYVaV VIGS vectors. CYVaV-GDD and negative control was conducted (Fig. 20, Panel D). Northern blot analysis of total RNA isolated from A. thaliana protoplasts infected by CYVaV wt and CYVaV VIGS vectors. CYVaV-GDD and negative control was conducted (Fig. 21, Panel D). Constructs CY2250sfPDS60, CY2301PDS60, CY2301sfPDS60, CY2319sfPDS60 (including inserts at positions 2250, 2301, 2319, respectively) all demonstrated excellent systemic movement with insertion. In addition, constructs CY2331PDS60 (including inserts at position 2331) also demonstrated the ability to move systemically throughout the host. A further construct, CY2083TAAPDS60, includes an insert at position 2083, which location is in the RdRp ORF (preceded by an inserted stop codon).
[00144] The sequences of the insertion regions (underlined below and as shown in Fig. 20, Panel G, and Fig. 21, Panel G) of the vector collected from systemic leaf is presented below: taqqcctcqacacqqqaaqqtaqctqtcccqqcactqqqttqcacatattccqtqcc qacqccac (SEQ ID NO: 26) ccggcctcgacacgggaaggtagctattccgtgccgacgccgt (SEQ ID NO: 27)
[00145] iRNA-based Vector Platform
[00146] In one embodiment, an iRNA-based vector is provided for treating disease in the citrus industry caused by CLas bacteria (HLB). An isolate of CYVaV is utilized as a vector to target both the bacteria and the psyllid insects that deliver the bacteria into the trees. As discussed above, CYVaV is limited to the phloem where it replicates and accumulates to extremely high levels comparable to the best plant viruses. In addition, its relatively small size makes it exceptionally easy to genetically engineer. Thus, consideration of the structure and biology of CYVaV aided in the development of this novel infectious agent as a vector and model system for phloem transit.
[00147] The structure of the 3’UTR of CYVaV was determined based on SHAPE RNA structure mapping (Fig. 9). In addition, a number of replication and translation elements were identified based on biochemical assays, as well as phylogenetic conservation (with umbraviruses) of their sequence and/or structure and position (Fig. 19, Panel A). An I-shaped element was also identified that serves as a cap-independent translation enhancer (3’CITE). A series of long-distance kissing-loop interactions (double arrows) were also identified, which are believed to be involved in stabilizing the RNA and accumulation in the absence of a silencing suppressor. Based on this structure, a number of areas were identified as suitable locations for sequence insertion, which should not disturb the surrounding structure.
[00148] Certain sites have been identified for potential inserts in the 3’ UTR and the RdRp ORF that can accommodate RNA hairpins, e.g., for generation of siRNAs that target feeding insects, sites that accommodate reporter ORFs and still allow for replication of an engineered CYVaV in agro-infiltrated N. benthamiana, and sites that trigger high level translation of reporter proteins in vitro. An engineered CYVaV incorporating the added ORF and siRNAs is introduced into a storage host tree, and then pieces thereof are usable for straight-forward introduction into field trees by grafting. Given the rarity of CYVaV (to date, it has only been identified in the four limequat trees by Weathers in the 1950s), there is little risk of superinfection exclusion.
[00149] Various insert locations were identified wherein replication or translation properties of the vector were not significantly reduced or eliminated. Insert locations adversely affecting such properties (likely due to disrupting the RNA structure or other important aspect of the CYVaV vector) were not pursued further. Four exemplary insert locations on the CYVaV-based vector were identified at positions 2250, 2301, 2319 and 2331. 50 nt hairpin inserts were successfully deployed in these locations with no disruption to translation in vitro or replication in protoplasts and CYVaV was able to move systemically in N. benthamiana.
[00150] Although CYVaV has no additional ORFs, both genomic (g)RNA and a subgenomic (sg)RNA of about 500 nt are detectable using probes to plus- and minus-strands. Investigation of the region that should contain an sgRNA promoter revealed an element with significant similarity to the highly conserved sgRNA promoter of umbraviruses and to a minimal but highly functional sgRNA promoter of carmovirus TCV. In addition, similar RNAs that also only express the RdRp and are related to Tombus viruses all generate a similar sized subgenomic RNA, and may simplify expression of peptides and proteins.
[00151] In order to determine where inserts are tolerated downstream of the sgRNA promoter in CYVaV, an evaluation of where critical elements exist in the 3’ UTR of CYVaV was conducted, so that such elements are avoided when inserting heterologous sequences. As described about, the 3’ CITE for CYVaV was identified, as well as several additional 3’ proximal hairpins that are highly conserved in umbraviruses and known to be critical for replication and translation. Using deletions/point mutations, the sequence downstream of the putative sgRNA promoter and upstream of the CAS (-120 nt) was investigated for regions that do not impact either accumulation in protoplasts or systemic movement in N. benthamiana. A similar strategy was previously utilized by the present inventors to identify regions in the 3’ UTR of TCV that can accommodate hairpins targeted by RNase Ill-type enzymes (Aguado, L.C. et al. (2017). RNase III nucleases from diverse kingdoms serve as antiviral effectors. Nature 547: 114-117).
[00152] After identifying suitable regions for accommodating deletions/mutations ( e.g . , regions not involved in critical functions), heterologous sequences of different lengths were inserted therein to evaluate CYVaV functionality with an extended 3’ UTR. Such investigation aids in determining maximal insert length to ensure that such insert will be tolerated by the CYVaV-based vector while still accumulating to robust levels and engaging in systemic movement. It is believed that the CYVaV-based vector may be able to accommodate an insert having a size of up to 2 kb. In this regard, the nearest related viruses (papaya umbra-like viruses, which like CYVaV, only encode a replicase-associated protein and the RdRp) are 1 to 2 kb larger, with all of the additional sequence length expanding their 3’ UTRs (Quito- Avila, D.F. et al. (2015). Detection and partial genome sequence of a new umbra-like virus of papaya discovered in Ecuador. Eur J Plant Pathol 143: 199-204). Various size sequence fragments were evaluated, beginning at 50 nt (the size of an inserted hairpin for small RNA production), up to about 600 nt (the size of an enzybiotic ORF). Initial small RNA fragments include a reporter for knock down of phytoene desaturase, which turns tissue white. The longer size fragments include nano luciferase and GFP ORFs, which may also be used as reporters for examining expression level. Inserts are made in constructs containing the wild-type (WT) sgRNA promoter and the enhanced sgRNA promoter.
[00153] Lock and Dock Sequence for stabilizing the base of inserts. Referring to Fig. 24, Panel A, the basic structure of the lock and dock sequence is shown. Tetraloop GNRA (GAAA) docking with its docking sequence generates an extremely stable structure. Sequences shown in Fig. 24, Panel A, are presented below: gaaa (SEQ ID NO: 28)
gauauggau (SEQ ID NO: 29)
guccuaaguc (SEQ ID NO: 30)
caggggaaacuuug (SEQ ID NO: 31)
[00154] The use of a scaffold comprising a docked tetraloop as a crystallography scaffold is provided (Fig. 24, Panel B). The sequence shown in Fig. 24, Panel B, is presented below: cauuagcuaaggaugaaagucuaugcuaaug (SEQ ID NO: 32)
[00155] A lock and dock structure in accordance with disclosed embodiments is shown in Fig. 24, Panel C. Inserts (hairpins or non-hairpin sequences) may be added to the restriction site at the identified additional insert location. Circled bases are docking sequences for the tetraloop. The sequence shown in Fig. 24, Panel C, is presented below: gcaccuaaggcgucagggucuagacccugcucaggggaaacuuugucgcuauggugc (SEQ ID NO: 33)
[00156] Stabilizing the local 3’UTR structure is detrimental; however insertion of a destabilizing insert nearby restores viability. Referring to Fig. 25, Panel A, a representation of CYVaV-wt is shown. CYVaV-wt 3’stb is the parental stabilized construct containing 6 nt changes converting G:U pairs to G:C pairs. Two insertions of 60 nucleotides were added to the stabilized parental construct at positions 2319 and 2330 forming CY2319PDS60_3’stb and CY2330PDS60_3’stb. Nucleotide changes made to stabilize the structure and generate CYVaV-wt 3’stb are circled in Panel B. The sequences shown in Fig. 25, Panel B, is presented below: ggcuaguuaaucucauucgugggauggacaggcagccugacguugac (SEQ ID NO: 34) guuaauguaggugucuuuccguaucuaguc (SEQ ID NO: 35) (unmodified G:U pairs) gucaacgcaggugccucjuccguaucuagcc (SEQ ID NO: 36) (converted G:C pairs)
[00157] Targets for Treatment and Management
[00158] An anti-biotic insert for delivery by the disclosed vector is provided, which comprises either an enzybiotic or small peptide engineered to destroy the CLas bacterium. Enzybiotics prefer sugar rich, room temperature environments such as found in the plant phloem. The enzybiotic is translated in companion cells during the engineered CYVaV infection cycle. Proteins produced in the cytoplasm of the phloem are naturally able to exit into the sieve element (the default pathway for translated proteins), where CLas and other plant pathogenic bacteria take up residence. In the sieve element, the enzyme molecules move with the photo-assimilate up and down the trunk and lyse any bacteria upon contact. Since enzybiotics are targeted towards a specific class of bacteria, they preferably do not disturb the microbiome of the host tree. Various agents that target CLas have been developed (e.g., Hailing Jin, University of California, Riverside, CA). Thus, numerous inserts that target CLas bacterium are known in the art and may be utilized with the CYVaV vectors of the present disclosure.
[00159] As a further embodiment, it can be beneficial to target multiple pathways for destroying the disease and the disease psyllid vector. As a result, in certain embodiments the disclosed vectors include the enzybiotic and/or peptides described above, as well as inserts that trigger the production of siRNAs that interfere with either gene expression of the tree or the disease-carrying psyllid. In the case of the ACP, the RNA could kill the vector or render it wingless and thus harmless.
[00160] CYVaV-based Vector Targeting Expression of Callose Synthase.
[00161] A vector comprising an RNA insert is provided that triggers the reduction of callose production and build-up in a host tree. A sufficiently large amount of the gene that produces callose in the phloem in response to bacteria is silenced via insertion of an siRNA sequence that is excised by the plant.
[00162] CYVaV-based vector may be utilized as a virus-induced gene-silencing (VIGS) vector to down-regulate expression of callose synthase in the phloem. VIGS has been widely used to down-regulate gene expression in mature plants to examine plant functional genomics (Senthil-Kumar el al. (2008). Virus-induced gene silencing and its application in characterizing genes involved in water-deficit-stress tolerance. J Plant Physiol 165(13): 1404-1421). A complementary sequence is inserted into CYVaV at a suitable location as identified above (either anti-sense or a RNase Ill-cleavable hairpin). A citrus version of the gene is known (Enrique et al. (2011). Novel demonstration of RNAi in citrus reveals importance of citrus callose synthase in defense against Xanthomonas citri subsp. citri. Plant Biotech J 9:394-407).
[00163] Callose is a b 1,3-glucan that is synthesized in various tissues during development and biotic and abiotic stress (Chen, X.Y. and Kim, J.Y. (2009). Callose synthesis in higher plants. Plant Sig Behav 4(6):489-492). Deposition of callose in the sieve plates of sieve elements inhibits photoassimilate flow in the phloem, leading to over accumulation of callose in chloroplasts, which contributes to the death of trees during bacterial infections such as HLB (Koh, H. et al. (2012). Silent information Regulator 2 (Sir2) and Forkhead Box O (FOXO) Complement Mitochondrial Dysfunction and Dopaminergic Neuron Loss in Drosophila PTE -induced Kinase 1 (PINKJ ) Null Mutant j Bio! Chem 287(16): 12750- 12758). All plants contain 12-14 callose synthase genes; one member of this gene family, CalS7 (Arabidopsis nomenclature), is mostly responsible for rapid callose deposition in sieve pores of the phloem in response to wounding and various pathogens (Xie et al. (2011). CalS7 encodes a callose synthase responsible for callose deposition in the phloem. Plant J 65(1): 1- 14). Complete inhibition of GSL7 impacted both normal phloem transport and inflorescence development in Arabidopsis (Barratt et al. (2011). Callose Synthase GSL7 Is Necessary for Normal Phloem Transport and Inflorescence Growth in Arabidopsis. Plant Physiol 155(1):328- 341). A CYVaV-based vector is utilized to down-regulate the N. benthamiana and orange tree orthologues of CalS7 in mature plants in order to investigate the consequences of reduced (but not eliminated) sieve plate callose deposition. Alternatively, or in addition, the vector provides for an insert that expresses a callose-degrading enzyme.
[00164] In some embodiments, an insert is provided that targets one or more virus and/or fungal pathogen. In some embodiments, a hairpin insert is provided that generates an siRNA that directly targets CVEV, since CVEV is known to slightly intensify the yellowing impacts of CYVaV and to enable transport of CYVaV between trees. In some embodiments, a hairpin insert is provided that targets CTV, since CTV is a highly destructive viral pathogen of citrus (second only to CLas). In other embodiments, an insert is provided that targets another citrus (or other) virus. In some embodiments, an insert is provided that targets a fungal pathogen(s), given such pathogen(s) is able to take up siRNAs from the phloem.
[00165] In some embodiments, the CYVaV-based (or other iRNA) vector includes an insert(s) engineered to modify a phenotypic property of a plant that emanates from gene expression in companion cells. In one implantation, an insert is provided that triggers dwarfism, so that the fruit is easier to harvest and growth space requirements are reduced. Additional and/or other traits may also be targeted as desired. The iRNA vectors of the present disclosure comprising 1, 2, 3 or more inserts demonstrate stability and functionality.
[00166] All identified publications and references mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication was specifically and individually indicated to be incorporated by reference in its entirety. While the invention has been described in connection with exemplary embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure as come within known or customary practice within the art to which the invention pertains and as may be applied to the features hereinbefore set forth.

Claims

What Is Claimed Is:
1. A plus-sense single stranded ribonucleic acid (RNA) vector comprising a replication element(s) and a heterologous segment(s), wherein said RNA vector lacks a functional coat protein(s) open reading frame (ORF) and a functional movement protein(s) ORF.
2. The RNA vector of claim 1, which comprises a 3’ Cap Independent Translation
Enhancer (3’ CITE) comprising the nucleic acid sequence(s) of SEQ ID NO: 4 and/or SEQ ID NO: 5.
3. The RNA vector of claim 2, wherein said 3’ CITE comprises the nucleic acid
sequence of SEQ ID NO: 3.
4. The RNA vector of any one of claims 1-3, wherein said replication element(s)
comprises one or more conserved polynucleotide sequence(s) having the nucleic acid sequence of: SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, and/or SEQ ID NO: 14.
5. The RNA vector of any one of claims 1-4, wherein said replication element(s) further comprises one of more conserved polynucleotide sequence(s) having the nucleic acid sequence of: SEQ ID NO: 15 and/or SEQ ID NO: 16.
6. The RNA vector of any one of claims 1-5, which is derived from citrus yellow vein virus (SEQ ID NO: 1) or an iRNA relative thereof.
7. The RNA vector of any one of claims 1-6, which is capable of systemic and phloem- limited movement and replication within a host plant.
8. The RNA vector of claim 7, which is functionally stable for replication, movement and/or translation within the host plant for at least one month after infection thereof.
9. The RNA vector of any one of claims 1-8, wherein said heterologous segment(s) comprises a polynucleotide that encodes at least one polypeptide selected from the group consisting of a reporter molecule, a peptide, and a protein.
10. The RNA vector of claim 9, wherein said polypeptide is an insecticide, an
antibacterial, an antiviral, or an antifungal.
11. The RNA vector of claim 10, wherein said antibacterial is an enzybiotic.
12. The RNA vector of any one of claims 10-11, wherein said antibacterial targets a
bacterium Candidatus Liberibacter species.
13. The RNA vector of claim 12, wherein said Candidatus Liberibacter species is
Candidatus Liberibacter asiaticus (CLas).
14. The RNA vector of any one of claims 1-13, wherein said heterologous segment(s) comprises a small non-coding RNA molecule and/or an RNA interfering molecule.
15. The RNA vector of claim 14, wherein said small non-coding RNA molecule and/or said RNA interfering molecule targets an insect vector, a virus, or a fungus.
16. The RNA vector of claim 15, wherein said small non-coding RNA molecule and/or said RNA interfering molecule targets a nucleic acid of said insect vector, said virus, or said fungus.
17. The RNA vector of any one of claims 15-16, wherein said virus is selected from the group consisting of Citrus vein enation virus (CVEV) and Citrus tristeza virus (CTV).
18. The RNA vector of any one of claims 1-17, wherein said heterologous segment(s) is a first heterologous segment, further comprising a second heterologous segment(s), wherein said replication element(s) is intermediate said first and second heterologous segments.
19. The RNA vector of any one of claims 1-18, wherein said heterologous segment(s) comprises a polynucleotide that encodes for a protein or peptide that alters a phenotypic trait.
20. The RNA vector of claim 19, wherein said phenotypic trait is selected from the group consisting of pesticide tolerance, herbicide tolerance, insect resistance, reduced callose production, increased growth rate, and dwarfism.
21. A host plant comprising the RNA vector of any one of claims 1-20, wherein said host plant is a whole plant, a plant organ, a plant tissue, or a plant cell.
22. The host plant of claim 21, wherein said host plant is in a genus selected from the group consisting of citrus, vitis, ficus and olea.
23. The host plant of claim 22, wherein said host plant is a citrus tree or a citrus tree graft.
24. A composition comprising a plant, a plant organ, a plant tissue, or a plant cell infected with the RNA vector of any one of claims 1 -20.
25. The composition of claim 24, wherein said plant is in a genus selected from the group consisting of citrus, vitis, ficus and olea.
26. The composition of claim 25, wherein said plant is a citrus tree or a citrus tree graft.
27. A method for introducing a heterologous segment(s) into a host plant comprising introducing into said host plant the RNA vector of any one of claims 1-20.
28. The method of claim 27, wherein said introducing step comprises grafting a plant organ or plant tissue of a plant that comprises the RNA vector to a plant organ or plant tissue of another plant that does not comprise the RNA vector prior to said introduction.
29. The method of any one of claims 27-28, wherein the RNA vector systemically infects the host plant.
30. A process of producing in a plant, a plant organ, a plant tissue, or a plant cell a
heterologous segment(s), comprising introducing into said plant, said plant tissue or said plant cell the RNA vector of any one of claims 1-20.
31. The process of claim 30, wherein said plant is in a genus selected from the group consisting of citrus, vitis, ficus and olea.
32. A kit comprising the RNA vector of any one of claims 1-20.
33. Use of the RNA vector of any one of claims 1-20 for introducing the heterologous segment(s) into a plant, a plant organ, a plant tissue, or a plant cell.
34. Use of the host plant of any one of claims 21-23, or of the composition of any one of claims 24-26, for introducing the RNA vector into a plant organ or plant tissue that does not, prior to said introducing, comprise the RNA vector.
35. The use of claim 34, wherein said introducing comprising grafting a plant organ or plant tissue of a plant that comprises the RNA vector to a plant organ or plant tissue of another plant that does not comprise the RNA vector.
36. A method of making a vector for use with a plant comprising the steps of inserting one or more heterologous segment(s) into an RNA, wherein the RNA is selected from the group consisting of: CYVaV ; a relative of CYVaV; other RNA vectors having at least 70% RdRp identity with CYVaV ; and another iRNA.
37. A vector produced by the method of claim 36.
38. The use of an RNA as a vector, wherein the RNA is selected from the group
consisting of: CYVaV; a relative of CYVaV; other RNA vectors having at least 70% RdRp identity with CYVaV; and, another iRNA.
39. The use of claim 38 wherein the RNA is used in the treatment of a plant, for example the treatment of a viral or bacterial infection of a plant, for example the treatment of CTV infection or Citrus greening in a Citrus plant.
40. The use of any one of claims 38-39, wherein the RNA is modified with one or more inserted heterologous segment(s), for example an enzybiotic.
41. Use of an RNA characterized by being in the manufacture of a medicament to treat a disease or condition of a plant, wherein the RNA is selected from the group consisting of: CYVaV; a relative of CYVaV; other RNA vectors having at least 70% RdRp identity with CYVaV; and, another iRNA
42. The use of claim 41, wherein the disease or condition is a viral or bacterial infection of a plant, for example CTV or Citrus greening in a Citrus plant.
43. An RNA for use as a medicament or in the treatment of a disease or condition of a plant, wherein the RNA is selected from the group consisting of: CYVaV; a relative of CYVaV; other RNA vectors having at least 70% RdRp identity with CYVaV; and, another iRNA.
PCT/US2019/060945 2018-11-13 2019-11-12 Plant vectors, compositions and uses relating thereto WO2020102210A1 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
EP19884145.4A EP3880828A4 (en) 2018-11-13 2019-11-12 Plant vectors, compositions and uses relating thereto
KR1020217017524A KR20210101227A (en) 2018-11-13 2019-11-12 Plant vectors, compositions and uses related thereto
BR112021009192-0A BR112021009192A2 (en) 2018-11-13 2019-11-12 POSITIVE SENSE SINGLE STRIP RIBONUCLEIC ACID (RNA) VECTOR, HOST PLANT, COMPOSITION, METHOD FOR INTRODUCING A HETEROLOGOUS SEGMENT (OR HETEROLOGOUS SEGMENTS) INTO A HOST PLANT, PROCESS FOR PRODUCING, IN A PLANT, A PLANT ORGAN, A TISSUE OR A PLANT CELL, A HETEROLOGOUS SEGMENT (OR HETEROLOGOUS SEGMENTS), KIT, USE OF RNA VECTOR, USE OF HOST PLANT, METHOD OF PRODUCING A VECTOR FOR USE WITH A PLANT, VECTOR, USE OF AN RNA AS A VECTOR, USE OF AN RNA, AND RNA FOR USE AS A MEDICINE OR IN THE TREATMENT OF A DISEASE OR AFFECT OF A PLANT
AU2019381736A AU2019381736A1 (en) 2018-11-13 2019-11-12 Plant vectors, compositions and uses relating thereto
CN201980088371.0A CN113302308A (en) 2018-11-13 2019-11-12 Plant vectors, compositions and uses related thereto
US17/291,431 US20220002746A1 (en) 2018-11-13 2019-11-12 Plant Vectors, Compositions and Uses Relating Thereto
MX2021005555A MX2021005555A (en) 2018-11-13 2019-11-12 Plant vectors, compositions and uses relating thereto.
JP2021549930A JP2022509553A (en) 2018-11-13 2019-11-12 Plant vectors, related compositions and uses
EP20886307.6A EP4058568A4 (en) 2019-11-12 2020-11-12 Plant vectors, compositions and uses relating thereto
PCT/US2020/060228 WO2021097086A1 (en) 2019-11-12 2020-11-12 Plant vectors, compositions and uses relating thereto
BR112022009127A BR112022009127A2 (en) 2019-11-12 2020-11-12 RIBONUCLEIC ACID VECTOR, A PLANT COMPRISING A SOUR ORANGE ROOTSTOCK AND AN IRNA-BASED VECTOR, METHOD FOR INTRODUCING A HETEROLOGOUS SEGMENT IN A HOST PLANT, MANUFACTURING METHOD OF A RIBONUCLEIC ACID VECTOR, AND IRNA-BASED VECTOR
AU2020381450A AU2020381450A1 (en) 2019-11-12 2020-11-12 Plant vectors, compositions and uses relating thereto
CN202080093354.9A CN115052979A (en) 2019-11-12 2020-11-12 Plant vectors, compositions and uses related thereto
MX2022005644A MX2022005644A (en) 2019-11-12 2020-11-12 Plant vectors, compositions and uses relating thereto.
US17/096,593 US20210130837A1 (en) 2018-11-13 2020-11-12 Plant Vectors, Compositions and Uses Relating Thereto
ZA2021/03058A ZA202103058B (en) 2018-11-13 2021-05-06 Plant vectors, compositions and uses relating thereto

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862760098P 2018-11-13 2018-11-13
US62/760,098 2018-11-13

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/096,593 Continuation-In-Part US20210130837A1 (en) 2018-11-13 2020-11-12 Plant Vectors, Compositions and Uses Relating Thereto

Publications (1)

Publication Number Publication Date
WO2020102210A1 true WO2020102210A1 (en) 2020-05-22

Family

ID=70732180

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/060945 WO2020102210A1 (en) 2018-11-13 2019-11-12 Plant vectors, compositions and uses relating thereto

Country Status (12)

Country Link
US (1) US20220002746A1 (en)
EP (1) EP3880828A4 (en)
JP (1) JP2022509553A (en)
KR (1) KR20210101227A (en)
CN (1) CN113302308A (en)
AU (1) AU2019381736A1 (en)
BR (1) BR112021009192A2 (en)
CL (1) CL2021001254A1 (en)
MA (1) MA54244A (en)
MX (1) MX2021005555A (en)
WO (1) WO2020102210A1 (en)
ZA (1) ZA202103058B (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021097086A1 (en) * 2019-11-12 2021-05-20 University Of Maryland, College Park Plant vectors, compositions and uses relating thereto
WO2022246005A1 (en) * 2021-05-21 2022-11-24 University Of Maryland, College Park Plant vectors, compositions and uses relating thereto

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20240002881A1 (en) * 2022-05-04 2024-01-04 University Of Maryland, College Park RNA Vectors with Hairpin-like Inserts
CN115976277B (en) * 2022-10-11 2024-01-19 云南农业大学 RT-PCR synchronous detection kit and detection method for PEMV-1 and PEMV-2
US11992444B1 (en) 2023-12-04 2024-05-28 Vita Inclinata Ip Holdings Llc Apparatus, system, and method to control torque or lateral thrust applied to a load suspended on a suspension cable

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130212739A1 (en) * 2010-08-07 2013-08-15 Nomad Bioscience Gmbh Process for transfecting plants

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1100924A1 (en) * 1998-07-24 2001-05-23 Scottish Crop Research Institute Polynucleotide transporter protein
CA2390152C (en) * 1999-11-22 2012-08-28 Plant Bioscience Limited Enhanced transgene expression by co-expression with a suppressor of post-transcriptional gene silencing (ptgs)
EP1686176A1 (en) * 2005-01-28 2006-08-02 Icon Genetics AG Production of antibodies in plants with plus-sense single-stranded viral RNA vectors

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130212739A1 (en) * 2010-08-07 2013-08-15 Nomad Bioscience Gmbh Process for transfecting plants

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DATABASE NUCLEOTIDE 31 July 2013 (2013-07-31), ANONYMOUS: "Citrus yellow vein-associated virus isolate YV920, complete genome", XP055811294, retrieved from GENBANK Database accession no. JX101610 *
See also references of EP3880828A4 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021097086A1 (en) * 2019-11-12 2021-05-20 University Of Maryland, College Park Plant vectors, compositions and uses relating thereto
WO2022246005A1 (en) * 2021-05-21 2022-11-24 University Of Maryland, College Park Plant vectors, compositions and uses relating thereto

Also Published As

Publication number Publication date
BR112021009192A2 (en) 2021-09-14
JP2022509553A (en) 2022-01-20
EP3880828A1 (en) 2021-09-22
KR20210101227A (en) 2021-08-18
AU2019381736A1 (en) 2021-06-03
ZA202103058B (en) 2023-02-22
EP3880828A4 (en) 2022-08-03
CN113302308A (en) 2021-08-24
MX2021005555A (en) 2021-09-10
CL2021001254A1 (en) 2021-12-24
MA54244A (en) 2022-02-16
US20220002746A1 (en) 2022-01-06

Similar Documents

Publication Publication Date Title
US20220002746A1 (en) Plant Vectors, Compositions and Uses Relating Thereto
EP1416049A1 (en) Method of interfering with a virus infection in plants
JP2020511472A (en) Systems and methods for biological control of plant pathogens
Dawson et al. Virus-based transient expression vectors for woody crops: a new frontier for vector design and use
Youssef et al. Post-transcriptional gene silencing of the gene encoding aldolase from soybean cyst nematode by transformed soybean roots
Robertson et al. Overexpression of the Arabidopsis NPR1 protein in citrus confers tolerance to Huanglongbing
Dubey et al. Enhanced host-parasite resistance based on down-regulation of Phelipanche aegyptiaca target genes is likely by mobile small RNA
US9970022B2 (en) Gall wasp control agents
US20210355499A1 (en) Plant Vectors, Compositions and Uses Relating Thereto
AU2022203005A1 (en) Plant vectors, compositions and uses relating thereto
Leonetti et al. Viral and subviral derived small RNAs as pathogenic determinants in plants and insects
US20210130837A1 (en) Plant Vectors, Compositions and Uses Relating Thereto
US20240002871A1 (en) RNA Vectors with Hairpin-like Inserts
US20240002881A1 (en) RNA Vectors with Hairpin-like Inserts
Dutt et al. Biotechnological approaches for the resistance to citrus diseases
Rêgo-Machado et al. Topical application of dsRNA for plant virus control: a review
US10308954B2 (en) Method for the control of nematodes in plants
CN110551718B (en) Nucleotide sequences and methods for controlling insect infestation
CN110669761B (en) Nucleotide sequences and methods for controlling insect infestation
Bolok Yazdi et al. Virus-induced gene silencing for functional analysis of eds1 gene in tomato infected with Ralstonia solanacearum.
Shingote et al. Virus–Vector Interactions and Transmission
WO2010018845A1 (en) Method for promotion of branch formation, dwarfing, sterility and promotion of multiple flower bud formation of plant
Pazhouhandeh The mechanism of action of polerovirus P0 in RNA silencing suppression
Charlesworth Investigation into resistance strategies against geminiviruses by understanding and adapting RNA interference
Mosen Development of RNA silencing as a novel disease control strategy to protect pines from Dothistroma needle blight: a thesis presented in the partial fulfilment of the requirements for the degree of Master of Science (MSc) in Genetics at Massey University, Manawatu, New Zealand

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19884145

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2021549930

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021009192

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2019381736

Country of ref document: AU

Date of ref document: 20191112

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019884145

Country of ref document: EP

Effective date: 20210614

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112021009192

Country of ref document: BR

Free format text: COM BASE NA PORTARIA 405 DE 21/12/2020, SOLICITA-SE QUE SEJA APRESENTADO, EM ATE 60 (SESSENTA) DIAS, NOVO CONTEUDO DE LISTAGEM DE SEQUENCIA POIS O CONTEUDO APRESENTADO NA PETICAO NO 270210062119 DE 08/07/2021 POSSUI INFORMACOES DIVERGENTES AO PEDIDO EM QUESTAO (DIVERGENCIA DE DEPOSITANTE)

ENP Entry into the national phase

Ref document number: 112021009192

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210512