WO2020028525A1 - Sumo inhibitor compounds and uses thereof - Google Patents

Sumo inhibitor compounds and uses thereof Download PDF

Info

Publication number
WO2020028525A1
WO2020028525A1 PCT/US2019/044404 US2019044404W WO2020028525A1 WO 2020028525 A1 WO2020028525 A1 WO 2020028525A1 US 2019044404 W US2019044404 W US 2019044404W WO 2020028525 A1 WO2020028525 A1 WO 2020028525A1
Authority
WO
WIPO (PCT)
Prior art keywords
substituted
unsubstituted
membered
nhc
heterocycloalkyl
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/044404
Other languages
French (fr)
Inventor
Yuan Chen
Xiaohu Ouyang
Sung Wook Yi
Ted Charles JUDD
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
City of Hope
Suvalent Therapeutics Inc
Original Assignee
City of Hope
Sumo Biosciences Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by City of Hope, Sumo Biosciences Inc filed Critical City of Hope
Priority to US17/263,487 priority Critical patent/US11578079B2/en
Publication of WO2020028525A1 publication Critical patent/WO2020028525A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/496Non-condensed piperazines containing further heterocyclic rings, e.g. rifampin, thiothixene or sparfloxacin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/34Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/34Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide
    • A61K31/341Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide not condensed with another ring, e.g. ranitidine, furosemide, bufetolol, muscarine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/35Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom
    • A61K31/351Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom not condensed with another ring
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/357Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having two or more oxygen atoms in the same ring, e.g. crown ethers, guanadrel
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/357Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having two or more oxygen atoms in the same ring, e.g. crown ethers, guanadrel
    • A61K31/36Compounds containing methylenedioxyphenyl groups, e.g. sesamin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/38Heterocyclic compounds having sulfur as a ring hetero atom
    • A61K31/381Heterocyclic compounds having sulfur as a ring hetero atom having five-membered rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/397Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having four-membered rings, e.g. azetidine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/40Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • A61K31/4025Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil not condensed and containing further heterocyclic rings, e.g. cromakalim
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/4151,2-Diazoles
    • A61K31/41551,2-Diazoles non condensed and containing further heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/4427Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
    • A61K31/443Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with oxygen as a ring hetero atom
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/445Non condensed piperidines, e.g. piperocaine
    • A61K31/4523Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems
    • A61K31/453Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a six-membered ring with oxygen as a ring hetero atom
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/445Non condensed piperidines, e.g. piperocaine
    • A61K31/4523Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems
    • A61K31/4535Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a heterocyclic ring having sulfur as a ring hetero atom, e.g. pizotifen
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/445Non condensed piperidines, e.g. piperocaine
    • A61K31/4523Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems
    • A61K31/4545Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a six-membered ring with nitrogen as a ring hetero atom, e.g. pipamperone, anabasine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47Quinolines; Isoquinolines
    • A61K31/4709Non-condensed quinolines and containing further heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/506Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/535Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
    • A61K31/53751,4-Oxazines, e.g. morpholine
    • A61K31/53771,4-Oxazines, e.g. morpholine not condensed and containing further heterocyclic rings, e.g. timolol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D493/00Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system
    • C07D493/02Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system in which the condensed system contains two hetero rings
    • C07D493/08Bridged systems
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D493/00Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system
    • C07D493/12Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system in which the condensed system contains three hetero rings
    • C07D493/18Bridged systems

Definitions

  • a method of treating cancer in a subject in need thereof including administering to the subject a pharmaceutically acceptable excipient and a therapeutically effective amount of a compound of formula:
  • [0006] — is a single bond or double bond.
  • L 3 is -0-, -S-, -N-, -S(O)-, -S(0) 2 -, -C(O)-, -N(R 7 )-, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene.
  • R 1 is hydrogen, halogen, -CX , -CHXS, -CH 2 X ⁇ -OCX , -OC1EX 1 , -OCHX ,
  • R 2 is hydrogen, halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 , -OCHX 2 2 , -CN, -SO Rules 2 R 2A , -SO V2 NR 2A R 2B , -NHC(0)NR 2A R 2B , -N(0)m2, -NR 2A R 2B , -NHNR 2A R 2B , -C(0)R 2A , -C(0)-OR 2A , -C(0)NR 2A R 2B , -C(0)NHNR 2A R 2B , -OR 2A , -NR 2A SO 2 R 2B ,
  • R 3 is hydrogen, halogen, -CX 3 3 , -CHX 3 2 , -CH 2 X 3 , -OCX 3 3 , -OCH 2 X 3 , -OCHX 3 2 , -CN, -SOfinityR 3A , -SO V3 NR 3A R 3B , -NHC(0)NR 3A R 3B , -N(0) m3 , -NR 3A R 3B , -NHNR 3A R 3B , -C(0)R 3A , -C(0)-OR 3A , -C(0)NR 3A R 3B , -OR 3A , -NR 3A S0 2 R 3B , -NR 3A C(0)R 3B ,
  • R 4 is hydrogen, halogen, -CX 4 3 , -CHX 4 2 , -CH 2 X 4 , -OCX 4 3 , -OCH 2 X 4 , -OCHX 4 2 , -CN, -SO n4 R 4A , -SO v4 NR 4A R 4B , -NHC(0)NR 4A R 4B , -N(0) m4 , -NR 4A R 4B , -NHNR 4A R 4B , -C(0)R 4A , -C(0)-0R 4A , -C(0)NR 4A R 4B , -C(0)NHNR 4A R 4B , -OR 4A , -NR 4A SO 2 R 4B ,
  • R 5 is hydrogen, halogen, -CX 5 3 , -CHX 5 2 , -CH 2 X 5 , -OCX 5 3 , -OCH 2 X 5 , -OCHX 5 2 , -CN, -SOn5R 5A , -SO V5 NR 5A R 5B , -NHC(0)NR 5A R 5B , -N(0) m5 , -NR 5A R 5B , -NHNR 5A R 5B , -C(0)R 5A , -C(0)-OR 5A , -C(0)NR 5A R 5B , -C(0)NHNR 5A R 5B , -OR 5A , -NR 5A SO 2 R 5B ,
  • R 6 is hydrogen, halogen, -CX 6 3 , -CHX 6 2 , -OEX 6 , -OCX 6 3 , -OOEX 6 , -OCHX 6 2 , -CN, -SO n6 R 6A , -SO V6 NR 6A R 6B , -NHC(0)NR 6A R 6B , -N(0) m6 , -NR 6A R 6B , -NHNR 6A R 6B , -C(0)R 6A , -C(0)-OR 6A , -C(0)NR 6A R 6B , -C(0)NHNR 6A R 6B , -OR 6A , -NR 6A SO 2 R 6B ,
  • R 7 is hydrogen, halogen, -CX 7 3 , -CHX 7 2 , -CH 2 X 7 , -OCX 7 3 , -OCH 2 X 7 , -OCHX 7 2 , -CN, -SOnvR 7A , -SO VV NR 7A R 7B , -NHC(0)NR 7A R 7B , -N(0) m v, -NR 7A R 7B , -NHNR 7A R 7B , -C(0)R 7A , -C(0)-OR 7A , -C(0)NR 7A R 7B , -C(0)NHNR 7A R 7B , -OR 7A , -NR 7A SO 2 R 7B ,
  • E 1 and E 2 are independently an electron- withdrawing moiety.
  • heterocycloalkyl substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl
  • R 1A and R 1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl
  • R 2A and R 2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl
  • R 4A and R 4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl
  • R 5A and R 5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubsti
  • ml, m2, m3, m4, m5, m6, and m7 are independently 1 or 2.
  • vl, v2, v3, v4, v5, v6, and v7 are independently 1 or 2.
  • nl, n2, n3, n4, n5, n6, and n7 are independently an integer from 0 to 4.
  • X, X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , and X 7 are independently -Cl, -Br, -I or -F.
  • L 1 and L 2 are independently a bond, -0-, -S-, -S(O)-, -S(0) 2 -, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -C(0)NHNH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted
  • heteroalkylene substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl ene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
  • R 1 and R 2 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • R 4 and R 5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • the compound is administered at a rate approximately equal to the half-life of an El enzyme.
  • L 3 is -0-, -S-, or -N(R 7 )-.
  • L 7 is -O- or -N(R 10 )-.
  • R 1A is hydrogen, halogen, -CX 1A 3 , -CHX 1A 2 , -CH 2 X 1A , -OCX 1A 3 , -OCH 2 X 1A , -OCHX 1A 2 , -CN, -SOni A R 1AA , -SO VI ANR 1AA R 1ab , -NHC(0)NR 1AA R 1AB , -N(0)miA,
  • -NR 1AA R 1AB -NHNR 1AA R 1AB , -C(0)R 1aa , -C(0)-OR 1aa , -C(0)NR 1AA R 1AB , -OR 1aa , -NR I AA S0 2 R I ab , -NR 1AA C(0)R 1AB , -NR 1AA C(0)0R 1AB , -NR 1AA OR 1AB , -N 3 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • R 2A is hydrogen, halogen, -CX 2A 3 , -CHX 2A 2 , -CH 2 X 2A , -OCX 2A 3 , -OCH 2 X 2A , -OCHX 2A 2 , -CN, -SO n2A R 2AA , -SO V2 ANR 2AA R 2AB , -NHC(0)NR 2AA R 2AB , -N(0) m2A ,
  • R 2B is hydrogen, halogen, -CX 2B 3 , -CHX 2B 2 , -CH 2 X 2B , -OCX 2B 3 , -OCH 2 X 2B , -OCHX 2B 2 , -CN, -SO Rules 2B R 2BA , -SO V2B NR 2BA R 2BB , -NHC(0)NR 2BA R 2BB , -N(0) m2B ,
  • R 3 is hydrogen, halogen, -CX 3 3 , -CHX 3 2 , -CH 2 X 3 , -OCX 3 3 , -OCH 2 X 3 , -OCHX 3 2 , -CN, -SOfinityR 3A , -SO V3 NR 3A R 3B , -NHC(0)NR 3A R 3B , -N(0) m3 , -NR 3A R 3B , -NHNR 3A R 3B , -C(0)R 3A , -C(0)-OR 3A , -C(0)NR 3A R 3B , -OR 3A , -NR 3A S0 2 R 3B , -NR 3A C(0)R 3B ,
  • R 4 is hydrogen, halogen, -CX 4 3 , -CHX 4 2 , -CH 2 X 4 , -OCX 4 3 , -OCH 2 X 4 , -OCHX 4 2 , -CN, -SO n4 R 4A , -SO V4 NR 4A R 4B , -NHC(0)NR 4A R 4B , -N(0) m4 , -NR 4A R 4B , -NHNR 4A R 4B , -C(0)R 4A , -C(0)-OR 4A , -C(0)NR 4A R 4B , -C(0)NHNR 4A R 4B , -OR 4A , -NR 4A SO 2 R 4B ,
  • R 5 is hydrogen, halogen, -CX 5 3 , -CHX 5 2 , -CH 2 X 5 , -OCX 5 3 , -OCH 2 X 5 , -OCHX 5 2 , -CN, -SOn5R 5A , -SO V5 NR 5A R 5B , -NHC(0)NR 5A R 5B , -N(0) m5 , -NR 5A R 5B , -NHNR 5A R 5B , -C(0)R 5A , -C(0)-0R 5A , -C(0)NR 5A R 5B , -C(0)NHNR 5A R 5B , -OR 5A , -NR 5A SO 2 R 5B ,
  • R 7 is hydrogen, halogen, -CX 7 3 , -CHX 7 2 , -CH 2 X 7 , -OCX 7 3 , -OCH 2 X 7 , -OCHX 7 2 , -CN, -SOnvR 7A , -SO VV NR 7A R 7B , -NHC(0)NR 7A R 7B , -N(0) m v, -NR 7A R 7B , -NHNR 7A R 7B , -C(0)R 7A , -C(0)-OR 7A , -C(0)NR 7A R 7B , -C(0)NHNR 7A R 7B , -OR 7A , -NR 7A SO 2 R 7B ,
  • R 8 is hydrogen, halogen, -CX 8 3 , -CHX 8 2 , -CH 2 X 8 , -OCX 8 3 , -OCH 2 X 8 , -OCHX 8 2 , -CN, -SO n8 R 8A , -SO v8 NR 8A R 8B , -NHC(0)NR 8A R 8B , -N(0) m8 , -NR 8A R 8B , -NHNR 8A R 8B , -C(0)R 8A , -C(0)-OR 8A , -C(0)NR 8A R 8B , -C(0)NHNR 8A R 8B , -OR 8A , -NR 8A SO 2 R 8B ,
  • R 9 is hydrogen, halogen, -CX 9 3 , -CHX 9 2 , -CH 2 X 9 , -OCX 9 3 , -OCH 2 X 9 , -OCHX 9 2 , -CN, -SOfinity9R 9A , -SO V9 NR 9A R 9B , -NHC(0)NR 9A R 9B , -N(0)m9, -NR 9A R 9B , -NHNR 9A R 9B , -C(0)R 9A , -C(0)-OR 9A , -C(0)NR 9A R 9B , -C(0)NHNR 9A R 9B , -OR 9A , -NR 9A SO 2 R 9B ,
  • R 10 is hydrogen, halogen, -CX 10 3 , -CHX 10 2 , -CH 2 X 10 , -OCX 10 3 , -OCH 2 X 10 ,
  • Each R 1AA , R 1AB , R 2AA , R 2AB , R 2BA , R 2BB , R 3A , R 3B , R 4A , R 4B , R 5A , R 5B , R 7A , R 7B , R 8A , R 8B , R 9A , R 9B , R 10a , and R 10B is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X,
  • R 1AA and R 1AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
  • R 2AA and R 2AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
  • R 2BA and R 2BB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
  • R 3A and R 3B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
  • R 4A and R 4B substituents bonded to the same nitrogen atom may optionally be
  • ml A, m2A, m2B, m3, m4, m5, m7, m8, m9, and mlO are independently 1 or 2.
  • vl A, v2A, v2B, v3, v4, v5, v7, v8, v9, and vlO are independently 1 or 2.
  • nlA, n2A, n2B, n3, n4, n5, n7, n8, n9, and nlO are independently an integer from 0 to 4.
  • X, X 1A , X 2A , X 2B , X 3 , X 4 , X 5 , X 7 , X 8 , X 9 , and X 10 are independently -Cl, -Br, -I, or -F.
  • L 6 is substituted or unsubstituted alkyl ene, substituted or unsubstituted
  • heteroalkylene substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl ene, substituted or unsubstituted aryl ene, or substituted or unsubstituted heteroaryl ene.
  • L 8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, -S-, -S(O)-, -S(0) 2 -, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or
  • L 9 is a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -0C(0)-, -NHC(O)-, -NHC(0)NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
  • R 2A and R 2B may optionally be joined to form a substituted or
  • R 4 and R 5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • a pharmaceutical composition including a compound described herein, or pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
  • a method of treating cancer including administering to a subject in need thereof an effective amount of a compound described herein.
  • a method of inhibiting cell proliferation the method including contacting the cell with a compound described herein.
  • FIG. 1 Examination of the effect of compounds 582 and 588 to reduce cancer stem cell (CSC) populations in patient derived xenograft (PDX) models using limited dilution assays.
  • Compound 582 showed dose-dependent inhibition on PDX cancer-initiating-cell (CIC) frequency, even at 1 mM.
  • Compound 588 only showed inhibition on CIC at high dose 10 mM.
  • substituent groups are specified by their conventional chemical formulae, written from left to right, they equally encompass the chemically identical substituents that would result from writing the structure from right to left, e.g., -CH 2 0- is equivalent to -OCH2-.
  • alkyl by itself or as part of another substituent, means, unless otherwise stated, a straight (i.e., unbranched) or branched carbon chain (or carbon), or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include mono-, di- and multivalent radicals, having the number of carbon atoms designated (i.e., C1-C10 means one to ten carbons).
  • Alkyl is an uncyclized chain.
  • saturated hydrocarbon radicals include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t- butyl, isobutyl, sec-butyl, homologs and isomers of, for example, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like.
  • An unsaturated alkyl group is one having one or more double bonds or triple bonds.
  • unsaturated alkyl groups include, but are not limited to, vinyl, 2- propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, 3-(l,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers.
  • An alkoxy is an alkyl attached to the remainder of the molecule via an oxygen linker (-0-).
  • alkylene by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkyl, as exemplified, but not limited by, -CH2CH2CH2CH2-.
  • alkenylene by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkene.
  • heteroalkyl by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or combinations thereof, including at least one carbon atom and at least one heteroatom (e.g., O, N, P, S, B, As, or Si), and wherein the nitrogen and sulfur atoms may optionally be oxidized, and the nitrogen heteroatom may optionally be quatemized.
  • the heteroatom(s) e.g., O, N, P, S, B, As, or Si
  • Heteroalkyl is an uncyclized chain. Examples include, but are not limited to: -CH2-CH2-O-CH3, -CH2-CH2-NH-CH3,
  • -O-CH2-CH3, and -CN Up to two or three heteroatoms may be consecutive, such as, for example, -CH2-NH-OCH3 and -CH2-0-Si(CH 3 )3.
  • heteroalkylene by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from heteroalkyl, as exemplified, but not limited by, -CH2-CH2-S-CH2-CH2- and -CH2-S-CH2-CH2-NH-CH2-.
  • heteroalkylene groups heteroatoms can also occupy either or both of the chain termini (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like). Still further, for alkylene and heteroalkylene linking groups, no orientation of the linking group is implied by the direction in which the formula of the linking group is written. For example, the formula - C(0) 2 R'- represents both -C(0) 2 R'- and -R'C(0) 2 -.
  • heteroalkyl groups include those groups that are attached to the remainder of the molecule through a heteroatom, such as -C(0)R, -C(0)NR', -NR'R", -OR', -SR', and/or -SO2R'.
  • heterocycloalkyl a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule.
  • halo or“halogen,” by themselves or as part of another substituent, mean, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom. Additionally, terms such as“haloalkyl” are meant to include monohaloalkyl and polyhaloalkyl.
  • halo(Ci-C 4 )alkyl includes, but is not limited to, fluoromethyl, difluoromethyl, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.
  • acyl means, unless otherwise stated, -C(0)R where R is a substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • aryl means, unless otherwise stated, a polyunsaturated, aromatic, hydrocarbon substituent, which can be a single ring or multiple rings (preferably from 1 to 3 rings) that are fused together (i.e., a fused ring aryl) or linked covalently.
  • a fused ring aryl refers to multiple rings fused together wherein at least one of the fused rings is an aryl ring.
  • heteroaryl refers to aryl groups (or rings) that contain at least one heteroatom such as N, O, or S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized.
  • heteroaryl includes fused ring heteroaryl groups (i.e., multiple rings fused together wherein at least one of the fused rings is a heteroaromatic ring).
  • a heteroaryl group can be attached to the remainder of the molecule through a carbon or heteroatom.
  • Spirocyclic rings are two or more rings wherein adjacent rings are attached through a single atom.
  • the individual rings within spirocyclic rings may be identical or different.
  • Individual rings in spirocyclic rings may be substituted or unsubstituted and may have different substituents from other individual rings within a set of spirocyclic rings.
  • Possible substituents for individual rings within spirocyclic rings are the possible substituents for the same ring when not part of spirocyclic rings (e.g. substituents for cycloalkyl or
  • Spirocylic rings may be substituted or unsubstituted cycloalkyl, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heterocycloalkylene and individual rings within a spirocyclic ring group may be any of the immediately previous list, including having all rings of one type (e.g. all rings being substituted heterocycloalkylene wherein each ring may be the same or different substituted heterocycloalkylene).
  • heterocyclic spirocyclic rings means a spirocyclic rings wherein at least one ring is a heterocyclic ring and wherein each ring may be a different ring.
  • substituted spirocyclic rings means that at least one ring is substituted and each substituent may optionally be different.
  • oxo means an oxygen that is double bonded to a carbon atom.
  • alkylarylene as an arylene moiety covalently bonded to an alkylene moiety (also referred to herein as an alkylene linker).
  • alkylarylene group has the formula:
  • heterocycloalkyl includes both substituted and unsubstituted forms of the indicated radical.
  • R, R', R", R", and R" each preferably independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl (e.g., aryl substituted with 1-3 halogens), substituted or unsubstituted heteroaryl, substituted or unsubstituted alkyl, alkoxy, or thioalkoxy groups, or arylalkyl groups.
  • aryl e.g., aryl substituted with 1-3 halogens
  • substituted or unsubstituted heteroaryl substituted or unsubstituted alkyl, alkoxy, or thioalkoxy groups, or arylalkyl groups.
  • each of the R groups is independently selected as are each R', R", R", and R"" group when more than one of these groups is present.
  • R and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 4-, 5-, 6-, or 7- membered ring.
  • -NR'R includes, but is not limited to, l-pyrrolidinyl and 4- morpholinyl.
  • alkyl is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (e.g., -CF 3 and -CH2CF3) and acyl (e.g., -C(0)CH 3 , -C(0)CF 3 , -C(0)CH 2 0CH 3 , and the like).
  • haloalkyl e.g., -CF 3 and -CH2CF3
  • acyl e.g., -C(0)CH 3 , -C(0)CF 3 , -C(0)CH 2 0CH 3 , and the like.
  • R, R", R", and R" are preferably independently selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • R groups are independently selected as are each R, R", R", and R"" groups when more than one of these groups is present.
  • substituents on the ring rather than on a specific atom of a ring may be attached to any of the ring atoms (obeying the rules of chemical valency) and in the case of fused rings or spirocyclic rings, a substituent depicted as associated with one member of the fused rings or spirocyclic rings (a floating substituent on a single ring), may be a substituent on any of the fused rings or spirocyclic rings (a floating substituent on multiple rings).
  • the multiple substituents may be on the same atom, same ring, different atoms, different fused rings, different spirocyclic rings, and each substituent may optionally be different.
  • a point of attachment of a ring to the remainder of a molecule is not limited to a single atom (a floating substituent)
  • the attachment point may be any atom of the ring and in the case of a fused ring or spirocyclic ring, any atom of any of the fused rings or spirocyclic rings while obeying the rules of chemical valency.
  • a ring, fused rings, or spirocyclic rings contain one or more ring heteroatoms and the ring, fused rings, or spirocyclic rings are shown with one more floating substituents (including, but not limited to, points of attachment to the remainder of the molecule), the floating substituents may be bonded to the heteroatoms.
  • the ring heteroatoms are shown bound to one or more hydrogens (e.g. a ring nitrogen with two bonds to ring atoms and a third bond to a hydrogen) in the structure or formula with the floating substituent, when the heteroatom is bonded to the floating substituent, the substituent will be understood to replace the hydrogen, while obeying the rules of chemical valency.
  • Two or more substituents may optionally be joined to form aryl, heteroaryl, cycloalkyl, or heterocycloalkyl groups.
  • Such so-called ring-forming substituents are typically, though not necessarily, found attached to a cyclic base structure.
  • the ring-forming substituents are attached to adjacent members of the base structure.
  • two ring-forming substituents attached to adjacent members of a cyclic base structure create a fused ring structure.
  • the ring-forming substituents are attached to a single member of the base structure.
  • two ring-forming substituents attached to a single member of a cyclic base structure create a spirocyclic structure.
  • the ring-forming substituents are attached to non- adjacent members of the base structure.
  • heteroatom or“ring heteroatom” are meant to include oxygen (O), nitrogen (N), sulfur (S), phosphorus (P), Boron (B), and silicon (Si).
  • A“substituent group,” as used herein, means a group selected from the following moieties:
  • alkyl e.g., Ci-C 20 , Ci-Ci 2 , Ci-Cs, Ci-C 6 , C1-C4, or Ci-C 2
  • heteroalkyl e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to
  • cycloalkyl e.g., C 3 -C 10 , C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • heterocycloalkyl e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered
  • unsubstituted alkyl e.g., Ci-C 20 , Ci-Ci 2 , Ci-Cs, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C3-C10, C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6
  • unsubstituted alkyl e.g., Ci-C 20 , Ci-Ci 2 , Ci-Cs, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 20 membered, 2 to 12 membered, 2 to
  • heterocycloalkyl e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered
  • alkyl e.g., Ci-C 20 , Ci-Ci 2 , Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2
  • heteroalkyl e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • cycloalkyl e.g., C 3 -C 10 , C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • heterocycloalkyl e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • aryl e.g., C 6 -Ci2, C 6 -Cio, or phenyl
  • heteroaryl e.
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
  • alkyl e.g., C1-C20, C1-C12, Ci-C 8 , Ci-C 6 , C1-C4, or C1-C2
  • heteroalkyl e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • cycloalkyl e.g., C 3 -Cio, C 3 -C 8 , C 3 -C 6 , C4-C6, or C 5 -C 6
  • heterocycloalkyl e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • aryl e.g., C 6 -Ci2, C 6 -Cio, or phenyl
  • heteroaryl e.g., 5
  • -ONH 2 -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO 2 H, -NHC(0)H, -NHC(0)OH, -NHOH, -OCCh, -OCF 3 , -OCBr 3 , -OCh, -OCHCb, -OCHBr 2 , -OCHb, -OCHF 2 , -OCH2CI, -OCH 2 Br, -OCH2F, -OCH2I, -N 3 , unsubstituted alkyl (e.g, C 1 -C 20 , Ci- C12, Ci-C 8 , Ci-C 6 , C1-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered),
  • A“size-limited substituent” or“ size-limited substituent group,” as used herein, means a group selected from all of the substituents described above for a“substituent group,” wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted C1-C20 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C8 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C 6 -Cio aryl, and each substituted or unsubstituted heteroaryl
  • A“lower substituent” or“ lower substituent group,” as used herein, means a group selected from all of the substituents described above for a“substituent group,” wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted Ci-Cs alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3- C 7 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C 6 -Cio aryl, and each substituted or unsubstituted heteroaryl is a substituted or un
  • each substituted group described in the compounds herein is substituted with at least one substituent group. More specifically, in some embodiments, each substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted
  • heterocycloalkyl substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene described in the compounds herein are substituted with at least one substituent group. In other embodiments, at least one or all of these groups are substituted with at least one size-limited substituent group. In other embodiments, at least one or all of these groups are substituted with at least one lower substituent group.
  • each substituted or unsubstituted alkyl may be a substituted or unsubstituted C 1 -C 20 alkyl
  • each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl
  • each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C 3 -C 8 cycloalkyl
  • each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered
  • each substituted or unsubstituted aryl is a substituted or unsubstituted C 6 - C 10 aryl
  • each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 10 membered heteroaryl.
  • each substituted or unsubstituted alkylene is a substituted or unsubstituted C 1 -C 20 alkylene
  • each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 20 membered
  • heteroalkylene each substituted or unsubstituted cycloalkylene is a substituted or
  • each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 8 membered heterocycloalkylene
  • each substituted or unsubstituted arylene is a substituted or unsubstituted C 6 -Cio arylene
  • each substituted or unsubstituted heteroaryl ene is a substituted or unsubstituted 5 to 10 membered
  • each substituted or unsubstituted alkyl is a substituted or unsubstituted Ci-C 8 alkyl
  • each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl
  • each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C 3 -C 7 cycloalkyl
  • each substituted or unsubstituted or unsubstituted alkyl is a substituted or unsubstituted Ci-C 8 alkyl
  • each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl
  • each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C 3 -C 7 cycloalkyl
  • heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl
  • each substituted or unsubstituted aryl is a substituted or unsubstituted C 6 -Cio aryl
  • each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 9 membered heteroaryl.
  • each substituted or unsubstituted alkylene is a substituted or unsubstituted Ci-C 8 alkylene
  • each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 8 membered heteroalkylene
  • unsubstituted cycloalkylene is a substituted or unsubstituted C 3 -C 7 cycloalkylene
  • each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 7 membered heterocycloalkylene
  • each substituted or unsubstituted arylene is a substituted or unsubstituted C 6 -Cio arylene
  • each substituted or unsubstituted heteroaryl ene is a substituted or unsubstituted 5 to 9 membered heteroarylene.
  • the compound is a chemical species set forth in the Examples section, figures, or tables below.
  • a substituted or unsubstituted moiety e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl ene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is unsubstituted (e.g., is an unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted cycloal
  • a substituted or unsubstituted moiety e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted
  • cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene is substituted (e.g., is a substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene, respectively).
  • a substituted moiety e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene
  • is substituted with at least one substituent group wherein if the substituted moiety is substituted with a plurality of substituent groups, each substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of substituent groups, each substituent group is different.
  • a substituted moiety e.g., substituted alkyl, substituted
  • heteroalkyl substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene) is substituted with at least one size-limited substituent group, wherein if the substituted moiety is substituted with a plurality of size-limited substituent groups, each size-limited substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of size-limited substituent groups, each size-limited substituent group is different.
  • a substituted moiety e.g., substituted alkyl, substituted
  • heteroalkyl substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene) is substituted with at least one lower substituent group, wherein if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group is different.
  • a substituted moiety e.g., substituted alkyl, substituted
  • heteroalkyl substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted moiety is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group is different.
  • Certain compounds of the present invention possess asymmetric carbon atoms (optical or chiral centers) or double bonds; the enantiomers, racemates, diastereomers, tautomers, geometric isomers, stereoisometric forms that may be defined, in terms of absolute stereochemistry, as (A)-or (S)- or, as (D)- or (L)- for amino acids, and individual isomers are encompassed within the scope of the present invention.
  • the compounds of the present invention do not include those that are known in art to be too unstable to synthesize and/or isolate.
  • the present invention is meant to include compounds in racemic and optically pure forms.
  • Optically active ( R )- and (S)-, or (D)- and (L)-isomers may be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques.
  • the compounds described herein contain olefmic bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E and Z geometric isomers.
  • the term“isomers” refers to compounds having the same number and kind of atoms, and hence the same molecular weight, but differing in respect to the structural arrangement or configuration of the atoms.
  • tautomer refers to one of two or more structural isomers which exist in equilibrium and which are readily converted from one isomeric form to another.
  • structures depicted herein are also meant to include all stereochemical forms of the structure; i.e., the R and S configurations for each asymmetric center. Therefore, single stereochemical isomers as well as enantiomeric and diastereomeric mixtures of the present compounds are within the scope of the invention.
  • structures depicted herein are also meant to include compounds which differ only in the presence of one or more isotopically enriched atoms.
  • compounds having the present structures except for the replacement of a hydrogen by a deuterium or tritium, or the replacement of a carbon by 13 C- or 14 C-enriched carbon are within the scope of this invention.
  • a or “an,” as used in herein means one or more.
  • substituted with a[n] means the specified group may be substituted with one or more of any or all of the named substituents.
  • a group such as an alkyl or heteroaryl group
  • the group may contain one or more unsubstituted C1-C20 alkyls, and/or one or more unsubstituted 2 to 20 membered heteroalkyls.
  • R-substituted where a moiety is substituted with an R substituent, the group may be referred to as“R-substituted.” Where a moiety is R-substituted, the moiety is substituted with at least one R substituent and each R substituent is optionally different. Where a particular R group is present in the description of a chemical genus (such as Formula (I)), a Roman alphabetic symbol may be used to distinguish each appearance of that particular R group. For example, where multiple R 13 substituents are present, each R 13 substituent may be distinguished as R 13A , R 13B , R 13C , R 13D , etc., wherein each of R 13A , R 13B , R 13C , R 13D , etc. is defined within the scope of the definition of R 13 and optionally differently.
  • salts are meant to include salts of the active compounds that are prepared with relatively nontoxic acids or bases, depending on the particular substituents found on the compounds described herein.
  • Non-limiting examples of such salts include hydrochlorides, hydrobromides, phosphates, sulfates, methanesulfonates, nitrates, maleates, acetates, citrates, fumarates, proprionates, tartrates (e.g., (+)-tartrates, (-)- tartrates, or mixtures thereof including racemic mixtures), succinates, benzoates, and salts with amino acids such as glutamic acid, and quaternary ammonium salts (e.g.
  • salts may be prepared by methods known to those skilled in the art.
  • base addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired base, either neat or in a suitable inert solvent.
  • pharmaceutically acceptable base addition salts include sodium, potassium, calcium, ammonium, organic amino, or magnesium salt, or a similar salt.
  • acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent.
  • pharmaceutically acceptable acid addition salts include those derived from inorganic acids like hydrochloric, hydrobromic, nitric, carbonic, monohydrogencarbonic, phosphoric, monohydrogenphosphoric,
  • salts of amino acids such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like (see, for example, Berge el al, “Pharmaceutical Salts”, Journal of Pharmaceutical Science, 1977, 66, 1-19).
  • Certain specific compounds of the present invention contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts.
  • the neutral forms of the compounds are preferably regenerated by contacting the salt with a base or acid and isolating the parent compound in the conventional manner.
  • the parent form of the compound may differ from the various salt forms in certain physical properties, such as solubility in polar solvents.
  • the present invention provides compounds, which are in a prodrug form.
  • Prodrugs of the compounds described herein are those compounds that readily undergo chemical changes under physiological conditions to provide the compounds of the present invention.
  • Prodrugs of the compounds described herein may be converted in vivo after administration.
  • prodrugs can be converted to the compounds of the present invention by chemical or biochemical methods in an ex vivo environment, such as, for example, when contacted with a suitable enzyme or chemical reagent.
  • Certain compounds of the present invention can exist in unsolvated forms as well as solvated forms, including hydrated forms. In general, the solvated forms are equivalent to unsolvated forms and are encompassed within the scope of the present invention. Certain compounds of the present invention may exist in multiple crystalline or amorphous forms. In general, all physical forms are equivalent for the uses contemplated by the present invention and are intended to be within the scope of the present invention.
  • “Pharmaceutically acceptable excipient” and“pharmaceutically acceptable carrier” refer to a substance that aids the administration of an active agent to and absorption by a subject and can be included in the compositions of the present invention without causing a significant adverse toxicological effect on the patient.
  • Non-limiting examples of pharmaceutically acceptable excipients include water, NaCl, normal saline solutions, lactated Ringer’s, normal sucrose, normal glucose, binders, fillers, disintegrants, lubricants, coatings, sweeteners, flavors, salt solutions (such as Ringer's solution), alcohols, oils, gelatins, carbohydrates such as lactose, amylose or starch, fatty acid esters, hydroxymethycellulose, polyvinyl pyrrolidine, and colors, and the like.
  • Such preparations can be sterilized and, if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
  • auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
  • auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
  • auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents
  • preparation is intended to include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it.
  • carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it.
  • cachets and lozenges are included. Tablets, powders, capsules, pills, cachets, and lozenges can be used as solid dosage forms suitable for oral administration.
  • Contacting is used in accordance with its plain ordinary meaning and refers to the process of allowing at least two distinct species (e.g. chemical compounds including biomolecules or cells) to become sufficiently proximal to react, interact or physically touch.
  • species e.g. chemical compounds including biomolecules or cells
  • the resulting reaction product can be produced directly from a reaction between the added reagents or from an intermediate from one or more of the added reagents that can be produced in the reaction mixture.
  • the term“contacting” may include allowing two species to react, interact, or physically touch, wherein the two species may be a compound as described herein and a protein or enzyme. In some embodiments contacting includes allowing a compound described herein to interact with a protein or enzyme that is involved in a signaling pathway.
  • the terms“disease” or“condition” refer to a state of being or health status of a patient or subject capable of being treated with the compounds or methods provided herein.
  • the disease may be a cancer.
  • “cancer” refers to human cancers and carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, etc., including solid and lymphoid cancers, kidney, breast, lung, bladder, colon, ovarian, prostate, pancreas, stomach, brain, head and neck, skin, uterine, testicular, glioma, esophagus, and liver cancer, including hepatocarcinoma, lymphoma, including B-acute lymphoblastic lymphoma, non-Hodgkin’s lymphomas ( e.g ., Burkitt’s, Small Cell, and Large Cell lymphomas), Hodgkin’s lymphoma, leukemia (including AML, ALL, and CML), or multiple
  • cancer refers to all types of cancer, neoplasm or malignant tumors found in mammals (e.g. humans), including leukemia, carcinomas and sarcomas.
  • leukemia refers broadly to progressive, malignant diseases of the blood-forming organs and is generally characterized by a distorted proliferation and development of leukocytes and their precursors in the blood and bone marrow.
  • sarcoma generally refers to a tumor which is made up of a substance like the embryonic connective tissue and is generally composed of closely packed cells embedded in a fibrillar or homogeneous substance.
  • melanoma is taken to mean a tumor arising from the melanocytic system of the skin and other organs.
  • carcinoma refers to a malignant new growth made up of epithelial cells tending to infiltrate the surrounding tissues and give rise to metastases.
  • exemplary carcinomas that may be treated with a compound or method provided herein include, for example, medullary thyroid carcinoma, familial medullary thyroid carcinoma, acinar carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, carcinoma adenomatosum, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma, basal cell carcinoma, carcinoma basocellulare, basaloid carcinoma, basosquamous cell carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma, chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid
  • treating refers to any indicia of success in the therapy or amelioration of an injury, disease, pathology or condition, including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the injury, pathology or condition more tolerable to the patient; slowing in the rate of
  • the treatment or amelioration of symptoms can be based on objective or subjective parameters; including the results of a physical examination, neuropsychiatric exams, and/or a psychiatric evaluation.
  • the term "treating" and conjugations thereof, may include prevention of an injury, pathology, condition, or disease.
  • treating is preventing. In embodiments, treating does not include preventing.
  • “Patient” or“subject in need thereof’ refers to a living organism suffering from or prone to a disease or condition that can be treated by administration of a pharmaceutical composition as provided herein.
  • Non-limiting examples include humans, other mammals, bovines, rats, mice, dogs, monkeys, goat, sheep, cows, deer, and other non-mammalian animals.
  • a patient is human.
  • A“effective amount” is an amount sufficient for a compound to accomplish a stated purpose relative to the absence of the compound (e.g. achieve the effect for which it is administered, treat a disease, reduce enzyme activity, increase enzyme activity, reduce a signaling pathway, or reduce one or more symptoms of a disease or condition).
  • An example of an“effective amount” is an amount sufficient to contribute to the treatment, prevention, or reduction of a symptom or symptoms of a disease, which could also be referred to as a “therapeutically effective amount.”
  • A“reduction” of a symptom or symptoms means decreasing of the severity or frequency of the symptom(s), or elimination of the symptom(s).
  • A“prophylactically effective amount” of a drug is an amount of a drug that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of an injury, disease, pathology or condition, or reducing the likelihood of the onset (or reoccurrence) of an injury, disease, pathology, or condition, or their symptoms.
  • the full prophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses.
  • a prophylactically effective amount may be administered in one or more administrations.
  • An“activity decreasing amount,” as used herein, refers to an amount of antagonist required to decrease the activity of an enzyme relative to the absence of the antagonist.
  • A“function disrupting amount,” as used herein, refers to the amount of antagonist required to disrupt the function of an enzyme or protein relative to the absence of the antagonist. The exact amounts will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); and Remington: The Science and Practice of Pharmacy, 20th Edition, 2003, Gennaro, Ed., Lippincott, Williams & Wilkins).
  • the therapeutically effective amount can be initially determined from cell culture assays. Target concentrations will be those
  • therapeutically effective amounts for use in humans can also be determined from animal models.
  • a dose for humans can be formulated to achieve a concentration that has been found to be effective in animals.
  • the dosage in humans can be adjusted by monitoring compounds effectiveness and adjusting the dosage upwards or downwards, as described above. Adjusting the dose to achieve maximal efficacy in humans based on the methods described above and other methods is well within the capabilities of the ordinarily skilled artisan.
  • Dosages may be varied depending upon the requirements of the patient and the compound being employed.
  • the dose administered to a patient, in the context of the present invention should be sufficient to effect a beneficial therapeutic response in the patient over time.
  • the size of the dose also will be determined by the existence, nature, and extent of any adverse side effects. Determination of the proper dosage for a particular situation is within the skill of the practitioner. Generally, treatment is initiated with smaller dosages which are less than the optimum dose of the compound. Thereafter, the dosage is increased by small increments until the optimum effect under circumstances is reached. Dosage amounts and intervals can be adjusted individually to provide levels of the administered compound effective for the particular clinical indication being treated. This will provide a therapeutic regimen that is commensurate with the severity of the individual's disease state.
  • the term“about” means a range of values including the specified value, which a person of ordinary skill in the art would consider reasonably similar to the specified value. In embodiments, about means within a standard deviation using
  • about means a range extending to +/- 10% of the specified value. In embodiments, about includes the specified value.
  • administering means oral administration, administration as a suppository, topical contact, intravenous, intraperitoneal, intramuscular, intralesional, intrathecal, intranasal or subcutaneous administration, or the implantation of a slow-release device, e.g., a mini-osmotic pump, to a subject.
  • Administration is by any route, including parenteral and transmucosal (e.g, buccal, sublingual, palatal, gingival, nasal, vaginal, rectal, or transdermal) compatible with the preparation.
  • Parenteral administration includes, e.g, intravenous, intramuscular, intra-arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial.
  • Other modes of delivery include, but are not limited to, the use of liposomal formulations, intravenous infusion, transdermal patches, etc.
  • Co-administer it is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of one or more additional therapies.
  • the compounds of the invention can be administered alone or can be
  • compositions of the present invention can be delivered transdermally, by a topical route, or formulated as applicator sticks, solutions, suspensions, emulsions, gels, creams, ointments, pastes, jellies, paints, powders, and aerosols.
  • A“cell” as used herein, refers to a cell carrying out metabolic or other function sufficient to preserve or replicate its genomic DNA.
  • a cell can be identified by well-known methods in the art including, for example, presence of an intact membrane, staining by a particular dye, ability to produce progeny or, in the case of a gamete, ability to combine with a second gamete to produce a viable offspring.
  • Cells may include prokaryotic and eukaroytic cells.
  • Control or“control experiment” is used in accordance with its plain ordinary meaning and refers to an experiment in which the subjects or reagents of the experiment are treated as in a parallel experiment except for omission of a procedure, reagent, or variable of the experiment. In some instances, the control is used as a standard of comparison in evaluating experimental effects. In some embodiments, a control is the measurement of the activity of a protein in the absence of a compound as described herein (including
  • modulator refers to a composition that increases or decreases the level of a target molecule or the function of a target molecule or the physical state of the target of the molecule.
  • modulate is used in accordance with its plain ordinary meaning and refers to the act of changing or varying one or more properties.“Modulation” refers to the process of changing or varying one or more properties. For example, as applied to the effects of a modulator on a target protein, to modulate means to change by increasing or decreasing a property or function of the target molecule or the amount of the target molecule.
  • the term“associated” or“associated with” in the context of a substance or substance activity or function associated with a disease means that the disease (e.g. cancer) is caused by (in whole or in part), or a symptom of the disease is caused by (in whole or in part) the substance or substance activity or function.
  • aberrant refers to different from normal. When used to describe enzymatic activity or protein function, aberrant refers to activity or function that is greater or less than a normal control or the average of normal non-diseased control samples. Aberrant activity may refer to an amount of activity that results in a disease, wherein returning the aberrant activity to a normal or non-disease-associated amount (e.g. by administering a compound or using a method as described herein), results in reduction of the disease or one or more disease symptoms.
  • signaling pathway refers to a series of interactions between cellular and optionally extra-cellular components (e.g. proteins, nucleic acids, small molecules, ions, lipids) that conveys a change in one component to one or more other components, which in turn may convey a change to additional components, which is optionally propogated to other signaling pathway components.
  • extra-cellular components e.g. proteins, nucleic acids, small molecules, ions, lipids
  • Anti-cancer agent and“anticancer agent” are used in accordance with their plain ordinary meaning and refers to a composition (e.g. compound, drug, antagonist, inhibitor, modulator) having antineoplastic properties or the ability to inhibit the growth or proliferation of cells.
  • an anti-cancer agent is a chemotherapeutic.
  • an anti-cancer agent is an agent identified herein having utility in methods of treating cancer.
  • an anti-cancer agent is an agent approved by the FDA or similar regulatory agency of a country other than the USA, for treating cancer. Examples of anti-cancer agents include, but are not limited to, MEK (e.g. MEK1, MEK2, or MEK1 and MEK2) inhibitors (e.g.
  • alkylating agents e.g., cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan, mechlorethamine, uramustine, thiotepa, nitrosoureas, nitrogen mustards (e.g., mechloroethamine, cyclophosphamide, chlorambucil, meiphalan), ethylenimine and methylmelamines (e.g., hexamethlymelamine, thiotepa), alkyl sulfonates
  • alkylating agents e.g., cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan, mechlorethamine, uramustine, thiotepa, nitrosoureas, nitrogen mustards (e.g., mechloroethamine, cyclophosphamide, chlorambuci
  • adecypenol adozelesin; aldesleukin; ALL-TK antagonists; altretamine; ambamustine;
  • amidox amifostine; aminolevulinic acid; amrubicin; amsacrine; anagrelide; anastrozole; andrographolide; angiogenesis inhibitors; antagonist D; antagonist G; antarelix; anti- dorsalizing morphogenetic protein- 1; antiandrogen, prostatic carcinoma; antiestrogen;
  • antineoplaston antisense oligonucleotides; aphidicolin glycinate; apoptosis gene modulators; apoptosis regulators; apurinic acid; ara-CDP-DL-PTBA; arginine deaminase; asulacrine; atamestane; atrimustine; axinastatin 1; axinastatin 2; axinastatin 3; azasetron; azatoxin;
  • azatyrosine baccatin III derivatives; balanol; batimastat; BCR/ABL antagonists;
  • benzochlorins benzoylstaurosporine; beta lactam derivatives; beta-alethine; betaclamycin B; betulinic acid; bFGF inhibitor; bicalutamide; bisantrene; bisaziridinylspermine; bisnafide; bistratene A; bizelesin; breflate; bropirimine; budotitane; buthionine sulfoximine;
  • calcipotriol calphostin C; camptothecin derivatives; canarypox IL-2; capecitabine;
  • carboxamide-amino-triazole carboxyamidotriazole; CaRest M3; CARN 700; cartilage derived inhibitor; carzelesin; casein kinase inhibitors (ICOS); castanospermine; cecropin B; cetrorelix; chlorins; chloroquinoxaline sulfonamide; cicaprost; cis-porphyrin; cladribine; clomifene analogues; clotrimazole; collismycin A; collismycin B; combretastatin A4;
  • combretastatin analogue conagenin; crambescidin 816; crisnatol; cryptophycin 8;
  • cryptophycin A derivatives curacin A; cyclopentanthraquinones; cycloplatam; cypemycin; cytarabine ocfosfate; cytolytic factor; cytostatin; dacliximab; decitabine; dehydrodidemnin B; deslorelin; dexamethasone; dexifosfamide; dexrazoxane; dexverapamil; diaziquone;
  • didemnin B didemnin B; didox; diethylnorspermine; dihydro-5-azacytidine; 9-dioxamycin; diphenyl spiromustine; docosanol; dolasetron; doxifluridine; droloxifene; dronabinol; duocarmycin SA; ebselen; ecomustine; edelfosine; edrecolomab; eflornithine; elemene; emitefur;
  • epirubicin epristeride
  • estramustine analogue epristeride
  • estrogen agonists epristeride
  • estrogen antagonists epristeride
  • estramustine analogue epristeride
  • estrogen agonists epristeride
  • estrogen antagonists epristeride
  • etanidazole etoposide phosphate; exemestane; fadrozole; trasrabine; fenretinide; filgrastim; finasteride; flavopiridol; flezelastine; fluasterone; fludarabine; fluorodaunorunicin
  • hydrochloride forfenimex; formestane; fostriecin; fotemustine; gadolinium texaphyrin;
  • gallium nitrate galocitabine; ganirelix; gelatinase inhibitors; gemcitabine; glutathione inhibitors; hepsulfam; heregulin; hexamethylene bisacetamide; hypericin; ibandronic acid; idarubicin; idoxifene; idramantone; ilmofosine; ilomastat; imidazoacridones; imiquimod; immunostimulant peptides; insulin-like growth factor- 1 receptor inhibitor; interferon agonists; interferons; interleukins; iobenguane; iododoxorubicin; ipomeanol, 4-; iroplact; irsogladine; isobengazole; isohomohalicondrin B; itasetron; jasplakinolide; kahalalide F; lamellarin-N triacetate; lanreotide; lein
  • leuprolide+estrogen+progesterone leuprorelin; levamisole; liarozole; linear polyamine analogue; lipophilic disaccharide peptide; lipophilic platinum compounds; lissoclinamide 7; lobaplatin; lombricine; lometrexol; lonidamine; losoxantrone; lovastatin; loxoribine;
  • marimastat masoprocol; maspin; matrilysin inhibitors; matrix metalloproteinase inhibitors; menogaril; merbarone; meterelin; methioninase; metoclopramide; MTF inhibitor;
  • mifepristone miltefosine; mirimostim; mismatched double stranded RNA; mitoguazone; mitolactol; mitomycin analogues; mitonafide; mitotoxin fibroblast growth factor-saporin; mitoxantrone; mofarotene; molgramostim; monoclonal antibody, human chorionic gonadotrophin; monophosphoryl lipid A+myobacterium cell wall sk; mopidamol; multiple drug resistance gene inhibitor; multiple tumor suppressor 1 -based therapy; mustard anticancer agent; mycaperoxide B; mycobacterial cell wall extract; myriaporone; N-acetyldinaline; N- substituted benzamides; nafarelin; nagrestip; naloxone+pentazocine; napavin; naphterpin; nartograstim; nedaplatin; nemorubicin; neridronic acid;
  • octreotide okicenone; oligonucleotides; onapristone; ondansetron; ondansetron; oracin; oral cytokine inducer; ormaplatin; osaterone; oxaliplatin; oxaunomycin; palauamine;
  • palmitoylrhizoxin pamidronic acid; panaxytriol; panomifene; parabactin; pazelliptine;
  • pegaspargase peldesine; pentosan polysulfate sodium; pentostatin; pentrozole; perflubron; perfosfamide; perillyl alcohol; phenazinomycin; phenylacetate; phosphatase inhibitors; picibanil; pilocarpine hydrochloride; pirarubicin; piritrexim; placetin A; placetin B;
  • plasminogen activator inhibitor platinum complex; platinum compounds; platinum-triamine complex; porfimer sodium; porfiromycin; prednisone; propyl bis-acridone; prostaglandin J2; proteasome inhibitors; protein A-based immune modulator; protein kinase C inhibitor;
  • protein kinase C inhibitors microalgal; protein tyrosine phosphatase inhibitors; purine nucleoside phosphorylase inhibitors; purpurins; pyrazoloacridine; pyridoxylated hemoglobin polyoxyethylerie conjugate; raf antagonists; raltitrexed; ramosetron; ras farnesyl protein transferase inhibitors; ras inhibitors; ras-GAP inhibitor; retelliptine demethylated; rhenium Re 186 etidronate; rhizoxin; ribozymes; RII retinamide; rogletimide; rohitukine; romurtide; roquinimex; rubiginone B 1 ; ruboxyl; safmgol; saintopin; SarCNU; sarcophytol A;
  • oligonucleotides oligonucleotides; signal transduction inhibitors; signal transduction modulators; single chain antigen-binding protein; sizofuran; sobuzoxane; sodium borocaptate; sodium phenylacetate; solverol; somatomedin binding protein; sonermin; sparfosic acid; spicamycin D;
  • spiromustine splenopentin
  • spongistatin 1 squalamine
  • stem cell inhibitor stem-cell division inhibitors
  • stipiamide stem-cell division inhibitors
  • stromelysin inhibitors sulfmosine
  • superactive vasoactive intestinal peptide antagonist suradista; suramin; swainsonine; synthetic glycosaminoglycans;
  • tallimustine tallimustine; tamoxifen methiodide; tauromustine; tazarotene; tecogalan sodium; tegafur; tellurapyrylium; telomerase inhibitors; temoporfm; temozolomide; teniposide;
  • thrombopoietin mimetic thymalfasin; thymopoietin receptor agonist; thymotrinan; thyroid stimulating hormone; tin ethyl etiopurpurin; tirapazamine; titanocene bichloride; topsentin; toremifene; totipotent stem cell factor; translation inhibitors; tretinoin; triacetyluridine;
  • triciribine trimetrexate; triptorelin; tropisetron; turosteride; tyrosine kinase inhibitors;
  • tyrphostins UBC inhibitors; ubenimex; urogenital sinus-derived growth inhibitory factor; urokinase receptor antagonists; vapreotide; variolin B; vector system, erythrocyte gene therapy; velaresol; veramine; verdins; verteporfm; vinorelbine; vinxaltine; vitaxin; vorozole; zanoterone; zeniplatin; zilascorb; zinostatin stimalamer, Adriamycin, Dactinomycin, Bleomycin, Vinblastine, Cisplatin, acivicin; aclarubicin; acodazole hydrochloride; acronine; adozelesin; aldesleukin; altretamine; ambomycin; ametantrone acetate; aminoglutethimide; amsacrine; anastrozole; anthramycin; asparaginase; asperlin; azacitidine;
  • azotomycin batimastat; benzodepa; bicalutamide; bisantrene hydrochloride; bisnafide dimesylate; bizelesin; bleomycin sulfate; brequinar sodium; bropirimine; busulfan; cactinomycin; calusterone; caracemide; carbetimer; carboplatin; carmustine; carubicin hydrochloride; carzelesin; cedefmgol; chlorambucil; cirolemycin; cladribine; crisnatol mesylate; cyclophosphamide; cytarabine; dacarbazine; daunorubicin hydrochloride;
  • decitabine dexormaplatin; dezaguanine; dezaguanine mesylate; diaziquone; doxorubicin; doxorubicin hydrochloride; droloxifene; droloxifene citrate; dromostanolone propionate; duazomycin; edatrexate; eflomithine hydrochloride; elsamitrucin; enloplatin; enpromate; epipropidine; epirubicin hydrochloride; erbulozole; esorubicin hydrochloride; estramustine; estramustine phosphate sodium; etanidazole; etoposide; etoposide phosphate; etoprine; fadrozole hydrochloride; camrabine; fenretinide; floxuridine; fludarabine phosphate;
  • melphalan menogaril; mercaptopurine; methotrexate; methotrexate sodium; metoprine; meturedepa; mitindomide; mitocarcin; mitocromin; mitogillin; mitomalcin; mitomycin; mitosper; mitotane; mitoxantrone hydrochloride; mycophenolic acid; nocodazoie;
  • Taxol.TM i.e. paclitaxel
  • Taxotere.TM compounds comprising the taxane skeleton, Erbulozole (i.e. R- 55104), Dolastatin 10 (i.e. DLS-10 and NSC-376128), Mivobulin isethionate (i.e. as CI-980), Vincristine, NSC-639829, Discodermolide (i.e. as NVP-XX-A-296), ABT-751 (Abbott, i.e. E-7010), Altorhyrtins (e.g. Altorhyrtin A and Altorhyrtin C), Spongistatins (e.g.
  • Epothilone A or dEpoA desoxyepothilone A or dEpoA
  • Epothilone D i.e. KOS-862, dEpoB, and desoxyepothilone B
  • Epothilone E Epothilone F
  • Epothilone B N-oxide Epothilone A N-oxide
  • l6-aza- epothilone B i.e. BMS-310705
  • 21 -hydroxy epothilone D i.e.
  • WS-9885B GS-164 (Takeda), GS- 198 (Takeda), KAR-2 (Hungarian Academy of Sciences), BSF-223651 (BASF, i.e. ILX-651 and LU-223651), SAH-49960 (Lilly/Novartis), SDZ-268970 (Lilly/Novartis), AM-97 (Armad/Kyowa Hakko), AM-132 (Armad), AM-138 (Armad/Kyowa Hakko), IDN-5005 (Indena), Cryptophycin 52 (i.e. LY-355703), AC-7739 (Ajinomoto, i.e.
  • AVE-8063A and CS- 39.HC1 AC-7700 (Ajinomoto, i.e. AVE-8062, AVE-8062A, CS-39-L-Ser.HCl, and RPR- 258062A), Vitilevuamide, Tubulysin A, Canadensol, Centaureidin (i.e. NSC-106969), T- 138067 (Tularik, i.e. T-67, TL-138067 and TI-138067), COBRA-l (Parker Hughes Institute, i.e. DDE-261 and WHI-261), H10 (Kansas State ETniversity), H16 (Kansas State University), Oncocidin Al (i.e.
  • NSCL-96F03-7 D-68838 (Asta Medica), D-68836 (Asta Medica), Myoseverin B, D-43411 (Zentaris, i.e. D-81862), A- 289099 (Abbott), A-318315 (Abbott), HTI-286 (i.e.
  • SPA-110, trifluoroacetate salt) (Wyeth), D-82317 (Zentaris), D-82318 (Zentaris), SC-12983 (NCI), Resverastatin phosphate sodium, BPR-OY-007 (National Health Research Institutes), and SSR-250411 (Sanofi)), steroids (e.g ., dexamethasone), finasteride, aromatase inhibitors, gonadotropin-releasing hormone agonists (GnRH) such as goserelin or leuprolide, adrenocorticosteroids (e.g., prednisone), progestins (e.g., hydroxyprogesterone caproate, megestrol acetate, medroxyprogesterone acetate), estrogens (e.g., diethlystilbestrol, ethinyl estradiol), antiestrogen (e.g., tamoxifen), androgens (e
  • “Chemotherapeutic” or“chemotherapeutic agent” is used in accordance with its plain ordinary meaning and refers to a chemical composition or compound having antineoplastic properties or the ability to inhibit the growth or proliferation of cells.
  • SEIMO protein or“small ubiquitin-like modifier protein” is a family of proteins that are covalently attached to other proteins to modify their function. SEIMO proteins are members of the ubiquitin-like protein family. SEIMO modification is involved in various cellular processes, for example, nuclear-cytosolic transport, transcriptional regulation, apoptosis, and protein stability.
  • the term“Ubiquitin-activating enzyme” or“El enzyme” or“El” refers to a protein (including homologs, isoforms, and functional fragments thereof) that catalyzes the first step in the ubiquitination reaction, which can target a protein for degradation.
  • El enzymes are capable of catalyzing SEIMO modification.
  • the El enzyme is encoded by EIBA1.
  • the El enzyme is encoded by EGBA2.
  • the El enzyme is encoded by EGBA3.
  • the El enzyme is encoded by EGBA4.
  • the El enzyme is encoded by EGBA5.
  • the El enzyme is encoded by EGBA6.
  • the El enzyme is encoded by EGBA7.
  • the El enzyme is encoded by ATG7.
  • the El enzyme is encoded by NAE1.
  • the El enzyme is encoded by SAE1.
  • the term“SEIMO-activating enzyme subunit 2” or“EGBA2” or“EGBA2 subunit 2” is a protein involved in SEIMO modification.
  • the term“EGBA2” refers to the nucleotide sequences or proteins of human EGBA2.
  • the term“EGBA2” includes both the wild type form of the nucleotide sequences or proteins as well as any mutants thereof. In some
  • “EGBA2” is wild-type EGBA2. In some embodiments,“EGBA2” is one or more mutant forms.
  • the term“EGB A2” XYZ refers to a nucleotide sequence or protein of a mutant EGBA2 wherein the Y numbered amino acid of EGBA2 has an X amino acid in the wild type instead has a Z amino acid in the mutant.
  • EGBA2 is a functional fragment thereof.
  • EGBA2 refers to RefSeq (mRNA) NM_005499.2 or RefSeq
  • EGBA2 refers to ElniProt Q9EIBT2, having the sequence:
  • L 1 and L 2 are independently a bond, -0-, -S-, -S(O)-, -S(0) 2 -, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -C(0)NHNH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene (e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or C1-C2), substituted or unsubstituted heteroalkyl ene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C3-C6, C 4 -C 6
  • L 3 is -0-, -S-, -N-, -S(O)-, -S(0) 2 -, -C(O)-, -N(R 7 )-, substituted or unsubstituted alkylene (e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2 ) or substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered).
  • alkylene e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • heteroalkylene e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered.
  • L 6 is substituted or unsubstituted alkylene (e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2 ), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C 6 -Ci 2 , C 6 -Cio, or phenylene), or substituted or substituted or
  • V is -O- or -N(R 10 )-.
  • L 8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, -S-, -S(O)-, -S(0) 2 -, substituted or unsubstituted alkylene (e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or C1-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C3-C6, C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6
  • L 9 is a bond, -O-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-, -NHC(0)NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene (e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2 ), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkylene (e.g.
  • R 1 is hydrogen, halogen, -CX , -CHXS, -CHiX 1 , -OCX ⁇ , -OCHiX 1 , -OCHX , -CN, -SOniR 1A , -SO VI NR 1A R 1b , -NHC(0)NR 1A R 1b , -N(0) mi , -NR 1A R 1B , -NHNR 1A R 1B , -C(0)R 1A , -C(0)-OR 1a , -C(0)NR 1A R 1b , -C(0)NHNR 1A R 1b , -OR 1a , -NR 1A S0 2 R 1B ,
  • R 2 is hydrogen, halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 , -OCHX 2 2 , -CN, -SO Rule2R 2A , -SO V2 NR 2A R 2B , -NHC(0)NR 2A R 2B , -N(0)m2, -NR 2A R 2B , -NHNR 2A R 2B , -C(0)R 2A , -C(0)-OR 2A , -C(0)NR 2A R 2B , -C(0)NHNR 2A R 2B , -OR 2A , -NR 2A SO 2 R 2B , -NR 2A C(0)R 2B , -NR 2A C(0)0R 2B , -NR 2A OR 2B , -N 3 , -L 2 -E 2 , substituted or unsubstitute
  • R 1 and R 2 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • R 3 is hydrogen, halogen, -CX 3 3 , -CHX 3 2 , -CH 2 X 3 , -OCX 3 3 , -OCH 2 X 3 , -OCHX 3 2 , -CN, -SOfinityR 3A , -SO V3 NR 3A R 3B , -NHC(0)NR 3A R 3B , -N(0) ⁇ , -NR 3A R 3B , -NHNR 3A R 3B , -C(0)R 3A , -C(0)-OR 3A , -C(0)NR 3A R 3B , -OR 3A , -NR 3A S0 2 R 3B , -NR 3A C(0)R 3B ,
  • R 4 is hydrogen, halogen, -CX 4 3 , -CHX 4 2 , -CH 2 X 4 , -OCX 4 3 , -OCH 2 X 4 , -OCHX 4 2 , -CN, -SO n4 R 4A , -SO V4 NR 4A R 4B , -NHC(0)NR 4A R 4B , -N(0) m4 , -NR 4A R 4B , -NHNR 4A R 4B , -C(0)R 4A , -C(0)-OR 4A , -C(0)NR 4A R 4B , -C(0)NHNR 4A R 4B , -OR 4A , -NR 4A SO 2 R 4B ,
  • R 5 is hydrogen, halogen, -CX 5 3 , -CHX 5 2 , -CH 2 X 5 , -OCX 5 3 , -OCH 2 X 5 , -OCHX 5 2 , -CN, -SOn5R 5A , -SO V5 NR 5A R 5B , -NHC(0)NR 5A R 5B , -N(0) m5 , -NR 5A R 5B , -NHNR 5A R 5B , -C(0)R 5A , -C(0)-OR 5A , -C(0)NR 5A R 5B , -C(0)NHNR 5A R 5B , -OR 5A , -NR 5A SO 2 R 5B ,
  • R 4 and R 5 may optionally be joined to form a substituted or unsubstituted cycloalkyl (e.g., C 3 -Cx, C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 4 and R 5 are joined to form a substituted or unsubstituted phenyl.
  • R 4 and R 5 are joined to form a substitute
  • R 6 is hydrogen, halogen, -CX ⁇ -CHX 6 2 , -CH2X 6 , -OCX 6 3 , -OCH2X 6 , -OCHX 6 2 , -CN, -SO n6 R 6A , -SO V6 NR 6A R 6B , -NHC(0)NR 6A R 6B , -N(0) m6 , -NR 6A R 6B , -NHNR 6A R 6B , -C(0)R 6A , -C(0)-OR 6A , -C(0)NR 6A R 6B , -C(0)NHNR 6A R 6B , -OR 6A , -NR 6A SO 2 R 6B ,
  • R 7 is hydrogen, halogen, -CX 7 3 , -CHX 7 2 , -CH 2 X 7 , -OCX 7 3 , -OCH 2 X 7 , -OCHX 7 2 , -CN, -SOnvR 7A , -SO VV NR 7A R 7B , -NHC(0)NR 7A R 7B , -N(0) m v, -NR 7A R 7B , -NHNR 7A R 7B , -C(0)R 7A , -C(0)-OR 7A , -C(0)NR 7A R 7B , -C(0)NHNR 7A R 7B , -OR 7A , -NR 7A SO 2 R 7B ,
  • R 8 is hydrogen, halogen, -CX 8 3 , -CHX 8 2 , -CH 2 X 8 , -OCX 8 3 , -OCH 2 X 8 , -OCHX 8 2 , -CN, -SO n8 R 8A , -SO V8 NR 8A R 8B , -NHC(0)NR 8A R 8B , -N(0) m8 , -NR 8A R 8B , -NHNR 8A R 8B , -C(0)R 8A , -C(0)-OR 8A , -C(0)NR 8A R 8B , -C(0)NHNR 8A R 8B , -OR 8A , -NR 8A SO 2 R 8B ,
  • R 9 is hydrogen, halogen, -CX 9 3 , -CHX 9 2 , -CH 2 X 9 , -OCX 9 3 , -OCH 2 X 9 , -OCHX 9 2 , -CN, -SO consequence9R 9A , -SO V9 NR 9A R 9B , -NHC(0)NR 9A R 9B , -N(0)m9, -NR 9A R 9B , -NHNR 9A R 9B , -C(0)R 9A , -C(0)-OR 9A , -C(0)NR 9A R 9B , -C(0)NHNR 9A R 9B , -OR 9A , -NR 9A SO 2 R 9B ,
  • R 10 is hydrogen, halogen, -CX 10 3 , -CHX 10 2 , -CH 2 X 10 , -OCX 10 3 , -OCH 2 X 10 ,
  • E 1 and E 2 are independently an electron- withdrawing moiety.
  • R 1A is hydrogen, halogen, -CX 1A 3 , -CHX 1A 2 , -CH 2 X 1A , -OCX 1A 3 , -OCH 2 X 1A , -OCHX 1A 2 , -CN, -SOni A R 1AA , -SO V IANR 1AA R 1ab , -NHC(0)NR 1AA R 1AB , -N(0) miA ,
  • R 2A is hydrogen, halogen, -CX 2A 3 , -CHX 2A 2 , -CH 2 X 2A , -OCX 2A 3 , -OCH 2 X 2A , -OCHX 2A 2 , -CN, -SO n2A R 2AA , -SO V2A NR 2AA R 2AB , -NHC(0)NR 2AA R 2AB , -N(0) m2A ,
  • R 2B is hydrogen, halogen, -CX 2B 3 , -CHX 2B 2 , -CH 2 X 2B , -OCX 2B 3 , -OCH 2 X 2B , -OCHX 2B 2 , -CN, -SO Rules 2 BR 2BA , -SO V2B NR 2BA R 2BB , -NHC(0)NR 2BA R 2BB , -N(0) m2B ,
  • -NR 2BA R 2BB -NHNR 2BA R 2BB , -C(0)R 2BA , -C(0)-OR 2BA , -C(0)NR 2BA R 2BB , -OR 2BA , -NR 2BA S0 2 R 2BB , -NR 2BA C(0)R 2BB , -NR 2BA C(0)0R 2BB , -NR 2BA OR 2BB , -N 3 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • vl, v2, v3, v4, v5, v6, v7, v8, v9, vlO, vl A, v2A, and v2B are independently 1 or 2.
  • nl, n2, n3, n4, n5, n6, n7, n8, n9, nlO, nlA, n2A, and n2B are independently an integer from 0 to 4.
  • X, X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 1A , X 2A , and X 2B are independently -Cl, -Br, -I or -F.
  • L 1 and L 2 are independently a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene (e.g., C i-Cx, Ci-C 6 , Ci-C 4 , or C1-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C3-C6, C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heteroalkylene (e.g
  • L 7 is independently -0-. In embodiments, L 7 is independently - N(R 10 )-.
  • L 8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, substituted or unsubstituted alkylene (e.g., C i-Cx, Ci-C 6 , Ci-C 4 , or C1-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.
  • alkylene e
  • R 6 is independently -L 6 (-L 7 -L 8 -R 8 )(-L 9 -R 9 ). In embodiments R 6 is
  • R 3 , R 4 , R 5 , R 8 , R 9 , R 1A , R 2A , R 2B , L 3 , L 6 , L 7 , L 8 , and L 9 are as described herein.
  • R 8 and R 9 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, a substituted or unsubstituted heterocycloalkyl, a substituted or unsubstituted aryl, or a substituted or unsubstituted heteroaryl.
  • the compound has the formula:
  • R 1A , R 2A , R 2B , R 3 , R 4 , R 5 , R 8 , R 9 , and L 9 are as described herein.
  • R 8 and R 9 substituents may optionally be joined to form a substituted or unsubstituted heterocycloalkyl, or a substituted or unsubstituted heteroaryl.
  • the compound has the formula:
  • R 1A , R 2A , R 2B , R 3 , R 8 , R 9 , and L 9 are as described herein.
  • R 8 and R 9 substituents may optionally be joined to form a substituted or unsubstituted heterocycloalkyl, or a substituted or unsubstituted heteroaryl.
  • the compound has the formula:
  • R 1A , R 2A , R 2B , R 3 , R 9 , and L 9 are as described herein.
  • R 41 is independently halogen, -CX 41 3 , -CHX 41 2 , -CH 2 X 41 , -C(0)0H, -C(0)NH 2 ,
  • R 41 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • z4l is an integer from 0 to 5.
  • X 41 is independently -Cl, -Br, -I, or -F.
  • the compound has the formula:
  • R 1A , R 2A , R 2B , R 3 , R 8 , R 9 , L 6 , L 7 , L 8 and L 9 are as described herein.
  • R 8 and R 9 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, a substituted or unsubstituted heterocycloalkyl, a substituted or unsubstituted aryl, or a substituted or unsubstituted heteroaryl.
  • L 10 is independently a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-,
  • R 11 is hydrogen, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • L 10 is independently a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene (e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or C1-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C3-C6, C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkylene
  • a substituted L 10 (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L 10 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • substituted L 10 e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene
  • R 11 is hydrogen, halogen, substituted or unsubstituted alkyl (e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -Ci 2 ,
  • a substituted R 11 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 11 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 11 when R 11 is substituted, it is substituted with at least one substituent group.
  • R 11 when R 11 is substituted, it is substituted with at least one size-limited substituent group.
  • R 11 when R 11 is substituted, it is substituted with at least one lower substituent group.
  • L 3 is -0-, -S-, or -N(R 7 )-.
  • V is -O- or -N(R 10 )-.
  • R 1A is hydrogen, halogen, -CX 1A 3 , -CHX 1A 2 , -CH 2 X 1A , -OCX 1A 3 , -OCH 2 X 1A ,
  • R 2A is hydrogen, halogen, -CX 2A 3 , -CHX 2A 2 , -CH 2 X 2A , -OCX 2A 3 , -OCH 2 X 2A , -OCHX 2A 2 , -CN, -SOn2 A R 2AA , -SO V2 ANR 2AA R 2AB , -NHC(0)NR 2AA R 2AB , -N(0) m2A ,
  • R 2B is hydrogen, halogen, -CX 2B 3 , -CHX 2B 2 , -CH 2 X 2B , -OCX 2B 3 , -OCH 2 X 2B , -OCHX 2B 2 , -CN, -SO Rules 2B R 2BA , -SO V2B NR 2BA R 2BB , -NHC(0)NR 2BA R 2BB , -N(0) m2B ,
  • R 3 is hydrogen, halogen, -CX 3 3 , -CHX 3 2 , -CH 2 X 3 , -OCX 3 3 , -OCH 2 X 3 , -OCHX 3 2 , -CN, -SOfinityR 3A , -SO V3 NR 3A R 3B , -NHC(0)NR 3A R 3B , -N(0) ⁇ , -NR 3A R 3B , -NHNR 3A R 3B , -C(0)R 3A , -C(0)-OR 3A , -C(0)NR 3A R 3B , -OR 3A , -NR 3A S0 2 R 3B , -NR 3A C(0)R 3B ,
  • R 4 is hydrogen, halogen, -CX 4 3 , -CHX 4 2 , -CH 2 X 4 , -OCX 4 3 , -OCH 2 X 4 , -OCHX 4 2 , -CN, -SO n4 R 4A , -SO V4 NR 4A R 4B , -NHC(0)NR 4A R 4B , -N(0) m4 , -NR 4A R 4B , -NHNR 4A R 4B , -C(0)R 4A , -C(0)-OR 4A , -C(0)NR 4A R 4B , -C(0)NHNR 4A R 4B , -OR 4A , -NR 4A SO 2 R 4B ,
  • R 5 is hydrogen, halogen, -CX 5 3 , -CHX 5 2 , -CH 2 X 5 , -OCX 5 3 , -OCH 2 X 5 , -OCHX 5 2 , -CN, -SOn5R 5A , -SO V5 NR 5A R 5B , -NHC(0)NR 5A R 5B , -N(0) m5 , -NR 5A R 5B , -NHNR 5A R 5B , -C(0)R 5A , -C(0)-OR 5A , -C(0)NR 5A R 5B , -C(0)NHNR 5A R 5B , -OR 5A , -NR 5A SO 2 R 5B ,
  • R 7 is hydrogen, halogen, -CX 7 3 , -CHX 7 2 , -CH 2 X 7 , -OCX 7 3 , -OCH 2 X 7 , -OCHX 7 2 , -CN, -SOnvR 7A , -SO V VNR 7A R 7B , -NHC(0)NR 7A R 7B , -N(0) m v, -NR 7A R 7B , -NHNR 7A R 7B , -C(0)R 7A , -C(0)-0R 7A , -C(0)NR 7A R 7B , -C(0)NHNR 7A R 7B , -OR 7A , -NR 7A SO 2 R 7B ,
  • R 8 is hydrogen, halogen, -CX -CHX 8 2 , -CH 2 X 8 , -OCX 8 3 , -OCH 2 X 8 , -OCHX 8 2 , -CN, -SO n8 R 8A , -SO v8 NR 8A R 8B , -NHC(0)NR 8A R 8B , -N(0) m8 , -NR 8A R 8B , -NHNR 8A R 8B , -C(0)R 8A , -C(0)-OR 8A , -C(0)NR 8A R 8B , -C(0)NHNR 8A R 8B , -OR 8A , -NR 8A SO 2 R 8B ,
  • R 9 is hydrogen, halogen, -CX 9 3 , -CHX 9 2 , -CH 2 X 9 , -OCX 9 3 , -OCH 2 X 9 , -OCHX 9 2 , -CN, -SOfinity9R 9A , -SO V9 NR 9A R 9B , -NHC(0)NR 9A R 9B , -N(0)m9, -NR 9A R 9B , -NHNR 9A R 9B , -C(0)R 9A , -C(0)-OR 9A , -C(0)NR 9A R 9B , -C(0)NHNR 9A R 9B , -OR 9A , -NR 9A SO 2 R 9B ,
  • R 8 and R 9 substituents may optionally be joined to form a substituted or
  • R 10 is hydrogen, halogen, -CX 10 3 , -CHX 10 2 , -CH 2 X 10 , -OCX 10 3 , -OCH 2 X 10 ,
  • R 8A R 8B , R 9A , R 9B , R 10a , and R 10B is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X,
  • R 1AA and R 1AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
  • R 2AA and R 2AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
  • R 2BA and R 2BB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
  • R 3A and R 3B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
  • R 4A and R 4B substituents bonded to the same nitrogen atom may optionally be
  • ml A, m2A, m2B, m3, m4, m5, m7, m8, m9, and mlO are independently 1 or 2.
  • vl A, v2A, v2B, v3, v4, v5, v7, v8, v9, and vlO are independently 1 or 2.
  • nlA, n2A, n2B, n3, n4, n5, n7, n8, n9, and nlO are independently an integer from 0 to 4.
  • X, X iA , X 2A , X 2B , X 3 , X 4 , X 5 , X 7 , X 8 , X 9 , and X i(J are independently -Cl, -Br, -I, or -F.
  • L 6 is substituted or unsubstituted alkyl ene, substituted or unsubstituted
  • heteroalkylene substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl ene, substituted or unsubstituted aryl ene, or substituted or unsubstituted heteroaryl ene.
  • L 8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, -S-, -S(O)-, -S(0) 2 -, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or
  • L 8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or
  • L 8 is unsubstituted phenylene.
  • L 9 is a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -0C(0)-, -NHC(O)-, -NHC(0)NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
  • R 2A and R 2B may optionally be joined to form a substituted or
  • R 4 and R 5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments, R 4 and R 5 are joined to form a substituted or unsubstituted phenyl.
  • R 1 is hydrogen, halogen, -CX , -CHXS, -CH2X 1 , -OCX , -OCH2X 1 , -OCHX , -CN, -SOniR 1A , -SO VI NR 1A R 1b , -NHC(0)NR 1A R 1b , -N(0) mi , -NR 1A R 1B , -NHNR 1A R 1B , -C(0)R 1A , -C(0)-OR 1a , -C(0)NR 1A R 1b , -C(0)NHNR 1A R 1b , -OR 1a , -NR 1A S0 2 R 1B ,
  • substituted or unsubstituted alkyl e.g., C i-Cx, Ci-C 6 , C1-C4, or C1-C2
  • substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C3-C6, C 4 -C 6 , or C 5 -C 6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5
  • E 1 is independently halogen, -CXS, -CHXS, -CH2X 1 , -OCX , -OCH2X 1 , -OCHXS, -CN, -SOniR 1A , -SO VI NR 1A R 1b , -NHC(0)NR 1A R 1B , -N(0) mi ,
  • unsubstituted alkyl e.g., Ci-C 8 , Ci-C 6 , C1-C4, or C1-C2
  • substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • substituted or unsubstituted cycloalkyl e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • substituted or unsubstituted aryl e.g., C 6 - C12, C 6 -Cio, or phenyl
  • substituted or unsubstituted heteroaryl
  • E 1 is independently halogen, -CXS, -CHXS, -CH2X 1 , -OCX , -OCH2X 1 , -OCHXS, -CN, -SOniR 1A , -SO VI NR 1A R 1b , -NHC(0)NR 1A R 1B , -N(0) mi ,
  • R 1 is independently hydrogen, halogen, -CX's, -CHXS, -CH2X 1 , -OCXS, -OCH2X 1 , -OCHXS, -CN, -OH, -NH 2 , -COOH, -CONH2, -NO2, -SH, -SO3H,
  • R 20 -substituted or unsubstituted alkyl e.g., C i-Cx, Ci- C 6 , C 1 -C 4 , or C 1 -C 2
  • R 20 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 20 -substituted or unsubstituted cycloalkyl e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6
  • R 20 -substituted or unsubstituted alkyl e.g., C i-Cx, Ci- C 6 , C 1 -C 4 , or C 1 -C 2
  • R 20 -substituted or unsubstituted heteroalkyl e.g.,
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 20 -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - C 10 , or phenyl
  • R 20 -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 1 is independently hydrogen, halogen, -CX , -CHX , -CH2X 1 , -OCX , -OCH2X 1 , -OCHX , -CN, -OH,
  • R 1 is independently hydrogen. In embodiments, R 1 is
  • R 1 independently -COOH. In embodiments, R 1 is independently -C(0)0(Ci-C 4 alkyl). In embodiments, R 1 is independently -CF 3 . In embodiments, R 1 is independently -CH 2 OH. In embodiments, R 1 is independently -C(0)CH 3 . In embodiments, R 1 is independently
  • R 1 is independently .
  • R 2U is hydrogen, -F, -Cl, or unsubstituted C1-C4 alkyl.
  • R 20 is independently oxo, halogen, -CX 20 3 , -CHX 20 2 , -CH 2 X 20 , -OCX 20 3 , -OCH 2 X 20 ,
  • R 21 -substituted or unsubstituted alkyl e.g., Ci-Cs, Ci-C 6 , Ci-C 4 , or C1-C2
  • R 21 - substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 21 - substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C3-C6, C 4 -C 6 , or C 5 -C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 21 - substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - C10, or phenyl
  • R 21 - substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 20 is independently oxo, halogen, -CX 20 3 , -CHX 20 2 , -CH 2 X 20 , -OCX 20 3 , -OCH 2 X 20 , -OCHX 20 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO 2 , -SH, -SO 3 H, -SO 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • R 21 is independently oxo, halogen, -CX 21 3 , -CHX 21 2 , -CH 2 X 21 , -OCX 21 3 , -OCH 2 X 21 ,
  • R 22 - substituted or unsubstituted alkyl e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 22 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 22 -substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 22 -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - C10, or phenyl
  • R 22 -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 21 is independently oxo, halogen, -CX 21 3 , -CHX 21 2 , -CH 2 X 21 , -OCX 21 3 , -OCH 2 X 21 , -OCHX 21 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -N0 2 , -SH, -S0 3 H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • R 22 is independently oxo, halogen, -CX 22 3 , -CHX 22 2 , -CH 2 X 22 , -OCX 22 3 , -OCH 2 X 22 ,
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • R 1A is hydrogen, halogen, -CX 1A 3 , -CHX 1A 2 , -CH 2 X 1A , -OCX 1A 3 , -OCH 2 X 1A , -OCHX 1A 2 , -CN, -SOni A R 1AA , -SO VI ANR 1AA R 1ab , -NHC(0)NR 1AA R 1AB , -N(0) miA ,
  • R 1A is independently hydrogen. In embodiments, R 1A is independently -CX 1A 3 . In embodiments, R 1A is independently -CHX 1A 2 . In embodiments, R 1A is independently -CH 2 X 1A . In embodiments, R 1A is independently -CN. In embodiments, R 1A is independently -COOH. In embodiments, R 1A is
  • X 1A is independently -F, -Cl, -Br, or -I.
  • R 1A is independently hydrogen, -CX 1A 3 , -CHX 1A 2 , -CH 2 X 1A ,
  • R 20A -substituted or unsubstituted alkyl e.g., C i-Cx, Ci-C 6 , C1-C4, or Ci-C 2
  • R 20A -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 20A -substituted or unsubstituted cycloalkyl e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 20A -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - C10, or phenyl
  • R 20A - substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 1A is independently hydrogen, -CX 1A 3 , -CHX 1A 2 , -CH 2 X 1A , -CN, -COOH, -CONH 2 , unsubstituted alkyl (e.g., Ci- C 8 , Ci-C 6 , C1-C4, or Ci-C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g.,
  • X 1A is independently -F, -Cl, -Br, or -I.
  • R 1A is independently hydrogen.
  • R 1A is independently unsubstituted methyl.
  • R 1A is independently unsubstituted ethyl.
  • R 1A and R 1B substituents bonded to the same nitrogen atom may optionally be joined to form a R 20A -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R 20A - substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • a R 20A -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 20A - substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to
  • R 1A and R 1B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • an unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 1A and R 1B substituents bonded to the same nitrogen atom may optionally be joined to form a R 20A -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 1A and R 1B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 21A -NHC (0)H, -NHC(0)-OH, -NHOH, -N 3 , R 21A -substituted or unsubstituted alkyl (e.g., Ci- C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2 ), R 21A -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 21A - substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 21A -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to
  • R 20A is independently oxo, halogen, -CX 20A 3 , -CHX 20A 2 , -CH 2 X 20A , -OCX 20A 3 , -OCH 2 X 20A ,
  • unsubstituted alkyl e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 20A is independently -F, -Cl, -Br, or -I.
  • R 20A is independently unsubstituted methyl.
  • R 20A is independently unsubstituted ethyl.
  • R 22A is independently selected from the group consisting of R 22A , R 22A -substituted or unsubstituted aryl (e.g., C 6 -Ci 2 , C 6 - C10, or phenyl), or R 22A - substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 21A is
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , C1-C4, or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 21A is independently -F, -Cl, -Br, or -I. In embodiments, R 21A is independently unsubstituted methyl. In embodiments, R 21A is independently unsubstituted ethyl.
  • X 22A is independently -F, -Cl, -Br, or -I.
  • R 22A is independently unsubstituted methyl.
  • R 22A is independently unsubstituted ethyl.
  • R 1A is independently hydrogen. In embodiments, R 1A is independently -OH. In embodiments, R 1A is independently unsubstituted methyl. In embodiments, R 1A is independently -OCH 3 . In embodiments, R 1A is independently -NH-(C I -C 4 alkyl). In embodiments, R 1A is independently . In embodiments, R 1A is independently -NH-NH-Ph. In embodiments, R 1A is independently R 20A - substituted or unsubstituted 5 membered heteroalkyl. In embodiments, R 1A is independently R 20A -substituted or unsubstituted 6 membered heteroalkyl.
  • R 1A is independently R 20A -substituted or unsubstituted 7 membered heteroalkyl.
  • R 20A is independently -F, -CF 3 , or unsubstituted Ci-C 4 alkyl.
  • a substituted R 1B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 1B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 1B when R 1B is substituted, it is substituted with at least one substituent group.
  • R 1B when R 1B is substituted, it is substituted with at least one size-limited substituent group.
  • R 1B when R 1B is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 1AA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 1AA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 1AA when R 1AA is substituted, it is substituted with at least one substituent group.
  • R 1AA when R 1AA is substituted, it is substituted with at least one size-limited substituent group.
  • R 1AA when R 1AA is substituted, it is substituted with at least one lower substituent group.
  • X 1AB is independently -Cl, -Br, -I, or -F.
  • a substituted R 1AB e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl
  • R 1AB when R 1AB is substituted, it is substituted with at least one substituent group. In embodiments, when R 1AB is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 1AB is substituted, it is substituted with at least one lower substituent group.
  • R 1AA and R 1AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • a substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • a substituted heterocycloalkyl or substituted heteroaryl formed by the joining of R 1AA and R 1AB substituents bonded to the same nitrogen atom is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted heterocycloalkyl or substituted heteroaryl is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • a heteroaryl formed by the joining of R 1AA and R 1AB substituents bonded to the same nitrogen atom when a heteroaryl formed by the joining of R 1AA and R 1AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one substituent group. In embodiments, when a heteroaryl formed by the joining of R 1AA and R 1AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when a heteroaryl formed by the joining of R 1AA and R 1AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one lower substituent group.
  • R 2 is hydrogen, halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 , -OCHX 2 2 , -CN, -SO Rules 2 R 2A , -SO V2 NR 2A R 2B , -NHC(0)NR 2A R 2B , -N(0)m2, -NR 2A R 2B , -NHNR 2A R 2B , -C(0)R 2A , -C(0)-OR 2A , -C(0)NR 2A R 2B , -C(0)NHNR 2A R 2B , -OR 2A , -NR 2A SO 2 R 2B ,
  • substituted or unsubstituted alkyl e.g., C i-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5
  • E 2 is independently halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 , -OCHX 2 2 , -CN, -SO Rules 2 R 2A , -SO VI NR 2A R 2B , -NHC(0)NR 2A R 2B , -N(0) m2 ,
  • E 2 is independently halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 , -OCHX 2 2 , -CN, -SO Rules 2 R 2A , -SO VI NR 2A R 2B , -NHC(0)NR 2A R 2B , -N(0) m2 ,
  • R 2 is independently hydrogen, halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 , -OCHX 2 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO 2 , -SH, -SO 3 H,
  • R 23 -substituted or unsubstituted alkyl e.g., C i-Cx, Ci- C 6 , Ci-C 4 , or Ci-C 2
  • R 23 - substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 23 -substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • R 23 -substituted or unsubstituted alkyl e.g., C i-Cx, Ci- C 6 , Ci-C 4 , or Ci-C 2
  • R 23 - substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 23 -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - C10, or phenyl
  • R 23 -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 2 is independently hydrogen, halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 , -OCHX 2 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -N0 2 , -SH, -S0 3 H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • R 23 is independently oxo, halogen, -CX 23 3 , -CHX 23 2 , -CH 2 X 23 , -OCX 23 3 , -OCH 2 X 23 ,
  • R 24 - substituted or unsubstituted alkyl e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 24 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 24 -substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • R 24 -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 23 is independently oxo, halogen, -CX 23 3 , -CHX 23 2 , -CH 2 X 23 , -OCX 23 3 , -OCH 2 X 23 , -OCHX 23 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO 2 , -SH, -SO 3 H, -SO 4 H, -SO 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • R 24 is independently oxo, halogen, -CX 24 3 , -CHX 24 2 , -CH 2 X 24 , -OCX 24 3 , -OCH 2 X 24 ,
  • R 25 -substituted or unsubstituted alkyl e.g., C i-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 25 - substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 25 -substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 25 -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl
  • R 25 -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 24 is independently oxo, halogen, -CX 24 3 , -CHX 24 2 , -CH 2 X 24 , -OCX 24 3 , -OCH 2 X 24 , -OCHX 24 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -N0 2 , -SH, -S0 3 H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • R 25 is independently oxo, halogen, -CX 25 3 , -CHX 25 2 , -CH 2 X 25 , -OCX 25 3 , -OCH 2 X 25 ,
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , C1-C4, or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C4-C6, or C5- C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • unsubstituted alkyl e.g., Ci-Cx, Ci-
  • R 2 is independently hydrogen. In embodiments, R 2 is
  • R 2 is independently -COOH.
  • R 2 is independently -C(0)0(Ci-C 4 alkyl).
  • R 2 is independently -CF 3 .
  • R 2 is independently -CH 2 OH.
  • R 2 is independently -C(0)CH 3 .
  • R 2 is independently
  • R 1 is independently In embodiments, R 23 is hydrogen, -F, -Cl, or unsubstituted C 1 -C 4 alkyl.
  • R 2A is hydrogen, halogen, -CX 2A 3 , -CHX 2A 2 , -CH 2 X 2A , -OCX 2A 3 , -OCH 2 X 2A , -OCHX 2A 2 , -CN, -SOn2 A R 2AA , -SO V2A NR 2AA R 2AB , -NHC(0)NR 2AA R 2AB , -N(0) m2A ,
  • R 2A is independently hydrogen, -CX 2A 3 , -CHX 2A 2 , -CH 2 X 2A , -CN, -COOH, -CONH 2 , R 23A -substituted or unsubstituted alkyl (e.g., C i-Cx, Ci-C 6 , Ci-C 4 , or Ci- C 2 ), R 23A -substituted or unsubstituted heteroalkyl (e.g., 2 to 12 membered, 2 to 8 membered,
  • alkyl e.g., C i-Cx, Ci-C 6 , Ci-C 4 , or Ci- C 2
  • R 23A -substituted or unsubstituted heteroalkyl e.g., 2 to 12 membered, 2 to 8 membered
  • R 23A -substituted or unsubstituted cycloalkyl e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6
  • R 23A -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 23A -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - C10, or phenyl
  • R 23A -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 2A is independently hydrogen, -CX 2A 3 , -CHX 2A 2 , -CH 2 X 2A , -CN, -COOH, -CONH 2 , unsubstituted alkyl (e.g., Ci- C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl
  • X 2A is independently -F, -Cl, -Br, or -I.
  • R 2A is independently hydrogen.
  • R 2A is independently unsubstituted methyl.
  • R 2A is independently unsubstituted ethyl.
  • R 2A and R 2B substituents bonded to the same nitrogen atom may optionally be joined to form a R 23A -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R 23A -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 2A and R 2B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g.,
  • R 2A and R 2B substituents bonded to the same nitrogen atom may optionally be joined to form a R 23A -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 2A and R 2B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 24A -substituted or unsubstituted aryl e.g., C 6 -Ci 4 , C 6 - Ci 2 , C 6 -Cio, or phenyl
  • R 24A - substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 23A is independently -F, -Cl, -Br, or -I.
  • R 23A is independently unsubstituted methyl.
  • R 23A is independently unsubstituted ethyl.
  • two adjacent R 23A substituents may optionally be joined to form an R 24A -substituted or unsubstituted cycloalkyl, R 24A - substituted or unsubstituted heterocycloalkyl, R 24A -substituted or unsubstituted aryl, or R 24A - substituted or unsubstituted heteroaryl.
  • R 25A is a -substituted or unsubstituted aryl (e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl), or R 25A -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 24A is
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -Cx, C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 24A is independently -F, -Cl, -Br, or -I.
  • R 24A is independently unsubstituted methyl.
  • R 24A is independently unsubstituted ethyl.
  • X 25A is independently -F, -Cl, -Br, or -I.
  • R 25A is independently unsubstituted methyl.
  • R 25A is independently unsubstituted ethyl.
  • R 2A is independently hydrogen. In embodiments, R 2A is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 2A is independently
  • R 2A is independently unsubstituted C 5 -C 6 cycloalkyl. In embodiments, R 2A is independently R 23A -substituted or unsubstituted phenyl.
  • R 2A is independently unsubstituted phenyl. In embodiments, R 2A is
  • R 2A is independently -NH-pyridyl. In embodiments, R 2A is independently an R 23A -substituted or unsubstituted 4 to 9 membered heteroalkyl. In embodiments, R 2A is independently an unsubstituted 4 to 9 membered heteroalkyl. In embodiments, R 2A is independently an R 23A - substituted or unsubstituted 5 to 9 membered heteroaryl. In embodiments, R 2A is
  • R 23A is independently an unsubstituted 5 to 9 membered heteroaryl.
  • R 23A is independently -F or -Cl.
  • R 23A is independently -OCH3.
  • R 23A is independently -OCF3.
  • R 23A is independently -C(0)0-tert-butyl.
  • R 23A is independently -CONH2.
  • R 23A is independently .
  • R 23A is independently -COCH 3 .
  • R 23A is independently -CH 2 CH 2 OH.
  • R 23A is independently an unsubstituted C 1 -C 4 alkyl.
  • R 23A is independently an unsubstituted C 2 alkynyl. In embodiments, R 23A is independently an R 24A - substituted or unsubstituted phenyl. In embodiments, R 23A is independently an unsubstituted phenyl. In embodiments, R 23A is independently an unsubstituted C 13 aryl. In embodiments, R 23A is independently an R 24A - substituted or unsubstituted pyridyl. In embodiments, R 23A is independently an unsubstituted pyridyl. In embodiments, R 23A is independently -SO 2 CH 3 . In embodiments, R 23A is independently - S0 2 Ph. In embodiments, R 23A is independently In embodiments,
  • R 23A is independently -OPh. In embodiments, R 23A is independently . In embodiments, R 23A is independently an R 24A -substituted or unsubstituted 6 membered
  • R 23A is independently . In embodiments,
  • R 23A is independently . In embodiments, R 23A is independently an unsubstituted 6 membered heteroalkyl. In embodiments, R 24A is independently oxo. In embodiments, R 24A is independently unsubsituted methyl. In embodiments, R 24A is independently an R 25A -substituted or unsubstituted phenyl. In embodiments, R 24A is independently unsubstituted phenyl. In embodiments, R 24A is independently an R 25A - substituted or unsubstituted 5 to 6 membered heterocycloalkyl. In embodiments, R 24A is independently an unsubstituted 5 to 6 membered heterocycloalkyl.
  • R 24A is independently an R 25A -substituted or unsubstituted 5 to 6 membered heteroaryl. In embodiments, R 24A is independently an unsubstituted 5 to 6 membered heteroaryl. In embodiments, R 24A is independently an R 25A -substituted thienyl. In embodiments, R 24A is independently an unsubstituted thienyl. In embodiments, R 24A is independently an R 25A - substituted pyridyl. In embodiments, R 24A is independently an unsubstituted pyridyl. In embodiments, R 24A is independently an R 25A -substituted pyrimidinyl. In embodiments, R 24A is independently an unsubstituted pyrimidinyl. In embodiments, R 25A is independently - F, -Cl, -CN, or unsubstituted methyl.
  • R 2B is hydrogen, halogen, -CX 2B 3 , -CHX 2B 2 , -CH 2 X 2B , -OCX 2B 3 , -OCH 2 X 2B , -OCHX 2B 2 , -CN, -SO Rules 2B R 2BA , -SO V2B NR 2BA R 2BB , -NHC(0)NR 2BA R 2BB , -N(0) m2B ,
  • R 2B is independently hydrogen, -CX 2B 3 , -CHX 2B 2 , -CH 2 X 2B ,
  • R 23B - substituted or unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 23B - substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 23B -substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 23B -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl
  • R 23B -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 2B is independently hydrogen, -CX 2B 3 , -CHX 2B 2 , -CH 2 X 2B , -CN, -COOH, -CONH 2 , unsubstituted alkyl (e.g., Ci- C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted
  • X 2B is independently -F, -Cl, -Br, or -I.
  • R 2B is independently hydrogen.
  • R 2B is independently an unsubstituted methyl.
  • R 2B is independently unsubstituted ethyl.
  • R 24B is independently selected from the group consisting of R 24B -substituted or unsubstituted aryl (e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl), or R 24B -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 23B is
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 23B is independently -F, -Cl, -Br, or -I.
  • R 23B is independently unsubstituted methyl.
  • R 23B is independently unsubstituted ethyl.
  • two adjacent R 23B substituents may optionally be joined to form an R 24B -substituted or unsubstituted cycloalkyl, R 24B -substituted or unsubstituted heterocycloalkyl, R 24B -substituted or unsubstituted aryl, or R 24B -substituted or unsubstituted heteroaryl.
  • R 25B is independently selected from the group consisting of R 25B -substituted or unsubstituted aryl (e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl), or R 25B -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 24B is selected from the group consisting of R 25B -substituted or unsubstituted aryl (e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl), or R 25B -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 24B is
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C3-C6, C 4 -C 6 , or C5- C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • unsubstituted alkyl e.g., Ci-Cx, Ci
  • X 24B is independently -F, -Cl, -Br, or -I.
  • R 24B is independently unsubstituted methyl.
  • R 24B is independently unsubstituted ethyl.
  • X 25B is independently -F, -Cl, -Br, or -I.
  • R 25B is independently unsubstituted methyl.
  • R 25B is independently unsubstituted ethyl.
  • X 2AA is independently -Cl, -Br, -I, or -F.
  • a substituted R 2AA e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl
  • R 2AA when R 2AA is substituted, it is substituted with at least one substituent group. In embodiments, when R 2AA is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 2AA is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 2AB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 2AB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 2AB when R 2AB is substituted, it is substituted with at least one substituent group.
  • R 2AB when R 2AB is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 2AB is substituted, it is substituted with at least one lower substituent group.
  • R 2AA and R 2AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • a substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • a substituted heterocycloalkyl or substituted heteroaryl formed by the joining of R 2AA and R 2AB substituents bonded to the same nitrogen atom is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted heterocycloalkyl or substituted heteroaryl is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • a heteroaryl formed by the joining of R 2AA and R 2AB substituents bonded to the same nitrogen atom when a heteroaryl formed by the joining of R 2AA and R 2AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one substituent group. In embodiments, when a heteroaryl formed by the joining of R 2AA and R 2AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when a heteroaryl formed by the joining of R 2AA and R 2AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 2BA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 2BA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 2BA when R 2BA is substituted, it is substituted with at least one substituent group.
  • R 2BA when R 2BA is substituted, it is substituted with at least one size-limited substituent group.
  • R 2BA when R 2BA is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 2BB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 2BB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 2BB when R 2BB is substituted, it is substituted with at least one substituent group.
  • R 2BB when R 2BB is substituted, it is substituted with at least one size-limited substituent group.
  • R 2BB when R 2BB is substituted, it is substituted with at least one lower substituent group.
  • R 2BA and R 2BB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • a substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • a substituted heterocycloalkyl or substituted heteroaryl formed by the joining of R 2BA and R 2BB substituents bonded to the same nitrogen atom is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted heterocycloalkyl or substituted heteroaryl is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • a heteroaryl formed by the joining of R 2BA and R 2BB substituents bonded to the same nitrogen atom when a heteroaryl formed by the joining of R 2BA and R 2BB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one substituent group. In embodiments, when a heteroaryl formed by the joining of R 2BA and R 2BB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when a heteroaryl formed by the joining of R 2BA and R 2BB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one lower substituent group.
  • alkyl e
  • R 3 is independently hydrogen. In embodiments, R 3 is
  • R 3 is independently unsubstituted methyl. In embodiments, R 3 is independently -CH2OH. In embodiments, R 3 is independently unsubstituted phenyl.
  • a substituted R 3 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 3 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 3 when R 3 is substituted, it is substituted with at least one substituent group.
  • R 3 when R 3 is substituted, it is substituted with at least one size-limited substituent group.
  • R 3 when R 3 is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 3A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 3A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 3A when R 3A is substituted, it is substituted with at least one substituent group.
  • R 3A when R 3A is substituted, it is substituted with at least one size-limited substituent group.
  • R 3A when R 3A is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 3B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 3B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 3B when R 3B is substituted, it is substituted with at least one substituent group.
  • R 3B when R 3B is substituted, it is substituted with at least one size-limited substituent group.
  • R 3B when R 3B is substituted, it is substituted with at least one lower substituent group.
  • R 4 is independently hydrogen, halogen, -CX 4 3 , -CHX 4 2 ,
  • R 4 is independently -OH.
  • X 4 is
  • a substituted R 4 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 4 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 4 when R 4 is substituted, it is substituted with at least one substituent group.
  • R 4 when R 4 is substituted, it is substituted with at least one size-limited substituent group.
  • R 4 when R 4 is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 4A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 4A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 4A when R 4A is substituted, it is substituted with at least one substituent group.
  • R 4A when R 4A is substituted, it is substituted with at least one size-limited substituent group.
  • R 4A when R 4A is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 4B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 4B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 4B when R 4B is substituted, it is substituted with at least one substituent group.
  • R 4B when R 4B is substituted, it is substituted with at least one size-limited substituent group.
  • R 4B when R 4B is substituted, it is substituted with at least one lower substituent group.
  • R 5 is independently hydrogen, halogen, -CX 5 3 , -CHX 5 2 ,
  • R 5 is independently -OH.
  • X 5 is
  • a substituted R 5 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 5 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 5 when R 5 is substituted, it is substituted with at least one substituent group.
  • R 5 when R 5 is substituted, it is substituted with at least one size-limited substituent group.
  • R 5 when R 5 is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 5A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 5A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 5A when R 5A is substituted, it is substituted with at least one substituent group.
  • R 5A when R 5A is substituted, it is substituted with at least one size-limited substituent group.
  • R 5A when R 5A is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 5B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 5B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 5B when R 5B is substituted, it is substituted with at least one substituent group.
  • R 5B when R 5B is substituted, it is substituted with at least one size-limited substituent group.
  • R 5B when R 5B is substituted, it is substituted with at least one lower substituent group.
  • R 6 is independently hydrogen, halogen, -CX , -CHX 6 2 ,
  • a substituted R 6 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 6 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 6 when R 6 is substituted, it is substituted with at least one substituent group.
  • R 6 when R 6 is substituted, it is substituted with at least one size-limited substituent group.
  • R 6 when R 6 is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 6A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 6A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 6A when R 6A is substituted, it is substituted with at least one substituent group.
  • R 6A when R 6A is substituted, it is substituted with at least one size-limited substituent group.
  • R 6A when R 6A is substituted, it is substituted with at least one lower substituent group.
  • X 6B is independently -Cl, -Br, -I, or -F.
  • a substituted R 6B e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl
  • R 6B when R 6B is substituted, it is substituted with at least one substituent group. In embodiments, when R 6B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 6B is substituted, it is substituted with at least one lower substituent group.
  • R 7 is independently hydrogen, halogen, -CX 7 3 , -CHX 7 2 ,
  • a substituted R 7 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 7 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 7 is substituted, it is substituted with at least one substituent group.
  • a substituted R 7A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 7A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 7A when R 7A is substituted, it is substituted with at least one substituent group.
  • R 7A when R 7A is substituted, it is substituted with at least one size-limited substituent group.
  • R 7A when R 7A is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 7B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 7B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 7B when R 7B is substituted, it is substituted with at least one substituent group.
  • R 7B when R 7B is substituted, it is substituted with at least one size-limited substituent group.
  • R 7B when R 7B is substituted, it is substituted with at least one lower substituent group.
  • R 8 is hydrogen, halogen, -CX -CHX 8 2 , -CH 2 X 8 , -OCX 8 3 , -OCH 2 X 8 , -OCHX 8 2 , -CN, -SO n8 R 8A , -SO v8 NR 8A R 8B , -NHC(0)NR 8A R 8B , -N(0) m8 , -NR 8A R 8B , -NHNR 8A R 8B , -C(0)R 8A , -C(0)-OR 8A , -C(0)NR 8A R 8B , -C(0)NHNR 8A R 8B , -OR 8A , -NR 8A SO 2 R 8B ,
  • substituted or unsubstituted alkyl e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2
  • substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6
  • substituted or unsubstituted alkyl e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 8 is independently hydrogen, halogen, -CX 8 3 , -CHX 8 2 , -CH 2 X 8 , -OCX 8 3 , -OCH 2 X 8 , -OCHX 8 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -N0 2 , -SH, -S0 3 H,
  • R 41 -substituted or unsubstituted alkyl e.g., Ci-C 8 , Ci- C 6 , C1-C4, or Ci-C 2
  • R 41 - substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 41 -substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C4-C6, or C 5 -C 6
  • R 41 -substituted or unsubstituted alkyl e.g., Ci-C 8 , Ci- C 6 , C1-C4, or Ci-C 2
  • R 41 - substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 41 - substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl
  • R 41 - substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 8 is independently hydrogen, halogen, -CX -CHX 8 2 , -CH 2 X 8 , -OCX 8 3 , -OCH 2 X 8 , -OCHX 8 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO 2 , -SH, -SO 3 H, -SO 4 H, -SO 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • R 8 is independently hydrogen. In embodiments, R 8 is
  • R 8 is independently unsubstituted methyl.
  • R 8 is independently -OCH 3 .
  • R 8 is independently -CN.
  • R 8 is independently -OPh.
  • R 8 is independently an R 41 -substituted or unsubstituted phenyl.
  • R 8 is independently an R 41 -substituted phenyl. In embodiments, R 8 is independently an unsubstituted phenyl. In embodiments, R 41 is independently -F, -Cl, -CN, -CH 3 , -OCH 3 , or -OCH 2 CH 3 .
  • R 8 and R 9 substituents may optionally be joined to form a R 41 - substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), or R 41 -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
  • R 8 and R 9 substituents may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 8 and R 9 substituents may optionally be joined to form a R 41 -substituted or unsubstituted
  • R 8 and R 9 substituents may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 41 is independently oxo, halogen, -CX 41 3 , -CHX 41 2 , -CH 2 X 41 , -OCX 41 3 , -OCH 2 X 41 ,
  • R 42 -substituted or unsubstituted alkyl e.g., Ci- C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 42 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 42 - substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • R 42 -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 42 -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - C10, or phenyl
  • R 42 -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 41 is independently oxo, halogen, -CX 41 3 , -CHX 41 2 , -CH 2 X 41 , -OCX 41 3 , -OCH 2 X 41 , -OCHX 41 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -N0 2 , -SH, -S0 3 H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • X 41 is independently -F, -Cl, -Br, or -I. In embodiments, R 41 is independently unsubstituted methyl. In embodiments, R 41 is independently unsubstituted ethyl. [0291] R 42 is independently oxo, halogen, -CX 42 3 , -CHX 42 2 , -CH 2 X 42 , -OCX 42 3 , -OCH 2 X 42 ,
  • R 43 -substituted or unsubstituted alkyl e.g., C i-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 43 - substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 43 -substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 43 -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl
  • R 43 -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 42 is independently oxo, halogen, -CX 42 3 , -CHX 42 2 , -CH 2 X 42 , -OCX 42 3 , -OCH 2 X 42 , -OCHX 42 2 , -CN, -OH, -NH 3 ⁇ 4 -COOH, -CONH 2 , -N0 2 , -SH, -S0 3 H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • R 43 is independently oxo, halogen, -CX 43 3 , -CHX 43 2 , -CH 2 X 43 , -OCX 43 3 , -OCH 2 X 43 ,
  • unsubstituted alkyl e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • R 8A is hydrogen, halogen, -CX 8A 3 , -CHX 8A 2 , -CH 2 X 8A , -OCX 8A 3 , -OCH 2 X 8A , -OCHX 8A 2 , -CN, -SOn8 A R 8AA , -SO V 8ANR 8AA R 8AB , -NHC(0)NR 8AA R 8AB , -N(0)m8A,
  • -NR 8AA R 8AB -NHNR 8AA R 8AB , -C(0)R 8AA , -C(0)-0R 8AA , -C(0)NR 8AA R 8AB , -OR 8AA , -NR 8AA S0 2 R 8AB , -NR 8AA C(0)R 8AB , -NR 8AA C(0)0R 8AB , -NR 8AA OR 8AB , -N 3 , substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -Cx, C 3 -C 6 , C 4 -C 6 ,
  • R 8A is independently hydrogen, -CX 8A 3 , -CHX 8A 2 , -CH 2 X 8A ,
  • R 41A -substituted or unsubstituted alkyl e.g., C i-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 41A -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 41A -substituted or unsubstituted cycloalkyl e.g., C 3 -Cx, C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 41A -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl
  • R 41A -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 8A is independently hydrogen, -CX 8A 3 , -CHX 8A 2 , -CH 2 X 8A , -CN, -COOH, -CONH 2 , unsubstituted alkyl (e.g., Ci- C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -Cs, C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted al
  • X 8A is independently -F, -Cl, -Br, or -I.
  • R 8A is independently hydrogen.
  • R 8A is independently unsubstituted methyl.
  • R 8A is independently unsubstituted ethyl.
  • R 8A and R 8B substituents bonded to the same nitrogen atom may optionally be joined to form a R 41A -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R 41A -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • a R 41A -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 41A -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10
  • R 8A and R 8B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • an unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 8A and R 8B substituents bonded to the same nitrogen atom may optionally be joined to form a R 41A -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 8A and R 8B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 8 and R 9 substituents may optionally be joined to form a R 41 - substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), or R 41 -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
  • R 8 and R 9 substituents may optionally be joined to form a R 41 - substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R 8 and R 9 substituents may optionally be joined to form a R 41 -substituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 8 and R 9 substituents may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 8 and R 9 substituents may optionally be joined to form a R 41 - substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 8 and R 9 substituents may optionally be joined to form a R 41 -substituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R 8 and R 9 substituents may optionally be joined to form an unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 42A substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 42A -substituted or unsubstituted aryl (e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl), or R 42A - substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 41A is
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -Cx, C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 41A is independently -F, -Cl, -Br, or -I. In embodiments, R 41A is independently unsubstituted methyl. In embodiments, R 41A is independently unsubstituted ethyl.
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 43A -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl
  • R 43A -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 42A is independently oxo, halogen, -CX 42A 3 , -CHX 42A 2 , -CH 2 X 42A , -OCX 42A 3 , -OCH 2 X 42A ,
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 42A is independently -F, -Cl, -Br, or -I.
  • R 42A is independently unsubstituted methyl.
  • R 42A is independently unsubstituted ethyl.
  • X 43A is independently -F, -Cl, -Br, or -I. In embodiments, R 43A is independently unsubstituted methyl. In embodiments, R 43A is independently unsubstituted ethyl.
  • R 8B is hydrogen, halogen, -CX 8B 3 , -CHX 8B 2 , -CH 2 X 8B , -OCX 8B 3 , -OCH 2 X 8B , -OCHX 8B 2 , -CN, -SOn8 B R 8BA , -SO V8B NR 8BA R 8BB , -NHC(0)NR 8BA R 8BB , -N(0)m8B,
  • R 8B is independently hydrogen, -CX 8B 3 , -CHX 8B 2 , -CH 2 X 8B , -CN, -COOH, -CONH 2 , R 41B - substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci- C 2 ), R 41B -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 41B -substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6 ), R 41B -substituted or unsubstituted or unsubstituted
  • heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 41B -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • R 41B -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 8B is independently hydrogen, -CX 8B 3 , -CHX 8B 2 , -CH 2 X 8B , -CN, -COOH, -CONH 2 , unsubstituted alkyl (e.g., Ci- C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl
  • X 8B is independently -F, -Cl, -Br, or -I.
  • R 8B is independently hydrogen.
  • R 8B is independently unsubstituted methyl.
  • R 8B is independently unsubstituted ethyl.
  • R 8A and R 8B substituents bonded to the same nitrogen atom may optionally be joined to form a R 41B -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R 41B -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • a R 41B -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 41B -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10
  • R 8A and R 8B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • an unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 8A and R 8B substituents bonded to the same nitrogen atom may optionally be joined to form a R 41B - substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 8A and R 8B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 42B is independently selected from a group consisting of aryl and aryl.
  • R 41B is selected from a group consisting of aryl and aryl.
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -Cx, C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 41B is independently -F, -Cl, -Br, or -I. In embodiments, R 41B is independently unsubstituted methyl. In embodiments, R 41B is independently unsubstituted ethyl.
  • R 43B is independently selected from the group consisting of R 43A and R 43B -substituted or unsubstituted aryl (e.g., C 6 -Ci 2 , C 6 - C10, or phenyl), or R 43B -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 42B is
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , C1-C4, or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C5- C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • unsubstituted alkyl e.g., Ci-Cx
  • X 42B is independently -F, -Cl, -Br, or -I.
  • R 42B is independently unsubstituted methyl.
  • R 42B is independently unsubstituted ethyl.
  • X 43B is independently -F, -Cl, -Br, or -I. In embodiments, R 43B is independently unsubstituted methyl. In embodiments, R 43B is independently unsubstituted ethyl. [0306] R 8AA is independently hydrogen, halogen, -CX 8AA 3 , -CHX 8AA 2 , -CH 2 X 8AA ,
  • a substituted R 8AA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 8AA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 8AA when R 8AA is substituted, it is substituted with at least one substituent group.
  • R 8AA when R 8AA is substituted, it is substituted with at least one size-limited substituent group.
  • R 8AA when R 8AA is substituted, it is substituted with at least one lower substituent group.
  • R 8AB is independently hydrogen, halogen, -CX 8AB 3 , -CHX 8AB 2 , -CH 2 X 8AB ,
  • a substituted R 8AB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 8AB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 8AB when R 8AB is substituted, it is substituted with at least one substituent group.
  • R 8AB when R 8AB is substituted, it is substituted with at least one size-limited substituent group.
  • R 8AB when R 8AB is substituted, it is substituted with at least one lower substituent group.
  • R 8BA is independently hydrogen, halogen, -CX 8BA 3 , -CHX 8BA 2 , -CH 2 X 8BA ,
  • R 8BA is independently hydrogen, halogen, -CX 8BA 3 , -CHX 8BA 2 , -CH 2 X 8BA , -C(0)OH, -C(0)NH 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO 2 , -SH, -SO 3 H,
  • substituted or unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • substituted or unsubstituted aryl e.g., C 6 - Ci 2 , C 6 -Cio, or pheny
  • a substituted R 8BA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 8BA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 8BA when R 8BA is substituted, it is substituted with at least one substituent group.
  • R 8BA when R 8BA is substituted, it is substituted with at least one size-limited substituent group.
  • R 8BA when R 8BA is substituted, it is substituted with at least one lower substituent group.
  • R 8BB is independently hydrogen, halogen, -CX 8BB 3 , -CHX 8BB 2 , -CH 2 X 8BB ,
  • X 8BB is independently -Cl, -Br, -I, or -F.
  • a substituted R 8BB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 8BB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 8BB when R 8BB is substituted, it is substituted with at least one substituent group.
  • R 8BB when R 8BB is substituted, it is substituted with at least one size-limited substituent group.
  • R 8BB when R 8BB is substituted, it is substituted with at least one lower substituent group.
  • R 9 is hydrogen, halogen, -CX 9 3 , -CHX 9 2 , -CH 2 X 9 , -OCX 9 3 , -OCH 2 X 9 , -OCHX 9 2 , -CN, -SOmony 9 R 9A , -SO V9 NR 9A R 9B , -NHC(0)NR 9A R 9B , -N(0) m9 , -NR 9A R 9B , -NHNR 9A R 9B , -C(0)R 9A , -C(0)-OR 9A , -C(0)NR 9A R 9B , -C(0)NHNR 9A R 9B , -OR 9A , -NR 9A SO 2 R 9B ,
  • substituted or unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • substituted or unsubstituted cycloalkyl e.g., C 3 -Cx, C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • substituted or unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 9 is independently hydrogen, halogen, -CX -CHX 9 2 , -CH 2 X 9 , -OCX 9 3 , -OCH 2 X 9 , -OCHX 9 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO 2 , -SH, -SO 3 H,
  • R 44 -substituted or unsubstituted alkyl e.g., C i-Cx, Ci- C 6 , Ci-C 4 , or Ci-C 2
  • R 44 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 44 -substituted or unsubstituted cycloalkyl e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6
  • R 44 -substituted or unsubstituted alkyl e.g., C i-Cx, Ci- C 6 , Ci-C 4 , or Ci-C 2
  • R 44 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 44 -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - C10, or phenyl
  • R 44 -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 9 is independently hydrogen, halogen, -CX 9 3 , -CHX 9 2 , -CH 2 X 9 , -OCX 9 3 , -OCH 2 X 9 , -OCHX 9 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -N0 2 , -SH, -SO3H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • R 8 and R 9 substituents may optionally be joined to form a R 44 - substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), or R 44 -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
  • R 8 and R 9 substituents may optionally be joined to form a R 44 - substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R 8 and R 9 substituents may optionally be joined to form a R 44 -substituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 8 and R 9 substituents may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 8 and R 9 substituents may optionally be joined to form a R 44 - substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 8 and R 9 substituents may optionally be joined to form a R 44 -substituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R 8 and R 9 substituents may optionally be joined to form an unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 44 is independently oxo, halogen, -CX 44 3 , -CHX 44 2 , -CH 2 X 44 , -OCX 44 3 , -OCH 2 X 44 ,
  • R 45 -substituted or unsubstituted alkyl e.g., Ci- C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 45 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 45 - substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • R 45 - substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 45 -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - C10, or phenyl
  • R 45 -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 45 is independently oxo, halogen, -CX 45 3, -CHX 45 2, -CH2X 45 , -OCX 45 3, -OCH2X 45 ,
  • R 46 - substituted or unsubstituted alkyl e.g., C i-Cx, Ci-C 6 , Ci-C 4 , or C1-C2
  • R 46 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 46 -substituted or unsubstituted cycloalkyl e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 46 -substituted or unsubstituted aryl e.g., C 6 -Ci2, C 6 - C10, or phenyl
  • R 46 -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 45 is independently oxo, halogen, -CX 45 3 , -CHX 45 2 , -CH 2 X 45 , -OCX 45 3 , -OCH 2 X 45 , -OCHX 45 2 , -CN, -OH, -NH 2 , -COOH, -CONH2, -NO2, -SH, -SO3H, -S0 4 H, -SO2NH2, -NHNH2, -ONH2,
  • X 45 is independently -F, -Cl, -Br, or -I. In embodiments, R 45 is independently unsubstituted methyl. In embodiments, R 45 is independently unsubstituted ethyl. [0324] R 46 is independently oxo, halogen, -CX 46 3 , -CHX 46 2 , -CH 2 X 46 , -OCX 46 3 , -OCH 2 X 46 ,
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • R 9 is independently an R 44 -substituted or unsubstituted Ci-C 4 alkyl. In embodiments, R 9 is independently an unsubstituted Ci-C 4 alkyl. In embodiments, R 9 is independently an R 44 -substituted or unsubstituted C 4 -C 6 cycloalkyl. In embodiments,
  • R 9 is independently an unsubstituted C 4 -C 6 cycloalkyl. In embodiments, R 9 is independently R 44 -substituted or unsubstituted 5 to 6 membered heterocycloalkyl. In embodiments, R 9 is independently an unsubstituted 5 to 6 membered heterocycloalkyl. In embodiments, R 9 is independently R 44 -substituted or unsubstituted phenyl. In embodiments, R 9 is independently an unsubstituted phenyl. In embodiments, R 9 is independently an R 44 -substituted or unsubstituted naphthyl. In embodiments, R 9 is independently an unsubstituted naphthyl. In embodiments, R 9 is independently an R 44 -substituted or unsubstituted pyridyl. In
  • R 9 is independently an unsubstituted pyridyl. In embodiments, R 9 is independently an R 44 -substituted or unsubstituted 10 membered heteroaryl. In embodiments, R 9 is independently an unsubstituted 10 membered heteroaryl. In embodiments, R 44 is independently -F, -Cl, -Br, or -I. In embodiments, R 44 is independently -CN. In
  • R 44 is independently -0-(Ci-C 4 alkyl). In embodiments, R 44 is independently -OCH 3 . In embodiments, R 44 is independently -OCH 2 CH 3 . In embodiments, R 44 is independently -OCF 3 . In embodiments, R 44 is independently an R 45 -substituted or unsubstituted Ci-C 4 alkyl. In embodiments, R 44 is independently an unsubstituted methyl. In embodiments, R 44 is independently an R 45 -substituted or unsubstituted 2 to 5 membered heteroalkyl. In embodiments, R 44 is independently -CH 2 OH. In embodiments, R 44 is independently -CH 2 CH 2 OH.
  • R 44 is independently an R 45 -substituted or unsubstituted phenyl. In embodiments, R 44 is independently an unsubstituted phenyl. In embodiments, R 45 is independently oxo. In embodiments, R 45 is independently an unsubstituted 5 to 6 membered heterocycloalkyl. In embodiments, R 45 is independently
  • R 9A is hydrogen, halogen, -CX 9A 3 , -CHX 9A 2 , -CH 2 X 9A , -OCX 9A 3 , -OCH 2 X 9A , -OCHX 9A 2 , -CN, - S On9 AR 9AA , -SO V9 ANR 9AA R 9AB , -NHC(0)NR 9AA R 9AB , -N(0)m9A,
  • -NR 9AA R 9AB -NHNR 9AA R 9AB , -C(0)R 9AA , -C(0)-0R 9AA , -C(0)NR 9AA R 9AB , -OR 9AA , -NR 9AA S0 2 R 9AB , -NR 9AA C(0)R 9AB , -NR 9AA C(0)0R 9AB , -NR 9AA OR 9AB , -N 3 , substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 ,
  • R 9A is independently hydrogen, -CX 9A 3 , -CHX 9A 2 , -CH 2 X 9A ,
  • R 44A -substituted or unsubstituted alkyl e.g., C i-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 44A -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 44A -substituted or unsubstituted cycloalkyl e.g., C 3 -Cx, C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 44A -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl
  • R 44A - substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 9A is independently hydrogen, -CX 9A 3 , -CHX 9A 2 , -CH 2 X 9A , -CN, -COOH, -CONH 2 , unsubstituted alkyl (e.g., Ci- C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted
  • X 9A is independently -F, -Cl, -Br, or -I.
  • R 9A is independently hydrogen.
  • R 9A is independently unsubstituted methyl.
  • R 9A is independently unsubstituted ethyl.
  • R 9A and R 9B substituents bonded to the same nitrogen atom may optionally be joined to form a R 44A -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R 44A - substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to
  • R 9A and R 9B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • an unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 9A and R 9B substituents bonded to the same nitrogen atom may optionally be joined to form a R 44A -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 9A and R 9B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 45A -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl
  • R 45A -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to
  • R 44A is
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C3-C6, C 4 -C 6 , or C5- C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • unsubstituted alkyl e.g., Ci-Cx, Ci
  • X 44A is independently -F, -Cl, -Br, or -I. In embodiments, R 44A is independently unsubstituted methyl. In embodiments, R 44A is independently unsubstituted ethyl.
  • R 46A is a -substituted or unsubstituted aryl (e.g., C 6 -Ci 2 , C 6 - C10, or phenyl), or R 46A - substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 45A is
  • unsubstituted alkyl e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C5- C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 45A is independently -F, -Cl, -Br, or -I. In embodiments, R 45A is independently unsubstituted methyl. In embodiments, R 45A is independently unsubstituted ethyl.
  • X 46A is independently -F, -Cl, -Br, or -I. In embodiments, R 46A is independently unsubstituted methyl. In embodiments, R 46A is independently unsubstituted ethyl.
  • R 9B is hydrogen, halogen, -CX 9B 3 , -CHX 9B 2 , -CH 2 X 9B , -OCX 9B 3 , -OCH 2 X 9B , -OCHX 9B 2 , -CN, -SO Interest9BR 9BA , -SO V9B NR 9BA R 9BB , -NHC(0)NR 9BA R 9BB , -N(0)m9B,
  • R 9B is independently hydrogen, -CX 9B 3 , -CHX 9B 2 , -CH 2 X 9B , -CN, -COOH, -CONH 2 , R 44B - substituted or unsubstituted alkyl (e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci- C 2 ), R 44B -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 44B -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 44B -substituted or unsubstituted or unsubstituted
  • heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 44B -substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • R 44B -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 9B is independently hydrogen, -CX 9B 3 , -CHX 9B 2 , -CH 2 X 9B , -CN, -COOH, -CONH 2 , unsubstituted alkyl (e.g., Ci- C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl
  • X 9B is independently -F, -Cl, -Br, or -I.
  • R 9B is independently hydrogen.
  • R 9B is independently unsubstituted methyl.
  • R 9B is independently unsubstituted ethyl.
  • R 9A and R 9B substituents bonded to the same nitrogen atom may optionally be joined to form a R 44B -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R 44B -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • a R 44B -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 44B -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10
  • R 9A and R 9B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • an unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 9A and R 9B substituents bonded to the same nitrogen atom may optionally be joined to form a R 44B - substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 9A and R 9B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
  • R 45B is independently selected from the group consisting of R 45A and R 45B -substituted or unsubstituted aryl (e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl), or R 45B -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 44B is
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 44B is independently -F, -Cl, -Br, or -I. In embodiments, R 44B is independently unsubstituted methyl. In embodiments, R 44B is independently unsubstituted ethyl.
  • R 46B is independently selected from the group consisting of R 46A -substituted or unsubstituted aryl (e.g., C 6 -Ci 2 , C 6 - Cio, or phenyl), or R 46B -substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 45B is
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -Cx, C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 45B is independently -F, -Cl, -Br, or -I. In embodiments, R 45B is independently unsubstituted methyl. In embodiments, R 45B is independently unsubstituted ethyl.
  • X 46B is independently -F, -Cl, -Br, or -I. In embodiments, R 46B is independently unsubstituted methyl. In embodiments, R 46B is independently unsubstituted ethyl.
  • R 9AA is independently hydrogen, halogen, -CX 9AA 3 , -CHX 9AA 2 , -CH 2 X 9AA ,
  • a substituted R 9AA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 9AA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 9AA when R 9AA is substituted, it is substituted with at least one substituent group.
  • R 9AA when R 9AA is substituted, it is substituted with at least one size-limited substituent group.
  • R 9AA when R 9AA is substituted, it is substituted with at least one lower substituent group.
  • R 9AB is independently hydrogen, halogen, -CX 9AB 3 , -CHX 9AB 2 , -CH 2 X 9AB ,
  • a substituted R 9AB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 9AB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 9AB when R 9AB is substituted, it is substituted with at least one substituent group.
  • R 9AB when R 9AB is substituted, it is substituted with at least one size-limited substituent group.
  • R 9AB when R 9AB is substituted, it is substituted with at least one lower substituent group.
  • R 9BA is independently hydrogen, halogen, -CX 9BA 3 , -CHX 9BA 2 , -CH 2 X 9BA ,
  • X 9BA is independently -Cl, -Br, -I, or -F.
  • a substituted R 9BA e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl
  • R 9BA is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 9BA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 9BA when R 9BA is substituted, it is substituted with at least one substituent group. In embodiments, when R 9BA is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 9BA is substituted, it is substituted with at least one lower substituent group.
  • R 9BB is independently hydrogen, halogen, -CX 9BB 3 , -CHX 9BB 2 , -CH 2 X 9BB ,
  • a substituted R 9BB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 9BB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 9BB when R 9BB is substituted, it is substituted with at least one substituent group.
  • R 9BB when R 9BB is substituted, it is substituted with at least one size-limited substituent group.
  • R 9BB when R 9BB is substituted, it is substituted with at least one lower substituent group.
  • m8A, m8B, m9A, and m9B are independently 1 or 2.
  • v8A, v8B, v9A, and v9B are independently 1 or 2.
  • n8A, n8B, n9A, and n9B are independently an integer from 0 to 4.
  • X 8A , X 8B , X 9A , and X 9B are independently -Cl, -Br, -I or -F.
  • R 10 is independently hydrogen, halogen, -CX 10 3 , -CHX 10 2 ,
  • X 10 is independently hydrogen or unsubstituted methyl.
  • X 10 is independently -Cl, -Br, -I, or -F.
  • a substituted R 10 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 10 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 10 when R 10 is substituted, it is substituted with at least one substituent group.
  • R 10 when R 10 is substituted, it is substituted with at least one size-limited substituent group.
  • R 10 when R 10 is substituted, it is substituted with at least one lower substituent group.
  • R 10A is independently hydrogen, halogen, -CX 10A 3 , -CHX 10A 2 , -CH 2 X 10A , -C(0)OH, -C(0)NH 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO 2 , -SH, -SO 3 H,
  • substituted or unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • substituted or unsubstituted aryl e.g., C 6 - Ci 2 , C 6 -Cio, or phenyl
  • a substituted R 10A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 10A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 10A when R 10A is substituted, it is substituted with at least one substituent group.
  • R 10A when R 10A is substituted, it is substituted with at least one size-limited substituent group.
  • R 10A when R 10A is substituted, it is substituted with at least one lower substituent group.
  • a substituted R 10B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 10B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 10B when R 10B is substituted, it is substituted with at least one substituent group.
  • R 10B when R 10B is substituted, it is substituted with at least one size-limited substituent group.
  • R 10B when R 10B is substituted, it is substituted with at least one lower substituent group.
  • a substituted L 1 , L 2 , L 3 , L 6 , L 8 , and/or L 9 e.g., substituted alkylene, substituted heteroalkyl ene, substituted cycloalkylene, substituted
  • heterocycloalkyl ene, substituted arylene, and/or substituted heteroaryl ene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L 1 , L 2 , L 3 , L 6 , L 8 , and/or L 9 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • L 1 , L 2 , L 3 , L 6 , L 8 , and/or L 9 is substituted, it is substituted with at least one substituent group.
  • L 1 , L 2 , L 3 , L 6 , L 8 , and/or L 9 when L 1 , L 2 , L 3 , L 6 , L 8 , and/or L 9 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L 1 , L 2 , L 3 , L 6 , L 8 , and/or L 9 is substituted, it is substituted with at least one lower substituent group.
  • L 9 is independently a bond. In embodiments, L 9 is independently
  • L 9 is independently In embodiments, L 9 is independently unsubstituted C 2 -C 4 alkyl. In embodiments, L 9 is independently a substituted or unsubstituted phenylene. In embodiments, L 9 is independently a substituted phenylene. In embodiments, L 9 is independently an unsubstituted phenylene. [0362] In embodiments, R 9 is an R 44 -substituted or unsubstituted C1-C4 alkyl. In embodiments, R 9 is an R 44 -substituted C1-C4 alkyl. In embodiments, R 9 is an unsubstituted C1-C4 alkyl.
  • R 44 is an R 45 -substituted or unsubstituted heterocycloalkyl. In embodiments, R 44 is an R 45 - substituted heterocycloalkyl. In embodiments, R 44 is an unsubstituted heterocycloalkyl. In embodiments, R 44 is an unsubstituted morpholinyl.
  • L 9 -R 9 is
  • embodiments, embodiments, L 9 -R 9 is
  • the compound has the formula:
  • zl is an integer from 0 to 4.
  • R 23AA is independently hydrogen, oxo, halogen, -CX 23AA 3 , -CHX 23AA 2 , -CH 2 X 23AA ,
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 24AA -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 24AA -substituted or unsubstituted cycloalkyl e.g., C3-C8, C3-C6, C 4 -C 6 , or C 5 -C 6
  • R 24AA .
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 24AA - substituted or unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • R 24AA -substituted or unsubstituted heteroaryl e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
  • c 23AA is independently -F, -Cl, -Br, or -I.
  • R 23AA is independently hydrogen.
  • R 23AA is independently unsubstituted methyl.
  • R 23AA is independently unsubstituted ethyl.
  • R 23AA is independently unsubstituted propyl.
  • R 23AA is independently unsubstituted butyl.
  • R 23AA is independently unsubstituted tert-butyl.
  • two adjacent R 23AA substituents may optionally be joined to form an R 24AA -substituted or unsubstituted cycloalkyl, R 24AA - substituted or unsubstituted heterocycloalkyl, R 24AA -substituted or unsubstituted aryl, or R 24AA -substituted or unsubstituted heteroaryl.
  • unsubstituted alkyl e.g., C i-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • R 24AB -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 24AB -substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6
  • R 24AB -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 24AB - substituted or unsubstituted aryl e.g
  • R 23AB is independently hydrogen. In embodiments, R 23AB is independently unsubstituted methyl. In embodiments, R 23AB is independently unsubstituted ethyl. In embodiments, R 23AB is independently unsubstituted propyl. In embodiments, R 23AB is independently unsubstituted butyl. In embodiments, R 23AB is independently unsubstituted tert-butyl.
  • two adjacent R 23AB substituents may optionally be joined to form an R 24AB - substituted or unsubstituted cycloalkyl, R 24AB - substituted or unsubstituted heterocycloalkyl, R 24AB - substituted or unsubstituted aryl, or R 24AB .
  • su b s it u ted or unsubstituted heteroaryl.
  • unsubstituted alkyl e.g., Ci-Cx, Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -Cx, C 3 -C 6 , C 4 -C 6 , or C 5 - C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • R 24AA is independently unsubstituted methyl. In embodiments, R 24AA is independently unsubstituted ethyl.
  • R 25AA is independently unsubstituted methyl. In embodiments, R 25AA is independently unsubstituted ethyl.
  • unsubstituted alkyl e.g., Ci-C 8 , Ci-C 6 , Ci-C 4 , or Ci-C 2
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C5- C 6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C 6 -Ci 2 , C 6 -Cio, or phenyl
  • X 24AB is independently -F, -Cl, -Br, or -I. In embodiments, R 24AB is independently unsubstituted methyl. In embodiments, R 24AB is independently unsubstituted ethyl.
  • X 25AB is independently -F, -Cl, -Br, or -I. In embodiments, R 25AB is independently unsubstituted methyl. In embodiments, R 25AB is independently unsubstituted ethyl.
  • zl is 0. In embodiments, zl is 1. In embodiments, zl is 2. In embodiments, zl is 3. In embodiments, zl is 4. [0373] In embodiments, the compound has the formula:
  • R 1A , R 23AA , R 23AB , and zl are as described herein, including in embodiments.
  • the compound has the formula:
  • the compound has the formula:
  • R 1A , R 23AA , R 23AB , and zl are as described herein, including in embodiments.
  • the compound has the formula: (Illi).
  • R 1A , R 23AA , R 23AB , and zl are as described herein, including in embodiments.
  • the compound has the formula:
  • the compound has the formula
  • the compound has the formula
  • the compound has the formula: In embodiments, the compound has the formula
  • the compound has the formula In embodiments, the compound has the formula
  • the compound has the formula: In embodiments, the compound has the formula
  • the compound has the formula
  • the compound has the
  • the compound has
  • the compound is covalently attached to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2.
  • at least one of R 1 or R 2 includes an electron-withdrawing moiety.
  • at least one of R 1 or R 2 are sufficiently electron withdrawing to allow the compound to covalently bind to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2, wherein the El cysteine amino acid is bound to ring carbon C 2 attached to R 2 or ring carbon Ci attached to R 1 .
  • the compound covalently binds to an El cysteine amino acid corresponding to Cys30 of Uba2
  • R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and L 3 are as described herein, including in embodiments.
  • R 4 is hydrogen.
  • R 5 is hydrogen.
  • R 8 is substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • R 8 is substituted or unsubstituted aryl or substituted or unsubstituted heteroaryl.
  • R 8 is substituted or unsubstituted phenyl or substituted or unsubstituted 5 to 6 membered heteroaryl. In embodiments, R 8 is substituted or unsubstituted phenyl. In embodiments, R 41 is independently halogen or -OPh. In embodiments, z4l is 2. In embodiments, z4l is 1. In embodiments, z4l is 0. In embodiments, L 9 is a bond or substituted or unsubstituted alkyl ene. In embodiments, L 9 is a bond or unsubstituted C 1 -C 3 alkylene. In embodiments, L 9 is an unsubstituted methylene. In embodiments, L 9 is a bond. In embodiments, R 9 is substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted
  • R 9 is unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.
  • R 9 is unsubstituted Ci-C 6 alkyl, unsubstituted 2 to 6 membered heteroalkyl, unsubstituted C 3 -C 6 cycloalkyl, unsubstituted 3 to 6 membered heterocycloalkyl,
  • R 9 is unsubstituted propyl, unsubstituted butyl, unsubstituted pentyl, unsubstituted propenyl, unsubstituted butenyl, unsubstituted pentenyl, unsubstituted propynyl, unsubstituted butynyl, unsubstituted pentynyl, unsubstituted cyclobutyl, unsubstituted cyclopentyl, unsubstituted tetrahydropyranyl, unsubstituted morpholinyl, or unsubstituted phenyl.
  • R 9 is unsubstituted phenyl.
  • R 2A is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
  • R 2A is hydrogen, substituted or unsubstituted Ci- C 6 alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl, substituted or
  • R 2A is hydrogen.
  • R 2B is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • R 2B is hydrogen, substituted or unsubstituted Ci-C 6 alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl, substituted or unsubstituted C 3 -C 6 cycloalkyl, substituted or unsubstituted 3 to 6 membered heterocycloalkyl, substituted or unsubstituted C 3 -C 6 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl.
  • R 2B is hydrogen.
  • R 2A and R 2B are joined to form a substituted or unsubstituted
  • R 2A and R 2B are joined to form a substituted or unsubstituted heterocycloalkyl. In embodiments, R 2A and R 2B are joined to form a substituted or unsubstituted 4 to 6 membered heterocycloalkyl.
  • R 1A is hydrogen, -CX 1A 3 , -CHX 1A 2 , -CH 2 X 1A , -OCX 1A 3 , -OCH 2 X 1A ,
  • R 1A is hydrogen, -CX 1A 3 , -CHX 1A 2 , -CH 2 X 1A , unsubstituted Ci-C 3 alkyl. In embodiments, R 1A is unsubstituted Ci-C 3 alkyl. In embodiments,
  • R 1A is hydrogen.
  • R 3 is hydrogen, -CX 3 3 , -CHX 3 2 , -CH 2 X 3 , substituted or unsubstituted alkyl.
  • R 3 is -CH 2 OH or -CH 3 .
  • R 3 is hydrogen. In embodiments, R 3 is substituted or unsubstituted phenyl. In embodiments, R 3 is unsubstituted phenyl.
  • a compound as described herein may include multiple instances of R 1 and/or other variables.
  • each variable may optional be different and be appropriately labeled to distinguish each group for greater clarity.
  • R 1 may be referred to, for example, as R 1 ⁇ 1 , R 1 2 , R 1 3 , R 1 4 , R 1 5 , respectively, wherein the definition of R 1 is assumed by R 1 ⁇ 1 , R 1 2 , R 1 3 , R 1 4 , R 1 5 .
  • the variables used within a definition of R 1 and/or other variables that appear at multiple instances and are different may similarly be appropriately labeled to distinguish each group for greater clarity.
  • a compound as described herein may include multiple instances of R 2 and/or other variables.
  • each variable may optional be different and be appropriately labeled to distinguish each group for greater clarity.
  • R 2 where each R 2 is different, they may be referred to, for example, as R 2 ⁇ 1 , R 2 2 , R 2 3 , R 2 4 , R2 5 reS p ec tively, wherein the definition of R 2 is assumed by R 2 ⁇ 1 , R 2 ⁇ 2 , R 2 ⁇ 3 , R 2 ⁇ 4 , R 2 5 .
  • the variables used within a definition of R 2 and/or other variables that appear at multiple instances and are different may similarly be appropriately labeled to distinguish each group for greater clarity.
  • the compound is a compound described herein (e.g., in an aspect, embodiment, example, claim, table, scheme, drawing, or figure).
  • a compound described herein is a racemic mixture of all stereoisomers. In embodiments, unless otherwise indicated, a compound described herein is a racemic mixture of all enantiomers. In embodiments, unless otherwise indicated, a compound described herein is a racemic mixture of two opposite stereoisomers. In embodiments, unless otherwise indicated, a compound described herein is a racemic mixture of two opposite enantiomers. In embodiments, unless otherwise indicated, a compound described herein is a single stereoisomer. In embodiments, unless otherwise indicated, a compound described herein is a single enantiomer. In embodiments, the compound is a compound described herein (e.g., in an aspect, embodiment, example, figure, table, scheme, or claim).
  • the compound is a compound described herein (e.g., in an aspect, embodiment, example, claim, table, scheme, drawing, or figure).
  • a moiety of a compound is a moiety described in a compound of Table I in the Example section below.
  • the moieties of a compound are moieties described in one or a plurality of compounds of Table I in the Example section below.
  • composition including a compound described herein, or pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
  • pharmaceutically acceptable salt thereof is included in a therapeutically effective amount.
  • the pharmaceutical composition includes a second agent (e.g., therapeutic agent). In embodiments of the pharmaceutical compositions, the pharmaceutical composition includes a second agent (e.g., therapeutic agent) in a therapeutically effective amount. In embodiments of the
  • the second agent is an agent for treating cancer.
  • the second agent is an anti-cancer agent. In embodiments, the second agent is a chemotherapeutic. In embodiments, the administering does not include administration of any active agent other than the recited active agent (e.g., a compound described herein). IV. Methods of Treatment
  • a method of treating cancer including administering to a subject in need thereof an effective amount of a compound described herein.
  • the compound is included in a therapeutically effective amount.
  • the compound is administered at a rate approximately equal to the half-life of an El enzyme.
  • the half-life of an El enzyme is about 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half- life of an El enzyme is greater than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half-life of an El enzyme is less than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours.
  • a method of treating a proliferative disease including administering to a subject in need thereof an effective amount of a compound described herein.
  • the compound is included in a therapeutically effective amount.
  • the compound is administered at a rate approximately equal to the half-life of an El enzyme.
  • the half-life of an El enzyme is about 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half- life of an El enzyme is greater than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half-life of an El enzyme is less than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours.
  • a method of treating cancer in a subject in need thereof including administering to the subject a pharmaceutically acceptable excipient and a therapeutically effective amount of a compound of formula:
  • [0393] are as described herein, including in embodiments.
  • [0394] — is a single bond or double bond.
  • L 3 is -0-, -S-, -N-, -S(O)-, -S(0) 2 -, -C(O)-, -N(R 7 )-, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene.
  • R 1 is hydrogen, halogen, -CXS, -CHXS, -CU 2 X ⁇ -OCX , -OCH2X 1 , -OCHXS, -CN, -SOniR 1A , -SO VI NR 1A R 1b , -NHC(0)NR 1A R 1b , -N(0) mi , -NR 1A R 1B , -NHNR 1A R 1B , -C(0)R 1A , -C(0)-OR 1a , -C(0)NR 1A R 1b , -C(0)NHNR 1A R 1b , -OR 1a , -NR 1A S0 2 R 1B ,
  • R 2 is hydrogen, halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCXS, -OCH 2 X 2 , -OCHX 2 2 , -CN, -SOfinity2R 2A , -SO V2 NR 2A R 2B , -NHC(0)NR 2A R 2B , -N(0)m2, -NR 2A R 2B , -NHNR 2A R 2B , -C(0)R 2A , -C(0)-OR 2A , -C(0)NR 2A R 2B , -C(0)NHNR 2A R 2B , -OR 2A , -NR 2A SO 2 R 2B ,
  • R 3 is hydrogen, halogen, -CX 3 3 , -CHX 3 2 , -CH 2 X 3 , -OCXS, -OCH 2 X 3 , -OCHXS, -CN, -SO estate 3 R 3A , -SO V3 NR 3A R 3B , -NHC(0)NR 3A R 3B , -N(0) m3 , -NR 3A R 3B , -NHNR 3A R 3B , -C(0)R 3A , -C(0)-OR 3A , -C(0)NR 3A R 3B , -OR 3A , -NR 3A S0 2 R 3B , -NR 3A C(0)R 3B ,
  • R 4 is hydrogen, halogen, -CX 4 3 , -CHX 4 2 , -CH 2 X 4 , -OCXS, -OCH 2 X 4 , -OCHXS, -CN, -SO n4 R 4A , -SO V4 NR 4A R 4B , -NHC(0)NR 4A R 4B , -N(0) m4 , -NR 4A R 4B , -NHNR 4A R 4B , -C(0)R 4A , -C(0)-OR 4A , -C(0)NR 4A R 4B , -C(0)NHNR 4A R 4B , -OR 4A , -NR 4A SO 2 R 4B ,
  • R 5 is hydrogen, halogen, -CX 5 3 , -CHX 5 2 , -CH 2 X 5 , -OCX 5 3 , -OCH 2 X 5 , -OCHX 5 2 , -CN, -SOn5R 5A , -SO V5 NR 5A R 5B , -NHC(0)NR 5A R 5B , -N(0) m5 , -NR 5A R 5B , -NHNR 5A R 5B , -C(0)R 5A , -C(0)-0R 5A , -C(0)NR 5A R 5B , -C(0)NHNR 5A R 5B , -OR 5A , -NR 5A SO 2 R 5B ,
  • R 6 is hydrogen, halogen, -CX 6 3 , -CHX 6 2 , -OEX 6 , -OCX 6 3 , -OOEX 6 , -OCHX 6 2 , -CN, -SO n6 R 6A , -SO V6 NR 6A R 6B , -NHC(0)NR 6A R 6B , -N(0) m6 , -NR 6A R 6B , -NHNR 6A R 6B , -C(0)R 6A , -C(0)-OR 6A , -C(0)NR 6A R 6B , -C(0)NHNR 6A R 6B , -OR 6A , -NR 6A SO 2 R 6B ,
  • R 7 is hydrogen, halogen, -CX 7 3 , -CHX 7 2 , -CH 2 X 7 , -OCX 7 3 , -OCH 2 X 7 , -OCHX 7 2 , -CN, -SOnvR 7A , -SO VV NR 7A R 7B , -NHC(0)NR 7A R 7B , -N(0) m v, -NR 7A R 7B , -NHNR 7A R 7B , -C(0)R 7A , -C(0)-OR 7A , -C(0)NR 7A R 7B , -C(0)NHNR 7A R 7B , -OR 7A , -NR 7A SO 2 R 7B ,
  • E 1 and E 2 are independently an electron- withdrawing moiety.
  • Each R 1A , R 1B , R 2A , R 2B , R 3A , R 3B , R 4A , R 4B , R 5A , R 5B , R 6A , R 6B , R 7A , and R 7B is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X, -C(0)OH, -C(0)NH 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO 2 , -SH, -SO 3 H, -SO 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • heterocycloalkyl substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl
  • R 1A and R 1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl
  • R 2A and R 2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl
  • R 4A and R 4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl
  • R 5A and R 5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubsti
  • ml, m2, m3, m4, m5, m6, and m7 are independently 1 or 2.
  • vl, v2, v3, v4, v5, v6, and v7 are independently 1 or 2.
  • nl, n2, n3, n4, n5, n6, and n7 are independently an integer from 0 to 4.
  • X, X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , and X 7 are independently -Cl, -Br, -I or -F.
  • L 1 and L 2 are independently a bond, -0-, -S-, -S(O)-, -S(0) 2 -, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkyl ene, substituted or unsubstituted heteroalkyl ene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
  • R 1 and R 2 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • R 4 and R 5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • the half-life of an El enzyme is about 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half- life of an El enzyme is greater than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half-life of an El enzyme is less than
  • the cancer is a human cancer, carcinoma, sarcoma,
  • the cancer is a solid cancer, lymphoid cancer, kidney, breast, lung, bladder, colon, ovarian, prostate, pancreas, stomach, brain, head and neck, skin, uterine, testicular, glioma, esophagus, or liver cancer.
  • the cancer is hepatocarcinoma or lymphoma.
  • the lymphoma is B-acute lymphoblastic lymphoma, non-Hodgkin’s lymphoma (e.g., Burkitt’s, Small Cell, and Large Cell lymphomas), Hodgkin’s lymphoma, leukemia (e.g., AML, ALL, and CML), or multiple myeloma.
  • non-Hodgkin’s lymphoma e.g., Burkitt’s, Small Cell, and Large Cell lymphomas
  • Hodgkin’s lymphoma e.g., Burkitt’s, Small Cell, and Large Cell lymphomas
  • leukemia e.g., AML, ALL, and CML
  • multiple myeloma e.g., multiple myeloma.
  • the compound is covalently attached to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2.
  • at least one of R 1 or R 2 includes an electron-withdrawing moiety.
  • at least one of R 1 or R 2 are sufficiently electron withdrawing to allow the compound to covalently bind to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2, wherein the El cysteine amino acid is bound to ring carbon C 2 attached to R 2 or ring carbon Ci attached to R 1 .
  • the compound covalently binds to an El cysteine amino acid corresponding to Cys30 of Uba2
  • the method includes allowing the compound to covalently bind an El enzyme. In embodiments, the method includes allowing the compound to covalently bind an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2. In embodiments, the method includes allowing the El cysteine amino acid to bind to carbon C 2 attached to R 2A and R 2B or to ring carbon Ci attached to R 1A . In embodiments, the method includes allowing the El cysteine amino acid to bind (e.g., covalently bind) to carbon C 2 attached to R 2A and R 2B or to carbon Ci attached to R 1A .
  • the carbon Ci is adjacent (e.g., bonded) to an R 1 or R 1A group as appropriate for the specified embodiment.
  • the carbon C 2 is adjacent (e.g., bonded) to an R 2 or R 2A or R 2B group as appropriate for the specified embodiment.
  • a method of inhibiting cell proliferation including contacting the cell with a compound described herein.
  • the method includes contacting the cell with an effective amount of the compound.
  • the compound is administered at a rate approximately equal to the half-life of an El enzyme.
  • the half-life of an El enzyme is about 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half- life of an El enzyme is greater than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half-life of an El enzyme is less than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours.
  • a method of inhibiting an El enzyme including contacting an El enzyme with a compound described herein, thereby inhibiting the El enzyme.
  • the method includes allowing the compound to covalently bind the El enzyme.
  • the method includes allowing the compound to covalently bind an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2.
  • the method includes allowing the El cysteine amino acid to bind to carbon C 2 attached to R 2A and R 2B or to ring carbon Ci attached to R 1A .
  • the method includes allowing the El cysteine amino acid to bind (e.g., covalently bind) to carbon C 2 attached to R 2A and R 2B or to carbon Ci attached to R 1A .
  • the methods include combining a ligand and a compound provided herein in a reaction vessel, allowing the ligand and the compound to form a covalent ligand- compound complex, and detecting the covalent ligand-compound complex thereby identifying the ligand as target protein or druggable hotspot.
  • A“reaction vessel” as provided herein refers to a vial, tube, flask, bottle, syringe or other container means, into which the ligand and the compound are combined to allow the formation of a covalent ligand- compound complex.
  • one or more of the ligands or compounds are labeled.
  • the label is a fluorescent label.
  • the compound includes a fluorescent label.
  • the method includes contacting a ligand with a compound provided herein and allowing the compound to covalently bind to the ligand, thereby forming a covalent compound-ligand complex; and detecting the covalent compound-ligand complex by nuclear magnetic resonance (NMR).
  • the ligand may be a protein, for example, any cellular or extracellular protein including without limitation, an enzyme, a structural protein, a cytoplasmic protein and a nuclear protein.
  • a method of detecting covalent binding of a ligand to a compound provided herein includes: (i) contacting a ligand with a compound provided herein; (ii) allowing the compound to covalently bind to the ligand, thereby forming a covalent ligand-compound complex; and (iii) detecting the covalent ligand-compound complex using nuclear magnetic resonance, thereby detecting covalent binding of the ligand to the compound.
  • the contacting is performed in a reaction vessel.
  • the ligand is a cysteine bearing polypeptide.
  • the detecting includes determining a chemical shift for an amino acid in the ligand.
  • the detecting includes producing an NMR spectra of the covalent ligand-compound complex and identifying a change in the NMR spectra relative to the absence of the compound.
  • a cysteine residue of the ligand is covalently bound to the compound.
  • a sulfhydryl functional group of a cysteine amino acid of the ligand may form a covalent bond with a compound provided herein including embodiments thereof.
  • the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an electrophilic moiety (e.g., E 1 or E 2 ) of the compound.
  • the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an atom adjacent to an electrophilic moiety (e.g., E 1 or E 2 ) of the compound.
  • the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an atom adjacent to L 1 or L 2 of the compound.
  • the ligand is a Uba2 enzyme and the amino acid corresponds to Cys30 of Uba2 subunit 2.
  • the method includes contacting a ligand with a compound provided herein and allowing the compound to covalently bind to the ligand, thereby forming a covalent compound-ligand complex; and detecting the covalent compound-ligand complex by quantitative mass spectrometry.
  • the ligand may be a protein, for example, any cellular or extracellular protein including without limitation, an enzyme, a structural protein, a cytoplasmic protein and a nuclear protein.
  • a method of detecting covalent binding of a ligand to a compound provided herein includes: (i) contacting a ligand with a compound provided herein; (ii) allowing the compound to covalently bind to the ligand, thereby forming a covalent ligand-compound complex; and (iii) detecting the covalent ligand-compound complex using quantitative mass spectrometry, thereby detecting covalent binding of the ligand to the compound.
  • the contacting is performed in a reaction vessel.
  • the ligand is a cysteine bearing polypeptide.
  • the detecting includes determining a molecular weight for the covalent ligand-compound complex.
  • the detecting includes producing a quantitative mass spectrometry spectrum of the covalent ligand-compound complex and identifying a change in the quantitative mass spectrometry spectrum relative to the absence of the compound.
  • a cysteine residue of the ligand is covalently bound to the compound.
  • a sulfhydryl functional group of a cysteine amino acid of the ligand may form a covalent bond with a compound provided herein including embodiments thereof.
  • the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an electrophilic moiety (e.g., E 1 or E 2 ) of the compound.
  • the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an atom adjacent to an electrophilic moiety (e.g., E 1 or E 2 ) of the compound.
  • the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an atom adjacent to L 1 or L 2 of the compound.
  • the ligand is a Uba2 enzyme and the amino acid corresponds to Cys30 of Uba2 subunit 2.
  • Embodiment Pl A method of treating cancer in a subject in need thereof, said method comprising administering to said subject a pharmaceutically acceptable excipient and a therapeutically effective amount of a compound of formula:
  • L 3 is -0-, -S-, -N-,— S(O)-,— S(0) 2 -, -C(O)— , -N(R 7 )-, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene;
  • R 1 is hydrogen, halogen, -CX 3 3 , -CHX ⁇ , -CH2X 1 , -OCX , -OCH2X 1 , -OCHXS, -CN, -SOniR 1A , -SO VI NR 1A R 1b , -NHC(0)NR 1A R 1b , -N(0)mi, -NR 1A R 1B , -NHNR 1A R 1B , -C(0)R 1A , -C(0)-OR 1A , -C(0)NR 1A R 1b , -C(0)NHNR 1A R 1b , -OR 1a , -NR 1A S0 2 R 1B , -NR 1A C(0)R 1b ,
  • R 2 is hydrogen, halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 , -OCHX 2 2 , -CN, -SO Rule2R 2A , -SO V2 NR 2A R 2B , -NHC(0)NR 2A R 2B , -N(0)m2, -NR 2A R 2B , -NHNR 2A R 2B , -C(0)R 2A ,
  • R 3 is hydrogen, halogen, -CX 3 3 , -CHX 3 2 , -CH 2 X 3 , -OCX 3 3 , -OCH 2 X 3 , -OCHX 3 2 , -
  • R 4 is hydrogen, halogen, -CX 4 3 , -CHX 4 2 , -CH 2 X 4 , -OCX 4 3 , -OCH 2 X 4 , -OCHX 4 2 , -CN, -SO n4 R 4A , -SO V4 NR 4A R 4B , -NHC(0)NR 4A R 4B , -N(0)m4, -NR 4A R 4B , -NHNR 4A R 4B , -C(0)R 4A , -C(0)-OR 4A , -C(0)NR 4A R 4B , -C(0)NHNR 4A R 4B , -OR 4A , -NR 4A S0 2 R 4B , -NR 4A C(0)R 4B , -NR 4A C(0)0R 4B , -NR 4A OR 4B , -N 3 , substituted or unsubstituted alkyl, substituted or unsubsti
  • R 5 is hydrogen, halogen, -CX 5 3 , -CHX 5 2 , -CH 2 X 5 , -OCX 5 3 , -OCH 2 X 5 , -OCHX 5 2 , -CN, -SOn5R 5A , -SO V5 NR 5A R 5B , -NHC(0)NR 5A R 5B , -N(0)m5, -NR 5A R 5B , -NHNR 5A R 5B , -C(0)R 5A , -C(0)-OR 5A , -C(0)NR 5A R 5B , -C(0)NHNR 5A R 5B , -OR 5A , -NR 5A S0 2 R 5B , -NR 5A C(0)R 5B , -NR 5A C(0)0R 5B , -NR 5A OR 5B , -N 3 , substituted or unsubstituted alkyl, substituted or unsubstit
  • R 6 is hydrogen, halogen, -CX 6 3 , -CHX 6 2 , -CH 2 X 6 , -OCX 6 3 , -OCH 2 X 6 , -OCHX 6 2 , -CN, -SO n6 R 6A , -SO V6 NR 6A R 6B , -NHC(0)NR 6A R 6B , -N(0)m6, -NR 6A R 6B , -NHNR 6A R 6B , -C(0)R 6A , -C(0)-OR 6A , -C(0)NR 6A R 6B , -C(0)NHNR 6A R 6B , -OR 6A , -NR 6A S0 2 R 6B , -NR 6A C(0)R 6B , -NR 6A C(0)0R 6B , -NR 6A OR 6B , -N 3 , substituted or unsubstituted alkyl, substituted or unsubsti
  • R 7 is hydrogen, halogen, -CX 7 3 , -CHX 7 2 , -CH 2 X 7 , -OCX 7 3 , -OCH 2 X 7 , -OCHX 7 2 , -CN, -SOnvR 7A , -SO VV NR 7A R 7B , -NHC(0)NR 7A R 7B , -N(0)mv, -NR 7A R 7B , -NHNR 7A R 7B , -C(0)R 7A , -C(0)-OR 7A , -C(0)NR 7A R 7B , -C(0)NHNR 7A R 7B , -OR 7A , -NR 7A S0 2 R 7B , -NR 7A C(0)R 7B , -NR 7A C(0)0R 7B , -NR 7A OR 7B , -N 3 , substituted or unsubstituted alkyl, substituted or unsubsti
  • E 1 and E 2 are independently an electron-withdrawing moiety;
  • Each R 1A , R 1b , R 2A , R 2B , R 3A , R 3B , R 4A , R 4B , R 5A , R 5B , R 6A , R 6B , R 7A , and R 7B is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X, -C(0)0H, -C(0)NH 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO 2 , -SH, -SO 3 H, -SO 4 H, -SO 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • heterocycloalkyl substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl
  • R 1A and R 1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl
  • R 2A and R 2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl
  • R 4A and R 4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl
  • R 5A and R 5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubsti
  • X, X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , and X 7 are independently -Cl, -Br, -I or -F;
  • L 1 and L 2 are independently a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkyl ene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted aryl ene, or substituted or unsubstituted heteroarylene;
  • R 1 and R 2 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
  • R 4 and R 5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; and wherein said compound is administered at a rate approximately equal to the half-life of an El enzyme.
  • Embodiment P2 The method of embodiment Pl, wherein said compound is covalently attached to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2.
  • Embodiment P3 The method of one of embodiments Pl to P2, wherein at least one of R 1 or R 2 comprises an electron-withdrawing moiety.
  • Embodiment P4 The method of one of embodiments Pl to P3, wherein at least one of R 1 or R 2 are sufficiently electron withdrawing to allow said compound to covalently bind to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2, wherein said El cysteine amino acid is bound to ring carbon C 2 attached to R 2 or ring carbon Ci attached to R 1 .
  • Embodiment P5. The method of one of embodiments Pl to P3, wherein said compound covalently binds to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2; and forms a complex of formula:
  • Embodiment P6 A compound of Formula
  • L 3 is -0-, -S-, or -N(R 7 )-;
  • V is -O- or -N(R 10 )-;
  • R 1A is hydrogen, halogen, -CX 1A 3 , -CHX 1A 2 , -CH 2 X 1A , -OCX 1A 3 , -OCH 2 X 1A , -OCHX 1A 2 ,
  • R 2A is hydrogen, halogen, -CX 2A 3 , -CHX 2A 2 , -CH 2 X 2A , -OCX 2A 3 , -OCH 2 X 2A , -OCHX 2A 2 ,
  • R 2B is hydrogen, halogen, -CX 2B 3 , -CHX 2B 2 , -CH 2 X 2B , -OCX 2B 3 , -OCH 2 X 2B , -OCHX 2B 2 ,
  • R 3 is hydrogen, halogen, -CX 3 3 , -CHX 3 2 , -CH 2 X 3 , -OCX 3 3 , -OCH 2 X 3 , -OCHX 3 2 , -CN, -SOfinityR 3A , -SO V3 NR 3A R 3B , -NHC(0)NR 3A R 3B , -N(0) m3 , -NR 3A R 3B , -NHNR 3A R 3B , -C(0)R 3A , -C(0)-OR 3A , -C(0)NR 3A R 3B , -OR 3A , -NR 3A S0 2 R 3B , -NR 3A C(0)R 3B , -NR 3A C(0)0R 3B , -NR 3A OR 3B , -N 3 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or un
  • R 4 is hydrogen, halogen, -CX 4 3 , -CHX 4 2 , -CH 2 X 4 , -OCX 4 3 , -OCH 2 X 4 , -OCHX 4 2 , -CN, -SO n4 R 4A , -SO V4 NR 4A R 4B , -NHC(0)NR 4A R 4B , -N(0)m4, -NR 4A R 4B , -NHNR 4A R 4B , -C(0)R 4A , -C(0)-OR 4A , -C(0)NR 4A R 4B , -C(0)NHNR 4A R 4B , -OR 4A , -NR 4A S0 2 R 4B , -NR 4A C(0)R 4B , -NR 4A C(0)0R 4B , -NR 4A OR 4B , -N 3 , substituted or unsubstituted alkyl, substituted or unsubsti
  • R 5 is hydrogen, halogen, -CX 5 3 , -CHX 5 2 , -CH 2 X 5 , -OCX 5 3 , -OCH 2 X 5 , -OCHX 5 2 , -CN, -SOn5R 5A , -SO V5 NR 5A R 5B , -NHC(0)NR 5A R 5B , -N(0)m5, -NR 5A R 5B , -NHNR 5A R 5B , -C(0)R 5A , -C(0)-OR 5A , -C(0)NR 5A R 5B , -C(0)NHNR 5A R 5B , -OR 5A , -NR 5A S0 2 R 5B , -NR 5A C(0)R 5B , -NR 5A C(0)0R 5B , -NR 5A OR 5B , -N 3 , substituted or unsubstituted alkyl, substituted or unsubstit
  • R 8 is hydrogen, halogen, -CX 8 3 , -CHX 8 2 , -CH 2 X 8 , -OCX 8 3 , -OCH 2 X 8 , -OCHX 8 2 , -CN, -SOn5R 8A , -SO V5 NR 8A R 8B , -NHC(0)NR 8A R 8B , -N(0) m5 , -NR 8A R 8B , -NHNR 8A R 8B , -C(0)R 8A , -C(0)-OR 8A , -C(0)NR 8A R 8B , -C(0)NHNR 8A R 8B , -OR 8A , -NR 8A S0 2 R 8B , -NR 8A C(0)R 8B , -NR 8A C(0)0R 8B , -NR 8A OR 8B , -N 3 , substituted or unsubstituted alkyl, substituted or un
  • R 9 is hydrogen, halogen, -CX 9 3 , -CHX 9 2 , -CH 2 X 9 , -OCX 9 3 , -OCH 2 X 9 , -OCHX 9 2 , -CN, -SOn5R 9A , -SO V5 NR 9A R 9B , -NHC(0)NR 9A R 9B , -N(0)m5, -NR 9A R 9B , -NHNR 9A R 9B , -C(0)R 9A , -C(0)-OR 9A , -C(0)NR 9A R 9B , -C(0)NHNR 9A R 9B , -OR 9A , -NR 9A S0 2 R 9B , -NR 9A C(0)R 9B , -NR 9A C(0)0R 9B , -NR 9A OR 9B , -N 3 , substituted or unsubstituted alkyl, substituted or unsubstit
  • R 10 is hydrogen, halogen, -CX 10 3 , -CHX 10 2 , -CH 2 X 10 , -OCX 10 3 , -OCH 2 X 10 , -OCHX 10 2 , -CN, -SOnioR 10A , -SOvioNR 10A R 10B , -NHC(O)NR 10A R 10B , -N(0) mi o, -NR 10A R 10B , -NHNR 10A R 10B , -C(O)R 10A , -C(O)-OR 10A , -C(O)NR 10A R 10B , -C(O)NHNR 10A R 10B , -OR 10A , -NR 10A SO 2 R 10B , -NR 10A C(O)R 10B , -NR 10A C(O)OR 10B , -NR 10A OR 10B , -N 3 , substituted or unsubsti
  • R 9A , R 9B , R 10a , and R 10B is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X, -C(0)OH, -C(0)NH 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -N0 2 , -SH, -SO 3 H, -SO 4 H, -SO 2 NH 2 ,
  • R 1AA and R 1AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
  • R 2AA and R 2AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
  • R 2BA and R 2BB substituents bonded to the same nitrogen atom may optionally
  • X, X 1A , X 2A , X 2B , X 3 , X 4 , X 5 , X 7 , X 8 , X 9 , and X 10 are independently -Cl, -Br, -I or, -F;
  • L 6 is substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene;

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

There are disclosed, inter alia, methods of inhibiting an E1 enzyme, and compounds useful for inhibiting an E1 enzyme.

Description

SUMO INHIBITOR COMPOUNDS AND USES THEREOF
CROSS-REFERENCES TO RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional Application No. 62/712,822, filed July 31, 2018, which is incorporated herein by reference in its entirety and for all purposes.
REFERENCE TO A "SEQUENCE LISTING," A TABLE, OR A COMPUTER
PROGRAM LISTING APPENDIX SUBMITTED AS AN ASCII FILE
[0002] The Sequence Listing written in file 048440-
50l00lWO_Sequence_Listing_ST25.txt, created July 30, 2019, 7,269 bytes, machine format IBM-PC, MS Windows operating system, is hereby incorporated by reference.
BACKGROUND
[0003] Post-translational modifications of cellular proteins by the small ubiquitin-like modifier (SUMO) family of proteins are important epigenetic mechanisms for regulating various cellular functions. Aberrations in post-translational modification of cellular proteins by the small ubiquitin-like modifier (SUMO) family of proteins are associated with the pathogenesis of life-threatening diseases, such as cancer, neurodegenerative disorders, and viral infection. Indeed, the enzymes catalyzing SUMO-modification (e.g., El disclosed herein) are present in higher levels in cancer tissues versus normal tissues and in metastasized tumors versus normal cells, and play an important role in cancer proliferation and metastasis. Without wishing to be bound by any theory, it is believed that El is a target for the development of therapeutics (e.g., cancer therapeutics). Thus, there are disclosed herein methods of inhibiting an El enzyme, and compounds useful for inhibiting an El enzyme.
SUMMARY
[0004] In an aspect is provided a method of treating cancer in a subject in need thereof, said method including administering to the subject a pharmaceutically acceptable excipient and a therapeutically effective amount of a compound of formula:
Figure imgf000003_0001
[0006] — is a single bond or double bond.
[0007] L3 is -0-, -S-, -N-, -S(O)-, -S(0)2-, -C(O)-, -N(R7)-, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene. [0008] R1 is hydrogen, halogen, -CX , -CHXS, -CH2X\ -OCX , -OC1EX1, -OCHX ,
-CN, -SOniR1A, -SOVINR1AR1b, -NHC(0)NR1AR1b, -N(0)mi, -NR1AR1B, -NHNR1AR1B, -C(0)R1A, -C(0)-OR1a, -C(0)NR1AR1b, -C(0)NHNR1AR1b, -OR1a, -NR1AS02R1B,
-NR1AC(0)R1B, -NR1AC(0)OR1B, -NR1AOR1B, -N3, -L'-E1, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0009] R2 is hydrogen, halogen, -CX2 3, -CHX2 2, -CH2X2, -OCX2 3, -OCH2X2, -OCHX2 2, -CN, -SO„2R2A, -SOV2NR2AR2B, -NHC(0)NR2AR2B, -N(0)m2, -NR2AR2B, -NHNR2AR2B, -C(0)R2A, -C(0)-OR2A, -C(0)NR2AR2B, -C(0)NHNR2AR2B, -OR2A, -NR2ASO2R2B,
-NR2AC(0)R2B, -NR2AC(0)0R2B, -NR2AOR2B, -N3, -L2-E2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0010] R3 is hydrogen, halogen, -CX3 3, -CHX3 2, -CH2X3, -OCX3 3, -OCH2X3, -OCHX3 2, -CN, -SO„R3A, -SOV3NR3AR3B, -NHC(0)NR3AR3B, -N(0)m3, -NR3AR3B, -NHNR3AR3B, -C(0)R3A, -C(0)-OR3A, -C(0)NR3AR3B, -OR3A, -NR3AS02R3B, -NR3AC(0)R3B,
-NR3AC(0)0R3B, -NR3AOR3B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. [0011] R4 is hydrogen, halogen, -CX4 3, -CHX4 2, -CH2X4, -OCX4 3, -OCH2X4, -OCHX4 2, -CN, -SOn4R4A, -SOv4NR4AR4B, -NHC(0)NR4AR4B, -N(0)m4, -NR4AR4B, -NHNR4AR4B, -C(0)R4A, -C(0)-0R4A, -C(0)NR4AR4B, -C(0)NHNR4AR4B, -OR4A, -NR4ASO2R4B,
-NR4AC(0)R4B, -NR4AC(0)0R4B, -NR4AOR4B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0012] R5 is hydrogen, halogen, -CX5 3, -CHX5 2, -CH2X5, -OCX5 3, -OCH2X5, -OCHX5 2, -CN, -SOn5R5A, -SOV5NR5AR5B, -NHC(0)NR5AR5B, -N(0)m5, -NR5AR5B, -NHNR5AR5B, -C(0)R5A, -C(0)-OR5A, -C(0)NR5AR5B, -C(0)NHNR5AR5B, -OR5A, -NR5ASO2R5B,
-NR5AC(0)R5B, -NR5AC(0)0R5B, -NR5AOR5B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0013] R6 is hydrogen, halogen, -CX6 3, -CHX6 2, -OEX6, -OCX6 3, -OOEX6, -OCHX6 2, -CN, -SOn6R6A, -SOV6NR6AR6B, -NHC(0)NR6AR6B, -N(0)m6, -NR6AR6B, -NHNR6AR6B, -C(0)R6A, -C(0)-OR6A, -C(0)NR6AR6B, -C(0)NHNR6AR6B, -OR6A, -NR6ASO2R6B,
-NR6AC(0)R6B, -NR6AC(0)0R6B, -NR6AOR6B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0014] R7 is hydrogen, halogen, -CX7 3, -CHX7 2, -CH2X7, -OCX7 3, -OCH2X7, -OCHX7 2, -CN, -SOnvR7A, -SOVVNR7AR7B, -NHC(0)NR7AR7B, -N(0)mv, -NR7AR7B, -NHNR7AR7B, -C(0)R7A, -C(0)-OR7A, -C(0)NR7AR7B, -C(0)NHNR7AR7B, -OR7A, -NR7ASO2R7B,
-NR7AC(0)R7B, -NR7AC(0)0R7B, -NR7AOR7B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0015] E1 and E2 are independently an electron- withdrawing moiety.
[0016] Each R1A, R1B, R2A, R2B, R3A, R3B, R4A, R4B, R5A, R5B, R6A, R6B, R7A, and R7B is independently hydrogen, -CX3, -CHX2, -CH2X, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)0H, -NHOH, -OCX3, -OCHX2, -OCH2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted
heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R1A and R1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2A and R2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R4A and R4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R5A and R5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R6A and R6B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R7A and R7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl.
[0017] ml, m2, m3, m4, m5, m6, and m7 are independently 1 or 2.
[0018] vl, v2, v3, v4, v5, v6, and v7 are independently 1 or 2.
[0019] nl, n2, n3, n4, n5, n6, and n7, are independently an integer from 0 to 4.
[0020] X, X1, X2, X3, X4, X5, X6, and X7 are independently -Cl, -Br, -I or -F.
[0021] L1 and L2 are independently a bond, -0-, -S-, -S(O)-, -S(0)2-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -C(0)NHNH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted
heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl ene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
[0022] R1 and R2 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. [0023] R4 and R5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0024] Wherein the compound is administered at a rate approximately equal to the half-life of an El enzyme.
[0025] In an aspect is provided a compound of Formula:
Figure imgf000006_0001
[0027] L3 is -0-, -S-, or -N(R7)-. [0028] L7 is -O- or -N(R10)-.
[0029] R1A is hydrogen, halogen, -CX1A 3, -CHX1A 2, -CH2X1A, -OCX1A 3, -OCH2X1A, -OCHX1A 2, -CN, -SOniAR1AA, -SOVIANR1AAR1ab, -NHC(0)NR1AAR1AB, -N(0)miA,
-NR1AAR1AB, -NHNR1AAR1AB, -C(0)R1aa, -C(0)-OR1aa, -C(0)NR1AAR1AB, -OR1aa, -NR I AAS02R I ab, -NR1AAC(0)R1AB, -NR1AAC(0)0R1AB, -NR1AAOR1AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0030] R2A is hydrogen, halogen, -CX2A 3, -CHX2A 2, -CH2X2A, -OCX2A 3, -OCH2X2A, -OCHX2A 2, -CN, -SOn2AR2AA, -SOV2ANR2AAR2AB, -NHC(0)NR2AAR2AB, -N(0)m2A,
-NR2AAR2AB, -NHNR2AAR2AB, -C(0)R2AA, -C(0)-OR2AA, -C(0)NR2AAR2AB, -OR2AA,
-NR2AAS02R2AB, -NR2AAC(0)R2AB, -NR2AAC(0)0R2AB, -NR2AAOR2AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0031] R2B is hydrogen, halogen, -CX2B 3, -CHX2B 2, -CH2X2B, -OCX2B 3, -OCH2X2B, -OCHX2B 2, -CN, -SO„2BR2BA, -SOV2BNR2BAR2BB, -NHC(0)NR2BAR2BB, -N(0)m2B,
-NR2BAR2BB, -NHNR2BAR2BB, -C(0)R2BA, -C(0)-OR2BA, -C(0)NR2BAR2BB, -OR2BA,
-NR2BAS02R2BB, -NR2BAC(0)R2BB, -NR2BAC(0)0R2BB, -NR2BAOR2BB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0032] R3 is hydrogen, halogen, -CX3 3, -CHX3 2, -CH2X3, -OCX3 3, -OCH2X3, -OCHX3 2, -CN, -SO„R3A, -SOV3NR3AR3B, -NHC(0)NR3AR3B, -N(0)m3, -NR3AR3B, -NHNR3AR3B, -C(0)R3A, -C(0)-OR3A, -C(0)NR3AR3B, -OR3A, -NR3AS02R3B, -NR3AC(0)R3B,
-NR3AC(0)0R3B, -NR3AOR3B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0033] R4 is hydrogen, halogen, -CX4 3, -CHX4 2, -CH2X4, -OCX4 3, -OCH2X4, -OCHX4 2, -CN, -SOn4R4A, -SOV4NR4AR4B, -NHC(0)NR4AR4B, -N(0)m4, -NR4AR4B, -NHNR4AR4B, -C(0)R4A, -C(0)-OR4A, -C(0)NR4AR4B, -C(0)NHNR4AR4B, -OR4A, -NR4ASO2R4B,
-NR4AC(0)R4B, -NR4AC(0)0R4B, -NR4AOR4B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl. [0034] R5 is hydrogen, halogen, -CX5 3, -CHX5 2, -CH2X5, -OCX5 3, -OCH2X5, -OCHX5 2, -CN, -SOn5R5A, -SOV5NR5AR5B, -NHC(0)NR5AR5B, -N(0)m5, -NR5AR5B, -NHNR5AR5B, -C(0)R5A, -C(0)-0R5A, -C(0)NR5AR5B, -C(0)NHNR5AR5B, -OR5A, -NR5ASO2R5B,
-NR5AC(0)R5B, -NR5AC(0)0R5B, -NR5AOR5B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0035] R7 is hydrogen, halogen, -CX7 3, -CHX7 2, -CH2X7, -OCX7 3, -OCH2X7, -OCHX7 2, -CN, -SOnvR7A, -SOVVNR7AR7B, -NHC(0)NR7AR7B, -N(0)mv, -NR7AR7B, -NHNR7AR7B, -C(0)R7A, -C(0)-OR7A, -C(0)NR7AR7B, -C(0)NHNR7AR7B, -OR7A, -NR7ASO2R7B,
-NR7AC(0)R7B, -NR7AC(0)0R7B, -NR7AOR7B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0036] R8 is hydrogen, halogen, -CX8 3, -CHX8 2, -CH2X8, -OCX8 3, -OCH2X8, -OCHX8 2, -CN, -SOn8R8A, -SOv8NR8AR8B, -NHC(0)NR8AR8B, -N(0)m8, -NR8AR8B, -NHNR8AR8B, -C(0)R8A, -C(0)-OR8A, -C(0)NR8AR8B, -C(0)NHNR8AR8B, -OR8A, -NR8ASO2R8B,
-NR8AC(0)R8B, -NR8AC(0)0R8B, -NR8AOR8B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0037] R9 is hydrogen, halogen, -CX9 3, -CHX9 2, -CH2X9, -OCX9 3, -OCH2X9, -OCHX9 2, -CN, -SO„9R9A, -SOV9NR9AR9B, -NHC(0)NR9AR9B, -N(0)m9, -NR9AR9B, -NHNR9AR9B, -C(0)R9A, -C(0)-OR9A, -C(0)NR9AR9B, -C(0)NHNR9AR9B, -OR9A, -NR9ASO2R9B,
-NR9AC(0)R9B, -NR9AC(0)0R9B, -NR9AOR9B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0038] R10 is hydrogen, halogen, -CX10 3, -CHX10 2, -CH2X10, -OCX10 3, -OCH2X10,
-OCHX10 2, -CN, -SOnioR10A, -SOvioNR10AR10B, -NHC(O)NR10AR10B, -N(0)mio, -NR10AR10B, -NHNR10AR10B, -C(O)R10A, -C(O)-OR10A, -C(O)NR10AR10B, -C(O)NHNR10AR10B, -OR10A, -NR10ASO2R10B, -NR10AC(O)R10B, -NR10AC(O)OR10B, -NR10AOR10B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0039] Each R1AA, R1AB, R2AA, R2AB, R2BA, R2BB, R3A, R3B, R4A, R4B, R5A, R5B, R7A, R7B, R8A, R8B, R9A, R9B, R10a, and R10B is independently hydrogen, -CX3, -CHX2, -CH2X,
-C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX3, -OCHX2, -OCH2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl; R1AA and R1AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2AA and R2AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2BA and R2BB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R3A and R3B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R4A and R4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R5A and R5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R7A and R7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R10A and R10B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl.
[0040] ml A, m2A, m2B, m3, m4, m5, m7, m8, m9, and mlO are independently 1 or 2. [0041] vl A, v2A, v2B, v3, v4, v5, v7, v8, v9, and vlO are independently 1 or 2.
[0042] nlA, n2A, n2B, n3, n4, n5, n7, n8, n9, and nlO are independently an integer from 0 to 4.
[0043] X, X1A, X2A, X2B, X3, X4, X5, X7, X8, X9, and X10 are independently -Cl, -Br, -I, or -F.
[0044] L6 is substituted or unsubstituted alkyl ene, substituted or unsubstituted
heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl ene, substituted or unsubstituted aryl ene, or substituted or unsubstituted heteroaryl ene.
[0045] L8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, -S-, -S(O)-, -S(0)2-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or
unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
[0046] L9 is a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -0C(0)-, -NHC(O)-, -NHC(0)NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
[0047] Wherein R2A and R2B may optionally be joined to form a substituted or
unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl.
[0048] R4 and R5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0049] In an aspect is provided a pharmaceutical composition including a compound described herein, or pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
[0050] In an aspect is provided a method of treating cancer, the method including administering to a subject in need thereof an effective amount of a compound described herein. [0051] In an aspect is provided a method of inhibiting cell proliferation, the method including contacting the cell with a compound described herein.
BRIEF DESCRIPTION OF THE DRAWINGS
[0052] FIG. 1. Examination of the effect of compounds 582 and 588 to reduce cancer stem cell (CSC) populations in patient derived xenograft (PDX) models using limited dilution assays. Compound 582 showed dose-dependent inhibition on PDX cancer-initiating-cell (CIC) frequency, even at 1 mM. Compound 588 only showed inhibition on CIC at high dose 10 mM.
DETAILED DESCRIPTION
I. Definitions
[0053] The abbreviations used herein have their conventional meaning within the chemical and biological arts. The chemical structures and formulae set forth herein are constructed according to the standard rules of chemical valency known in the chemical arts.
[0054] Where substituent groups are specified by their conventional chemical formulae, written from left to right, they equally encompass the chemically identical substituents that would result from writing the structure from right to left, e.g., -CH20- is equivalent to -OCH2-.
[0055] The term“alkyl,” by itself or as part of another substituent, means, unless otherwise stated, a straight (i.e., unbranched) or branched carbon chain (or carbon), or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include mono-, di- and multivalent radicals, having the number of carbon atoms designated (i.e., C1-C10 means one to ten carbons). Alkyl is an uncyclized chain. Examples of saturated hydrocarbon radicals include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t- butyl, isobutyl, sec-butyl, homologs and isomers of, for example, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like. An unsaturated alkyl group is one having one or more double bonds or triple bonds. Examples of unsaturated alkyl groups include, but are not limited to, vinyl, 2- propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, 3-(l,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers. An alkoxy is an alkyl attached to the remainder of the molecule via an oxygen linker (-0-). [0056] The term“alkylene,” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkyl, as exemplified, but not limited by, -CH2CH2CH2CH2-. The term“alkenylene,” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkene.
[0057] The term“heteroalkyl,” by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or combinations thereof, including at least one carbon atom and at least one heteroatom (e.g., O, N, P, S, B, As, or Si), and wherein the nitrogen and sulfur atoms may optionally be oxidized, and the nitrogen heteroatom may optionally be quatemized. The heteroatom(s) (e.g., O, N, P, S, B, As, or Si) may be placed at any interior position of the heteroalkyl group or at the position at which the alkyl group is attached to the remainder of the molecule. Heteroalkyl is an uncyclized chain. Examples include, but are not limited to: -CH2-CH2-O-CH3, -CH2-CH2-NH-CH3,
-CH2-CH2-N(CH3)-CH3, -CH2-S-CH2-CH3, -CH2-CH2, -S(0)-CH3, -CH2-CH2-S(0)2-CH3, -CH=CH-0-CH3, -Si(CH3)3, -CH2-CH=N-OCH3, -CH=CH-N(CH3)-CH3, -0-CH3,
-O-CH2-CH3, and -CN. Up to two or three heteroatoms may be consecutive, such as, for example, -CH2-NH-OCH3 and -CH2-0-Si(CH3)3.
[0058] Similarly, the term“heteroalkylene,” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from heteroalkyl, as exemplified, but not limited by, -CH2-CH2-S-CH2-CH2- and -CH2-S-CH2-CH2-NH-CH2-. For
heteroalkylene groups, heteroatoms can also occupy either or both of the chain termini (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like). Still further, for alkylene and heteroalkylene linking groups, no orientation of the linking group is implied by the direction in which the formula of the linking group is written. For example, the formula - C(0)2R'- represents both -C(0)2R'- and -R'C(0)2-. As described above, heteroalkyl groups, as used herein, include those groups that are attached to the remainder of the molecule through a heteroatom, such as -C(0)R, -C(0)NR', -NR'R", -OR', -SR', and/or -SO2R'.
[0059] The terms“cycloalkyl” and“heterocycloalkyl,” by themselves or in combination with other terms, mean, unless otherwise stated, cyclic versions of“alkyl” and“heteroalkyl,” respectively. Cycloalkyl and heterocycloalkyl are not aromatic. Additionally, for
heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule. A“cycloalkylene” and a“heterocycloalkylene,” alone or as part of another substituent, means a divalent radical derived from a cycloalkyl and
heterocycloalkyl, respectively.
[0060] The terms“halo” or“halogen,” by themselves or as part of another substituent, mean, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom. Additionally, terms such as“haloalkyl” are meant to include monohaloalkyl and polyhaloalkyl. For example, the term“halo(Ci-C4)alkyl” includes, but is not limited to, fluoromethyl, difluoromethyl, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.
[0061] The term“acyl” means, unless otherwise stated, -C(0)R where R is a substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0062] The term“aryl” means, unless otherwise stated, a polyunsaturated, aromatic, hydrocarbon substituent, which can be a single ring or multiple rings (preferably from 1 to 3 rings) that are fused together (i.e., a fused ring aryl) or linked covalently. A fused ring aryl refers to multiple rings fused together wherein at least one of the fused rings is an aryl ring. The term“heteroaryl” refers to aryl groups (or rings) that contain at least one heteroatom such as N, O, or S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized. Thus, the term“heteroaryl” includes fused ring heteroaryl groups (i.e., multiple rings fused together wherein at least one of the fused rings is a heteroaromatic ring). A heteroaryl group can be attached to the remainder of the molecule through a carbon or heteroatom. An“arylene” and a“heteroaryl ene,” alone or as part of another substituent, mean a divalent radical derived from an aryl and heteroaryl, respectively.
[0063] Spirocyclic rings are two or more rings wherein adjacent rings are attached through a single atom. The individual rings within spirocyclic rings may be identical or different. Individual rings in spirocyclic rings may be substituted or unsubstituted and may have different substituents from other individual rings within a set of spirocyclic rings. Possible substituents for individual rings within spirocyclic rings are the possible substituents for the same ring when not part of spirocyclic rings (e.g. substituents for cycloalkyl or
heterocycloalkyl rings). Spirocylic rings may be substituted or unsubstituted cycloalkyl, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heterocycloalkylene and individual rings within a spirocyclic ring group may be any of the immediately previous list, including having all rings of one type (e.g. all rings being substituted heterocycloalkylene wherein each ring may be the same or different substituted heterocycloalkylene). When referring to a spirocyclic ring system, heterocyclic spirocyclic rings means a spirocyclic rings wherein at least one ring is a heterocyclic ring and wherein each ring may be a different ring. When referring to a spirocyclic ring system, substituted spirocyclic rings means that at least one ring is substituted and each substituent may optionally be different.
[0064] The symbol
Figure imgf000014_0001
” denotes the point of attachment of a chemical moiety to the remainder of a molecule or chemical formula.
[0065] The term“oxo,” as used herein, means an oxygen that is double bonded to a carbon atom.
[0066] The term“alkylarylene” as an arylene moiety covalently bonded to an alkylene moiety (also referred to herein as an alkylene linker). In embodiments, the alkylarylene group has the formula:
Figure imgf000014_0002
[0067] Each of the above terms (e.g.,“alkyl,”“heteroalkyl,”“cycloalkyl,”
“heterocycloalkyl,”“aryl,” and“heteroaryl”) includes both substituted and unsubstituted forms of the indicated radical.
[0068] Substituents for the alkyl and heteroalkyl radicals (including those groups often referred to as alkylene, alkenyl, heteroalkylene, heteroalkenyl, alkynyl, cycloalkyl, heterocycloalkyl, cycloalkenyl, and heterocycloalkenyl) can be one or more of a variety of groups selected from, but not limited to, -OR', =0, =NR', =N-OR, -NR'R", -SR', -halogen, -SiR'R"R"', -OC(0)R', -C(0)R', -C02R, -CONR'R", -OC(0)NR'R", -NR"C(0)R',
NR'-C(0)NR"R'", -NR"C(0)2R, -NR-C(NR'R"R"')=NR"", -NR-C(NR'R")=NR"', -S(0)R', S(0)2R, -S(0)2NR'R", -NRS02R, -NR'NR'R'", -ONR'R", -NR'C(0)NR"NR"'R"", -CN,
-N02, -NR'S02R", -NR'C(0)R", -NR'C(0)-OR", -NR'OR", in a number ranging from zero to (2m'+l), where m' is the total number of carbon atoms in such radical. R, R', R", R", and R"" each preferably independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl (e.g., aryl substituted with 1-3 halogens), substituted or unsubstituted heteroaryl, substituted or unsubstituted alkyl, alkoxy, or thioalkoxy groups, or arylalkyl groups. When a compound described herein includes more than one R group, for example, each of the R groups is independently selected as are each R', R", R", and R"" group when more than one of these groups is present. When R and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 4-, 5-, 6-, or 7- membered ring. For example, -NR'R" includes, but is not limited to, l-pyrrolidinyl and 4- morpholinyl. From the above discussion of substituents, one of skill in the art will understand that the term“alkyl” is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (e.g., -CF3 and -CH2CF3) and acyl (e.g., -C(0)CH3, -C(0)CF3, -C(0)CH20CH3, and the like).
[0069] Similar to the substituents described for the alkyl radical, substituents for the aryl and heteroaryl groups are varied and are selected from, for example: -OR, -NR'R", -SR, -halogen, -SiR'R'R", -OC(0)R, -C(0)R, -C02R, -CONR'R", -OC(0)NRR", -NR"C(0)R, -NR-C(0)NR"R", -NR"C(0)2R, -NR-C(NRR"R")=NR"", -NR-C(NRR")=NR", -S(0)R, -S(0)2R, -S(0)2NRR", -NRSO2R, -NR'NR'R", -ONR'R", -NRC(0)NR"NR"R"", -CN, -NO2, -R, -N3, -CH(Ph)2, fluoro(Ci-C4)alkoxy, and fluoro(Ci-C4)alkyl, -NRSO2R",
-NR'C(0)R", -NR'C(0)-OR", -NR'OR", in a number ranging from zero to the total number of open valences on the aromatic ring system; and where R, R", R", and R"" are preferably independently selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. When a compound described herein includes more than one R group, for example, each of the R groups is independently selected as are each R, R", R", and R"" groups when more than one of these groups is present.
[0070] Substituents for rings (e.g. cycloalkyl, heterocycloalkyl, aryl, heteroaryl, cycloalkylene, heterocycloalkylene, arylene, or heteroaryl ene) may be depicted as
substituents on the ring rather than on a specific atom of a ring (commonly referred to as a floating substituent). In such a case, the substituent may be attached to any of the ring atoms (obeying the rules of chemical valency) and in the case of fused rings or spirocyclic rings, a substituent depicted as associated with one member of the fused rings or spirocyclic rings (a floating substituent on a single ring), may be a substituent on any of the fused rings or spirocyclic rings (a floating substituent on multiple rings). When a substituent is attached to a ring, but not a specific atom (a floating substituent), and a subscript for the substituent is an integer greater than one, the multiple substituents may be on the same atom, same ring, different atoms, different fused rings, different spirocyclic rings, and each substituent may optionally be different. Where a point of attachment of a ring to the remainder of a molecule is not limited to a single atom (a floating substituent), the attachment point may be any atom of the ring and in the case of a fused ring or spirocyclic ring, any atom of any of the fused rings or spirocyclic rings while obeying the rules of chemical valency. Where a ring, fused rings, or spirocyclic rings contain one or more ring heteroatoms and the ring, fused rings, or spirocyclic rings are shown with one more floating substituents (including, but not limited to, points of attachment to the remainder of the molecule), the floating substituents may be bonded to the heteroatoms. Where the ring heteroatoms are shown bound to one or more hydrogens (e.g. a ring nitrogen with two bonds to ring atoms and a third bond to a hydrogen) in the structure or formula with the floating substituent, when the heteroatom is bonded to the floating substituent, the substituent will be understood to replace the hydrogen, while obeying the rules of chemical valency.
[0071] Two or more substituents may optionally be joined to form aryl, heteroaryl, cycloalkyl, or heterocycloalkyl groups. Such so-called ring-forming substituents are typically, though not necessarily, found attached to a cyclic base structure. In one embodiment, the ring-forming substituents are attached to adjacent members of the base structure. For example, two ring-forming substituents attached to adjacent members of a cyclic base structure create a fused ring structure. In another embodiment, the ring-forming substituents are attached to a single member of the base structure. For example, two ring-forming substituents attached to a single member of a cyclic base structure create a spirocyclic structure. In yet another embodiment, the ring-forming substituents are attached to non- adjacent members of the base structure.
[0072] As used herein, the terms“heteroatom” or“ring heteroatom” are meant to include oxygen (O), nitrogen (N), sulfur (S), phosphorus (P), Boron (B), and silicon (Si).
[0073] A“substituent group,” as used herein, means a group selected from the following moieties:
(A) oxo, halogen, -CC13, -CBr3, -CF3, -CL·, -CHCh, -CHBr2, -CHF2, -CHI2, -CH2C1, -CH2Br, -CH2F, -CH2I, -CN, -OH, -ML·, -COOH, -COML·, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -OML·, -MfC(0)MfNH2, -NHC(0)Mf2, -MfS02H, -NHC(0)H, -NHC(0)0H, -NHOH, -OCCb, -OCF3, -OCBr3, -OC OCHCh, -OCHBr2, -OCHI2, -OCHF2, -OCH2Cl, -OCH2Br, -OCH2F, -OCH2I, -N3, unsubstituted alkyl (e g., Ci-C20, Ci-Ci2, Ci-C8, Ci-C6, C1-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 20 membered,
2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C10, C3-C8, C3-C6, C4- C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), and
(B) alkyl (e.g., Ci-C20, Ci-Ci2, Ci-Cs, Ci-C6, C1-C4, or Ci-C2), heteroalkyl (e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to
3 membered, or 4 to 5 membered), cycloalkyl (e.g., C3-C10, C3-C8, C3-C6, C4-C6, or C5- C6), heterocycloalkyl (e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), substituted with at least one substituent selected from:
(i) oxo, halogen, -CCI3, -CBr3, -CF3, -CI3, -CHCh, -CHBr2, -CHF2, -CHI2, -CH2C1, -CH2Br, -CH2F, -CH2I, -CN, -OH, -NH2, -COOH, -COMB, -N02, -SH, -SO3H, -S04H, -S02NH2, -MFNH2, -OMB, -MIC (0)MFNH2, -MiC(0)MB, -NHS02H, -MiC(0)H, -MiC(0)OH, -MiOH, -OCCb, -OCF3, -OCBr3, -OCb,-OCHCl2, -OCHBr2, -OCHb, -OCHF2, -OCH2Cl, -OCH2Br, -OCH2F, -OCH2I, -N3,
unsubstituted alkyl (e.g., Ci-C20, Ci-Ci2, Ci-Cs, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C10, C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted
heterocycloalkyl (e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), and
(ii) alkyl (e.g., Ci-C20, Ci-Ci2, Ci-C8, Ci-C6, Ci-C4, or Ci-C2), heteroalkyl (e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), cycloalkyl (e.g., C3-C10, C3-C8, C3-C6, C4-C6, or C5-C6), heterocycloalkyl (e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered,
5 to 9 membered, or 5 to 6 membered), substituted with at least one substituent selected from:
(a) oxo, halogen, -CCh, -CBr3, -CF3, -CI3, -CHCb, -CHBr2, -CHF2, -CHI2, -CH2CI, -CH2Br, -CH2F, -CH2I, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC(0)NHNH2, -NHC(0)NH2, -NHSO2H, -NHC(0)H, -NHC(0)OH, -NHOH, -OCCh, -OCF3, -OCBr3, -OCI3, -OCHCb, -OCHBr2, -OCHI2, -OCHF2, -OCH2CI, -OCH2Br, -OCH2F, -OCH2I, -N3, unsubstituted alkyl (e.g., C1-C20, C1-C12, Ci-C8, Ci-C6, C1-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-Cio, C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered),
unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
membered), and
(b) alkyl (e.g., C1-C20, C1-C12, Ci-C8, Ci-C6, C1-C4, or C1-C2), heteroalkyl (e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), cycloalkyl (e.g., C3-Cio, C3-C8, C3-C6, C4-C6, or C5-C6), heterocycloalkyl (e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), substituted with at least one substituent selected from: oxo, halogen, -CCh, -CBr3, -CF3,
-Ch, -CHCh, -CHBr2, -CHF2, -CHI2, -CH2Cl, -CH2Br, -CH2F, -CH2I, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2,
-ONH2, -NHC(0)NHNH2, -NHC(0)NH2, -NHSO2H, -NHC(0)H, -NHC(0)OH, -NHOH, -OCCh, -OCF3, -OCBr3, -OCh, -OCHCb, -OCHBr2, -OCHb, -OCHF2, -OCH2CI, -OCH2Br, -OCH2F, -OCH2I, -N3, unsubstituted alkyl (e.g, C1-C20, Ci- C12, Ci-C8, Ci-C6, C1-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C10, C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0074] A“size-limited substituent” or“ size-limited substituent group,” as used herein, means a group selected from all of the substituents described above for a“substituent group,” wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted C1-C20 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C8 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C6-Cio aryl, and each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 10 membered heteroaryl.
[0075] A“lower substituent” or“ lower substituent group,” as used herein, means a group selected from all of the substituents described above for a“substituent group,” wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted Ci-Cs alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3- C7 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C6-Cio aryl, and each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 9 membered heteroaryl.
[0076] In some embodiments, each substituted group described in the compounds herein is substituted with at least one substituent group. More specifically, in some embodiments, each substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted
heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene described in the compounds herein are substituted with at least one substituent group. In other embodiments, at least one or all of these groups are substituted with at least one size-limited substituent group. In other embodiments, at least one or all of these groups are substituted with at least one lower substituent group.
[0077] In other embodiments of the compounds herein, each substituted or unsubstituted alkyl may be a substituted or unsubstituted C1-C20 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C8 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered
heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C6- C10 aryl, and/or each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 10 membered heteroaryl. In some embodiments of the compounds herein, each substituted or unsubstituted alkylene is a substituted or unsubstituted C1-C20 alkylene, each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 20 membered
heteroalkylene, each substituted or unsubstituted cycloalkylene is a substituted or
unsubstituted C3-C8 cycloalkylene, each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 8 membered heterocycloalkylene, each substituted or unsubstituted arylene is a substituted or unsubstituted C6-Cio arylene, and/or each substituted or unsubstituted heteroaryl ene is a substituted or unsubstituted 5 to 10 membered
heteroaryl ene.
[0078] In some embodiments, each substituted or unsubstituted alkyl is a substituted or unsubstituted Ci-C8 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C7 cycloalkyl, each substituted or unsubstituted
heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C6-Cio aryl, and/or each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 9 membered heteroaryl. In some embodiments, each substituted or unsubstituted alkylene is a substituted or unsubstituted Ci-C8 alkylene, each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 8 membered heteroalkylene, each substituted or
unsubstituted cycloalkylene is a substituted or unsubstituted C3-C7 cycloalkylene, each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 7 membered heterocycloalkylene, each substituted or unsubstituted arylene is a substituted or unsubstituted C6-Cio arylene, and/or each substituted or unsubstituted heteroaryl ene is a substituted or unsubstituted 5 to 9 membered heteroarylene. In some embodiments, the compound is a chemical species set forth in the Examples section, figures, or tables below.
[0079] In embodiments, a substituted or unsubstituted moiety (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl ene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is unsubstituted (e.g., is an unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, unsubstituted alkylene, unsubstituted heteroalkylene, unsubstituted cycloalkylene, unsubstituted heterocycloalkylene, unsubstituted arylene, and/or unsubstituted heteroarylene, respectively). In embodiments, a substituted or unsubstituted moiety (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted
cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is substituted (e.g., is a substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene, respectively).
[0080] In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, wherein if the substituted moiety is substituted with a plurality of substituent groups, each substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of substituent groups, each substituent group is different. [0081] In embodiments, a substituted moiety (e.g., substituted alkyl, substituted
heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene) is substituted with at least one size-limited substituent group, wherein if the substituted moiety is substituted with a plurality of size-limited substituent groups, each size-limited substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of size-limited substituent groups, each size-limited substituent group is different.
[0082] In embodiments, a substituted moiety (e.g., substituted alkyl, substituted
heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene) is substituted with at least one lower substituent group, wherein if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group is different.
[0083] In embodiments, a substituted moiety (e.g., substituted alkyl, substituted
heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted moiety is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group is different.
[0084] Certain compounds of the present invention possess asymmetric carbon atoms (optical or chiral centers) or double bonds; the enantiomers, racemates, diastereomers, tautomers, geometric isomers, stereoisometric forms that may be defined, in terms of absolute stereochemistry, as (A)-or (S)- or, as (D)- or (L)- for amino acids, and individual isomers are encompassed within the scope of the present invention. The compounds of the present invention do not include those that are known in art to be too unstable to synthesize and/or isolate. The present invention is meant to include compounds in racemic and optically pure forms. Optically active ( R )- and (S)-, or (D)- and (L)-isomers may be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques. When the compounds described herein contain olefmic bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E and Z geometric isomers.
[0085] As used herein, the term“isomers” refers to compounds having the same number and kind of atoms, and hence the same molecular weight, but differing in respect to the structural arrangement or configuration of the atoms.
[0086] The term“tautomer,” as used herein, refers to one of two or more structural isomers which exist in equilibrium and which are readily converted from one isomeric form to another.
[0087] It will be apparent to one skilled in the art that certain compounds of this invention may exist in tautomeric forms, all such tautomeric forms of the compounds being within the scope of the invention.
[0088] Unless otherwise stated, structures depicted herein are also meant to include all stereochemical forms of the structure; i.e., the R and S configurations for each asymmetric center. Therefore, single stereochemical isomers as well as enantiomeric and diastereomeric mixtures of the present compounds are within the scope of the invention.
[0089] Unless otherwise stated, structures depicted herein are also meant to include compounds which differ only in the presence of one or more isotopically enriched atoms. For example, compounds having the present structures except for the replacement of a hydrogen by a deuterium or tritium, or the replacement of a carbon by 13C- or 14C-enriched carbon are within the scope of this invention.
[0090] It should be noted that throughout the application that alternatives are written in Markush groups, for example, each amino acid position that contains more than one possible amino acid. It is specifically contemplated that each member of the Markush group should be considered separately, thereby comprising another embodiment, and the Markush group is not to be read as a single unit.
[0091] The terms "a" or "an," as used in herein means one or more. In addition, the phrase "substituted with a[n]," as used herein, means the specified group may be substituted with one or more of any or all of the named substituents. For example, where a group, such as an alkyl or heteroaryl group, is "substituted with an unsubstituted C1-C20 alkyl, or unsubstituted 2 to 20 membered heteroalkyl," the group may contain one or more unsubstituted C1-C20 alkyls, and/or one or more unsubstituted 2 to 20 membered heteroalkyls.
[0092] Moreover, where a moiety is substituted with an R substituent, the group may be referred to as“R-substituted.” Where a moiety is R-substituted, the moiety is substituted with at least one R substituent and each R substituent is optionally different. Where a particular R group is present in the description of a chemical genus (such as Formula (I)), a Roman alphabetic symbol may be used to distinguish each appearance of that particular R group. For example, where multiple R13 substituents are present, each R13 substituent may be distinguished as R13A, R13B, R13C, R13D, etc., wherein each of R13A, R13B, R13C, R13D, etc. is defined within the scope of the definition of R13 and optionally differently.
[0093] The term“pharmaceutically acceptable salts” is meant to include salts of the active compounds that are prepared with relatively nontoxic acids or bases, depending on the particular substituents found on the compounds described herein. Non-limiting examples of such salts include hydrochlorides, hydrobromides, phosphates, sulfates, methanesulfonates, nitrates, maleates, acetates, citrates, fumarates, proprionates, tartrates (e.g., (+)-tartrates, (-)- tartrates, or mixtures thereof including racemic mixtures), succinates, benzoates, and salts with amino acids such as glutamic acid, and quaternary ammonium salts (e.g. methyl iodide, ethyl iodide, and the like). These salts may be prepared by methods known to those skilled in the art. When compounds of the present invention contain relatively acidic functionalities, base addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired base, either neat or in a suitable inert solvent. Examples of pharmaceutically acceptable base addition salts include sodium, potassium, calcium, ammonium, organic amino, or magnesium salt, or a similar salt. When compounds of the present invention contain relatively basic functionalities, acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent. Examples of pharmaceutically acceptable acid addition salts include those derived from inorganic acids like hydrochloric, hydrobromic, nitric, carbonic, monohydrogencarbonic, phosphoric, monohydrogenphosphoric,
dihydrogenphosphoric, sulfuric, monohydrogensulfuric, hydriodic, or phosphorous acids and the like, as well as the salts derived from relatively nontoxic organic acids like acetic, propionic, isobutyric, maleic, malonic, benzoic, succinic, suberic, fumaric, lactic, mandelic, phthalic, benzenesulfonic, p-tolylsulfonic, citric, tartaric, oxalic, methanesulfonic, and the like. Also included are salts of amino acids such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like (see, for example, Berge el al, “Pharmaceutical Salts”, Journal of Pharmaceutical Science, 1977, 66, 1-19). Certain specific compounds of the present invention contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts.
[0094] The neutral forms of the compounds are preferably regenerated by contacting the salt with a base or acid and isolating the parent compound in the conventional manner. The parent form of the compound may differ from the various salt forms in certain physical properties, such as solubility in polar solvents.
[0095] In addition to salt forms, the present invention provides compounds, which are in a prodrug form. Prodrugs of the compounds described herein are those compounds that readily undergo chemical changes under physiological conditions to provide the compounds of the present invention. Prodrugs of the compounds described herein may be converted in vivo after administration. Additionally, prodrugs can be converted to the compounds of the present invention by chemical or biochemical methods in an ex vivo environment, such as, for example, when contacted with a suitable enzyme or chemical reagent.
[0096] Certain compounds of the present invention can exist in unsolvated forms as well as solvated forms, including hydrated forms. In general, the solvated forms are equivalent to unsolvated forms and are encompassed within the scope of the present invention. Certain compounds of the present invention may exist in multiple crystalline or amorphous forms. In general, all physical forms are equivalent for the uses contemplated by the present invention and are intended to be within the scope of the present invention.
[0097] “Pharmaceutically acceptable excipient” and“pharmaceutically acceptable carrier” refer to a substance that aids the administration of an active agent to and absorption by a subject and can be included in the compositions of the present invention without causing a significant adverse toxicological effect on the patient. Non-limiting examples of pharmaceutically acceptable excipients include water, NaCl, normal saline solutions, lactated Ringer’s, normal sucrose, normal glucose, binders, fillers, disintegrants, lubricants, coatings, sweeteners, flavors, salt solutions (such as Ringer's solution), alcohols, oils, gelatins, carbohydrates such as lactose, amylose or starch, fatty acid esters, hydroxymethycellulose, polyvinyl pyrrolidine, and colors, and the like. Such preparations can be sterilized and, if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention. One of skill in the art will recognize that other pharmaceutical excipients are useful in the present invention.
[0098] The term "preparation" is intended to include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it. Similarly, cachets and lozenges are included. Tablets, powders, capsules, pills, cachets, and lozenges can be used as solid dosage forms suitable for oral administration.
[0099] “Contacting” is used in accordance with its plain ordinary meaning and refers to the process of allowing at least two distinct species (e.g. chemical compounds including biomolecules or cells) to become sufficiently proximal to react, interact or physically touch.
It should be appreciated; however, the resulting reaction product can be produced directly from a reaction between the added reagents or from an intermediate from one or more of the added reagents that can be produced in the reaction mixture. The term“contacting” may include allowing two species to react, interact, or physically touch, wherein the two species may be a compound as described herein and a protein or enzyme. In some embodiments contacting includes allowing a compound described herein to interact with a protein or enzyme that is involved in a signaling pathway.
[0100] The terms“disease” or“condition” refer to a state of being or health status of a patient or subject capable of being treated with the compounds or methods provided herein. The disease may be a cancer. In some further instances,“cancer” refers to human cancers and carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, etc., including solid and lymphoid cancers, kidney, breast, lung, bladder, colon, ovarian, prostate, pancreas, stomach, brain, head and neck, skin, uterine, testicular, glioma, esophagus, and liver cancer, including hepatocarcinoma, lymphoma, including B-acute lymphoblastic lymphoma, non-Hodgkin’s lymphomas ( e.g ., Burkitt’s, Small Cell, and Large Cell lymphomas), Hodgkin’s lymphoma, leukemia (including AML, ALL, and CML), or multiple myeloma. As used herein, the term "cancer" refers to all types of cancer, neoplasm or malignant tumors found in mammals (e.g. humans), including leukemia, carcinomas and sarcomas. The term "leukemia" refers broadly to progressive, malignant diseases of the blood-forming organs and is generally characterized by a distorted proliferation and development of leukocytes and their precursors in the blood and bone marrow. The term "sarcoma" generally refers to a tumor which is made up of a substance like the embryonic connective tissue and is generally composed of closely packed cells embedded in a fibrillar or homogeneous substance. The term "melanoma" is taken to mean a tumor arising from the melanocytic system of the skin and other organs.
[0101] The term "carcinoma" refers to a malignant new growth made up of epithelial cells tending to infiltrate the surrounding tissues and give rise to metastases. Exemplary carcinomas that may be treated with a compound or method provided herein include, for example, medullary thyroid carcinoma, familial medullary thyroid carcinoma, acinar carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, carcinoma adenomatosum, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma, basal cell carcinoma, carcinoma basocellulare, basaloid carcinoma, basosquamous cell carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma, chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid carcinoma, epiermoid carcinoma, carcinoma epitheliale adenoides, exophytic carcinoma, carcinoma ex ulcere, carcinoma fibrosum, gelatiniforni carcinoma, gelatinous carcinoma, giant cell carcinoma, carcinoma gigantocellulare, glandular carcinoma, granulosa cell carcinoma, hair-matrix carcinoma, hematoid carcinoma, hepatocellular carcinoma, Hurthle cell carcinoma, hyaline carcinoma, hypemephroid carcinoma, infantile embryonal carcinoma, carcinoma in situ, intraepidermal carcinoma, intraepithelial carcinoma, Krompecher's carcinoma, Kulchitzky-cell carcinoma, large-cell carcinoma, lenticular carcinoma, carcinoma lenticulare, lipomatous carcinoma, lymphoepithelial carcinoma, carcinoma medullare, medullary carcinoma, melanotic carcinoma, carcinoma molle, mucinous carcinoma, carcinoma muciparum, carcinoma mucocellulare, mucoepidermoid carcinoma, carcinoma mucosum, mucous carcinoma, carcinoma myxomatodes, nasopharyngeal carcinoma, oat cell carcinoma, carcinoma ossificans, osteoid carcinoma, papillary carcinoma, periportal carcinoma, preinvasive carcinoma, prickle cell carcinoma, pultaceous carcinoma, renal cell carcinoma of kidney, reserve cell carcinoma, carcinoma sarcomatodes, Schneiderian carcinoma, scirrhous carcinoma, carcinoma scroti, signet-ring cell carcinoma, carcinoma simplex, small-cell carcinoma, solanoid carcinoma, spheroidal cell carcinoma, spindle cell carcinoma, carcinoma spongiosum, squamous carcinoma, squamous cell carcinoma, string carcinoma, carcinoma telangiectaticum, carcinoma telangiectodes, transitional cell carcinoma, carcinoma tuberosum, tuberous carcinoma, verrucous carcinoma, or carcinoma villosum.
[0102] The terms“treating”, or“treatment” refers to any indicia of success in the therapy or amelioration of an injury, disease, pathology or condition, including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the injury, pathology or condition more tolerable to the patient; slowing in the rate of
degeneration or decline; making the final point of degeneration less debilitating; improving a patient’s physical or mental well-being. The treatment or amelioration of symptoms can be based on objective or subjective parameters; including the results of a physical examination, neuropsychiatric exams, and/or a psychiatric evaluation. The term "treating" and conjugations thereof, may include prevention of an injury, pathology, condition, or disease. In
embodiments, treating is preventing. In embodiments, treating does not include preventing.
[0103] “Patient” or“subject in need thereof’ refers to a living organism suffering from or prone to a disease or condition that can be treated by administration of a pharmaceutical composition as provided herein. Non-limiting examples include humans, other mammals, bovines, rats, mice, dogs, monkeys, goat, sheep, cows, deer, and other non-mammalian animals. In some embodiments, a patient is human.
[0104] A“effective amount” is an amount sufficient for a compound to accomplish a stated purpose relative to the absence of the compound (e.g. achieve the effect for which it is administered, treat a disease, reduce enzyme activity, increase enzyme activity, reduce a signaling pathway, or reduce one or more symptoms of a disease or condition). An example of an“effective amount” is an amount sufficient to contribute to the treatment, prevention, or reduction of a symptom or symptoms of a disease, which could also be referred to as a “therapeutically effective amount.” A“reduction” of a symptom or symptoms (and grammatical equivalents of this phrase) means decreasing of the severity or frequency of the symptom(s), or elimination of the symptom(s). A“prophylactically effective amount” of a drug is an amount of a drug that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of an injury, disease, pathology or condition, or reducing the likelihood of the onset (or reoccurrence) of an injury, disease, pathology, or condition, or their symptoms. The full prophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses. Thus, a prophylactically effective amount may be administered in one or more administrations. An“activity decreasing amount,” as used herein, refers to an amount of antagonist required to decrease the activity of an enzyme relative to the absence of the antagonist. A“function disrupting amount,” as used herein, refers to the amount of antagonist required to disrupt the function of an enzyme or protein relative to the absence of the antagonist. The exact amounts will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); and Remington: The Science and Practice of Pharmacy, 20th Edition, 2003, Gennaro, Ed., Lippincott, Williams & Wilkins).
[0105] For any compound described herein, the therapeutically effective amount can be initially determined from cell culture assays. Target concentrations will be those
concentrations of active compound(s) that are capable of achieving the methods described herein, as measured using the methods described herein or known in the art.
[0106] As is well known in the art, therapeutically effective amounts for use in humans can also be determined from animal models. For example, a dose for humans can be formulated to achieve a concentration that has been found to be effective in animals. The dosage in humans can be adjusted by monitoring compounds effectiveness and adjusting the dosage upwards or downwards, as described above. Adjusting the dose to achieve maximal efficacy in humans based on the methods described above and other methods is well within the capabilities of the ordinarily skilled artisan.
[0107] Dosages may be varied depending upon the requirements of the patient and the compound being employed. The dose administered to a patient, in the context of the present invention should be sufficient to effect a beneficial therapeutic response in the patient over time. The size of the dose also will be determined by the existence, nature, and extent of any adverse side effects. Determination of the proper dosage for a particular situation is within the skill of the practitioner. Generally, treatment is initiated with smaller dosages which are less than the optimum dose of the compound. Thereafter, the dosage is increased by small increments until the optimum effect under circumstances is reached. Dosage amounts and intervals can be adjusted individually to provide levels of the administered compound effective for the particular clinical indication being treated. This will provide a therapeutic regimen that is commensurate with the severity of the individual's disease state.
[0108] As used herein, the term“about” means a range of values including the specified value, which a person of ordinary skill in the art would consider reasonably similar to the specified value. In embodiments, about means within a standard deviation using
measurements generally acceptable in the art. In embodiments, about means a range extending to +/- 10% of the specified value. In embodiments, about includes the specified value.
[0109] As used herein, the term "administering" means oral administration, administration as a suppository, topical contact, intravenous, intraperitoneal, intramuscular, intralesional, intrathecal, intranasal or subcutaneous administration, or the implantation of a slow-release device, e.g., a mini-osmotic pump, to a subject. Administration is by any route, including parenteral and transmucosal (e.g, buccal, sublingual, palatal, gingival, nasal, vaginal, rectal, or transdermal) compatible with the preparation. Parenteral administration includes, e.g, intravenous, intramuscular, intra-arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial. Other modes of delivery include, but are not limited to, the use of liposomal formulations, intravenous infusion, transdermal patches, etc.
[0110] " Co-administer" it is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of one or more additional therapies. The compounds of the invention can be administered alone or can be
coadministered to the patient. Coadministration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound). Thus, the preparations can also be combined, when desired, with other active substances (e.g. to reduce metabolic degradation). The compositions of the present invention can be delivered transdermally, by a topical route, or formulated as applicator sticks, solutions, suspensions, emulsions, gels, creams, ointments, pastes, jellies, paints, powders, and aerosols. [0111] A“cell” as used herein, refers to a cell carrying out metabolic or other function sufficient to preserve or replicate its genomic DNA. A cell can be identified by well-known methods in the art including, for example, presence of an intact membrane, staining by a particular dye, ability to produce progeny or, in the case of a gamete, ability to combine with a second gamete to produce a viable offspring. Cells may include prokaryotic and eukaroytic cells.
[0112] “ Control” or“control experiment” is used in accordance with its plain ordinary meaning and refers to an experiment in which the subjects or reagents of the experiment are treated as in a parallel experiment except for omission of a procedure, reagent, or variable of the experiment. In some instances, the control is used as a standard of comparison in evaluating experimental effects. In some embodiments, a control is the measurement of the activity of a protein in the absence of a compound as described herein (including
embodiments and examples).
[0113] The term“modulator” refers to a composition that increases or decreases the level of a target molecule or the function of a target molecule or the physical state of the target of the molecule.
[0114] The term“modulate” is used in accordance with its plain ordinary meaning and refers to the act of changing or varying one or more properties.“Modulation” refers to the process of changing or varying one or more properties. For example, as applied to the effects of a modulator on a target protein, to modulate means to change by increasing or decreasing a property or function of the target molecule or the amount of the target molecule.
[0115] The term“associated” or“associated with” in the context of a substance or substance activity or function associated with a disease (e.g. a protein associated disease) means that the disease (e.g. cancer) is caused by (in whole or in part), or a symptom of the disease is caused by (in whole or in part) the substance or substance activity or function.
[0116] The term“aberrant” as used herein refers to different from normal. When used to describe enzymatic activity or protein function, aberrant refers to activity or function that is greater or less than a normal control or the average of normal non-diseased control samples. Aberrant activity may refer to an amount of activity that results in a disease, wherein returning the aberrant activity to a normal or non-disease-associated amount (e.g. by administering a compound or using a method as described herein), results in reduction of the disease or one or more disease symptoms.
[0117] The term“signaling pathway” as used herein refers to a series of interactions between cellular and optionally extra-cellular components (e.g. proteins, nucleic acids, small molecules, ions, lipids) that conveys a change in one component to one or more other components, which in turn may convey a change to additional components, which is optionally propogated to other signaling pathway components.
[0118] “Anti-cancer agent” and“anticancer agent” are used in accordance with their plain ordinary meaning and refers to a composition (e.g. compound, drug, antagonist, inhibitor, modulator) having antineoplastic properties or the ability to inhibit the growth or proliferation of cells. In some embodiments, an anti-cancer agent is a chemotherapeutic. In some embodiments, an anti-cancer agent is an agent identified herein having utility in methods of treating cancer. In some embodiments, an anti-cancer agent is an agent approved by the FDA or similar regulatory agency of a country other than the USA, for treating cancer. Examples of anti-cancer agents include, but are not limited to, MEK (e.g. MEK1, MEK2, or MEK1 and MEK2) inhibitors (e.g. XL518, CI-1040, PD035901, selumetinib/ AZD6244, GSK1120212/ trametinib, GDC-0973, ARRY-162, ARRY-300, AZD8330, PD0325901, U0126, PD98059, TAK-733, PD318088, AS703026, BAY 869766), alkylating agents (e.g., cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan, mechlorethamine, uramustine, thiotepa, nitrosoureas, nitrogen mustards (e.g., mechloroethamine, cyclophosphamide, chlorambucil, meiphalan), ethylenimine and methylmelamines (e.g., hexamethlymelamine, thiotepa), alkyl sulfonates (e.g., busulfan), nitrosoureas (e.g., carmustine, lomusitne, semustine, streptozocin), triazenes (decarbazine)), anti-metabolites (e.g, 5- azathioprine, leucovorin, capecitabine, fludarabine, gemcitabine, pemetrexed, raltitrexed, folic acid analog (e.g., methotrexate), or pyrimidine analogs (e.g., fluorouracil, floxouridine, Cytarabine), purine analogs (e.g., mercaptopurine, thioguanine, pentostatin), etc.), plant alkaloids (e.g, vincristine, vinblastine, vinorelbine, vindesine, podophyllotoxin, paclitaxel, docetaxel, etc.), topoisomerase inhibitors (e.g, irinotecan, topotecan, amsacrine, etoposide (VP 16), etoposide phosphate, teniposide, etc.), antitumor antibiotics (e.g, doxorubicin, adriamycin, daunorubicin, epirubicin, actinomycin, bleomycin, mitomycin, mitoxantrone, plicamycin, etc.), platinum-based compounds (e.g. cisplatin, oxaloplatin, carboplatin), anthracenedione (e.g., mitoxantrone), substituted urea (e.g., hydroxyurea), methyl hydrazine derivative (e.g., procarbazine), adrenocortical suppressant (e.g., mitotane, aminoglutethimide), epipodophyllotoxins (e.g., etoposide), antibiotics (e.g., daunorubicin, doxorubicin, bleomycin), enzymes (e.g., L- asparaginase), inhibitors of mitogen-activated protein kinase signaling (e.g. U0126,
PD98059, PD 184352, PD0325901, ARRY-142886, SB239063, SP600125, BAY 43-9006, wortmannin, or LY294002, Syk inhibitors, mTOR inhibitors, antibodies (e.g., rituxan), gossyphol, genasense, polyphenol E, Chlorofusin, all trans-retinoic acid (ATRA), bryostatin, tumor necrosis factor-related apoptosis-inducing ligand (TRAIL), 5-aza-2'-deoxycytidine, all trans retinoic acid, doxorubicin, vincristine, etoposide, gemcitabine, imatinib
(Gleevec.RTM.), geldanamycin, l7-N-Allylamino-l7-Demethoxygeldanamycin (17-AAG), flavopiridol, LY294002, bortezomib, trastuzumab, BAY 11-7082, PKC412, PD184352, 20- epi-l, 25 dihydroxyvitamin D3; 5-ethynyluracil; abiraterone; aclarubicin; acylfulvene;
adecypenol; adozelesin; aldesleukin; ALL-TK antagonists; altretamine; ambamustine;
amidox; amifostine; aminolevulinic acid; amrubicin; amsacrine; anagrelide; anastrozole; andrographolide; angiogenesis inhibitors; antagonist D; antagonist G; antarelix; anti- dorsalizing morphogenetic protein- 1; antiandrogen, prostatic carcinoma; antiestrogen;
antineoplaston; antisense oligonucleotides; aphidicolin glycinate; apoptosis gene modulators; apoptosis regulators; apurinic acid; ara-CDP-DL-PTBA; arginine deaminase; asulacrine; atamestane; atrimustine; axinastatin 1; axinastatin 2; axinastatin 3; azasetron; azatoxin;
azatyrosine; baccatin III derivatives; balanol; batimastat; BCR/ABL antagonists;
benzochlorins; benzoylstaurosporine; beta lactam derivatives; beta-alethine; betaclamycin B; betulinic acid; bFGF inhibitor; bicalutamide; bisantrene; bisaziridinylspermine; bisnafide; bistratene A; bizelesin; breflate; bropirimine; budotitane; buthionine sulfoximine;
calcipotriol; calphostin C; camptothecin derivatives; canarypox IL-2; capecitabine;
carboxamide-amino-triazole; carboxyamidotriazole; CaRest M3; CARN 700; cartilage derived inhibitor; carzelesin; casein kinase inhibitors (ICOS); castanospermine; cecropin B; cetrorelix; chlorins; chloroquinoxaline sulfonamide; cicaprost; cis-porphyrin; cladribine; clomifene analogues; clotrimazole; collismycin A; collismycin B; combretastatin A4;
combretastatin analogue; conagenin; crambescidin 816; crisnatol; cryptophycin 8;
cryptophycin A derivatives; curacin A; cyclopentanthraquinones; cycloplatam; cypemycin; cytarabine ocfosfate; cytolytic factor; cytostatin; dacliximab; decitabine; dehydrodidemnin B; deslorelin; dexamethasone; dexifosfamide; dexrazoxane; dexverapamil; diaziquone;
didemnin B; didox; diethylnorspermine; dihydro-5-azacytidine; 9-dioxamycin; diphenyl spiromustine; docosanol; dolasetron; doxifluridine; droloxifene; dronabinol; duocarmycin SA; ebselen; ecomustine; edelfosine; edrecolomab; eflornithine; elemene; emitefur;
epirubicin; epristeride; estramustine analogue; estrogen agonists; estrogen antagonists;
etanidazole; etoposide phosphate; exemestane; fadrozole; fazarabine; fenretinide; filgrastim; finasteride; flavopiridol; flezelastine; fluasterone; fludarabine; fluorodaunorunicin
hydrochloride; forfenimex; formestane; fostriecin; fotemustine; gadolinium texaphyrin;
gallium nitrate; galocitabine; ganirelix; gelatinase inhibitors; gemcitabine; glutathione inhibitors; hepsulfam; heregulin; hexamethylene bisacetamide; hypericin; ibandronic acid; idarubicin; idoxifene; idramantone; ilmofosine; ilomastat; imidazoacridones; imiquimod; immunostimulant peptides; insulin-like growth factor- 1 receptor inhibitor; interferon agonists; interferons; interleukins; iobenguane; iododoxorubicin; ipomeanol, 4-; iroplact; irsogladine; isobengazole; isohomohalicondrin B; itasetron; jasplakinolide; kahalalide F; lamellarin-N triacetate; lanreotide; leinamycin; lenograstim; lentinan sulfate; leptolstatin; letrozole; leukemia inhibiting factor; leukocyte alpha interferon;
leuprolide+estrogen+progesterone; leuprorelin; levamisole; liarozole; linear polyamine analogue; lipophilic disaccharide peptide; lipophilic platinum compounds; lissoclinamide 7; lobaplatin; lombricine; lometrexol; lonidamine; losoxantrone; lovastatin; loxoribine;
lurtotecan; lutetium texaphyrin; lysofylline; lytic peptides; maitansine; mannostatin A;
marimastat; masoprocol; maspin; matrilysin inhibitors; matrix metalloproteinase inhibitors; menogaril; merbarone; meterelin; methioninase; metoclopramide; MTF inhibitor;
mifepristone; miltefosine; mirimostim; mismatched double stranded RNA; mitoguazone; mitolactol; mitomycin analogues; mitonafide; mitotoxin fibroblast growth factor-saporin; mitoxantrone; mofarotene; molgramostim; monoclonal antibody, human chorionic gonadotrophin; monophosphoryl lipid A+myobacterium cell wall sk; mopidamol; multiple drug resistance gene inhibitor; multiple tumor suppressor 1 -based therapy; mustard anticancer agent; mycaperoxide B; mycobacterial cell wall extract; myriaporone; N-acetyldinaline; N- substituted benzamides; nafarelin; nagrestip; naloxone+pentazocine; napavin; naphterpin; nartograstim; nedaplatin; nemorubicin; neridronic acid; neutral endopeptidase; nilutamide; nisamycin; nitric oxide modulators; nitroxide antioxidant; nitrullyn; 06-benzylguanine;
octreotide; okicenone; oligonucleotides; onapristone; ondansetron; ondansetron; oracin; oral cytokine inducer; ormaplatin; osaterone; oxaliplatin; oxaunomycin; palauamine;
palmitoylrhizoxin; pamidronic acid; panaxytriol; panomifene; parabactin; pazelliptine;
pegaspargase; peldesine; pentosan polysulfate sodium; pentostatin; pentrozole; perflubron; perfosfamide; perillyl alcohol; phenazinomycin; phenylacetate; phosphatase inhibitors; picibanil; pilocarpine hydrochloride; pirarubicin; piritrexim; placetin A; placetin B;
plasminogen activator inhibitor; platinum complex; platinum compounds; platinum-triamine complex; porfimer sodium; porfiromycin; prednisone; propyl bis-acridone; prostaglandin J2; proteasome inhibitors; protein A-based immune modulator; protein kinase C inhibitor;
protein kinase C inhibitors, microalgal; protein tyrosine phosphatase inhibitors; purine nucleoside phosphorylase inhibitors; purpurins; pyrazoloacridine; pyridoxylated hemoglobin polyoxyethylerie conjugate; raf antagonists; raltitrexed; ramosetron; ras farnesyl protein transferase inhibitors; ras inhibitors; ras-GAP inhibitor; retelliptine demethylated; rhenium Re 186 etidronate; rhizoxin; ribozymes; RII retinamide; rogletimide; rohitukine; romurtide; roquinimex; rubiginone B 1 ; ruboxyl; safmgol; saintopin; SarCNU; sarcophytol A;
sargramostim; Sdi 1 mimetics; semustine; senescence derived inhibitor 1; sense
oligonucleotides; signal transduction inhibitors; signal transduction modulators; single chain antigen-binding protein; sizofuran; sobuzoxane; sodium borocaptate; sodium phenylacetate; solverol; somatomedin binding protein; sonermin; sparfosic acid; spicamycin D;
spiromustine; splenopentin; spongistatin 1; squalamine; stem cell inhibitor; stem-cell division inhibitors; stipiamide; stromelysin inhibitors; sulfmosine; superactive vasoactive intestinal peptide antagonist; suradista; suramin; swainsonine; synthetic glycosaminoglycans;
tallimustine; tamoxifen methiodide; tauromustine; tazarotene; tecogalan sodium; tegafur; tellurapyrylium; telomerase inhibitors; temoporfm; temozolomide; teniposide;
tetrachlorodecaoxide; tetrazomine; thaliblastine; thiocoraline; thrombopoietin;
thrombopoietin mimetic; thymalfasin; thymopoietin receptor agonist; thymotrinan; thyroid stimulating hormone; tin ethyl etiopurpurin; tirapazamine; titanocene bichloride; topsentin; toremifene; totipotent stem cell factor; translation inhibitors; tretinoin; triacetyluridine;
triciribine; trimetrexate; triptorelin; tropisetron; turosteride; tyrosine kinase inhibitors;
tyrphostins; UBC inhibitors; ubenimex; urogenital sinus-derived growth inhibitory factor; urokinase receptor antagonists; vapreotide; variolin B; vector system, erythrocyte gene therapy; velaresol; veramine; verdins; verteporfm; vinorelbine; vinxaltine; vitaxin; vorozole; zanoterone; zeniplatin; zilascorb; zinostatin stimalamer, Adriamycin, Dactinomycin, Bleomycin, Vinblastine, Cisplatin, acivicin; aclarubicin; acodazole hydrochloride; acronine; adozelesin; aldesleukin; altretamine; ambomycin; ametantrone acetate; aminoglutethimide; amsacrine; anastrozole; anthramycin; asparaginase; asperlin; azacitidine; azetepa;
azotomycin; batimastat; benzodepa; bicalutamide; bisantrene hydrochloride; bisnafide dimesylate; bizelesin; bleomycin sulfate; brequinar sodium; bropirimine; busulfan; cactinomycin; calusterone; caracemide; carbetimer; carboplatin; carmustine; carubicin hydrochloride; carzelesin; cedefmgol; chlorambucil; cirolemycin; cladribine; crisnatol mesylate; cyclophosphamide; cytarabine; dacarbazine; daunorubicin hydrochloride;
decitabine; dexormaplatin; dezaguanine; dezaguanine mesylate; diaziquone; doxorubicin; doxorubicin hydrochloride; droloxifene; droloxifene citrate; dromostanolone propionate; duazomycin; edatrexate; eflomithine hydrochloride; elsamitrucin; enloplatin; enpromate; epipropidine; epirubicin hydrochloride; erbulozole; esorubicin hydrochloride; estramustine; estramustine phosphate sodium; etanidazole; etoposide; etoposide phosphate; etoprine; fadrozole hydrochloride; fazarabine; fenretinide; floxuridine; fludarabine phosphate;
fluorouracil; fluorocitabine; fosquidone; fostriecin sodium; gemcitabine; gemcitabine hydrochloride; hydroxyurea; idarubicin hydrochloride; ifosfamide; iimofosine; interleukin II (including recombinant interleukin II, or rlL.sub.2), interferon alfa-2a; interferon alfa-2b; interferon alfa-nl; interferon alfa-n3; interferon beta- la; interferon gamma-lb; iproplatin; irinotecan hydrochloride; lanreotide acetate; letrozole; leuprolide acetate; liarozole hydrochloride; lometrexol sodium; lomustine; losoxantrone hydrochloride; masoprocol; maytansine; mechlorethamine hydrochloride; megestrol acetate; melengestrol acetate;
melphalan; menogaril; mercaptopurine; methotrexate; methotrexate sodium; metoprine; meturedepa; mitindomide; mitocarcin; mitocromin; mitogillin; mitomalcin; mitomycin; mitosper; mitotane; mitoxantrone hydrochloride; mycophenolic acid; nocodazoie;
nogalamycin; ormaplatin; oxisuran; pegaspargase; peliomycin; pentamustine; peplomycin sulfate; perfosfamide; pipobroman; piposulfan; piroxantrone hydrochloride; plicamycin; plomestane; porfimer sodium; porfiromycin; prednimustine; procarbazine hydrochloride; puromycin; puromycin hydrochloride; pyrazofurin; riboprine; rogletimide; safmgol; safmgol hydrochloride; semustine; simtrazene; sparfosate sodium; sparsomycin; spirogermanium hydrochloride; spiromustine; spiroplatin; streptonigrin; streptozocin; sulofenur; talisomycin; tecogalan sodium; tegafur; teloxantrone hydrochloride; temoporfm; teniposide; teroxirone; testolactone; thiamiprine; thioguanine; thiotepa; tiazofurin; tirapazamine; toremifene citrate; trestolone acetate; triciribine phosphate; trimetrexate; trimetrexate glucuronate; triptorelin; tubulozole hydrochloride; uracil mustard; uredepa; vapreotide; verteporfm; vinblastine sulfate; vincristine sulfate; vindesine; vindesine sulfate; vinepidine sulfate; vinglycinate sulfate; vinleurosine sulfate; vinorelbine tartrate; vinrosidine sulfate; vinzolidine sulfate; vorozole; zeniplatin; zinostatin; zorubicin hydrochloride, agents that arrest cells in the G2-M phases and/or modulate the formation or stability of microtubules, (e.g. Taxol.TM (i.e. paclitaxel), Taxotere.TM, compounds comprising the taxane skeleton, Erbulozole (i.e. R- 55104), Dolastatin 10 (i.e. DLS-10 and NSC-376128), Mivobulin isethionate (i.e. as CI-980), Vincristine, NSC-639829, Discodermolide (i.e. as NVP-XX-A-296), ABT-751 (Abbott, i.e. E-7010), Altorhyrtins (e.g. Altorhyrtin A and Altorhyrtin C), Spongistatins (e.g. Spongistatin 1, Spongistatin 2, Spongistatin 3, Spongistatin 4, Spongistatin 5, Spongistatin 6, Spongistatin 7, Spongistatin 8, and Spongistatin 9), Cemadotin hydrochloride (i.e. LET-l 03793 and NSC- D-669356), Epothilones (e.g. Epothilone A, Epothilone B, Epothilone C (i.e.
desoxyepothilone A or dEpoA), Epothilone D (i.e. KOS-862, dEpoB, and desoxyepothilone B), Epothilone E, Epothilone F, Epothilone B N-oxide, Epothilone A N-oxide, l6-aza- epothilone B, 2l-aminoepothilone B (i.e. BMS-310705), 21 -hydroxy epothilone D (i.e.
Desoxyepothilone F and dEpoF), 26-fluoroepothilone, Auristatin PE (i.e. NSC-654663), Soblidotin (i.e. TZT-1027), LS-4559-P (Pharmacia, i.e. LS-4577), LS-4578 (Pharmacia, i.e. LS-477-P), LS-4477 (Pharmacia), LS-4559 (Pharmacia), RPR-l 12378 (Aventis), Vincristine sulfate, DZ-3358 (Daiichi), FR-182877 (Fujisawa, i.e. WS-9885B), GS-164 (Takeda), GS- 198 (Takeda), KAR-2 (Hungarian Academy of Sciences), BSF-223651 (BASF, i.e. ILX-651 and LU-223651), SAH-49960 (Lilly/Novartis), SDZ-268970 (Lilly/Novartis), AM-97 (Armad/Kyowa Hakko), AM-132 (Armad), AM-138 (Armad/Kyowa Hakko), IDN-5005 (Indena), Cryptophycin 52 (i.e. LY-355703), AC-7739 (Ajinomoto, i.e. AVE-8063A and CS- 39.HC1), AC-7700 (Ajinomoto, i.e. AVE-8062, AVE-8062A, CS-39-L-Ser.HCl, and RPR- 258062A), Vitilevuamide, Tubulysin A, Canadensol, Centaureidin (i.e. NSC-106969), T- 138067 (Tularik, i.e. T-67, TL-138067 and TI-138067), COBRA-l (Parker Hughes Institute, i.e. DDE-261 and WHI-261), H10 (Kansas State ETniversity), H16 (Kansas State University), Oncocidin Al (i.e. BTO-956 and DIME), DDE-313 (Parker Hughes Institute), Fijianolide B, Laulimalide, SPA-2 (Parker Hughes Institute), SPA-l (Parker Hughes Institute, i.e. SPIKET- P), 3-IAABU (Cytoskeleton/Mt. Sinai School of Medicine, i.e. MF-569), Narcosine (also known as NSC-5366), Nascapine, D-24851 (Asta Medica), A-105972 (Abbott), Hemiasterlin, 3-BAABU (Cytoskeleton/Mt. Sinai School of Medicine, i.e. MF-191), TMPN (Arizona State University), Vanadocene acetyl acetonate, T-138026 (Tularik), Monsatrol, lnanocine (i.e. NSC-698666), 3-IAABE (Cytoskeleton/Mt. Sinai School of Medicine), A-204197 (Abbott), T-607 (Tuiarik, i.e. T-900607), RPR-l 15781 (Aventis), Eleutherobins (such as
Desmethyleleutherobin, Desaetyleleutherobin, lsoeleutherobin A, and Z-Eleutherobin), Caribaeoside, Caribaeolin, Halichondrin B, D-64131 (Asta Medica), D-68144 (Asta Medica), Diazonamide A, A-293620 (Abbott), NPI-2350 (Nereus), Taccalonolide A, TUB-245 (Aventis), A-259754 (Abbott), Diozostatin, (-)-Phenylahistin (i.e. NSCL-96F037), D-68838 (Asta Medica), D-68836 (Asta Medica), Myoseverin B, D-43411 (Zentaris, i.e. D-81862), A- 289099 (Abbott), A-318315 (Abbott), HTI-286 (i.e. SPA-110, trifluoroacetate salt) (Wyeth), D-82317 (Zentaris), D-82318 (Zentaris), SC-12983 (NCI), Resverastatin phosphate sodium, BPR-OY-007 (National Health Research Institutes), and SSR-250411 (Sanofi)), steroids ( e.g ., dexamethasone), finasteride, aromatase inhibitors, gonadotropin-releasing hormone agonists (GnRH) such as goserelin or leuprolide, adrenocorticosteroids (e.g., prednisone), progestins (e.g., hydroxyprogesterone caproate, megestrol acetate, medroxyprogesterone acetate), estrogens (e.g., diethlystilbestrol, ethinyl estradiol), antiestrogen (e.g., tamoxifen), androgens (e.g., testosterone propionate, fluoxymesterone), antiandrogen (e.g., flutamide), immunostimulants (e.g., Bacillus Calmette-Guerin (BCG), levamisole, interleukin-2, alpha- interferon, etc.), monoclonal antibodies (e.g., anti-CD20, anti-HER2, anti-CD52, anti-HLA- DR, and anti-VEGF monoclonal antibodies), immunotoxins (e.g., anti-CD33 monoclonal antibody-calicheamicin conjugate, anti-CD22 monoclonal antibody-pseudomonas exotoxin conjugate, etc.), radioimmunotherapy (e.g, anti-CD20 monoclonal antibody conjugated to luIn, 90Y, or 131I, etc.), triptolide, homoharringtonine, dactinomycin, doxorubicin, epirubicin, topotecan, itraconazole, vindesine, cerivastatin, vincristine, deoxyadenosine, sertraline, pitavastatin, irinotecan, clofazimine, 5-nonyloxytryptamine, vemurafenib, dabrafenib, erlotinib, gefitinib, EGFR inhibitors, epidermal growth factor receptor (EGFR)-targeted therapy or therapeutic (e.g. gefitinib (Iressa™), erlotinib (Tarceva™), cetuximab
(Erbitux™), lapatinib (Tykerb™), panitumumab (Vectibix™), vandetanib (Caprelsa™), afatinib/BIBW2992, CI-l033/canertinib, neratinib/HKI-272, CP-724714, TAK-285, AST- 1306, ARRY334543, ARRY-380, AG-1478, dacomitinib/PF299804, OSI-420/desmethyl erlotinib, AZD8931, AEE788, pelitinib/EKB-569, CUDC-101, WZ8040, WZ4002, WZ3146, AG-490, XL647, PD153035, BMS-599626), sorafenib, imatinib, sunitinib, dasatinib, or the like.
[0119] “Chemotherapeutic” or“chemotherapeutic agent” is used in accordance with its plain ordinary meaning and refers to a chemical composition or compound having antineoplastic properties or the ability to inhibit the growth or proliferation of cells.
[0120] The term“SEIMO protein” or“small ubiquitin-like modifier protein” is a family of proteins that are covalently attached to other proteins to modify their function. SEIMO proteins are members of the ubiquitin-like protein family. SEIMO modification is involved in various cellular processes, for example, nuclear-cytosolic transport, transcriptional regulation, apoptosis, and protein stability.
[0121] The term“Ubiquitin-activating enzyme” or“El enzyme” or“El” refers to a protein (including homologs, isoforms, and functional fragments thereof) that catalyzes the first step in the ubiquitination reaction, which can target a protein for degradation. El enzymes are capable of catalyzing SEIMO modification. In embodiments, the El enzyme is encoded by EIBA1. In embodiments, the El enzyme is encoded by EGBA2. In embodiments, the El enzyme is encoded by EGBA3. In embodiments, the El enzyme is encoded by EGBA4. In embodiments, the El enzyme is encoded by EGBA5. In embodiments, the El enzyme is encoded by EGBA6. In embodiments, the El enzyme is encoded by EGBA7. In embodiments, the El enzyme is encoded by ATG7. In embodiments, the El enzyme is encoded by NAE1. In embodiments, the El enzyme is encoded by SAE1.
[0122] The term“SEIMO-activating enzyme subunit 2” or“EGBA2” or“EGBA2 subunit 2” is a protein involved in SEIMO modification. The term“EGBA2” refers to the nucleotide sequences or proteins of human EGBA2. The term“EGBA2” includes both the wild type form of the nucleotide sequences or proteins as well as any mutants thereof. In some
embodiments,“EGBA2” is wild-type EGBA2. In some embodiments,“EGBA2” is one or more mutant forms. The term“EGB A2” XYZ refers to a nucleotide sequence or protein of a mutant EGBA2 wherein the Y numbered amino acid of EGBA2 has an X amino acid in the wild type instead has a Z amino acid in the mutant. In embodiments, EGBA2 is a functional fragment thereof. In embodiments, EGBA2 refers to RefSeq (mRNA) NM_005499.2 or RefSeq
(Protein) NP 005490.1. In some embodiments, EGBA2 refers to ElniProt Q9EIBT2, having the sequence:
MALSRGLPRELAEAVAGGRVLVV GAGGIGCELLKNLVLTGFSHIDLIDLDTIDV SNLNRQ
FLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRA
ARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPS
EPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQ
NEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAAN
LRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNK
QPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDV
QIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGK
DVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNN ADVSEEERSRKRKLDEKENLSAKRSRIEQKEELDDVIALD (SEQ ID NO: 1).
II. Compounds
[0123] In an aspect is provided a compound having the formula:
Figure imgf000040_0001
[0124] — is a single bond or double bond.
[0125] L1 and L2 are independently a bond, -0-, -S-, -S(O)-, -S(0)2-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -C(0)NHNH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene (e.g., Ci-Cx, Ci-C6, Ci-C4, or C1-C2), substituted or unsubstituted heteroalkyl ene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C6-Ci2, C6-Cio, or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0126] L3 is -0-, -S-, -N-, -S(O)-, -S(0)2-, -C(O)-, -N(R7)-, substituted or unsubstituted alkylene (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2) or substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered).
[0127] L6 is substituted or unsubstituted alkylene (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C6-Ci2, C6-Cio, or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0128] V is -O- or -N(R10)-.
[0129] L8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, -S-, -S(O)-, -S(0)2-, substituted or unsubstituted alkylene (e.g., Ci-C8, Ci-C6, Ci-C4, or C1-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C6-Ci2, C6-Cio, or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0130] L9 is a bond, -O-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-, -NHC(0)NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C6-Ci2, C6-Cio, or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0131] R1 is hydrogen, halogen, -CX , -CHXS, -CHiX1, -OCX^, -OCHiX1, -OCHX , -CN, -SOniR1A, -SOVINR1AR1b, -NHC(0)NR1AR1b, -N(0)mi, -NR1AR1B, -NHNR1AR1B, -C(0)R1A, -C(0)-OR1a, -C(0)NR1AR1b, -C(0)NHNR1AR1b, -OR1a, -NR1AS02R1B,
-NR1AC(0)R1B, -NR1AC(0)OR1B, -NR1AOR1B, -N3, -L'-E1, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0132] R2 is hydrogen, halogen, -CX2 3, -CHX2 2, -CH2X2, -OCX2 3, -OCH2X2, -OCHX2 2, -CN, -SO„2R2A, -SOV2NR2AR2B, -NHC(0)NR2AR2B, -N(0)m2, -NR2AR2B, -NHNR2AR2B, -C(0)R2A, -C(0)-OR2A, -C(0)NR2AR2B, -C(0)NHNR2AR2B, -OR2A, -NR2ASO2R2B, -NR2AC(0)R2B, -NR2AC(0)0R2B, -NR2AOR2B, -N3, -L2-E2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0133] R1 and R2 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0134] R3 is hydrogen, halogen, -CX3 3, -CHX3 2, -CH2X3, -OCX3 3, -OCH2X3, -OCHX3 2, -CN, -SO„R3A, -SOV3NR3AR3B, -NHC(0)NR3AR3B, -N(0) ύ, -NR3AR3B, -NHNR3AR3B, -C(0)R3A, -C(0)-OR3A, -C(0)NR3AR3B, -OR3A, -NR3AS02R3B, -NR3AC(0)R3B,
-NR3AC(0)0R3B, -NR3AOR3B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0135] R4 is hydrogen, halogen, -CX4 3, -CHX4 2, -CH2X4, -OCX4 3, -OCH2X4, -OCHX4 2, -CN, -SOn4R4A, -SOV4NR4AR4B, -NHC(0)NR4AR4B, -N(0)m4, -NR4AR4B, -NHNR4AR4B, -C(0)R4A, -C(0)-OR4A, -C(0)NR4AR4B, -C(0)NHNR4AR4B, -OR4A, -NR4ASO2R4B,
-NR4AC(0)R4B, -NR4AC(0)0R4B, -NR4AOR4B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0136] R5 is hydrogen, halogen, -CX5 3, -CHX5 2, -CH2X5, -OCX5 3, -OCH2X5, -OCHX5 2, -CN, -SOn5R5A, -SOV5NR5AR5B, -NHC(0)NR5AR5B, -N(0)m5, -NR5AR5B, -NHNR5AR5B, -C(0)R5A, -C(0)-OR5A, -C(0)NR5AR5B, -C(0)NHNR5AR5B, -OR5A, -NR5ASO2R5B,
-NR5AC(0)R5B, -NR5AC(0)0R5B, -NR5AOR5B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0137] R4 and R5 may optionally be joined to form a substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R4 and R5 are joined to form a substituted or unsubstituted phenyl. In embodiments, R4 and R5 are joined to form an unsubstituted phenyl.
[0138] R6 is hydrogen, halogen, -CX\ -CHX6 2, -CH2X6, -OCX6 3, -OCH2X6, -OCHX6 2, -CN, -SOn6R6A, -SOV6NR6AR6B, -NHC(0)NR6AR6B, -N(0)m6, -NR6AR6B, -NHNR6AR6B, -C(0)R6A, -C(0)-OR6A, -C(0)NR6AR6B, -C(0)NHNR6AR6B, -OR6A, -NR6ASO2R6B,
-NR6AC(0)R6B, -NR6AC(0)0R6B, -NR6AOR6B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, or -L6(-L7-L8-R8)(-L9-R9).
[0139] R7 is hydrogen, halogen, -CX7 3, -CHX7 2, -CH2X7, -OCX7 3, -OCH2X7, -OCHX7 2, -CN, -SOnvR7A, -SOVVNR7AR7B, -NHC(0)NR7AR7B, -N(0)mv, -NR7AR7B, -NHNR7AR7B, -C(0)R7A, -C(0)-OR7A, -C(0)NR7AR7B, -C(0)NHNR7AR7B, -OR7A, -NR7ASO2R7B,
-NR7AC(0)R7B, -NR7AC(0)0R7B, -NR7AOR7B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0140] R8 is hydrogen, halogen, -CX8 3, -CHX8 2, -CH2X8, -OCX8 3, -OCH2X8, -OCHX8 2, -CN, -SOn8R8A, -SOV8NR8AR8B, -NHC(0)NR8AR8B, -N(0)m8, -NR8AR8B, -NHNR8AR8B, -C(0)R8A, -C(0)-OR8A, -C(0)NR8AR8B, -C(0)NHNR8AR8B, -OR8A, -NR8ASO2R8B,
-NR8AC(0)R8B, -NR8AC(0)0R8B, -NR8AOR8B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0141] R9 is hydrogen, halogen, -CX9 3, -CHX9 2, -CH2X9, -OCX9 3, -OCH2X9, -OCHX9 2, -CN, -SO„9R9A, -SOV9NR9AR9B, -NHC(0)NR9AR9B, -N(0)m9, -NR9AR9B, -NHNR9AR9B, -C(0)R9A, -C(0)-OR9A, -C(0)NR9AR9B, -C(0)NHNR9AR9B, -OR9A, -NR9ASO2R9B,
-NR9AC(0)R9B, -NR9AC(0)0R9B, -NR9AOR9B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl. [0142] R10 is hydrogen, halogen, -CX10 3, -CHX10 2, -CH2X10, -OCX10 3, -OCH2X10,
-OCHX10 2, -CN, -SOnioR10A, -SOvioNR10AR10B, -NHC(O)NR10AR10B, -N(0)mio, -NR10AR10B, -NHNR10AR10B, -C(O)R10A, -C(O)-OR10A, -C(O)NR10AR10B, -C(O)NHNR10AR10B, -OR10A, -NR10ASO2R10B, -NR10AC(O)R10B, -NR10AC(O)OR10B, -NR10AOR10B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0143] E1 and E2 are independently an electron- withdrawing moiety.
[0144] R1A is hydrogen, halogen, -CX1A 3, -CHX1A 2, -CH2X1A, -OCX1A 3, -OCH2X1A, -OCHX1A 2, -CN, -SOniAR1AA, -SOVIANR1AAR1ab, -NHC(0)NR1AAR1AB, -N(0)miA,
-NR1AAR1AB, -NHNR1AAR1ab, -C(0)R1aa, -C(0)-OR1aa, -C(0)NR1AAR1AB, -OR1aa, -NR1AAS02R1AB, -NR1AAC(0)R1AB, -NR1AAC(0)OR1AB, -NR1AAOR1AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0145] R2A is hydrogen, halogen, -CX2A 3, -CHX2A 2, -CH2X2A, -OCX2A 3, -OCH2X2A, -OCHX2A 2, -CN, -SOn2AR2AA, -SOV2ANR2AAR2AB, -NHC(0)NR2AAR2AB, -N(0)m2A,
-NR2AAR2AB, -NHNR2AAR2AB, -C(0)R2AA, -C(0)-OR2AA, -C(0)NR2AAR2AB, -OR2AA, -NR2AAS02R2AB, -NR2AAC(0)R2AB, -NR2AAC(0)0R2AB, -NR2AAOR2AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0146] R2B is hydrogen, halogen, -CX2B 3, -CHX2B 2, -CH2X2B, -OCX2B 3, -OCH2X2B, -OCHX2B 2, -CN, -SO„2BR2BA, -SOV2BNR2BAR2BB, -NHC(0)NR2BAR2BB, -N(0)m2B,
-NR2BAR2BB, -NHNR2BAR2BB, -C(0)R2BA, -C(0)-OR2BA, -C(0)NR2BAR2BB, -OR2BA, -NR2BAS02R2BB, -NR2BAC(0)R2BB, -NR2BAC(0)0R2BB, -NR2BAOR2BB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0147] Each R1B, R3A, R3B, R4A, R4B, R5A, R5B, R6A, R6B, R7A, R7B, R1AA, R1AB, R2AA, R2AB, R2EA, R2BB, R8A, R8B, R9A, R9B, R10a, and R10B is independently hydrogen, -CX3, -CHX2, -CH2X, -C(0)0H, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)0H, -NHOH, -OCX3, -OCHX2, -OCH2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R1A and R1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2A and R2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R3A and R3B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R4A and R4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R5A and R5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R6A and R6B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R7A and R7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R10A and R10B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R1AA and R1AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2AA and R2AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2BA and R2BB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl. [0148] ml, m2, m3, m4, m5, m6, m7, m8, m9, mlO, mlA, m2A, and m2B are independently 1 or 2.
[0149] vl, v2, v3, v4, v5, v6, v7, v8, v9, vlO, vl A, v2A, and v2B are independently 1 or 2.
[0150] nl, n2, n3, n4, n5, n6, n7, n8, n9, nlO, nlA, n2A, and n2B are independently an integer from 0 to 4.
[0151] X, X1, X2, X3, X4, X5, X6, X7, X8, X9, X10, X1A, X2A, and X2B are independently -Cl, -Br, -I or -F.
[0152] In embodiments, L1 and L2 are independently a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene (e.g., C i-Cx, Ci-C6, Ci-C4, or C1-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C6-Ci2, C6-Cio, or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0153] In embodiments, L7 is independently -0-. In embodiments, L7 is independently - N(R10)-.
[0154] In embodiments, L8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, substituted or unsubstituted alkylene (e.g., C i-Cx, Ci-C6, Ci-C4, or C1-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C6-Ci2, C6-Cio, or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, L8 is independently a bond. In embodiments, L8 is
independently an unsubstituted phenylene. [0155] In embodiments, R6 is independently -L6(-L7-L8-R8)(-L9-R9). In embodiments R6 is
Figure imgf000047_0001
[0156] In an aspect is provided a compound having the formula:
Figure imgf000047_0002
[0157] R3, R4, R5, R8, R9, R1A, R2A, R2B, L3, L6, L7, L8, and L9 are as described herein. R8 and R9 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, a substituted or unsubstituted heterocycloalkyl, a substituted or unsubstituted aryl, or a substituted or unsubstituted heteroaryl. [0158] In embodiments, the compound has the formula:
Figure imgf000048_0001
[0159] R1A, R2A, R2B, R3, R4, R5, R8, R9, and L9 are as described herein. R8 and R9 substituents may optionally be joined to form a substituted or unsubstituted heterocycloalkyl, or a substituted or unsubstituted heteroaryl. [0160] In embodiments, the compound has the formula:
Figure imgf000048_0002
[0161] R1A, R2A, R2B, R3, R8, R9, and L9 are as described herein. R8 and R9 substituents may optionally be joined to form a substituted or unsubstituted heterocycloalkyl, or a substituted or unsubstituted heteroaryl. [0162] In embodiments, the compound has the formula:
Figure imgf000049_0001
[0163] R1A, R2A, R2B, R3, R9, and L9 are as described herein.
[0164] R41 is independently halogen, -CX41 3, -CHX41 2, -CH2X41, -C(0)0H, -C(0)NH2,
-CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX41 3, -OCHX41 2, -OCH2X41, -OPh, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl; two adjacent R41 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0165] z4l is an integer from 0 to 5.
[0166] X41 is independently -Cl, -Br, -I, or -F.
[0167] In embodiments, the compound has the formula:
Figure imgf000050_0001
[0168] R1A, R2A, R2B, R3, R8, R9, L6, L7, L8 and L9 are as described herein. R8 and R9 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, a substituted or unsubstituted heterocycloalkyl, a substituted or unsubstituted aryl, or a substituted or unsubstituted heteroaryl.
[0169] L10 is independently a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-,
-NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkyl ene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted aryl ene, or substituted or unsubstituted heteroaryl ene.
[0170] R11 is hydrogen, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0171] In embodiments, L10 is independently a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene (e.g., Ci-Cx, Ci-C6, Ci-C4, or C1-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C6-Ci2, C6-Cio, or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). [0172] In embodiments, a substituted L10 (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L10 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In
embodiments, when L10 is substituted, it is substituted with at least one substituent group. In embodiments, when L10 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L10 is substituted, it is substituted with at least one lower substituent group.
[0173] In embodiments, R11 is hydrogen, halogen, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0174] In embodiments, a substituted R11 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R11 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R11 is substituted, it is substituted with at least one substituent group. In embodiments, when R11 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R11 is substituted, it is substituted with at least one lower substituent group.
[0175] In an aspect is provided a compound of Formula:
Figure imgf000052_0001
[0177] L3 is -0-, -S-, or -N(R7)-.
[0178] V is -O- or -N(R10)-. [0179] R1A is hydrogen, halogen, -CX1A 3, -CHX1A 2, -CH2X1A, -OCX1A 3, -OCH2X1A,
-OCHX1A 2, -CN, -SOniAR1AA, -SOVIANR1AAR1ab, -NHC(0)NR1AAR1AB, -N(0)miA,
-NR1AAR1AB, -NHNR1AAR1AB, -C(0)R1aa, -C(0)-OR1aa, -C(0)NR1AAR1AB, -OR1aa, -NR1AAS02R1AB, -NR1AAC(0)R1AB, -NR1AAC(0)OR1AB, -NR1AAOR1AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0180] R2A is hydrogen, halogen, -CX2A 3, -CHX2A 2, -CH2X2A, -OCX2A 3, -OCH2X2A, -OCHX2A 2, -CN, -SOn2AR2AA, -SOV2ANR2AAR2AB, -NHC(0)NR2AAR2AB, -N(0)m2A,
-NR2AAR2AB, -NHNR2AAR2AB, -C(0)R2AA, -C(0)-OR2AA, -C(0)NR2AAR2AB, -OR2AA, -NR2AAS02R2AB, -NR2AAC(0)R2AB, -NR2AAC(0)0R2AB, -NR2AAOR2AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0181] R2B is hydrogen, halogen, -CX2B 3, -CHX2B 2, -CH2X2B, -OCX2B 3, -OCH2X2B, -OCHX2B 2, -CN, -SO„2BR2BA, -SOV2BNR2BAR2BB, -NHC(0)NR2BAR2BB, -N(0)m2B,
-NR2BAR2BB, -NHNR2BAR2BB, -C(0)R2BA, -C(0)-OR2BA, -C(0)NR2BAR2BB, -OR2BA,
-NR2BAS02R2BB, -NR2BAC(0)R2BB, -NR2BAC(0)0R2BB, -NR2BAOR2BB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0182] R3 is hydrogen, halogen, -CX3 3, -CHX3 2, -CH2X3, -OCX3 3, -OCH2X3, -OCHX3 2, -CN, -SO„R3A, -SOV3NR3AR3B, -NHC(0)NR3AR3B, -N(0) ύ, -NR3AR3B, -NHNR3AR3B, -C(0)R3A, -C(0)-OR3A, -C(0)NR3AR3B, -OR3A, -NR3AS02R3B, -NR3AC(0)R3B,
-NR3AC(0)0R3B, -NR3AOR3B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0183] R4 is hydrogen, halogen, -CX4 3, -CHX4 2, -CH2X4, -OCX4 3, -OCH2X4, -OCHX4 2, -CN, -SOn4R4A, -SOV4NR4AR4B, -NHC(0)NR4AR4B, -N(0)m4, -NR4AR4B, -NHNR4AR4B, -C(0)R4A, -C(0)-OR4A, -C(0)NR4AR4B, -C(0)NHNR4AR4B, -OR4A, -NR4ASO2R4B,
-NR4AC(0)R4B, -NR4AC(0)0R4B, -NR4AOR4B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0184] R5 is hydrogen, halogen, -CX5 3, -CHX5 2, -CH2X5, -OCX5 3, -OCH2X5, -OCHX5 2, -CN, -SOn5R5A, -SOV5NR5AR5B, -NHC(0)NR5AR5B, -N(0)m5, -NR5AR5B, -NHNR5AR5B, -C(0)R5A, -C(0)-OR5A, -C(0)NR5AR5B, -C(0)NHNR5AR5B, -OR5A, -NR5ASO2R5B,
-NR5AC(0)R5B, -NR5AC(0)0R5B, -NR5AOR5B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl. [0185] R7 is hydrogen, halogen, -CX7 3, -CHX7 2, -CH2X7, -OCX7 3, -OCH2X7, -OCHX7 2, -CN, -SOnvR7A, -SOVVNR7AR7B, -NHC(0)NR7AR7B, -N(0)mv, -NR7AR7B, -NHNR7AR7B, -C(0)R7A, -C(0)-0R7A, -C(0)NR7AR7B, -C(0)NHNR7AR7B, -OR7A, -NR7ASO2R7B,
-NR7AC(0)R7B, -NR7AC(0)0R7B, -NR7AOR7B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0186] R8 is hydrogen, halogen, -CX -CHX8 2, -CH2X8, -OCX8 3, -OCH2X8, -OCHX8 2, -CN, -SOn8R8A, -SOv8NR8AR8B, -NHC(0)NR8AR8B, -N(0)m8, -NR8AR8B, -NHNR8AR8B, -C(0)R8A, -C(0)-OR8A, -C(0)NR8AR8B, -C(0)NHNR8AR8B, -OR8A, -NR8ASO2R8B,
-NR8AC(0)R8B, -NR8AC(0)0R8B, -NR8AOR8B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0187] R9 is hydrogen, halogen, -CX9 3, -CHX9 2, -CH2X9, -OCX9 3, -OCH2X9, -OCHX9 2, -CN, -SO„9R9A, -SOV9NR9AR9B, -NHC(0)NR9AR9B, -N(0)m9, -NR9AR9B, -NHNR9AR9B, -C(0)R9A, -C(0)-OR9A, -C(0)NR9AR9B, -C(0)NHNR9AR9B, -OR9A, -NR9ASO2R9B,
-NR9AC(0)R9B, -NR9AC(0)0R9B, -NR9AOR9B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0188] R8 and R9 substituents may optionally be joined to form a substituted or
unsubstituted cycloalkyl, a substituted or unsubstituted heterocycloalkyl, a substituted or unsubstituted aryl, or a substituted or unsubstituted heteroaryl.
[0189] R10 is hydrogen, halogen, -CX10 3, -CHX10 2, -CH2X10, -OCX10 3, -OCH2X10,
-OCHX10 2, -CN, -SOnioR10A, -SOvioNR10AR10B, -NHC(O)NR10AR10B, -N(0)mio, -NR10AR10B, -NHNR10AR10B, -C(O)R10A, -C(O)-OR10A, -C(O)NR10AR10B, -C(O)NHNR10AR10B, -OR10A, -NR10ASO2R10B, -NR10AC(O)R10B, -NR10AC(O)OR10B, -NR10AOR10B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. [0190] Each R1AA, R1AB, R2AA, R2AB, R2BA, R2BB, R3A, R3B, R4A, R4B, R5A, R5B, R7A, R7B,
R8A R8B, R9A, R9B, R10a, and R10B is independently hydrogen, -CX3, -CHX2, -CH2X,
-C(0)0H, -C(0)NH2, -CN, -OH, -NH2, -COOH, -COME, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX3, -OCHX2, -OCH2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl; R1AA and R1AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2AA and R2AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2BA and R2BB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R3A and R3B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R4A and R4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R5A and R5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R7A and R7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R10A and R10B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl.
[0191] ml A, m2A, m2B, m3, m4, m5, m7, m8, m9, and mlO are independently 1 or 2.
[0192] vl A, v2A, v2B, v3, v4, v5, v7, v8, v9, and vlO are independently 1 or 2.
[0193] nlA, n2A, n2B, n3, n4, n5, n7, n8, n9, and nlO are independently an integer from 0 to 4. [0194] X, XiA, X2A, X2B, X3, X4, X5, X7, X8, X9, and Xi(J are independently -Cl, -Br, -I, or -F.
[0195] L6 is substituted or unsubstituted alkyl ene, substituted or unsubstituted
heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl ene, substituted or unsubstituted aryl ene, or substituted or unsubstituted heteroaryl ene.
[0196] L8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, -S-, -S(O)-, -S(0)2-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or
unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
[0197] In embodiments, L8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or
unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene. In embodiments, L8 is unsubstituted phenylene.
[0198] L9 is a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -0C(0)-, -NHC(O)-, -NHC(0)NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
[0199] Wherein R2A and R2B may optionally be joined to form a substituted or
unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl.
[0200] R4 and R5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments, R4 and R5 are joined to form a substituted or unsubstituted phenyl.
[0201] R1 is hydrogen, halogen, -CX , -CHXS, -CH2X1, -OCX , -OCH2X1, -OCHX , -CN, -SOniR1A, -SOVINR1AR1b, -NHC(0)NR1AR1b, -N(0)mi, -NR1AR1B, -NHNR1AR1B, -C(0)R1A, -C(0)-OR1a, -C(0)NR1AR1b, -C(0)NHNR1AR1b, -OR1a, -NR1AS02R1B,
-NR1AC(0)R1B, -NR1AC(0)OR1B, -NR1AOR1B, -N3, -L'-E1, substituted or unsubstituted alkyl (e.g., C i-Cx, Ci-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0202] In embodiments, E1 is independently halogen, -CXS, -CHXS, -CH2X1, -OCX , -OCH2X1, -OCHXS, -CN, -SOniR1A, -SOVINR1AR1b, -NHC(0)NR1AR1B, -N(0)mi,
-NR1AR1B, -NHNR1AR1B, -C(0)R1a, -C(0)-OR1a, -C(0)NR1AR1b, -C(0)NHNR1AR1b, -OR1a, -NR1AS02R1B, -NR1AC(0)R1b, -NR1AC(0)OR1B, -NR1AOR1B, -N3, substituted or
unsubstituted alkyl (e.g., Ci-C8, Ci-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- C12, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0203] In embodiments, E1 is independently halogen, -CXS, -CHXS, -CH2X1, -OCX , -OCH2X1, -OCHXS, -CN, -SOniR1A, -SOVINR1AR1b, -NHC(0)NR1AR1B, -N(0)mi,
-NR1AR1B, -NHNR1AR1B, -C(0)R1a, -C(0)-OR1a, -C(0)NR1AR1b, -C(0)NHNR1AR1b, -OR1a, -NR1AS02R1B, -NR1AC(0)R1b, -NR1AC(0)OR1B, -NR1AOR1B, -NS, R20-substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or C1-C2), R20-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R20-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), R20-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R20-substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or R20-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
membered).
[0204] In embodiments, R1 is independently hydrogen, halogen, -CX's, -CHXS, -CH2X1, -OCXS, -OCH2X1, -OCHXS, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H,
-S04H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)-OH, -NHOH, R20-substituted or unsubstituted alkyl (e.g., C i-Cx, Ci- C6, C1-C4, or C1-C2), R20-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R20-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R20-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R20-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R20-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R1 is independently hydrogen, halogen, -CX , -CHX , -CH2X1, -OCX , -OCH2X1, -OCHX , -CN, -OH,
-NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -S04H, -SO2NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)-OH, -NHOH, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X1 is independently -F, -Cl, -Br, or -I.
[0205] In embodiments, R1 is independently hydrogen. In embodiments, R1 is
independently -COOH. In embodiments, R1 is independently -C(0)0(Ci-C4 alkyl). In embodiments, R1 is independently -CF3. In embodiments, R1 is independently -CH2OH. In embodiments, R1 is independently -C(0)CH3. In embodiments, R1 is independently
Figure imgf000058_0001
. In embodiments, R1 is independently
Figure imgf000058_0002
. In embodiments, R2U is hydrogen, -F, -Cl, or unsubstituted C1-C4 alkyl.
[0206] R20 is independently oxo, halogen, -CX20 3, -CHX20 2, -CH2X20, -OCX20 3, -OCH2X20,
-OCHX202, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -S04H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, R21-substituted or unsubstituted alkyl (e.g., Ci-Cs, Ci-C6, Ci-C4, or C1-C2), R21- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R21- substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R21-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R21- substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R21- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R20 is independently oxo, halogen, -CX20 3, -CHX20 2, -CH2X20, -OCX20 3, -OCH2X20, -OCHX20 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, C1-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X20 is independently -F, -Cl, -Br, or -I. In embodiments, R20 is independently unsubstituted methyl. In embodiments, R20 is independently unsubstituted ethyl.
[0207] R21 is independently oxo, halogen, -CX21 3, -CHX21 2, -CH2X21, -OCX21 3, -OCH2X21,
-OCHX21 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0) NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, R22- substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), R22-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R22-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R22-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R22-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R22-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R21 is independently oxo, halogen, -CX21 3, -CHX21 2, -CH2X21, -OCX21 3, -OCH2X21, -OCHX21 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC= (0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X21 is independently -F, -Cl, -Br, or -I. In embodiments, R21 is independently unsubstituted methyl. In embodiments, R21 is independently unsubstituted ethyl.
[0208] R22 is independently oxo, halogen, -CX22 3, -CHX22 2, -CH2X22, -OCX22 3, -OCH2X22,
-OCHX22 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X22 is independently -F, -Cl, -Br, or -I. In embodiments, R22 is independently unsubstituted methyl. In embodiments, R22 is independently
unsubstituted ethyl.
[0209] R1A is hydrogen, halogen, -CX1A 3, -CHX1A 2, -CH2X1A, -OCX1A 3, -OCH2X1A, -OCHX1A 2, -CN, -SOniAR1AA, -SOVIANR1AAR1ab, -NHC(0)NR1AAR1AB, -N(0)miA,
-NR1AAR1AB, -NHNR1AAR1ab, -C(0)R1aa, -C(0)-OR1aa, -C(0)NR1AAR1AB, -OR1aa, -NR1AAS02R1AB, -NR1AAC(0)R1AB, -NR1AAC(0)OR1AB, -NR1AAOR1AB, -N3, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0210] In embodiments, R1A is independently hydrogen. In embodiments, R1A is independently -CX1A 3. In embodiments, R1A is independently -CHX1A 2. In embodiments, R1A is independently -CH2X1A. In embodiments, R1A is independently -CN. In embodiments, R1A is independently -COOH. In embodiments, R1A is
independently -CONH2. In embodiments, X1A is independently -F, -Cl, -Br, or -I.
[0211] In embodiments, R1A is independently hydrogen, -CX1A 3, -CHX1A 2, -CH2X1A,
-CN, -COOH, -CONH2, R20A-substituted or unsubstituted alkyl (e.g., C i-Cx, Ci-C6, C1-C4, or Ci-C2), R20A-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R20A-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R20A-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R20A-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R20A- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R1A is independently hydrogen, -CX1A 3, -CHX1A 2, -CH2X1A, -CN, -COOH, -CONH2, unsubstituted alkyl (e.g., Ci- C8, Ci-C6, C1-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X1A is independently -F, -Cl, -Br, or -I. In embodiments, R1A is independently hydrogen. In embodiments, R1A is independently unsubstituted methyl. In embodiments, R1A is independently unsubstituted ethyl.
[0212] In embodiments, R1A and R1B substituents bonded to the same nitrogen atom may optionally be joined to form a R20A-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R20A- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R1A and R1B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R1A and R1B substituents bonded to the same nitrogen atom may optionally be joined to form a R20A-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R1A and R1B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
[0213] R20A is independently oxo, halogen, -CX20A 3, -CHX20A 2, -CH2X20A, -OCX20A 3, -OCH2X20A, -OCHX20A 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H,
-NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R21A-substituted or unsubstituted alkyl (e.g., Ci- C8, Ci-C6, Ci-C4, or Ci-C2), R21A-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R21A- substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R21A-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R21A-substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or R21A-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R20A is independently oxo, halogen, -CX20A 3, -CHX20A 2, -CH2X20A, -OCX20A 3, -OCH2X20A,
-OCHX20A 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X20A is independently -F, -Cl, -Br, or -I. In embodiments, R20A is independently unsubstituted methyl. In embodiments, R20A is independently unsubstituted ethyl.
[0214] R21A is independently oxo, halogen, -CX21A 3, -CHX21A 2, -CH2X21A, -OCX21A 3, -OCH2X21A, -OCHX21A 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R22A- substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci- C4, or Ci-C2), R22A-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R22A-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R22A-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R22A-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R22A- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R21A is
independently oxo, halogen, -CX21A 3, -CHX21A 2, -CH2X21A, -OCX21A 3, -OCH2X21A,
-OCHX21A 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, C1-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X21A is independently -F, -Cl, -Br, or -I. In embodiments, R21A is independently unsubstituted methyl. In embodiments, R21A is independently unsubstituted ethyl.
[0215] R22A is independently oxo, halogen, -CX22A 3, -CHX22A 2, -CH2X22A, -OCX22A 3, -OCH2X22A, -OCHX22A 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X22A is independently -F, -Cl, -Br, or -I. In embodiments, R22A is independently unsubstituted methyl. In embodiments, R22A is independently unsubstituted ethyl.
[0216] In embodiments, R1A is independently hydrogen. In embodiments, R1A is independently -OH. In embodiments, R1A is independently unsubstituted methyl. In embodiments, R1A is independently -OCH3. In embodiments, R1A is independently -NH-(CI-C4 alkyl). In embodiments, R1A is independently
Figure imgf000064_0001
. In embodiments, R1A is independently -NH-NH-Ph. In embodiments, R1A is independently R20A- substituted or unsubstituted 5 membered heteroalkyl. In embodiments, R1A is independently R20A-substituted or unsubstituted 6 membered heteroalkyl. In embodiments, R1A is independently R20A-substituted or unsubstituted 7 membered heteroalkyl. In embodiments, R20A is independently -F, -CF3, or unsubstituted Ci-C4 alkyl.
[0217] In embodiments, R1B is independently hydrogen, halogen, -CX1B 3, -CHX1B 2, -CH2X1B, -C(0)0H, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)0H, -NHOH, -OCX1B 3, -OCHX1B 2, -OCH2X1B, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X1B are independently -Cl, -Br, -I, or -F.
[0218] In embodiments, a substituted R1B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R1B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R1B is substituted, it is substituted with at least one substituent group. In embodiments, when R1B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R1B is substituted, it is substituted with at least one lower substituent group.
[0219] In embodiments, R1AA is independently hydrogen, halogen, -CX1AA 3, -CHX1AA 2, -CH2X1AA, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -0NH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)0H, -NHOH, -OCX1AA 3, -OCHX1AA 2, -OCH2X1AA, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- C12, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X1AA is independently -Cl, -Br, -I, or -F.
[0220] In embodiments, a substituted R1AA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R1AA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R1AA is substituted, it is substituted with at least one substituent group. In embodiments, when R1AA is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R1AA is substituted, it is substituted with at least one lower substituent group.
[0221] In embodiments, R1AB is independently hydrogen, halogen, -CX1AB3, -CHX1AB2, -CH2X1AB, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -S04H, -SO2NH2, -NHNH2, -0NH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX1AB 3, -OCHX1AB 2, -OCH2X1AB, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- C12, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X1AB is independently -Cl, -Br, -I, or -F. [0222] In embodiments, a substituted R1AB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R1AB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R1AB is substituted, it is substituted with at least one substituent group. In embodiments, when R1AB is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R1AB is substituted, it is substituted with at least one lower substituent group.
[0223] In embodiments, R1AA and R1AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, a substituted heterocycloalkyl or substituted heteroaryl formed by the joining of R1AA and R1AB substituents bonded to the same nitrogen atom is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted heterocycloalkyl or substituted heteroaryl is substituted with a plurality of groups selected from substituent groups, size- limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In
embodiments, when a heterocycloalkyl formed by the joining of R1AA and R1AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one substituent group. In embodiments, when a heterocycloalkyl formed by the joining of R1AA and R1AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when a heterocycloalkyl formed by the joining of R1AA and R1AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one lower substituent group. In embodiments, when a heteroaryl formed by the joining of R1AA and R1AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one substituent group. In embodiments, when a heteroaryl formed by the joining of R1AA and R1AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when a heteroaryl formed by the joining of R1AA and R1AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one lower substituent group.
[0224] R2 is hydrogen, halogen, -CX2 3, -CHX2 2, -CH2X2, -OCX2 3, -OCH2X2, -OCHX2 2, -CN, -SO„2R2A, -SOV2NR2AR2B, -NHC(0)NR2AR2B, -N(0)m2, -NR2AR2B, -NHNR2AR2B, -C(0)R2A, -C(0)-OR2A, -C(0)NR2AR2B, -C(0)NHNR2AR2B, -OR2A, -NR2ASO2R2B,
-NR2AC(0)R2B, -NR2AC(0)0R2B, -NR2AOR2B, -N3, -L2-E2, substituted or unsubstituted alkyl (e.g., C i-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0225] In embodiments, E2 is independently halogen, -CX2 3, -CHX2 2, -CH2X2, -OCX2 3, -OCH2X2, -OCHX2 2, -CN, -SO„2R2A, -SOVINR2AR2B, -NHC(0)NR2AR2B, -N(0)m2,
-NR2AR2B, -NHNR2AR2B, -C(0)R2A, -C(0)-OR2A, -C(0)NR2AR21b, -C(0)NHNR2AR2B, -OR2A, -NR2AS02R2B, -NR2AC(0)R2B, -NR2AC(0)0R2B, -NR2AOR2B, -N3, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, C1-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0226] In embodiments, E2 is independently halogen, -CX2 3, -CHX2 2, -CH2X2, -OCX2 3, -OCH2X2, -OCHX2 2, -CN, -SO„2R2A, -SOVINR2AR2B, -NHC(0)NR2AR2B, -N(0)m2,
-NR2AR2B, -NHNR2AR2B, -C(0)R2A, -C(0)-OR2A, -C(0)NR2AR21b, -C(0)NHNR2AR2B, -OR2A, -NR2AS02R2B, -NR2AC(0)R2B, -NR2AC(0)0R2B, -NR2AOR2B, -N3, R23- substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, C1-C4, or Ci-C2), R23-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R23-substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5- C6), R23-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R23-substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or R23-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
membered).
[0227] In embodiments, R2 is independently hydrogen, halogen, -CX2 3, -CHX2 2, -CH2X2, -OCX2 3, -OCH2X2, -OCHX2 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H,
-SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)-OH, -NHOH, R23 -substituted or unsubstituted alkyl (e.g., C i-Cx, Ci- C6, Ci-C4, or Ci-C2), R23- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R23 -substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R23-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R23-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R23-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R2 is independently hydrogen, halogen, -CX2 3, -CHX2 2, -CH2X2, -OCX2 3, -OCH2X2, -OCHX2 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X2 is independently -F, -Cl, -Br, or -I.
[0228] R23 is independently oxo, halogen, -CX23 3, -CHX23 2, -CH2X23, -OCX23 3, -OCH2X23,
-OCHX23 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, R24- substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), R24-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R24-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R24-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R24-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R24-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R23 is independently oxo, halogen, -CX23 3, -CHX23 2, -CH2X23, -OCX23 3, -OCH2X23, -OCHX23 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X23 is independently -F, -Cl, -Br, or -I. In embodiments, R23 is independently unsubstituted methyl. In embodiments, R23 is independently unsubstituted ethyl.
[0229] R24 is independently oxo, halogen, -CX24 3, -CHX24 2, -CH2X24, -OCX24 3, -OCH2X24,
-OCHX24 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, R25-substituted or unsubstituted alkyl (e.g., C i-Cx, Ci-C6, Ci-C4, or Ci-C2), R25- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R25-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R25-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R25-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R25-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R24 is independently oxo, halogen, -CX24 3, -CHX24 2, -CH2X24, -OCX24 3, -OCH2X24, -OCHX24 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X24 is independently -F, -Cl, -Br, or -I. In embodiments, R24 is independently unsubstituted methyl. In embodiments, R24 is independently unsubstituted ethyl.
[0230] R25 is independently oxo, halogen, -CX25 3, -CHX25 2, -CH2X25, -OCX25 3, -OCH2X25,
-OCHX25 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, C1-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X25 is independently -F, -Cl, -Br, or -I. In embodiments, R25 is independently unsubstituted methyl. In embodiments, R25 is independently
unsubstituted ethyl.
[0231] In embodiments, R2 is independently hydrogen. In embodiments, R2 is
independently -COOH. In embodiments, R2 is independently -C(0)0(Ci-C4 alkyl). In embodiments, R2 is independently -CF3. In embodiments, R2 is independently -CH2OH. In embodiments, R2 is independently -C(0)CH3. In embodiments, R2 is independently
Figure imgf000070_0001
. In embodiments, R1 is independently
Figure imgf000070_0002
In embodiments, R23 is hydrogen, -F, -Cl, or unsubstituted C1-C4 alkyl.
[0232] R2A is hydrogen, halogen, -CX2A 3, -CHX2A 2, -CH2X2A, -OCX2A 3, -OCH2X2A, -OCHX2A 2, -CN, -SOn2AR2AA, -SOV2ANR2AAR2AB, -NHC(0)NR2AAR2AB, -N(0)m2A,
-NR2AAR2AB, -NHNR2AAR2AB, -C(0)R2AA, -C(0)-OR2AA, -C(0)NR2AAR2AB, -OR2AA, -NR2AAS02R2AB, -NR2AAC(0)R2AB, -NR2AAC(0)0R2AB, -NR2AAOR2AB, -N3, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, C1-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0233] In embodiments, R2A is independently hydrogen, -CX2A 3, -CHX2A 2, -CH2X2A, -CN, -COOH, -CONH2, R23A-substituted or unsubstituted alkyl (e.g., C i-Cx, Ci-C6, Ci-C4, or Ci- C2), R23A-substituted or unsubstituted heteroalkyl (e.g., 2 to 12 membered, 2 to 8 membered,
2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R23A-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R23A-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R23A-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R23A-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R2A is independently hydrogen, -CX2A 3, -CHX2A 2, -CH2X2A, -CN, -COOH, -CONH2, unsubstituted alkyl (e.g., Ci- C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X2A is independently -F, -Cl, -Br, or -I. In embodiments, R2A is independently hydrogen. In embodiments, R2A is independently unsubstituted methyl. In embodiments, R2A is independently unsubstituted ethyl.
[0234] In embodiments, R2A and R2B substituents bonded to the same nitrogen atom may optionally be joined to form a R23A-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R23A-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R2A and R2B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g.,
3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R2A and R2B substituents bonded to the same nitrogen atom may optionally be joined to form a R23A-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R2A and R2B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R2A and R2B substituents bonded to the same nitrogen and the nitrogen they are both bonded
to are joined to form
Figure imgf000072_0001
[0235] R23A is independently oxo, halogen, -CX23A 3, -CHX23A 2, -CH2X23A, -OCX23A 3, -OCH2X23A, -OCHX23A 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-0H, -NHOH, -N3, -OPh, R24A-substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci- C6, Ci-C4, or Ci-C2), R24A- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R24A- substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R24A-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R24A-substituted or unsubstituted aryl (e.g., C6-Ci4, C6- Ci2, C6-Cio, or phenyl), or R24A- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R23A is independently oxo, halogen, -CX23A 3, -CHX23A 2, -CH2X23A, -OCX23A 3, -OCH2X23A, -OCHX23A 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X23A is independently -F, -Cl, -Br, or -I. In embodiments, R23A is independently unsubstituted methyl. In embodiments, R23A is independently unsubstituted ethyl. In embodiments, two adjacent R23A substituents may optionally be joined to form an R24A-substituted or unsubstituted cycloalkyl, R24A- substituted or unsubstituted heterocycloalkyl, R24A-substituted or unsubstituted aryl, or R24A- substituted or unsubstituted heteroaryl.
[0236] R24A is independently oxo, halogen, -CX24A 3, -CHX24A 2, -CH2X24A, -OCX24A 3, -OCH2X24A, -OCHX24A 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R25A-substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or Ci-C2), R25A-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R25A-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R25A-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R25A-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R25A-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R24A is
independently oxo, halogen, -CX24A 3, -CHX24A 2, -CH2X24A, -OCX24A 3, -OCH2X24A,
-OCHX24A 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X24A is independently -F, -Cl, -Br, or -I. In embodiments, R24A is independently unsubstituted methyl. In embodiments, R24A is independently unsubstituted ethyl.
[0237] R25A is independently oxo, halogen, -CX25A 3, -CHX25A 2, -CH2X25A, -OCX25A 3, -OCH2X25A, -OCHX25A 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X25A is independently -F, -Cl, -Br, or -I. In embodiments, R25A is independently unsubstituted methyl. In embodiments, R25A is independently unsubstituted ethyl.
[0238] In embodiments, R2A is independently hydrogen. In embodiments, R2A is independently unsubstituted C1-C4 alkyl. In embodiments, R2A is independently
-CH2CH2OH. In embodiments, R2A is independently unsubstituted C5-C6 cycloalkyl. In embodiments, R2A is independently R23A-substituted or unsubstituted phenyl. In
embodiments, R2A is independently unsubstituted phenyl. In embodiments, R2A is
Figure imgf000074_0002
. , . In embodiments, R 2A is independently -NH-pyridyl. In embodiments, R2A is independently an R23A-substituted or unsubstituted 4 to 9 membered heteroalkyl. In embodiments, R2A is independently an unsubstituted 4 to 9 membered heteroalkyl. In embodiments, R2A is independently an R23A- substituted or unsubstituted 5 to 9 membered heteroaryl. In embodiments, R2A is
independently an unsubstituted 5 to 9 membered heteroaryl. In embodiments, R23A is independently -F or -Cl. In embodiments, R23A is independently -OCH3. In embodiments, R23A is independently -OCF3. In embodiments, R23A is independently -C(0)0-tert-butyl. In embodiments, R23A is independently -CONH2. In embodiments, R23A is independently
Figure imgf000074_0001
. In embodiments, R23A is independently -COCH3. In embodiments, R23A is independently -CH2CH2OH. In embodiments, R23A is independently an unsubstituted C1-C4 alkyl. In embodiments, R23A is independently an unsubstituted C2 alkynyl. In embodiments, R23A is independently an R24A- substituted or unsubstituted phenyl. In embodiments, R23A is independently an unsubstituted phenyl. In embodiments, R23A is independently an unsubstituted C13 aryl. In embodiments, R23A is independently an R24A- substituted or unsubstituted pyridyl. In embodiments, R23A is independently an unsubstituted pyridyl. In embodiments, R23A is independently -SO2CH3. In embodiments, R23A is independently - S02Ph. In embodiments, R23A is independently
Figure imgf000075_0001
In embodiments,
R23A is independently -OPh. In embodiments, R23A is independently
Figure imgf000075_0002
. In embodiments, R23A is independently an R24A-substituted or unsubstituted 6 membered
heteroalkyl. In embodiments, R23A is independently
Figure imgf000075_0003
. In embodiments,
R23A is independently
Figure imgf000075_0004
. In embodiments, R23A is independently an unsubstituted 6 membered heteroalkyl. In embodiments, R24A is independently oxo. In embodiments, R24A is independently unsubsituted methyl. In embodiments, R24A is independently an R25A-substituted or unsubstituted phenyl. In embodiments, R24A is independently unsubstituted phenyl. In embodiments, R24A is independently an R25A- substituted or unsubstituted 5 to 6 membered heterocycloalkyl. In embodiments, R24A is independently an unsubstituted 5 to 6 membered heterocycloalkyl. In embodiments, R24A is independently an R25A-substituted or unsubstituted 5 to 6 membered heteroaryl. In embodiments, R24A is independently an unsubstituted 5 to 6 membered heteroaryl. In embodiments, R24A is independently an R25A-substituted thienyl. In embodiments, R24A is independently an unsubstituted thienyl. In embodiments, R24A is independently an R25A- substituted pyridyl. In embodiments, R24A is independently an unsubstituted pyridyl. In embodiments, R24A is independently an R25A-substituted pyrimidinyl. In embodiments, R24A is independently an unsubstituted pyrimidinyl. In embodiments, R25A is independently - F, -Cl, -CN, or unsubstituted methyl.
[0239] R2B is hydrogen, halogen, -CX2B 3, -CHX2B 2, -CH2X2B, -OCX2B 3, -OCH2X2B, -OCHX2B 2, -CN, -SO„2BR2BA, -SOV2BNR2BAR2BB, -NHC(0)NR2BAR2BB, -N(0)m2B,
-NR2BAR2BB, -NHNR2BAR2BB, -C(0)R2BA, -C(0)-OR2BA, -C(0)NR2BAR2BB, -OR2BA,
-NR2BAS02R2BB, -NR2BAC(0)R2BB, -NR2BAC(0)0R2BB, -NR2BAOR2BB, -N3, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0240] In embodiments, R2B is independently hydrogen, -CX2B 3, -CHX2B 2, -CH2X2B,
-CN, -COOH, -CONH2, R23B- substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), R23B- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R23B-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R23B-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R23B-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R23B-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R2B is independently hydrogen, -CX2B 3, -CHX2B 2, -CH2X2B, -CN, -COOH, -CONH2, unsubstituted alkyl (e.g., Ci- C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X2B is independently -F, -Cl, -Br, or -I. In embodiments, R2B is independently hydrogen. In embodiments, R2B is independently an unsubstituted methyl. In embodiments, R2B is independently unsubstituted ethyl.
[0241] R23B is independently oxo, halogen, -CX23B 3, -CHX23B 2, -CH2X23B, -OCX23B 3, -OCH2X23B, -OCHX23B 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, -OPh, R24B-substituted or unsubstituted alkyl (e.g., Ci-C8, Ci- C6, Ci-C4, or Ci-C2), R24B-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R24B-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R24B- substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R24B-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R24B-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R23B is
independently oxo, halogen, -CX23B 3, -CHX23B 2, -CH2X23B, -OCX23B 3, -OCH2X23B,
-OCHX23B 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X23B is independently -F, -Cl, -Br, or -I. In embodiments, R23B is independently unsubstituted methyl. In embodiments, R23B is independently unsubstituted ethyl. In embodiments, two adjacent R23B substituents may optionally be joined to form an R24B-substituted or unsubstituted cycloalkyl, R24B-substituted or unsubstituted heterocycloalkyl, R24B-substituted or unsubstituted aryl, or R24B-substituted or unsubstituted heteroaryl.
[0242] R24B is independently oxo, halogen, -CX24B 3, -CHX24B 2, -CH2X24B, -OCX24B 3, -OCH2X24B, -OCHX24B 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R25B-substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or Ci-C2), R25B- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R25B-substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), R25B-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R25B-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R25B-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R24B is
independently oxo, halogen, -CX24B 3, -CHX24B 2, -CH2X24B, -OCX24B 3, -OCH2X24B,
-OCHX24B 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X24B is independently -F, -Cl, -Br, or -I. In embodiments, R24B is independently unsubstituted methyl. In embodiments, R24B is independently unsubstituted ethyl.
[0243] R25B is independently oxo, halogen, -CX25B 3, -CHX25B 2, -CH2X25B, -OCX25B 3, -OCH2X25B, -OCHX25B 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, C1-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X25B is independently -F, -Cl, -Br, or -I. In embodiments, R25B is independently unsubstituted methyl. In embodiments, R25B is independently unsubstituted ethyl.
[0244] In embodiments, R2AA is independently hydrogen, halogen, -CX2AA 3, -CHX2AA 2, -CH2X2AA, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX2AA 3, -OCHX2AA 2, -OCH2X2AA, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X2AA is independently -Cl, -Br, -I, or -F. [0245] In embodiments, a substituted R2AA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R2AA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R2AA is substituted, it is substituted with at least one substituent group. In embodiments, when R2AA is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R2AA is substituted, it is substituted with at least one lower substituent group.
[0246] In embodiments, R2AB is independently hydrogen, halogen, -CX2AB 3, -CHX2AB 2, -CH2X2AB, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX2AB 3, -OCHX2AB 2, -OCH2X2AB, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, C1-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X2AB is independently -Cl, -Br, -I, or -F.
[0247] In embodiments, a substituted R2AB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R2AB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R2AB is substituted, it is substituted with at least one substituent group. In embodiments, when R2AB is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R2AB is substituted, it is substituted with at least one lower substituent group. [0248] In embodiments, R2AA and R2AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, a substituted heterocycloalkyl or substituted heteroaryl formed by the joining of R2AA and R2AB substituents bonded to the same nitrogen atom is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted heterocycloalkyl or substituted heteroaryl is substituted with a plurality of groups selected from substituent groups, size- limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In
embodiments, when a heterocycloalkyl formed by the joining of R2AA and R2AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one substituent group. In embodiments, when a heterocycloalkyl formed by the joining of R2AA and R2AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when a heterocycloalkyl formed by the joining of R2AA and R2AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one lower substituent group. In embodiments, when a heteroaryl formed by the joining of R2AA and R2AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one substituent group. In embodiments, when a heteroaryl formed by the joining of R2AA and R2AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when a heteroaryl formed by the joining of R2AA and R2AB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one lower substituent group.
[0249] In embodiments, R2BA is independently hydrogen, halogen, -CX2BA 3, -CHX2BA 2, -CH2X2BA, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX2BA 3, -OCHX2BA 2, -OCH2X2BA, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X2BA is independently -Cl, -Br, -I, or -F.
[0250] In embodiments, a substituted R2BA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R2BA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R2BA is substituted, it is substituted with at least one substituent group. In embodiments, when R2BA is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R2BA is substituted, it is substituted with at least one lower substituent group.
[0251] In embodiments, R2BB is independently hydrogen, halogen, -CX2BB 3, -CHX2BB 2, -CH2X2BB, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX2BB 3, -OCHX2BB 2, -OCH2X2BB, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X2BB is independently -Cl, -Br, -I, or -F.
[0252] In embodiments, a substituted R2BB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R2BB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R2BB is substituted, it is substituted with at least one substituent group. In embodiments, when R2BB is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R2BB is substituted, it is substituted with at least one lower substituent group.
[0253] In embodiments, R2BA and R2BB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, a substituted heterocycloalkyl or substituted heteroaryl formed by the joining of R2BA and R2BB substituents bonded to the same nitrogen atom is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted heterocycloalkyl or substituted heteroaryl is substituted with a plurality of groups selected from substituent groups, size- limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In
embodiments, when a heterocycloalkyl formed by the joining of R2BA and R2BB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one substituent group. In embodiments, when a heterocycloalkyl formed by the joining of R2BA and R2BB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when a heterocycloalkyl formed by the joining of R2BA and R2BB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one lower substituent group. In embodiments, when a heteroaryl formed by the joining of R2BA and R2BB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one substituent group. In embodiments, when a heteroaryl formed by the joining of R2BA and R2BB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when a heteroaryl formed by the joining of R2BA and R2BB substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one lower substituent group.
[0254] In embodiments, R3 is independently hydrogen, halogen, -CX -CHX3 2, -CH2X3, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)0H, -NHOH, -OCX3 3, -OCHX3 2, -OCH2X3, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X3 is independently -Cl, -Br, -I, or -F.
[0255] In embodiments, R3 is independently hydrogen. In embodiments, R3 is
independently unsubstituted methyl. In embodiments, R3 is independently -CH2OH. In embodiments, R3 is independently unsubstituted phenyl.
[0256] In embodiments, a substituted R3 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R3 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R3 is substituted, it is substituted with at least one substituent group. In embodiments, when R3 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R3 is substituted, it is substituted with at least one lower substituent group.
[0257] In embodiments, R3A is independently hydrogen, halogen, -CX3A3, -CHX3A2, -CH2X3A, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -0NH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX3A 3, -OCHX3A 2, -OCH2X3A, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- C12, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X3A is independently -Cl, -Br, -I, or -F.
[0258] In embodiments, a substituted R3A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R3A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R3A is substituted, it is substituted with at least one substituent group. In embodiments, when R3A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R3A is substituted, it is substituted with at least one lower substituent group.
[0259] In embodiments, R3B is independently hydrogen, halogen, -CX3B 3, -CHX3B 2, -CH2X3B, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX3B 3, -OCHX3B 2, -OCH2X3B, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X3B is independently -Cl, -Br, -I, or -F.
[0260] In embodiments, a substituted R3B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R3B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R3B is substituted, it is substituted with at least one substituent group. In embodiments, when R3B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R3B is substituted, it is substituted with at least one lower substituent group.
[0261] In embodiments, R4 is independently hydrogen, halogen, -CX4 3, -CHX4 2,
-CH2X4, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX4 3, -OCHX4 2, -OCH2X4, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R4 is
independently hydrogen. In embodiments, R4 is independently -OH. X4 is
independently -Cl, -Br, -I, or -F.
[0262] In embodiments, a substituted R4 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R4 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R4 is substituted, it is substituted with at least one substituent group. In embodiments, when R4 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R4 is substituted, it is substituted with at least one lower substituent group.
[0263] In embodiments, R4A is independently hydrogen, halogen, -CX4A 3, -CHX4A 2, -CH2X4A, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX4A 3, -OCHX4A 2, -OCH2X4A, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X4A is independently -Cl, -Br, -I or, -F.
[0264] In embodiments, a substituted R4A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R4A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R4A is substituted, it is substituted with at least one substituent group. In embodiments, when R4A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R4A is substituted, it is substituted with at least one lower substituent group.
[0265] In embodiments, R4B is independently hydrogen, halogen, -CX4B 3, -CHX4B 2, -CH2X4B, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONHI, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX4B 3, -OCHX4B 2, -OCH2X4B, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X4B is independently -Cl, -Br, -I, or -F.
[0266] In embodiments, a substituted R4B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R4B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R4B is substituted, it is substituted with at least one substituent group. In embodiments, when R4B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R4B is substituted, it is substituted with at least one lower substituent group.
[0267] In embodiments, R5 is independently hydrogen, halogen, -CX5 3, -CHX5 2,
-CH2X5, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX5 3, -OCHX5 2, -OCH2X5, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R5 is
independently hydrogen. In embodiments, R5 is independently -OH. X5 is
independently -Cl, -Br, -I, or -F.
[0268] In embodiments, a substituted R5 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R5 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R5 is substituted, it is substituted with at least one substituent group. In embodiments, when R5 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R5 is substituted, it is substituted with at least one lower substituent group.
[0269] In embodiments, R5A is independently hydrogen, halogen, -CX5A 3, -CHX5A 2, -CH2X5A, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX5A 3, -OCHX5A 2, -OCH2X5A, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- C12, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X5A is independently -Cl, -Br, -I, or -F.
[0270] In embodiments, a substituted R5A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R5A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R5A is substituted, it is substituted with at least one substituent group. In embodiments, when R5A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R5A is substituted, it is substituted with at least one lower substituent group.
[0271] In embodiments, R5B is independently hydrogen, halogen, -CX5B 3, -CHX5B 2, -CH2X5B, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONHI, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX5B 3, -OCHX5B 2, -OCH2X5B, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, C1-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X5B is independently -Cl, -Br, -I, or -F.
[0272] In embodiments, a substituted R5B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R5B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R5B is substituted, it is substituted with at least one substituent group. In embodiments, when R5B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R5B is substituted, it is substituted with at least one lower substituent group.
[0273] In embodiments, R6 is independently hydrogen, halogen, -CX , -CHX6 2,
-CH2X6, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX6 3, -OCHX6 2, -OCH2X6, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X6 is independently -Cl, -Br, -I, or -F.
[0274] In embodiments, a substituted R6 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R6 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R6 is substituted, it is substituted with at least one substituent group. In embodiments, when R6 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R6 is substituted, it is substituted with at least one lower substituent group.
[0275] In embodiments, R6A is independently hydrogen, halogen, -CX6A 3, -CHX6A 2, -CH2X6A, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -0NH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)0H, -NHOH, -OCX6A 3, -OCHX6A 2, -OCH2X6A, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- C12, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X6A is independently -Cl, -Br, -I, or -F.
[0276] In embodiments, a substituted R6A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R6A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R6A is substituted, it is substituted with at least one substituent group. In embodiments, when R6A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R6A is substituted, it is substituted with at least one lower substituent group.
[0277] In embodiments, R6B is independently hydrogen, halogen, -CX6B3, -CHX6B2, -CH2X6B, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -S04H, -SO2NH2, -NHNH2, -0NH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX6B 3, -OCHX6B 2, -OCH2X6B, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- C12, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X6B is independently -Cl, -Br, -I, or -F. [0278] In embodiments, a substituted R6B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R6B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R6B is substituted, it is substituted with at least one substituent group. In embodiments, when R6B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R6B is substituted, it is substituted with at least one lower substituent group.
[0279] In embodiments, R7 is independently hydrogen, halogen, -CX7 3, -CHX7 2,
-CH2X7, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX7 3, -OCHX7 2, -OCH2X7, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X7 is independently -Cl, -Br, -I, or -F.
[0280] In embodiments, a substituted R7 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R7 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R7 is substituted, it is substituted with at least one substituent group. In embodiments, when R7 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R7 is substituted, it is substituted with at least one lower substituent group. [0281] In embodiments, R7A is independently hydrogen, halogen, -CX7A 3, -CHX7A 2, -CH2X7A, -C(0)0H, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX7A 3, -OCHX7A 2, -OCH2X7A, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X7A is independently -Cl, -Br, -I, or -F.
[0282] In embodiments, a substituted R7A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R7A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R7A is substituted, it is substituted with at least one substituent group. In embodiments, when R7A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R7A is substituted, it is substituted with at least one lower substituent group.
[0283] In embodiments, R7B is independently hydrogen, halogen, -CX7B 3, -CHX7B 2, -CH2X7B, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX7B 3, -OCHX7B 2, -OCH2X7B, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X7B is independently -Cl, -Br, -I, or -F.
[0284] In embodiments, a substituted R7B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R7B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R7B is substituted, it is substituted with at least one substituent group. In embodiments, when R7B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R7B is substituted, it is substituted with at least one lower substituent group.
[0285] R8 is hydrogen, halogen, -CX -CHX8 2, -CH2X8, -OCX8 3, -OCH2X8, -OCHX8 2, -CN, -SOn8R8A, -SOv8NR8AR8B, -NHC(0)NR8AR8B, -N(0)m8, -NR8AR8B, -NHNR8AR8B, -C(0)R8A, -C(0)-OR8A, -C(0)NR8AR8B, -C(0)NHNR8AR8B, -OR8A, -NR8ASO2R8B,
-NR8AC(0)R8B, -NR8AC(0)0R8B, -NR8AOR8B, -N3, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0286] In embodiments, R8 is independently hydrogen, halogen, -CX8 3, -CHX8 2, -CH2X8, -OCX8 3, -OCH2X8, -OCHX8 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H,
-SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)-OH, -NHOH, R41-substituted or unsubstituted alkyl (e.g., Ci-C8, Ci- C6, C1-C4, or Ci-C2), R41- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R41-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R41-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R41- substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R41- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8 is independently hydrogen, halogen, -CX -CHX8 2, -CH2X8, -OCX8 3, -OCH2X8, -OCHX8 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X8 is independently -F, -Cl, -Br, or -I.
[0287] In embodiments, R8 is independently hydrogen. In embodiments, R8 is
independently unsubstituted methyl. In embodiments, R8 is independently -OCH3. In embodiments, R8 is independently -CN. In embodiments, R8 is independently -OPh. In embodiments, R8 is independently an R41-substituted or unsubstituted phenyl. In
embodiments, R8 is independently an R41-substituted phenyl. In embodiments, R8 is independently an unsubstituted phenyl. In embodiments, R41 is independently -F, -Cl, -CN, -CH3, -OCH3, or -OCH2CH3.
[0288] In embodiments, R8 and R9 substituents may optionally be joined to form a R41- substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), or R41-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
membered). In embodiments, R8 and R9 substituents may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form a R41-substituted or unsubstituted
heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). [0289] R41 is independently oxo, halogen, -CX41 3, -CHX41 2, -CH2X41, -OCX41 3, -OCH2X41,
-OCHX41 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, -NHPh, -OPh, R42-substituted or unsubstituted alkyl (e.g., Ci- C8, Ci-C6, Ci-C4, or Ci-C2), R42-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R42- substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R42-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R42-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R42-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0290] In embodiments, R41 is independently oxo, halogen, -CX41 3, -CHX41 2, -CH2X41, -OCX41 3, -OCH2X41, -OCHX41 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R42-substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), R42-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R42-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R42-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R42-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R42-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R41 is independently oxo, halogen, -CX41 3, -CHX41 2, -CH2X41, -OCX41 3, -OCH2X41, -OCHX41 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X41 is independently -F, -Cl, -Br, or -I. In embodiments, R41 is independently unsubstituted methyl. In embodiments, R41 is independently unsubstituted ethyl. [0291] R42 is independently oxo, halogen, -CX42 3, -CHX42 2, -CH2X42, -OCX42 3, -OCH2X42,
-OCHX42 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, R43-substituted or unsubstituted alkyl (e.g., C i-Cx, Ci-C6, Ci-C4, or Ci-C2), R43- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R43-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R43-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R43-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R43-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R42 is independently oxo, halogen, -CX42 3, -CHX42 2, -CH2X42, -OCX42 3, -OCH2X42, -OCHX42 2, -CN, -OH, -NH¾ -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X42 is independently -F, -Cl, -Br, or -I. In embodiments, R42 is independently unsubstituted methyl. In embodiments, R42 is independently unsubstituted ethyl.
[0292] R43 is independently oxo, halogen, -CX43 3, -CHX43 2, -CH2X43, -OCX43 3, -OCH2X43,
-OCHX43 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X43 is independently -F, -Cl, -Br, or -I. In embodiments, R43 is independently unsubstituted methyl. In embodiments, R43 is independently
unsubstituted ethyl.
[0293] R8A is hydrogen, halogen, -CX8A 3, -CHX8A 2, -CH2X8A, -OCX8A 3, -OCH2X8A, -OCHX8A 2, -CN, -SOn8AR8AA, -SOV8ANR8AAR8AB, -NHC(0)NR8AAR8AB, -N(0)m8A,
-NR8AAR8AB, -NHNR8AAR8AB, -C(0)R8AA, -C(0)-0R8AA, -C(0)NR8AAR8AB, -OR8AA, -NR8AAS02R8AB, -NR8AAC(0)R8AB, -NR8AAC(0)0R8AB, -NR8AAOR8AB, -N3, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0294] In embodiments, R8A is independently hydrogen, -CX8A 3, -CHX8A 2, -CH2X8A,
-CN, -COOH, -CONH2, R41A-substituted or unsubstituted alkyl (e.g., C i-Cx, Ci-C6, Ci-C4, or Ci-C2), R41A-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R41A-substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), R41A-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R41A-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R41A-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8A is independently hydrogen, -CX8A 3, -CHX8A 2, -CH2X8A, -CN, -COOH, -CONH2, unsubstituted alkyl (e.g., Ci- C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-Cs, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X8A is independently -F, -Cl, -Br, or -I. In embodiments, R8A is independently hydrogen. In embodiments, R8A is independently unsubstituted methyl. In embodiments, R8A is independently unsubstituted ethyl. [0295] In embodiments, R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form a R41A-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R41A-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form a R41A-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
[0296] In embodiments, R8 and R9 substituents may optionally be joined to form a R41- substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), or R41-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
membered). In embodiments, R8 and R9 substituents may optionally be joined to form a R41- substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form a R41-substituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form a R41- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form a R41-substituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form an unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). [0297] R41A is independently oxo, halogen, -CX41A 3, -CHX41A 2, -CH2X41A, -OCX41A 3, -OCH2X41A, -OCHX41A 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R42A- substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or Ci-C2), R42A-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R42A-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R42A-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R42A-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R42A- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R41A is
independently oxo, halogen, -CX41A 3, -CHX41A 2, -CH2X41A, -OCX41A 3, -OCH2X41A,
-OCHX41A 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO¾ -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X41A is independently -F, -Cl, -Br, or -I. In embodiments, R41A is independently unsubstituted methyl. In embodiments, R41A is independently unsubstituted ethyl.
[0298] R42A is independently oxo, halogen, -CX42A 3, -CHX42A 2, -CH2X42A, -OCX42A 3, -OCH2X42A, -OCHX42A 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R43A-substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or Ci-C2), R43A-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R43A-substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), R43A-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R43A-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R43A-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R42A is independently oxo, halogen, -CX42A 3, -CHX42A 2, -CH2X42A, -OCX42A 3, -OCH2X42A,
-OCHX42A 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X42A is independently -F, -Cl, -Br, or -I. In embodiments, R42A is independently unsubstituted methyl. In embodiments, R42A is independently unsubstituted ethyl.
[0299] R43A is independently oxo, halogen, -CX43A 3, -CHX43A 2, -CH2X43A, -OCX43A 3, -OCH2X43A, -OCHX43A 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X43A is independently -F, -Cl, -Br, or -I. In embodiments, R43A is independently unsubstituted methyl. In embodiments, R43A is independently unsubstituted ethyl.
[0300] R8B is hydrogen, halogen, -CX8B 3, -CHX8B 2, -CH2X8B, -OCX8B 3, -OCH2X8B, -OCHX8B 2, -CN, -SOn8BR8BA, -SOV8BNR8BAR8BB, -NHC(0)NR8BAR8BB, -N(0)m8B,
-NR8BAR8BB, -NHNR8BAR8BB, -C(0)R8BA, -C(0)-OR8BA, -C(0)NR8BAR8BB, -OR8BA,
-NR8BAS02R8BB, -NR8BAC(0)R8BB, -NR8BAC(0)0R8BB, -NR8BAOR8BB, -N3, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0301] In embodiments, R8B is independently hydrogen, -CX8B 3, -CHX8B 2, -CH2X8B, -CN, -COOH, -CONH2, R41B- substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci- C2), R41B-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R41B-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R41B-substituted or unsubstituted
heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R41B-substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or R41B-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8B is independently hydrogen, -CX8B 3, -CHX8B 2, -CH2X8B, -CN, -COOH, -CONH2, unsubstituted alkyl (e.g., Ci- C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X8B is independently -F, -Cl, -Br, or -I. In embodiments, R8B is independently hydrogen. In embodiments, R8B is independently unsubstituted methyl. In embodiments, R8B is independently unsubstituted ethyl.
[0302] In embodiments, R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form a R41B-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R41B-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form a R41B- substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
[0303] R41B is independently oxo, halogen, -CX41B 3, -CHX41B 2, -CH2X41B, -OCX41B 3, -OCH2X41B, -OCHX41B 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R42B-substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or Ci-C2), R42B- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R42B-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R42B- substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R42B-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R42B-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R41B is
independently oxo, halogen, -CX41B 3, -CHX41B 2, -CH2X41B, -OCX41B 3, -OCH2X41B,
-OCHX41B 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO¾ -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X41B is independently -F, -Cl, -Br, or -I. In embodiments, R41B is independently unsubstituted methyl. In embodiments, R41B is independently unsubstituted ethyl.
[0304] R42B is independently oxo, halogen, -CX42B 3, -CHX42B 2, -CH2X42B, -OCX42B 3, -OCH2X42B, -OCHX42B 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R43B-substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or C1-C2), R43B- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R43B-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R43B-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R43B-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R43B-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R42B is
independently oxo, halogen, -CX42 -CHX42B 2, -CH2X42B, -OCX42B 3, -OCH2X42B,
-OCHX42B 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, C1-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X42B is independently -F, -Cl, -Br, or -I. In embodiments, R42B is independently unsubstituted methyl. In embodiments, R42B is independently unsubstituted ethyl.
[0305] R43B is independently oxo, halogen, -CX43B 3, -CHX43B 2, -CH2X43B, -OCX43B 3, -OCH2X43B, -OCHX43B 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X43B is independently -F, -Cl, -Br, or -I. In embodiments, R43B is independently unsubstituted methyl. In embodiments, R43B is independently unsubstituted ethyl. [0306] R8AA is independently hydrogen, halogen, -CX8AA 3, -CHX8AA 2, -CH2X8AA,
-C(0)0H, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX8AA 3, -OCHX8AA 2, -OCH2X8AA, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl), substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. X8AA is independently -Cl, -Br, -I, or -F.
[0307] In embodiments, R8AA is independently hydrogen, halogen, -CX8AA 3, -CHX8AA 2, -CH2X8AA, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX8AA 3, -OCHX8AA 2, -OCH2X8AA, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X8AA is independently -Cl, -Br, -I, or -F.
[0308] In embodiments, a substituted R8AA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R8AA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R8AA is substituted, it is substituted with at least one substituent group. In embodiments, when R8AA is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R8AA is substituted, it is substituted with at least one lower substituent group.
[0309] R8AB is independently hydrogen, halogen, -CX8AB 3, -CHX8AB 2, -CH2X8AB,
-C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)0H, -NHOH, -OCX8AB 3, -OCHX8AB 2, -OCH2X8AB, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. X8AB is independently -Cl, -Br, -I, or -F.
[0310] In embodiments, R8AB is independently hydrogen, halogen, -CX8AB 3, -CHX8AB 2, -CH2X8AB, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX8AB 3, -OCHX8AB 2, -OCH2X8AB, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X8AB is independently -Cl, -Br, -I, or -F.
[0311] In embodiments, a substituted R8AB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R8AB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R8AB is substituted, it is substituted with at least one substituent group. In embodiments, when R8AB is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R8AB is substituted, it is substituted with at least one lower substituent group.
[0312] R8BA is independently hydrogen, halogen, -CX8BA 3, -CHX8BA 2, -CH2X8BA,
-C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX8BA 3, -OCHX8BA 2, -OCH2X8BA, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. X8BA is independently -Cl, -Br, -I, or -F.
[0313] In embodiments, R8BA is independently hydrogen, halogen, -CX8BA 3, -CHX8BA 2, -CH2X8BA, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H,
, -NHSO2H,
Figure imgf000106_0001
substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X8BA is independently -Cl, -Br, -I, or -F.
[0314] In embodiments, a substituted R8BA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R8BA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R8BA is substituted, it is substituted with at least one substituent group. In embodiments, when R8BA is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R8BA is substituted, it is substituted with at least one lower substituent group.
[0315] R8BB is independently hydrogen, halogen, -CX8BB 3, -CHX8BB 2, -CH2X8BB,
-C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX8BB 3, -OCHX8BB 2, -OCH2X8BB, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. X8BB is independently -Cl, -Br, -I, or -F. [0316] In embodiments, R8BB is independently hydrogen, halogen, -CX8BB 3, -CHX8BB 2, -CH2X8BB, -C(0)0H, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX8BB 3, -OCHX8BB 2, -OCH2X8BB, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X8BB is independently -Cl, -Br, -I, or -F.
[0317] In embodiments, a substituted R8BB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R8BB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R8BB is substituted, it is substituted with at least one substituent group. In embodiments, when R8BB is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R8BB is substituted, it is substituted with at least one lower substituent group.
[0318] R9 is hydrogen, halogen, -CX9 3, -CHX9 2, -CH2X9, -OCX9 3, -OCH2X9, -OCHX9 2, -CN, -SO„9R9A, -SOV9NR9AR9B, -NHC(0)NR9AR9B, -N(0)m9, -NR9AR9B, -NHNR9AR9B, -C(0)R9A, -C(0)-OR9A, -C(0)NR9AR9B, -C(0)NHNR9AR9B, -OR9A, -NR9ASO2R9B,
-NR9AC(0)R9B, -NR9AC(0)0R9B, -NR9AOR9B, -N3, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0319] In embodiments, R9 is independently hydrogen, halogen, -CX -CHX9 2, -CH2X9, -OCX9 3, -OCH2X9, -OCHX9 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H,
-SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)-OH, -NHOH, R44-substituted or unsubstituted alkyl (e.g., C i-Cx, Ci- C6, Ci-C4, or Ci-C2), R44-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R44-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R44-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R44-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R44-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R9 is independently hydrogen, halogen, -CX9 3, -CHX9 2, -CH2X9, -OCX9 3, -OCH2X9, -OCHX9 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -SO3H, -S04H, -S02NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X9 is independently -F, -Cl, -Br, or -I.
[0320] In embodiments, R8 and R9 substituents may optionally be joined to form a R44- substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), or R44-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
membered). In embodiments, R8 and R9 substituents may optionally be joined to form a R44- substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form a R44-substituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form a R44- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form a R44-substituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R8 and R9 substituents may optionally be joined to form an unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0321] R44 is independently oxo, halogen, -CX44 3, -CHX44 2, -CH2X44, -OCX44 3, -OCH2X44,
-OCHX44 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, -NHPh, -OPh, R45 -substituted or unsubstituted alkyl (e.g., Ci- C8, Ci-C6, Ci-C4, or Ci-C2), R45-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R45- substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R45- substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R45 -substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R45-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0322] In embodiments, R44 is independently oxo, halogen, -CX44 3, -CHX44 2, -CH2X44, -OCX44 3, -OCH2X44, -OCHX44 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R45-substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), R45-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R45- substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R45-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R45-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R45-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R44 is independently oxo, halogen, -CX44 3, -CHX44 2, -CH2X44, -OCX44 3, -OCH2X44, -OCHX44 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)-0H, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, C1-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X44 is independently -F, -Cl, -Br, or -I. In embodiments, R44 is independently unsubstituted methyl. In embodiments, R44 is independently unsubstituted ethyl.
[0323] R45 is independently oxo, halogen, -CX453, -CHX452, -CH2X45, -OCX453, -OCH2X45,
-OCHX452, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -S04H, -SO2NH2, -NHNH2, -0NH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, R46- substituted or unsubstituted alkyl (e.g., C i-Cx, Ci-C6, Ci-C4, or C1-C2), R46-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R46-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R46-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R46-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R46-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R45 is independently oxo, halogen, -CX45 3, -CHX45 2, -CH2X45, -OCX45 3, -OCH2X45, -OCHX45 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -S04H, -SO2NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cs, Ci-C6, Ci-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X45 is independently -F, -Cl, -Br, or -I. In embodiments, R45 is independently unsubstituted methyl. In embodiments, R45 is independently unsubstituted ethyl. [0324] R46 is independently oxo, halogen, -CX46 3, -CHX46 2, -CH2X46, -OCX46 3, -OCH2X46,
-OCHX46 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X46 is independently -F, -Cl, -Br, or -I. In embodiments, R46 is independently unsubstituted methyl. In embodiments, R46 is independently
unsubstituted ethyl.
[0325] In embodiments, R9 is independently an R44-substituted or unsubstituted Ci-C4 alkyl. In embodiments, R9 is independently an unsubstituted Ci-C4 alkyl. In embodiments, R9 is independently an R44-substituted or unsubstituted C4-C6 cycloalkyl. In embodiments,
R9 is independently an unsubstituted C4-C6 cycloalkyl. In embodiments, R9 is independently R44-substituted or unsubstituted 5 to 6 membered heterocycloalkyl. In embodiments, R9 is independently an unsubstituted 5 to 6 membered heterocycloalkyl. In embodiments, R9 is independently R44-substituted or unsubstituted phenyl. In embodiments, R9 is independently an unsubstituted phenyl. In embodiments, R9 is independently an R44-substituted or unsubstituted naphthyl. In embodiments, R9 is independently an unsubstituted naphthyl. In embodiments, R9 is independently an R44-substituted or unsubstituted pyridyl. In
embodiments, R9 is independently an unsubstituted pyridyl. In embodiments, R9 is independently an R44-substituted or unsubstituted 10 membered heteroaryl. In embodiments, R9 is independently an unsubstituted 10 membered heteroaryl. In embodiments, R44 is independently -F, -Cl, -Br, or -I. In embodiments, R44 is independently -CN. In
embodiments, R44 is independently -0-(Ci-C4 alkyl). In embodiments, R44 is independently -OCH3. In embodiments, R44 is independently -OCH2CH3. In embodiments, R44 is independently -OCF3. In embodiments, R44 is independently an R45 -substituted or unsubstituted Ci-C4 alkyl. In embodiments, R44 is independently an unsubstituted methyl. In embodiments, R44 is independently an R45-substituted or unsubstituted 2 to 5 membered heteroalkyl. In embodiments, R44 is independently -CH2OH. In embodiments, R44 is independently -CH2CH2OH. In embodiments, R44 is independently an R45-substituted or unsubstituted phenyl. In embodiments, R44 is independently an unsubstituted phenyl. In embodiments, R45 is independently oxo. In embodiments, R45 is independently an unsubstituted 5 to 6 membered heterocycloalkyl. In embodiments, R45 is independently
Figure imgf000112_0001
[0326] R9A is hydrogen, halogen, -CX9A 3, -CHX9A 2, -CH2X9A, -OCX9A 3, -OCH2X9A, -OCHX9A 2, -CN, - S On9 AR9AA, -SOV9ANR9AAR9AB, -NHC(0)NR9AAR9AB, -N(0)m9A,
-NR9AAR9AB, -NHNR9AAR9AB, -C(0)R9AA, -C(0)-0R9AA, -C(0)NR9AAR9AB, -OR9AA, -NR9AAS02R9AB, -NR9AAC(0)R9AB, -NR9AAC(0)0R9AB, -NR9AAOR9AB, -N3, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0327] In embodiments, R9A is independently hydrogen, -CX9A 3, -CHX9A 2, -CH2X9A,
-CN, -COOH, -CONH2, R44A-substituted or unsubstituted alkyl (e.g., C i-Cx, Ci-C6, Ci-C4, or Ci-C2), R44A-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R44A-substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), R44A-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R44A-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R44A- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R9A is independently hydrogen, -CX9A 3, -CHX9A 2, -CH2X9A, -CN, -COOH, -CONH2, unsubstituted alkyl (e.g., Ci- C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X9A is independently -F, -Cl, -Br, or -I. In embodiments, R9A is independently hydrogen. In embodiments, R9A is independently unsubstituted methyl. In embodiments, R9A is independently unsubstituted ethyl.
[0328] In embodiments, R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form a R44A-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R44A- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to
9 membered, or 5 to 6 membered). In embodiments, R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form a R44A-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
[0329] R44A is independently oxo, halogen, -CX44A 3, -CHX44A 2, -CH2X44A, -OCX44A 3, -OCH2X44A, -OCHX44A 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R45A-substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or Ci-C2), R45A-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R45A-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R45A-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R45A-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R45A-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to
10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R44A is
independently oxo, halogen, -CX44A 3, -CHX44A 2, -CH2X44A, -OCX44A 3, -OCH2X44A,
-OCHX44A 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X44A is independently -F, -Cl, -Br, or -I. In embodiments, R44A is independently unsubstituted methyl. In embodiments, R44A is independently unsubstituted ethyl.
[0330] R45A is independently oxo, halogen, -CX45A 3, -CHX45A 2, -CH2X45A, -OCX45A 3, -OCH2X45A, -OCHX45A 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R46A- substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or Ci-C2), R46A-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R46A-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R46A-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R46A-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R46A- substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R45A is
independently oxo, halogen, -CX45A 3, -CHX45A 2, -CH2X45A, -OCX45A 3, -OCH2X45A,
-OCHX45A 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X45A is independently -F, -Cl, -Br, or -I. In embodiments, R45A is independently unsubstituted methyl. In embodiments, R45A is independently unsubstituted ethyl. [0331] R46A is independently oxo, halogen, -CX46A 3, -CHX46A 2, -CH2X46A, -OCX46A 3, -OCH2X46A, -OCHX46A 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X46A is independently -F, -Cl, -Br, or -I. In embodiments, R46A is independently unsubstituted methyl. In embodiments, R46A is independently unsubstituted ethyl.
[0332] R9B is hydrogen, halogen, -CX9B 3, -CHX9B 2, -CH2X9B, -OCX9B 3, -OCH2X9B, -OCHX9B 2, -CN, -SO„9BR9BA, -SOV9BNR9BAR9BB, -NHC(0)NR9BAR9BB, -N(0)m9B,
-NR9BAR9BB, -NHNR9BAR9BB, -C(0)R9BA, -C(0)-OR9BA, -C(0)NR9BAR9BB, -OR9BA,
-NR9BAS02R9BB, -NR9BAC(0)R9BB, -NR9BAC(0)0R9BB, -NR9BAOR9BB, -N3, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0333] In embodiments, R9B is independently hydrogen, -CX9B 3, -CHX9B 2, -CH2X9B, -CN, -COOH, -CONH2, R44B- substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci- C2), R44B-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R44B-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R44B-substituted or unsubstituted
heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R44B-substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or R44B-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R9B is independently hydrogen, -CX9B 3, -CHX9B 2, -CH2X9B, -CN, -COOH, -CONH2, unsubstituted alkyl (e.g., Ci- C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X9B is independently -F, -Cl, -Br, or -I. In embodiments, R9B is independently hydrogen. In embodiments, R9B is independently unsubstituted methyl. In embodiments, R9B is independently unsubstituted ethyl.
[0334] In embodiments, R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form a R44B-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or R44B-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form a R44B- substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). In embodiments, R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form an unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered).
[0335] R44B is independently oxo, halogen, -CX44B 3, -CHX44B 2, -CH2X44B, -OCX44B 3, -OCH2X44B, -OCHX44B 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -SO3H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R45B-substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or Ci-C2), R45B- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R45B-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R45B-substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R45B-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R45B-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R44B is
independently oxo, halogen, -CX44 -CHX44B 2, -CH2X44B, -OCX44B 3, -OCH2X44B,
-OCHX44B 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X44B is independently -F, -Cl, -Br, or -I. In embodiments, R44B is independently unsubstituted methyl. In embodiments, R44B is independently unsubstituted ethyl.
[0336] R45B is independently oxo, halogen, -CX45B 3, -CHX45B 2, -CH2X45B, -OCX45B 3, -OCH2X45B, -OCHX45B 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R46B-substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or Ci-C2), R46B- substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R46B-substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), R46B- substituted or
unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R46B-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- Cio, or phenyl), or R46B-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R45B is
independently oxo, halogen, -CX45B 3, -CHX45B 2, -CH2X45B, -OCX45B 3, -OCH2X45B,
-OCHX45B 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X45B is independently -F, -Cl, -Br, or -I. In embodiments, R45B is independently unsubstituted methyl. In embodiments, R45B is independently unsubstituted ethyl.
[0337] R46B is independently oxo, halogen, -CX46B 3, -CHX46B 2, -CH2X46B, -OCX46B 3, -OCH2X46B, -OCHX46B 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, - S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X46B is independently -F, -Cl, -Br, or -I. In embodiments, R46B is independently unsubstituted methyl. In embodiments, R46B is independently unsubstituted ethyl.
[0338] R9AA is independently hydrogen, halogen, -CX9AA 3, -CHX9AA 2, -CH2X9AA,
-C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX9AA 3, -OCHX9AA 2, -OCH2X9AA, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. X9AA is independently -Cl, -Br, -I, or -F.
[0339] In embodiments, R9AA is independently hydrogen, halogen, -CX9AA 3, -CHX9AA 2, -CH2X9AA, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX9AA 3, -OCHX9AA 2, -OCH2X9AA, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X9AA is independently -Cl, -Br, -I, or -F.
[0340] In embodiments, a substituted R9AA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R9AA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R9AA is substituted, it is substituted with at least one substituent group. In embodiments, when R9AA is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R9AA is substituted, it is substituted with at least one lower substituent group.
[0341] R9AB is independently hydrogen, halogen, -CX9AB 3, -CHX9AB 2, -CH2X9AB,
-C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX9AB 3, -OCHX9AB 2, -OCH2X9AB, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. X9AB is independently -Cl, -Br, -I, or -F.
[0342] In embodiments, R9AB is independently hydrogen, halogen, -CX9AB 3, -CHX9AB 2, -CH2X9AB, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX9AB 3, -OCHX9AB 2, -OCH2X9AB, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X9AB is independently -Cl, -Br, -I, or -F.
[0343] In embodiments, a substituted R9AB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R9AB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R9AB is substituted, it is substituted with at least one substituent group. In embodiments, when R9AB is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R9AB is substituted, it is substituted with at least one lower substituent group.
[0344] R9BA is independently hydrogen, halogen, -CX9BA 3, -CHX9BA 2, -CH2X9BA,
-C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX9BA 3, -OCHX9BA 2, -OCH2X9BA, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. X9BA is independently -Cl, -Br, -I, or -F.
[0345] In embodiments, R9BA is independently hydrogen, halogen, -CX9BA 3, -CHX9BA 2, -CH2X9BA, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX9BA 3, -OCHX9BA 2, -OCH2X9BA, substituted or unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X9BA is independently -Cl, -Br, -I, or -F. [0346] In embodiments, a substituted R9BA (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R9BA is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R9BA is substituted, it is substituted with at least one substituent group. In embodiments, when R9BA is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R9BA is substituted, it is substituted with at least one lower substituent group.
[0347] R9BB is independently hydrogen, halogen, -CX9BB 3, -CHX9BB 2, -CH2X9BB,
-C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX9BB 3, -OCHX9BB 2, -OCH2X9BB, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. X9BB is independently -Cl, -Br, -I, or -F.
[0348] In embodiments, R9BB is independently hydrogen, halogen, -CX9BB 3, -CHX9BB 2, -CH2X9BB, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX9BB 3, -OCHX9BB 2, -OCH2X9BB, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X9BB is independently -Cl, -Br, -I, or -F.
[0349] In embodiments, a substituted R9BB (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R9BB is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R9BB is substituted, it is substituted with at least one substituent group. In embodiments, when R9BB is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R9BB is substituted, it is substituted with at least one lower substituent group.
[0350] m8A, m8B, m9A, and m9B are independently 1 or 2.
[0351] v8A, v8B, v9A, and v9B are independently 1 or 2.
[0352] n8A, n8B, n9A, and n9B are independently an integer from 0 to 4.
[0353] X8A, X8B, X9A, and X9B are independently -Cl, -Br, -I or -F.
[0354] In embodiments, R10 is independently hydrogen, halogen, -CX10 3, -CHX10 2,
-CH2X10, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX10 3, -OCHX10 2, -OCH2X10, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R10 is
independently hydrogen or unsubstituted methyl. X10 is independently -Cl, -Br, -I, or -F.
[0355] In embodiments, a substituted R10 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R10 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R10 is substituted, it is substituted with at least one substituent group. In embodiments, when R10 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R10 is substituted, it is substituted with at least one lower substituent group.
[0356] In embodiments, R10A is independently hydrogen, halogen, -CX10A 3, -CHX10A 2, -CH2X10A, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H,
2, -NHSO2H,
Figure imgf000123_0001
substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- Ci2, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X10A is independently -Cl, -Br, -I, or -F.
[0357] In embodiments, a substituted R10A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R10A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R10A is substituted, it is substituted with at least one substituent group. In embodiments, when R10A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R10A is substituted, it is substituted with at least one lower substituent group.
[0358] In embodiments, R10B is independently hydrogen, halogen, -CX10B 3, -CHX10B 2, -CH2X10B, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX10B 3, -OCHX10B 2, -OCH2X10B, substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6- C12, C6-Cio, or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X10B is independently -Cl, -Br, -I, or -F.
[0359] In embodiments, a substituted R10B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R10B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R10B is substituted, it is substituted with at least one substituent group. In embodiments, when R10B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R10B is substituted, it is substituted with at least one lower substituent group.
[0360] In embodiments, a substituted L1, L2, L3, L6, L8, and/or L9 (e.g., substituted alkylene, substituted heteroalkyl ene, substituted cycloalkylene, substituted
heterocycloalkyl ene, substituted arylene, and/or substituted heteroaryl ene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L1, L2, L3, L6, L8, and/or L9 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L1, L2, L3, L6, L8, and/or L9 is substituted, it is substituted with at least one substituent group. In embodiments, when L1, L2, L3, L6, L8, and/or L9 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L1, L2, L3, L6, L8, and/or L9 is substituted, it is substituted with at least one lower substituent group.
[0361] In embodiments, L9 is independently a bond. In embodiments, L9 is independently
— CH2-. In embodiments, L9 is independently
Figure imgf000124_0001
In embodiments, L9 is independently unsubstituted C2-C4 alkyl. In embodiments, L9 is independently a substituted or unsubstituted phenylene. In embodiments, L9 is independently a substituted phenylene. In embodiments, L9 is independently an unsubstituted phenylene. [0362] In embodiments, R9 is an R44-substituted or unsubstituted C1-C4 alkyl. In embodiments, R9 is an R44-substituted C1-C4 alkyl. In embodiments, R9 is an unsubstituted C1-C4 alkyl.
[0363] In embodiments, R44 is an R45-substituted or unsubstituted heterocycloalkyl. In embodiments, R44 is an R45- substituted heterocycloalkyl. In embodiments, R44 is an unsubstituted heterocycloalkyl. In embodiments, R44 is an unsubstituted morpholinyl.
[0364] In embodiments, L9-R9 is
Figure imgf000125_0001
embodiments,
Figure imgf000125_0002
embodiments, L9-R9 is
Figure imgf000125_0003
[0365] In embodiments, the compound has the formula:
Figure imgf000126_0001
described herein, including in embodiments. The symbol zl is an integer from 0 to 4.
[0366] R23AA is independently hydrogen, oxo, halogen, -CX23AA 3, -CHX23AA 2, -CH2X23AA,
Figure imgf000126_0002
-SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2,
-NHSOIH, -NHC=(0)H, -NHC(0)-0H, -NHOH, -N3, -OPh, R24AA- substituted or
unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), R24AA-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R24AA-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R24AA. substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R24AA- substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or R24AA-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
membered). In embodiments, R23AA is independently hydrogen, oxo, halogen, -CX23AA 3, -CHX23AA 2, -CH2X23AA, -OCX23AA 3, -OCH2X23AA, -OCHX23AA 2, -CN, -OH, -NH¾ -COOH, -CONHi, -N02, -SH, -SO3H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSOiH, -NHC=(0)H, -NHC(0)-0H, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). c23AA is independently -F, -Cl, -Br, or -I. In embodiments, R23AA is independently hydrogen. In embodiments, R23AA is independently unsubstituted methyl. In embodiments, R23AA is independently unsubstituted ethyl. In embodiments, R23AA is independently unsubstituted propyl. In embodiments, R23AA is independently unsubstituted butyl. In embodiments, R23AA is independently unsubstituted tert-butyl. In embodiments, two adjacent R23AA substituents may optionally be joined to form an R24AA-substituted or unsubstituted cycloalkyl, R24AA- substituted or unsubstituted heterocycloalkyl, R24AA-substituted or unsubstituted aryl, or R24AA-substituted or unsubstituted heteroaryl.
[0367] R23AB is independently hydrogen, oxo, halogen, -CX23AB 3, -CHX23AB 2, -CH2X23AB, -OCX23AB 3, -OCH2X23AB, -OCHX23AB 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2,
-NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, -OPh, R24AB-substituted or
unsubstituted alkyl (e.g., C i-Cx, Ci-C6, Ci-C4, or Ci-C2), R24AB-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R24AB-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R24AB-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R24AB- substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or R24AB-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6
membered). In embodiments, R23AB is independently hydrogen, oxo, halogen, -CX23AB 3, -CHX23AB 2, -CH2X23AB, -OCX23AB 3, -OCH2X23AB, -OCHX23AB 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X23AB is
independently -F, -Cl, -Br, or -I. In embodiments, R23AB is independently hydrogen. In embodiments, R23AB is independently unsubstituted methyl. In embodiments, R23AB is independently unsubstituted ethyl. In embodiments, R23AB is independently unsubstituted propyl. In embodiments, R23AB is independently unsubstituted butyl. In embodiments, R23AB is independently unsubstituted tert-butyl. In embodiments, two adjacent R23AB substituents may optionally be joined to form an R24AB- substituted or unsubstituted cycloalkyl, R24AB- substituted or unsubstituted heterocycloalkyl, R24AB- substituted or unsubstituted aryl, or R24AB.subs ituted or unsubstituted heteroaryl.
[0368] R24AA is independently oxo, halogen, -CX24AA 3, -CHX24AA 2, -CH2X24AA, -OCX24AA 3, -OCH2X24AA, -OCHX24AA 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R25AA-substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or Ci-C2), R25AA-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R25AA-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R25AA-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R25AA-substituted or unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or R25AA-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R24AA is independently oxo, halogen, -CX24AA 3, -CHX24AA 2, -CH2X24AA, -OCX24AA 3, -OCH2X24AA, -OCHX24AA 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-Cx, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X24AA is independently -F, -Cl, -Br, or -I. In
embodiments, R24AA is independently unsubstituted methyl. In embodiments, R24AA is independently unsubstituted ethyl.
[0369] R25AA is independently oxo, halogen, -CX25AA 3, -CHX25AA 2, -CH2X25AA, -OCX25AA 3, -OCH2X25AA, -OCHX25AA 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X25AA is independently -F, -Cl, -Br, or -I. In
embodiments, R25AA is independently unsubstituted methyl. In embodiments, R25AA is independently unsubstituted ethyl.
[0370] R24AB is independently oxo, halogen, -CX24AB 3, -CHX24AB 2, -CH2X24AB, -OCX24AB 3, -OCH2X24AB, -OCHX24AB 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-OH, -NHOH, -N3, R25AB-substituted or unsubstituted alkyl (e.g., Ci-Cx, Ci-C6, Ci- C4, or Ci-C2), R25AB-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R25AB-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), R25AB-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R25AB-substituted or unsubstituted aryl (e.g., C6-Ci2, C6- C10, or phenyl), or R25AB-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R24AB is
independently oxo, halogen, -CX24AB 3, -CHX24AB 2, -CH2X24AB, -OCX24AB 3, -OCH2X24AB, -OCHX24AB 2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)-OH, -NHOH, -N3, unsubstituted alkyl (e.g., Ci-C8, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X24AB is independently -F, -Cl, -Br, or -I. In embodiments, R24AB is independently unsubstituted methyl. In embodiments, R24AB is independently unsubstituted ethyl. [0371] R25AB is independently oxo, halogen, -CX25AB 3, -CHX25AB 2, -CH2X25AB, -OCX25AB 3, -OCH2X25AB, -OCHX25AB 2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)-0H, -NHOH, -N3, unsubstituted alkyl (e.g., C i-Cx, Ci-C6, Ci-C4, or Ci-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5- C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-Ci2, C6-Cio, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X25AB is independently -F, -Cl, -Br, or -I. In embodiments, R25AB is independently unsubstituted methyl. In embodiments, R25AB is independently unsubstituted ethyl.
[0372] In embodiments, zl is 0. In embodiments, zl is 1. In embodiments, zl is 2. In embodiments, zl is 3. In embodiments, zl is 4. [0373] In embodiments, the compound has the formula:
Figure imgf000130_0001
(Illf). R1A, R23AA, R23AB, and zl are as described herein, including in embodiments.
[0374] In embodiments, the compound has the formula:
Figure imgf000131_0001
are as described herein, including in embodiments.
[0375] In embodiments, the compound has the formula:
Figure imgf000131_0002
(Illh). R1A, R23AA, R23AB, and zl are as described herein, including in embodiments.
[0376] In embodiments, the compound has the formula:
Figure imgf000132_0001
(Illi). R1A, R23AA, R23AB, and zl are as described herein, including in embodiments.
[0377] In embodiments, the compound has the formula:
Figure imgf000132_0002
In embodiments, the compound has the formula
Figure imgf000132_0003
In embodiments, the compound has the formula
Figure imgf000133_0001
[0378] In embodiments, the compound has the formula:
Figure imgf000133_0002
In embodiments, the compound has the formula
Figure imgf000134_0001
In embodiments, the compound has the formula
Figure imgf000134_0002
In embodiments, the compound has the formula
Figure imgf000135_0001
[0379] In embodiments, the compound has the formula:
Figure imgf000135_0002
In embodiments, the compound has the formula
Figure imgf000136_0001
In embodiments, the compound has the formula
Figure imgf000136_0002
In embodiments, the compound has the
formula
Figure imgf000137_0001
. In embodiments, the compound has
the formula
Figure imgf000137_0002
[0380] In embodiments, the compound is covalently attached to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2. In embodiments, at least one of R1 or R2 includes an electron-withdrawing moiety. In embodiments, at least one of R1 or R2 are sufficiently electron withdrawing to allow the compound to covalently bind to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2, wherein the El cysteine amino acid is bound to ring carbon C2 attached to R2 or ring carbon Ci attached to R1. In embodiments, the compound covalently binds to an El cysteine amino acid corresponding to Cys30 of Uba2
subunit 2; and forms a complex of formula:
Figure imgf000137_0003
(lb). R1, R2, R3, R4, R5, R6, and L3 are as described herein, including in embodiments. In embodiments, R4 is hydrogen. In embodiments, R5 is hydrogen. In embodiments, R8 is substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments, R8 is substituted or unsubstituted aryl or substituted or unsubstituted heteroaryl. In embodiments, R8 is substituted or unsubstituted phenyl or substituted or unsubstituted 5 to 6 membered heteroaryl. In embodiments, R8 is substituted or unsubstituted phenyl. In embodiments, R41 is independently halogen or -OPh. In embodiments, z4l is 2. In embodiments, z4l is 1. In embodiments, z4l is 0. In embodiments, L9 is a bond or substituted or unsubstituted alkyl ene. In embodiments, L9 is a bond or unsubstituted C1-C3 alkylene. In embodiments, L9 is an unsubstituted methylene. In embodiments, L9 is a bond. In embodiments, R9 is substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted
heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments, R9 is unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl. In embodiments, R9 is unsubstituted Ci-C6 alkyl, unsubstituted 2 to 6 membered heteroalkyl, unsubstituted C3-C6 cycloalkyl, unsubstituted 3 to 6 membered heterocycloalkyl,
unsubstituted phenyl, or unsubstituted 5 to 6 membered heteroaryl. In embodiments, R9 is unsubstituted propyl, unsubstituted butyl, unsubstituted pentyl, unsubstituted propenyl, unsubstituted butenyl, unsubstituted pentenyl, unsubstituted propynyl, unsubstituted butynyl, unsubstituted pentynyl, unsubstituted cyclobutyl, unsubstituted cyclopentyl, unsubstituted tetrahydropyranyl, unsubstituted morpholinyl, or unsubstituted phenyl. In embodiments, R9 is unsubstituted phenyl. In embodiments, R2A is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl. In embodiments, R2A is hydrogen, substituted or unsubstituted Ci- C6 alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl, substituted or
unsubstituted C3-C6 cycloalkyl, substituted or unsubstituted 3 to 6 membered
heterocycloalkyl, substituted or unsubstituted C3-C6 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl. In embodiments, R2A is hydrogen. In embodiments, R2B is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments, R2B is hydrogen, substituted or unsubstituted Ci-C6 alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl, substituted or unsubstituted C3-C6 cycloalkyl, substituted or unsubstituted 3 to 6 membered heterocycloalkyl, substituted or unsubstituted C3-C6 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl. In embodiments, R2B is hydrogen. In embodiments, R2A and R2B are joined to form a substituted or unsubstituted
heterocycloalkyl or substituted or unsubstituted heteroaryl. In embodiments, R2A and R2B are joined to form a substituted or unsubstituted heterocycloalkyl. In embodiments, R2A and R2B are joined to form a substituted or unsubstituted 4 to 6 membered heterocycloalkyl. In embodiments, R1A is hydrogen, -CX1A 3, -CHX1A 2, -CH2X1A, -OCX1A 3, -OCH2X1A,
-OCHX1A 2, -C(0)R1aa, -C(0)OR1aa, -C(0)NR1AAR1AB, -OR1aa, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments, R1A is hydrogen, -CX1A 3, -CHX1A 2, -CH2X1A, unsubstituted Ci-C3 alkyl. In embodiments, R1A is unsubstituted Ci-C3 alkyl. In
embodiments, R1A is hydrogen. In embodiments, R3 is hydrogen, -CX3 3, -CHX3 2, -CH2X3, substituted or unsubstituted alkyl. In embodiments, R3 is -CH2OH or -CH3. In
embodiments, R3 is hydrogen. In embodiments, R3 is substituted or unsubstituted phenyl. In embodiments, R3 is unsubstituted phenyl.
[0381] In some embodiments, a compound as described herein may include multiple instances of R1 and/or other variables. In such embodiments, each variable may optional be different and be appropriately labeled to distinguish each group for greater clarity. For example, where each R1 is different, they may be referred to, for example, as R1·1, R1 2, R1 3, R1 4, R1 5, respectively, wherein the definition of R1 is assumed by R1·1, R1 2, R1 3, R1 4, R1 5. The variables used within a definition of R1 and/or other variables that appear at multiple instances and are different may similarly be appropriately labeled to distinguish each group for greater clarity.
[0382] In some embodiments, a compound as described herein may include multiple instances of R2 and/or other variables. In such embodiments, each variable may optional be different and be appropriately labeled to distinguish each group for greater clarity. For example, where each R2 is different, they may be referred to, for example, as R2·1, R2 2, R2 3, R2 4, R2 5 reSpectively, wherein the definition of R2 is assumed by R2·1, R2·2, R2·3, R2·4, R2 5. The variables used within a definition of R2 and/or other variables that appear at multiple instances and are different may similarly be appropriately labeled to distinguish each group for greater clarity. In some embodiments, the compound is a compound described herein (e.g., in an aspect, embodiment, example, claim, table, scheme, drawing, or figure).
[0383] In embodiments, unless otherwise indicated, a compound described herein is a racemic mixture of all stereoisomers. In embodiments, unless otherwise indicated, a compound described herein is a racemic mixture of all enantiomers. In embodiments, unless otherwise indicated, a compound described herein is a racemic mixture of two opposite stereoisomers. In embodiments, unless otherwise indicated, a compound described herein is a racemic mixture of two opposite enantiomers. In embodiments, unless otherwise indicated, a compound described herein is a single stereoisomer. In embodiments, unless otherwise indicated, a compound described herein is a single enantiomer. In embodiments, the compound is a compound described herein (e.g., in an aspect, embodiment, example, figure, table, scheme, or claim).
[0384] In embodiments, the compound is a compound described herein (e.g., in an aspect, embodiment, example, claim, table, scheme, drawing, or figure). In embodiments, a moiety of a compound is a moiety described in a compound of Table I in the Example section below. In embodiments, the moieties of a compound are moieties described in one or a plurality of compounds of Table I in the Example section below.
III. Pharmaceutical compositions
[0385] In an aspect is provided a pharmaceutical composition including a compound described herein, or pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
[0386] In embodiments of the pharmaceutical compositions, the compound, or
pharmaceutically acceptable salt thereof, is included in a therapeutically effective amount.
[0387] In embodiments of the pharmaceutical compositions, the pharmaceutical composition includes a second agent (e.g., therapeutic agent). In embodiments of the pharmaceutical compositions, the pharmaceutical composition includes a second agent (e.g., therapeutic agent) in a therapeutically effective amount. In embodiments of the
pharmaceutical compositions, the second agent is an agent for treating cancer. In
embodiments, the second agent is an anti-cancer agent. In embodiments, the second agent is a chemotherapeutic. In embodiments, the administering does not include administration of any active agent other than the recited active agent (e.g., a compound described herein). IV. Methods of Treatment
[0388] In an aspect is provided a method of treating cancer, the method including administering to a subject in need thereof an effective amount of a compound described herein. In embodiments, the compound is included in a therapeutically effective amount. In embodiments, the compound is administered at a rate approximately equal to the half-life of an El enzyme.
[0389] In embodiments, the half-life of an El enzyme is about 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half- life of an El enzyme is greater than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half-life of an El enzyme is less than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours.
[0390] In an aspect is provided a method of treating a proliferative disease, the method including administering to a subject in need thereof an effective amount of a compound described herein. In embodiments, the compound is included in a therapeutically effective amount. In embodiments, the compound is administered at a rate approximately equal to the half-life of an El enzyme.
[0391] In embodiments, the half-life of an El enzyme is about 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half- life of an El enzyme is greater than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half-life of an El enzyme is less than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours.
[0392] In an aspect is provided a method of treating cancer in a subject in need thereof, said method including administering to the subject a pharmaceutically acceptable excipient and a therapeutically effective amount of a compound of formula:
[0393]
Figure imgf000141_0001
are as described herein, including in embodiments. [0394] — is a single bond or double bond.
[0395] L3 is -0-, -S-, -N-, -S(O)-, -S(0)2-, -C(O)-, -N(R7)-, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene.
[0396] R1 is hydrogen, halogen, -CXS, -CHXS, -CU2X\ -OCX , -OCH2X1, -OCHXS, -CN, -SOniR1A, -SOVINR1AR1b, -NHC(0)NR1AR1b, -N(0)mi, -NR1AR1B, -NHNR1AR1B, -C(0)R1A, -C(0)-OR1a, -C(0)NR1AR1b, -C(0)NHNR1AR1b, -OR1a, -NR1AS02R1B,
-NR1AC(0)R1B, -NR1AC(0)OR1B, -NR1AOR1B, -N3, -L'-E1, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0397] R2 is hydrogen, halogen, -CX2 3, -CHX2 2, -CH2X2, -OCXS, -OCH2X2, -OCHX2 2, -CN, -SO„2R2A, -SOV2NR2AR2B, -NHC(0)NR2AR2B, -N(0)m2, -NR2AR2B, -NHNR2AR2B, -C(0)R2A, -C(0)-OR2A, -C(0)NR2AR2B, -C(0)NHNR2AR2B, -OR2A, -NR2ASO2R2B,
-NR2AC(0)R2B, -NR2AC(0)0R2B, -NR2AOR2B, -N3J -L2-E2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0398] R3 is hydrogen, halogen, -CX3 3, -CHX3 2, -CH2X3, -OCXS, -OCH2X3, -OCHXS, -CN, -SO„3R3A, -SOV3NR3AR3B, -NHC(0)NR3AR3B, -N(0)m3, -NR3AR3B, -NHNR3AR3B, -C(0)R3A, -C(0)-OR3A, -C(0)NR3AR3B, -OR3A, -NR3AS02R3B, -NR3AC(0)R3B,
-NR3AC(0)0R3B, -NR3AOR3B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0399] R4 is hydrogen, halogen, -CX4 3, -CHX4 2, -CH2X4, -OCXS, -OCH2X4, -OCHXS, -CN, -SOn4R4A, -SOV4NR4AR4B, -NHC(0)NR4AR4B, -N(0)m4, -NR4AR4B, -NHNR4AR4B, -C(0)R4A, -C(0)-OR4A, -C(0)NR4AR4B, -C(0)NHNR4AR4B, -OR4A, -NR4ASO2R4B,
-NR4AC(0)R4B, -NR4AC(0)0R4B, -NR4AOR4B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl. [0400] R5 is hydrogen, halogen, -CX5 3, -CHX5 2, -CH2X5, -OCX5 3, -OCH2X5, -OCHX5 2, -CN, -SOn5R5A, -SOV5NR5AR5B, -NHC(0)NR5AR5B, -N(0)m5, -NR5AR5B, -NHNR5AR5B, -C(0)R5A, -C(0)-0R5A, -C(0)NR5AR5B, -C(0)NHNR5AR5B, -OR5A, -NR5ASO2R5B,
-NR5AC(0)R5B, -NR5AC(0)0R5B, -NR5AOR5B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0401] R6 is hydrogen, halogen, -CX6 3, -CHX6 2, -OEX6, -OCX6 3, -OOEX6, -OCHX6 2, -CN, -SOn6R6A, -SOV6NR6AR6B, -NHC(0)NR6AR6B, -N(0)m6, -NR6AR6B, -NHNR6AR6B, -C(0)R6A, -C(0)-OR6A, -C(0)NR6AR6B, -C(0)NHNR6AR6B, -OR6A, -NR6ASO2R6B,
-NR6AC(0)R6B, -NR6AC(0)0R6B, -NR6AOR6B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0402] R7 is hydrogen, halogen, -CX7 3, -CHX7 2, -CH2X7, -OCX7 3, -OCH2X7, -OCHX7 2, -CN, -SOnvR7A, -SOVVNR7AR7B, -NHC(0)NR7AR7B, -N(0)mv, -NR7AR7B, -NHNR7AR7B, -C(0)R7A, -C(0)-OR7A, -C(0)NR7AR7B, -C(0)NHNR7AR7B, -OR7A, -NR7ASO2R7B,
-NR7AC(0)R7B, -NR7AC(0)0R7B, -NR7AOR7B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl.
[0403] E1 and E2 are independently an electron- withdrawing moiety.
[0404] Each R1A, R1B, R2A, R2B, R3A, R3B, R4A, R4B, R5A, R5B, R6A, R6B, R7A, and R7B is independently hydrogen, -CX3, -CHX2, -CH2X, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -S02NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH,
-OCX3, -OCHX2, -OCH2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted
heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R1A and R1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2A and R2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R4A and R4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R5A and R5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R6A and R6B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R7A and R7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl.
[0405] ml, m2, m3, m4, m5, m6, and m7 are independently 1 or 2.
[0406] vl, v2, v3, v4, v5, v6, and v7 are independently 1 or 2.
[0407] nl, n2, n3, n4, n5, n6, and n7, are independently an integer from 0 to 4.
[0408] X, X1, X2, X3, X4, X5, X6, and X7 are independently -Cl, -Br, -I or -F.
[0409] L1 and L2 are independently a bond, -0-, -S-, -S(O)-, -S(0)2-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkyl ene, substituted or unsubstituted heteroalkyl ene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
[0410] R1 and R2 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0411] R4 and R5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0412] Wherein the compound is administered at a rate approximately equal to the half-life of an El enzyme.
[0413] In embodiments, the half-life of an El enzyme is about 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half- life of an El enzyme is greater than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half-life of an El enzyme is less than
1, 2, 4, 6, 8, 10, 12, 14, 16 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours.
[0414] In embodiments, the cancer is a human cancer, carcinoma, sarcoma,
adenocarcinoma, lymphoma, or leukemia. In embodiments, the cancer is a solid cancer, lymphoid cancer, kidney, breast, lung, bladder, colon, ovarian, prostate, pancreas, stomach, brain, head and neck, skin, uterine, testicular, glioma, esophagus, or liver cancer. In embodiments, the cancer is hepatocarcinoma or lymphoma. In embodiments, the lymphoma is B-acute lymphoblastic lymphoma, non-Hodgkin’s lymphoma (e.g., Burkitt’s, Small Cell, and Large Cell lymphomas), Hodgkin’s lymphoma, leukemia (e.g., AML, ALL, and CML), or multiple myeloma.
[0415] In embodiments, the compound is covalently attached to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2. In embodiments, at least one of R1 or R2 includes an electron-withdrawing moiety. In embodiments, at least one of R1 or R2 are sufficiently electron withdrawing to allow the compound to covalently bind to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2, wherein the El cysteine amino acid is bound to ring carbon C2 attached to R2 or ring carbon Ci attached to R1. In embodiments, the compound covalently binds to an El cysteine amino acid corresponding to Cys30 of Uba2
subunit 2; and forms a complex of formula:
Figure imgf000145_0001
Figure imgf000145_0002
are as described herein, including in embodiments. [0416] In embodiments, the method includes allowing the compound to covalently bind an El enzyme. In embodiments, the method includes allowing the compound to covalently bind an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2. In embodiments, the method includes allowing the El cysteine amino acid to bind to carbon C2 attached to R2A and R2B or to ring carbon Ci attached to R1A. In embodiments, the method includes allowing the El cysteine amino acid to bind (e.g., covalently bind) to carbon C2 attached to R2A and R2B or to carbon Ci attached to R1A.
[0417] It will be understood that the carbon Ci is adjacent (e.g., bonded) to an R1 or R1A group as appropriate for the specified embodiment. It will be understood that the carbon C2 is adjacent (e.g., bonded) to an R2 or R2A or R2B group as appropriate for the specified embodiment.
V. Methods of Inhibition
[0418] In an aspect is provided a method of inhibiting cell proliferation, the method including contacting the cell with a compound described herein. In embodiments, the method includes contacting the cell with an effective amount of the compound. In embodiments, the compound is administered at a rate approximately equal to the half-life of an El enzyme.
[0419] In embodiments, the half-life of an El enzyme is about 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half- life of an El enzyme is greater than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours. In embodiments, the half-life of an El enzyme is less than 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 34, or 36 hours.
[0420] In an aspect is provided a method of inhibiting an El enzyme, the method including contacting an El enzyme with a compound described herein, thereby inhibiting the El enzyme. In embodiments, the method includes allowing the compound to covalently bind the El enzyme. In embodiments, the method includes allowing the compound to covalently bind an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2. In embodiments, the method includes allowing the El cysteine amino acid to bind to carbon C2 attached to R2A and R2B or to ring carbon Ci attached to R1A. In embodiments, the method includes allowing the El cysteine amino acid to bind (e.g., covalently bind) to carbon C2 attached to R2A and R2B or to carbon Ci attached to R1A. VI. Methods of Screening
[0421] Also provided are methods of identifying ligands (e.g., therapeutic target proteins, druggable hotspots) capable of covalently binding a compound provided herein including embodiments thereof. The methods include combining a ligand and a compound provided herein in a reaction vessel, allowing the ligand and the compound to form a covalent ligand- compound complex, and detecting the covalent ligand-compound complex thereby identifying the ligand as target protein or druggable hotspot. A“reaction vessel” as provided herein refers to a vial, tube, flask, bottle, syringe or other container means, into which the ligand and the compound are combined to allow the formation of a covalent ligand- compound complex. Optionally, one or more of the ligands or compounds are labeled. Optionally, the label is a fluorescent label. Optionally, the compound includes a fluorescent label.
[0422] Provided herein are methods of detecting a ligand capable of covalently binding a compound provided herein including embodiments thereof. The method includes contacting a ligand with a compound provided herein and allowing the compound to covalently bind to the ligand, thereby forming a covalent compound-ligand complex; and detecting the covalent compound-ligand complex by nuclear magnetic resonance (NMR). The ligand may be a protein, for example, any cellular or extracellular protein including without limitation, an enzyme, a structural protein, a cytoplasmic protein and a nuclear protein.
[0423] In one aspect, a method of detecting covalent binding of a ligand to a compound provided herein is provided. The method includes: (i) contacting a ligand with a compound provided herein; (ii) allowing the compound to covalently bind to the ligand, thereby forming a covalent ligand-compound complex; and (iii) detecting the covalent ligand-compound complex using nuclear magnetic resonance, thereby detecting covalent binding of the ligand to the compound. In embodiments, the contacting is performed in a reaction vessel. In embodiments, the ligand is a cysteine bearing polypeptide. In embodiments, the detecting includes determining a chemical shift for an amino acid in the ligand. In embodiments, the detecting includes producing an NMR spectra of the covalent ligand-compound complex and identifying a change in the NMR spectra relative to the absence of the compound. In embodiments, a cysteine residue of the ligand is covalently bound to the compound. A sulfhydryl functional group of a cysteine amino acid of the ligand may form a covalent bond with a compound provided herein including embodiments thereof. Thus, in embodiments, the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an electrophilic moiety (e.g., E1 or E2) of the compound. In embodiments, the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an atom adjacent to an electrophilic moiety (e.g., E1 or E2) of the compound. In embodiments, the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an atom adjacent to L1 or L2 of the compound. In embodiments, the ligand is a Uba2 enzyme and the amino acid corresponds to Cys30 of Uba2 subunit 2.
[0424] Provided herein are methods of detecting a ligand capable of covalently binding a compound provided herein including embodiments thereof. The method includes contacting a ligand with a compound provided herein and allowing the compound to covalently bind to the ligand, thereby forming a covalent compound-ligand complex; and detecting the covalent compound-ligand complex by quantitative mass spectrometry. The ligand may be a protein, for example, any cellular or extracellular protein including without limitation, an enzyme, a structural protein, a cytoplasmic protein and a nuclear protein.
[0425] In another aspect, a method of detecting covalent binding of a ligand to a compound provided herein is provided. The method includes: (i) contacting a ligand with a compound provided herein; (ii) allowing the compound to covalently bind to the ligand, thereby forming a covalent ligand-compound complex; and (iii) detecting the covalent ligand-compound complex using quantitative mass spectrometry, thereby detecting covalent binding of the ligand to the compound. In embodiments, the contacting is performed in a reaction vessel.
In embodiments, the ligand is a cysteine bearing polypeptide. In embodiments, the detecting includes determining a molecular weight for the covalent ligand-compound complex. In embodiments, the detecting includes producing a quantitative mass spectrometry spectrum of the covalent ligand-compound complex and identifying a change in the quantitative mass spectrometry spectrum relative to the absence of the compound. In embodiments, a cysteine residue of the ligand is covalently bound to the compound. A sulfhydryl functional group of a cysteine amino acid of the ligand may form a covalent bond with a compound provided herein including embodiments thereof. Thus, in embodiments, the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an electrophilic moiety (e.g., E1 or E2) of the compound. In embodiments, the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an atom adjacent to an electrophilic moiety (e.g., E1 or E2) of the compound. In embodiments, the covalent bond between the ligand and the compound may be formed by a cysteine of the ligand and an atom adjacent to L1 or L2 of the compound. In embodiments, the ligand is a Uba2 enzyme and the amino acid corresponds to Cys30 of Uba2 subunit 2.
VII. Embodiments
[0426] Embodiment Pl . A method of treating cancer in a subject in need thereof, said method comprising administering to said subject a pharmaceutically acceptable excipient and a therapeutically effective amount of a compound of formula:
Figure imgf000149_0001
wherein: is a single bond or double bond;
L3 is -0-, -S-, -N-,— S(O)-,— S(0)2-, -C(O)— , -N(R7)-, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene;
R1 is hydrogen, halogen, -CX3 3, -CHX^, -CH2X1, -OCX , -OCH2X1, -OCHXS, -CN, -SOniR1A, -SOVINR1AR1b, -NHC(0)NR1AR1b, -N(0)mi, -NR1AR1B, -NHNR1AR1B, -C(0)R1A, -C(0)-OR1A, -C(0)NR1AR1b, -C(0)NHNR1AR1b, -OR1a, -NR1AS02R1B, -NR1AC(0)R1b,
-NR1AC(0)OR1B, -NR1AOR1B, -N3, -L'-E1, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R2 is hydrogen, halogen, -CX2 3, -CHX2 2, -CH2X2, -OCX2 3, -OCH2X2, -OCHX2 2, -CN, -SO„2R2A, -SOV2NR2AR2B, -NHC(0)NR2AR2B, -N(0)m2, -NR2AR2B, -NHNR2AR2B, -C(0)R2A,
-C(0)-OR2A, -C(0)NR2AR2B, -C(0)NHNR2AR2B, -OR2A, -NR2AS02R2B, -NR2AC(0)R2B, -NR2AC(0)0R2B, -NR2AOR2B, -N3, -L2-E2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R3 is hydrogen, halogen, -CX3 3, -CHX3 2, -CH2X3, -OCX3 3, -OCH2X3, -OCHX3 2, -CN, -SO„R3A, -SOV3NR3AR3B, -NHC(0)NR3AR3B, -N(0)m3, -NR3AR3B, -NHNR3AR3B, -C(0)R3A, -C(0)-0R3A, -C(0)NR3AR3B, -OR3A, -NR3AS02R3B, -NR3AC(0)R3B, -NR3AC(0)0R3B, -NR3AOR3B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R4 is hydrogen, halogen, -CX4 3, -CHX4 2, -CH2X4, -OCX4 3, -OCH2X4, -OCHX4 2, -CN, -SOn4R4A, -SOV4NR4AR4B, -NHC(0)NR4AR4B, -N(0)m4, -NR4AR4B, -NHNR4AR4B, -C(0)R4A, -C(0)-OR4A, -C(0)NR4AR4B, -C(0)NHNR4AR4B, -OR4A, -NR4AS02R4B, -NR4AC(0)R4B, -NR4AC(0)0R4B, -NR4AOR4B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R5 is hydrogen, halogen, -CX5 3, -CHX5 2, -CH2X5, -OCX5 3, -OCH2X5, -OCHX5 2, -CN, -SOn5R5A, -SOV5NR5AR5B, -NHC(0)NR5AR5B, -N(0)m5, -NR5AR5B, -NHNR5AR5B, -C(0)R5A, -C(0)-OR5A, -C(0)NR5AR5B, -C(0)NHNR5AR5B, -OR5A, -NR5AS02R5B, -NR5AC(0)R5B, -NR5AC(0)0R5B, -NR5AOR5B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R6 is hydrogen, halogen, -CX6 3, -CHX6 2, -CH2X6, -OCX6 3, -OCH2X6, -OCHX6 2, -CN, -SOn6R6A, -SOV6NR6AR6B, -NHC(0)NR6AR6B, -N(0)m6, -NR6AR6B, -NHNR6AR6B, -C(0)R6A, -C(0)-OR6A, -C(0)NR6AR6B, -C(0)NHNR6AR6B, -OR6A, -NR6AS02R6B, -NR6AC(0)R6B, -NR6AC(0)0R6B, -NR6AOR6B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R7 is hydrogen, halogen, -CX7 3, -CHX7 2, -CH2X7, -OCX7 3, -OCH2X7, -OCHX7 2, -CN, -SOnvR7A, -SOVVNR7AR7B, -NHC(0)NR7AR7B, -N(0)mv, -NR7AR7B, -NHNR7AR7B, -C(0)R7A, -C(0)-OR7A, -C(0)NR7AR7B, -C(0)NHNR7AR7B, -OR7A, -NR7AS02R7B, -NR7AC(0)R7B, -NR7AC(0)0R7B, -NR7AOR7B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
E1 and E2 are independently an electron-withdrawing moiety; Each R1A, R1b, R2A, R2B, R3A, R3B, R4A, R4B, R5A, R5B, R6A, R6B, R7A, and R7B is independently hydrogen, -CX3, -CHX2, -CH2X, -C(0)0H, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX3, -OCHX2, -OCH2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted
heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R1A and R1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2A and R2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R4A and R4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R5A and R5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R6A and R6B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R7A and R7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; ml, m2, m3, m4, m5, m6, and m7 are independently 1 or 2; vl, v2, v3, v4, v5, v6, and v7 are independently 1 or 2; nl, n2, n3, n4, n5, n6, and n7, are independently an integer from 0 to 4;
X, X1, X2, X3, X4, X5, X6, and X7 are independently -Cl, -Br, -I or -F;
L1 and L2 are independently a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkyl ene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted aryl ene, or substituted or unsubstituted heteroarylene;
R1 and R2 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R4 and R5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; and wherein said compound is administered at a rate approximately equal to the half-life of an El enzyme.
[0427] Embodiment P2. The method of embodiment Pl, wherein said compound is covalently attached to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2.
[0428] Embodiment P3. The method of one of embodiments Pl to P2, wherein at least one of R1 or R2 comprises an electron-withdrawing moiety. [0429] Embodiment P4. The method of one of embodiments Pl to P3, wherein at least one of R1 or R2 are sufficiently electron withdrawing to allow said compound to covalently bind to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2, wherein said El cysteine amino acid is bound to ring carbon C2 attached to R2 or ring carbon Ci attached to R1. [0430] Embodiment P5. The method of one of embodiments Pl to P3, wherein said compound covalently binds to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2; and forms a complex of formula:
Figure imgf000152_0001
[0431] Embodiment P6. A compound of Formula
Figure imgf000153_0001
wherein:
L3 is -0-, -S-, or -N(R7)-; V is -O- or -N(R10)-;
R1A is hydrogen, halogen, -CX1A 3, -CHX1A 2, -CH2X1A, -OCX1A 3, -OCH2X1A, -OCHX1A 2,
-CN, -SOniAR1AA, -SOVIANR1AAR1ab, -NHC(0)NR1AAR1AB, -N(0)miA, -NR1AAR1AB,
-NHNR1AAR1AB, -C(0)R1aa, -C(0)-0R1aa, -C(0)NR1AAR1AB, -OR1aa, -NR1AAS02R1AB, -NR1AAC(0)R1AB, -NR1AAC(0)0R1AB, -NR1AAOR1AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl; R2A is hydrogen, halogen, -CX2A 3, -CHX2A 2, -CH2X2A, -OCX2A 3, -OCH2X2A, -OCHX2A 2,
-CN, -SO„2AR2AA, -SOV2ANR2AAR2AB, -NHC(0)NR2AAR2AB, -N(0)m2A, -NR2AAR2AB,
-NHNR2AAR2AB, -C(0)R2AA, -C(0)-0R2AA, -C(0)NR2AAR2AB, -OR2AA, -NR2AASO2R2AB, -NR2AAC(0)R2AB, -NR2AAC(0)0R2AB, -NR2AAOR2AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl;
R2B is hydrogen, halogen, -CX2B 3, -CHX2B 2, -CH2X2B, -OCX2B 3, -OCH2X2B, -OCHX2B 2,
-CN, -SO„2BR2BA, -SOV2BNR2BAR2BB, -NHC(0)NR2BAR2BB, -N(0)m2B, -NR2BAR2BB,
-NHNR2BAR2BB, -C(0)R2BA, -C(0)-OR2BA, -C(0)NR2BAR2BB, -OR2BA, -NR2BASO2R2BB, -NR2BAC(0)R2BB, -NR2BAC(0)0R2BB, -NR2BAOR2BB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl;
R3 is hydrogen, halogen, -CX3 3, -CHX3 2, -CH2X3, -OCX3 3, -OCH2X3, -OCHX3 2, -CN, -SO„R3A, -SOV3NR3AR3B, -NHC(0)NR3AR3B, -N(0)m3, -NR3AR3B, -NHNR3AR3B, -C(0)R3A, -C(0)-OR3A, -C(0)NR3AR3B, -OR3A, -NR3AS02R3B, -NR3AC(0)R3B, -NR3AC(0)0R3B, -NR3AOR3B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R4 is hydrogen, halogen, -CX4 3, -CHX4 2, -CH2X4, -OCX4 3, -OCH2X4, -OCHX4 2, -CN, -SOn4R4A, -SOV4NR4AR4B, -NHC(0)NR4AR4B, -N(0)m4, -NR4AR4B, -NHNR4AR4B, -C(0)R4A, -C(0)-OR4A, -C(0)NR4AR4B, -C(0)NHNR4AR4B, -OR4A, -NR4AS02R4B, -NR4AC(0)R4B, -NR4AC(0)0R4B, -NR4AOR4B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R5 is hydrogen, halogen, -CX5 3, -CHX5 2, -CH2X5, -OCX5 3, -OCH2X5, -OCHX5 2, -CN, -SOn5R5A, -SOV5NR5AR5B, -NHC(0)NR5AR5B, -N(0)m5, -NR5AR5B, -NHNR5AR5B, -C(0)R5A, -C(0)-OR5A, -C(0)NR5AR5B, -C(0)NHNR5AR5B, -OR5A, -NR5AS02R5B, -NR5AC(0)R5B, -NR5AC(0)0R5B, -NR5AOR5B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R7 is hydrogen, halogen, -CX7 3, -CHX7 2, -CH2X7, -OCX7 3, -OCH2X7, -OCHX7 2, -CN, -SOn5R7A, -SOV5NR7AR7B, -NHC(0)NR7AR7B, -N(0)m5, -NR7AR7B, -NHNR7AR7B, -C(0)R7A, -C(0)-OR7A, -C(0)NR7AR7B, -C(0)NHNR7AR7B, -OR7A, -NR7AS02R7B, -NR7AC(0)R7B, -NR7AC(0)0R7B, -NR7AOR7B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R8 is hydrogen, halogen, -CX8 3, -CHX8 2, -CH2X8, -OCX8 3, -OCH2X8, -OCHX8 2, -CN, -SOn5R8A, -SOV5NR8AR8B, -NHC(0)NR8AR8B, -N(0)m5, -NR8AR8B, -NHNR8AR8B, -C(0)R8A, -C(0)-OR8A, -C(0)NR8AR8B, -C(0)NHNR8AR8B, -OR8A, -NR8AS02R8B, -NR8AC(0)R8B, -NR8AC(0)0R8B, -NR8AOR8B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R9 is hydrogen, halogen, -CX9 3, -CHX9 2, -CH2X9, -OCX9 3, -OCH2X9, -OCHX9 2, -CN, -SOn5R9A, -SOV5NR9AR9B, -NHC(0)NR9AR9B, -N(0)m5, -NR9AR9B, -NHNR9AR9B, -C(0)R9A, -C(0)-OR9A, -C(0)NR9AR9B, -C(0)NHNR9AR9B, -OR9A, -NR9AS02R9B, -NR9AC(0)R9B, -NR9AC(0)0R9B, -NR9AOR9B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R10 is hydrogen, halogen, -CX10 3, -CHX10 2, -CH2X10, -OCX10 3, -OCH2X10, -OCHX10 2, -CN, -SOnioR10A, -SOvioNR10AR10B, -NHC(O)NR10AR10B, -N(0)mio, -NR10AR10B, -NHNR10AR10B, -C(O)R10A, -C(O)-OR10A, -C(O)NR10AR10B, -C(O)NHNR10AR10B, -OR10A, -NR10ASO2R10B, -NR10AC(O)R10B, -NR10AC(O)OR10B, -NR10AOR10B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl;
E ich R1AA RlAB J^2AA J^2AB J^2BA J^2BB R^A R^B R4A R4B R^A R^B R^A R^B J^8A J^8B
R9A, R9B, R10a, and R10B is independently hydrogen, -CX3, -CHX2, -CH2X, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -SO3H, -SO4H, -SO2NH2,
-NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)0H, -NHOH, -OCX3, -OCHX2, -OCH2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R1AA and R1AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2AA and R2AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2BA and R2BB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R3A and R3B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R4A and R4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R5A and R5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R7A and R7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R10A and R10B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; ml A, m2A, m2B, m3, m4, m5, m7, m8, m9, and mlO are independently 1 or 2; vl A, v2A, v2B, v3, v4, v5, v7 ,v8, v9, and vlO are independently 1 or 2; nl A, n2A, n2B, n3, n4, n5, n7, n8, n9, and nlO are independently an integer from 0 to 4;
X, X1A, X2A, X2B, X3, X4, X5, X7, X8, X9, and X10 are independently -Cl, -Br, -I or, -F;
L6 is substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene;
L8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl ene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene;
L9 is a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-,
-NHC(0)NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl ene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene; wherein R2A and R2B may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; and. R4 and R5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0432] Embodiment P7. The compound of embodiment P6, having the formula:
Figure imgf000157_0001
[0433] Embodiment P8. The compound of one of embodiments P6 to P7, wherein R4 is hydrogen.
[0434] Embodiment P9. The compound of one of embodiments P6 to P7, wherein R5 is hydrogen.
[0435] Embodiment P 10. The compound of one of embodiments P6 to P7, having the formula:
Figure imgf000158_0001
[0436] Embodiment Pl 1. The compound of one of embodiments P6 to P10, wherein R8 is substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. [0437] Embodiment P12. The compound of one of embodiments P6 to P10, wherein R8 is substituted or unsubstituted aryl or substituted or unsubstituted heteroaryl.
[0438] Embodiment P13. The compound of one of embodiments P6 to P10, wherein R8 is substituted or unsubstituted phenyl or substituted or unsubstituted 5 to 6 membered heteroaryl. [0439] Embodiment P14. The compound of one of embodiments P6 to P 10, wherein R8 is substituted or unsubstituted phenyl.
[0440] Embodiment Pl 5. The compound of one of embodiments P6 to P7, having the formula:
Figure imgf000159_0001
R41 is independently halogen, -CX41 3, -CHX41 2, -CH2X41, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -COME, -N02, -SH, -S03H, -S04H, -S02NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)OH, -NHOH, -OCX41 3, -OCHX41 2, -OCH2X41, -OPh, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; two adjacent R41 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or sub stituted or unsub stituted heteroaryl ; z4l is an integer from 0 to 5;
X41 is independently -Cl, -Br, -I or, -F.
[0441] Embodiment P 16. The compound of embodiment P15, wherein R41 is
independently halogen or -OPh. [0442] Embodiment P 17. The compound of one of embodiments P15 to P16, wherein z4l is 2.
[0443] Embodiment P 18. The compound of one of embodiments P15 to P16, wherein z4l is 1. [0444] Embodiment P 19. The compound of one of embodiments P15 to P16, wherein z4l is 0.
[0445] Embodiment P20. The compound of one of embodiments P6 to P19, wherein L9 is a bond or substituted or unsubstituted alkyl ene. [0446] Embodiment P21. The compound of one of embodiments P6 to P19, wherein L9 is a bond or unsubstituted C1-C3 alkylene.
[0447] Embodiment P22. The compound of one of embodiments P6 to P19, wherein L9 is an unsubstituted methylene.
[0448] Embodiment P23. The compound of one of embodiments P6 to P19, wherein L9 is a bond.
[0449] Embodiment P24. The compound of one of embodiments P6 to P23, wherein R9 is substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. [0450] Embodiment P25. The compound of one of embodiments P6 to P23, wherein R9 is unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.
[0451] Embodiment P26. The compound of one of embodiments P6 to P23, wherein R9 is unsubstituted Ci-C6 alkyl, unsubstituted 2 to 6 membered heteroalkyl, unsubstituted C3-C6 cycloalkyl, unsubstituted 3 to 6 membered heterocycloalkyl, unsubstituted phenyl, or unsubstituted 5 to 6 membered heteroaryl.
[0452] Embodiment P27. The compound of one of embodiments P6 to P23, wherein R9 is unsubstituted propyl, unsubstituted butyl, unsubstituted pentyl, unsubstituted propenyl, unsubstituted butenyl, unsubstituted pentenyl, unsubstituted propynyl, unsubstituted butynyl, unsubstituted pentynyl, unsubstituted cyclobutyl, unsubstituted cyclopentyl, unsubstituted tetrahydropyranyl, unsubstituted morpholinyl, or unsubstituted phenyl.
[0453] Embodiment P28. The compound of one of embodiments P6 to P23, wherein R9 is unsubstituted phenyl. [0454] Embodiment P29. The compound of one of embodiments P6 to P28, wherein R2A is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0455] Embodiment P30. The compound of one of embodiments P6 to P28, wherein R2A is hydrogen, substituted or unsubstituted Ci-C6 alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl, substituted or unsubstituted C3-C6 cycloalkyl, substituted or unsubstituted 3 to 6 membered heterocycloalkyl, substituted or unsubstituted C3-C6 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl.
[0456] Embodiment P31. The compound of one of embodiments P6 to P28, wherein R2A is hydrogen.
[0457] Embodiment P32. The compound of one of embodiments P6 to P31, wherein R2B is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0458] Embodiment P33. The compound of one of embodiments P6 to P31, wherein R2B is hydrogen, substituted or unsubstituted Ci-C6 alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl, substituted or unsubstituted C3-C6 cycloalkyl, substituted or unsubstituted 3 to 6 membered heterocycloalkyl, substituted or unsubstituted C3-C6 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl.
[0459] Embodiment P34. The compound of one of embodiments P6 to P31, wherein R2B is hydrogen.
[0460] Embodiment P35. The compound of one of embodiments P6 to P28, wherein R2A and R2B are joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl.
[0461] Embodiment P36. The compound of one of embodiments P6 to P28, wherein R2A and R2B are joined to form a substituted or unsubstituted heterocycloalkyl.
[0462] Embodiment P37. The compound of one of embodiments P6 to P28, wherein R2A and R2B are joined to form a substituted or unsubstituted 4 to 6 membered heterocycloalkyl. [0463] Embodiment P38. The compound of one of embodiments P6 to P37, wherein R1A is hydrogen, -CX1A 3, -CHX1A 2, -CH2X1A, -OCX1A 3, -OCH2X1A, -OCHX1A 2, -C(0)R1AA, -C(0)0R1AA, -C(0)NR1AAR1AB, -OR1aa, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0464] Embodiment P39. The compound of one of embodiments P6 to P37, wherein R1A is hydrogen, -CX1A 3, -CHX1A 2, -CH2X1A, unsubstituted Ci-C3 alkyl.
[0465] Embodiment P40. The compound of one of embodiments P6 to P37, wherein R1A is unsubstituted Ci-C3 alkyl. [0466] Embodiment P41. The compound of one of embodiments P6 to P37, wherein R1A is hydrogen.
[0467] Embodiment P42. The compound of one of embodiments P6 to P41, wherein R3 is hydrogen, -CX3 3, -CHX3 2, -CH2X3, substituted or unsubstituted alkyl.
[0468] Embodiment P43. The compound of one of embodiments P6 to P41, wherein R3 is -CH2OH or -CEE.
[0469] Embodiment P44. The compound of one of embodiments P6 to P41, wherein R3 is hydrogen.
[0470] Embodiment P45. A method of inhibiting an El enzyme, said method comprising contacting an El enzyme with a compound of one of embodiments P6 to P44, thereby inhibiting said El enzyme.
[0471] Embodiment P46. The method of embodiment P45, wherein said method comprises allowing said compound to covalently bind said El enzyme.
[0472] Embodiment P47. The method of embodiment P45 or P46, wherein said method comprises allowing said compound to covalently bind an El cysteine amino acid
corresponding to Cys30 of Uba2 subunit 2.
[0473] Embodiment P48. The method of embodiment P47, wherein said method comprises allowing said El cysteine amino acid to bind to carbon C2 attached to R2Aand R2B or to ring carbon Ci attached to R1A. [0474] Embodiment P49. A method of treating cancer in a subject in need thereof, said method comprising administering to said subject a compound of one of embodiments P6 to P44.
[0475] Embodiment P50. The method of embodiment P49, wherein said method comprises allowing said compound to covalently bind an El enzyme.
[0476] Embodiment P51. The method of embodiment P49 or P50, wherein said method comprises allowing said compound to covalently bind an El cysteine amino acid
corresponding to Cys30 of Uba2 subunit 2.
[0477] Embodiment P52. The method of embodiment P51, wherein said method comprises allowing said El cysteine amino acid to bind to carbon C2 attached to R2A and R2B or to ring carbon Ci attached to R1A.
VIII. Additional embodiments
[0478] Embodiment 1. A method of treating cancer in a subject in need thereof, said method comprising administering to said subject a pharmaceutically acceptable excipient and a therapeutically effective amount of a compound of formula:
Figure imgf000163_0001
wherein: is a single bond or double bond;
L3 is -0-, -S-, -N-,— S(O)-, -S(0)2-, -C(O)— , -N(R7)-, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene;
R1 is hydrogen, halogen, -CX -CUX -CU2X -OCX , -OCH2X1,
-OCHX , -CN, -SOniR1A, -SOVINR1AR1b, -NHC(0)NR1AR1B, -N(0)mi, -NR1AR1B,
-NHNR1AR1B, -C(0)R1a, -C(0)-OR1a, -C(0)NR1AR1b, -C(0)NHNR1AR1b, -OR1a,
-NR1AS02R1B, -NR1AC(0)R1b, -NR1AC(0)OR1B, -NR1AOR1B, -N3, -L'-E1, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R2 is hydrogen, halogen, -CX2 3, -CHX2 2, -CH2X2, -OCX2 3, -OCH2X2,
-OCHX2 2, -CN, -SO„2R2A, -SOV2NR2AR2B, -NHC(0)NR2AR2B, -N(0)m2, -NR2AR2B,
-NHNR2AR2B, -C(0)R2A, -C(0)-OR2A, -C(0)NR2AR2B, -C(0)NHNR2AR2B, -OR2A,
-NR2AS02R2B, -NR2AC(0)R2B, -NR2AC(0)0R2B, -NR2AOR2B, -N3, -L2-E2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R3 is hydrogen, halogen, -CX3 3, -CHX3 2, -CH2X3, -OCX3 3, -OCH2X3,
-OCHX3 2, -CN, -SOn3R3A, -SOV3NR3AR3B, -NHC(0)NR3AR3B, -N(0)m3, -NR3AR3B,
-NHNR3AR3B, -C(0)R3A, -C(0)-OR3A, -C(0)NR3AR3B, -OR3A, -NR3ASO2R3B,
-NR3AC(0)R3B, -NR3AC(0)0R3B, -NR3AOR3B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl;
R4 is hydrogen, halogen, -CX4 3, -CHX4 2, -CH2X4, -OCX4 3, -OCH2X4,
-OCHX4 2, -CN, -SOn4R4A, -SOV4NR4AR4B, -NHC(0)NR4AR4B, -N(0)m4, -NR4AR4B,
-NHNR4AR4B, -C(0)R4A, -C(0)-OR4A, -C(0)NR4AR4B, -C(0)NHNR4AR4B, -OR4A,
-NR4AS02R4B, -NR4AC(0)R4B, -NR4AC(0)0R4B, -NR4AOR4B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R5 is hydrogen, halogen, -CX5 3, -CHX5 2, -CH2X5, -OCX5 3, -OCH2X5,
-OCHX5 2, -CN, -SOn5R5A, -SOV5NR5AR5B, -NHC(0)NR5AR5B, -N(0)m5, -NR5AR5B,
-NHNR5AR5B, -C(0)R5A, -C(0)-OR5A, -C(0)NR5AR5B, -C(0)NHNR5AR5B, -OR5A,
-NR5AS02R5B, -NR5AC(0)R5B, -NR5AC(0)0R5B, -NR5AOR5B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R6 is hydrogen, halogen, -CX -CHX6!, -CH2X6, -OCX6 3, -OCH2X6,
-OCHX62, -CN, -SOn6R6A, -SOV6NR6AR6B, -NHC(0)NR6AR6B, -N(0)m6, -NR6AR6B,
-NHNR6AR6B, -C(0)R6A, -C(0)-0R6A, -C(0)NR6AR6B, -C(0)NHNR6AR6B, -OR6A,
-NR6AS02R6B, -NR6AC(0)R6B, -NR6AC(0)0R6B, -NR6AOR6B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R7 is hydrogen, halogen, -CX -CHX7 2, -CH2X7, -OCX7 3, -OCH2X7,
-OCHX72, -CN, -SOnvR7A, -SOVVNR7AR7B, -NHC(0)NR7AR7B, -N(0)mv, -NR7AR7B,
-NHNR7AR7B, -C(0)R7A, -C(0)-OR7A, -C(0)NR7AR7B, -C(0)NHNR7AR7B, -OR7A,
-NR7AS02R7B, -NR7AC(0)R7B, -NR7AC(0)0R7B, -NR7AOR7B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
E1 and E2 are independently an electron-withdrawing moiety; each R1A, R1b, R2A, R2B, R3A, R3B, R4A, R4B, R5A, R5B, R6A, R6B, R7A, and R7B is independently hydrogen, -CX3, -CHX2, -CH2X, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2,
-COOH, -CONH2, -NO2, -SH, -S03H, -SO4H, -SO2NH2, -NHNH2, -ONH2,
-NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)OH, -NHOH,
-OCX3, -OCHX2, -OCH2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted
heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R1A and R1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2A and R2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R4A and R4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R5A and R5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R6A and R6B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R7A and R7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; ml, m2, m3, m4, m5, m6, and m7 are independently 1 or 2; vl, v2, v3, v4, v5, v6, and v7 are independently 1 or 2; nl, n2, n3, n4, n5, n6, and n7 are independently an integer from 0 to 4;
X, X1, X2, X3, X4, X5, X6, and X7 are independently -Cl, -Br, -I, or -F;
L1 and L2 are independently a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-,
-C(0)NH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene;
R1 and R2 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R4 and R5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; and wherein said compound is administered at a rate approximately equal to the half-life of an El enzyme.
[0479] Embodiment 2. The method of embodiment 1, wherein said compound is covalently attached to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2.
[0480] Embodiment 3. The method of one of embodiments 1 to 2, wherein at least one of R1 or R2 comprises an electron-withdrawing moiety.
[0481] Embodiment 4. The method of one of embodiments 1 to 3, wherein at least one of R1 or R2 are sufficiently electron withdrawing to allow said compound to covalently bind to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2, wherein said El cysteine amino acid is bound to ring carbon C2 attached to R2 or ring carbon Ci attached to R1. [0482] Embodiment 5. The method of one of embodiments 1 to 3, wherein said compound covalently binds to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2; and forms a complex of formula:
Figure imgf000167_0001
[0483] Embodiment 6. A compound of formula:
Figure imgf000167_0002
wherein L3 is -0-, -S-, or -N(R7)-;
V is -O- or -N(R10)-;
R1A is hydrogen, halogen, -CX1A 3, -CHX1A 2, -CH2X1A, -OCX1A 3, -OCH2X1A,
-OCHX1A 2, -CN, -SOniAR1AA, -SOVIANR1AAR1ab, -NHC(0)NR1AAR1AB, -N(0)miA,
-NR1AAR1AB, -NHNR1AAR1AB, -C(0)R1aa, -C(0)-OR1aa, -C(0)NR1AAR1AB, -OR1aa,
-NR1AAS02R1AB, -NR1AAC(0)R1AB, -NR1AAC(0)OR1AB, -NR1AAOR1AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R2A is hydrogen, halogen, -CX2A 3, -CHX2A 2, -CH2X2A, -OCX2A 3, -OCH2X2A,
-OCHX2A 2, -CN, -SOn2AR2AA, -SOV2ANR2AAR2AB, -NHC(0)NR2AAR2AB, -N(0)m2A,
-NR2AAR2AB, -NHNR2AAR2AB, -C(0)R2AA, -C(0)-OR2AA, -C(0)NR2AAR2AB, -OR2AA,
-NR2AAS02R2AB, -NR2AAC(0)R2AB, -NR2AAC(0)0R2AB, -NR2AAOR2AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R2B is hydrogen, halogen, -CX2B 3, -CHX2B 2, -CH2X2B, -OCX2B 3, -OCH2X2B,
-OCHX2B 2, -CN, -SO„2BR2BA, -SOV2BNR2BAR2BB, -NHC(0)NR2BAR2BB, -N(0)m2B,
-NR2BAR2BB, -NHNR2BAR2BB, -C(0)R2BA, -C(0)-OR2BA, -C(0)NR2BAR2BB, -OR2BA,
-NR2BAS02R2BB, -NR2BAC(0)R2BB, -NR2BAC(0)0R2BB, -NR2BAOR2BB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R3 is hydrogen, halogen, -CX3 3, -CHX3 2, -CH2X3, -OCX3 3, -OCH2X3,
-OCHX3 2, -CN, -SOn3R3A, -SOV3NR3AR3B, -NHC(0)NR3AR3B, -N(0)m3, -NR3AR3B,
-NHNR3AR3B, -C(0)R3A, -C(0)-OR3A, -C(0)NR3AR3B, -OR3A, -NR3ASO2R3B,
-NR3AC(0)R3B, -NR3AC(0)0R3B, -NR3AOR3B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl; R4 is hydrogen, halogen, -CX4 3, -CHX4 2, -CH2X4, -OCX4 3, -OCH2X4,
-OCHX4 2, -CN, -SOn4R4A, -SOv4NR4AR4B, -NHC(0)NR4AR4B, -N(0)m4, -NR4AR4B,
-NHNR4AR4B, -C(0)R4A, -C(0)-0R4A, -C(0)NR4AR4B, -C(0)NHNR4AR4B, -OR4A,
-NR4AS02R4B, -NR4AC(0)R4B, -NR4AC(0)0R4B, -NR4AOR4B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R5 is hydrogen, halogen, -CX5 3, -CHX5 2, -CH2X5, -OCX5 3, -OCH2X5,
-OCHX5 2, -CN, -SOn5R5A, -SOV5NR5AR5B, -NHC(0)NR5AR5B, -N(0)m5, -NR5AR5B,
-NHNR5AR5B, -C(0)R5A, -C(0)-OR5A, -C(0)NR5AR5B, -C(0)NHNR5AR5B, -OR5A,
-NR5AS02R5B, -NR5AC(0)R5B, -NR5AC(0)0R5B, -NR5AOR5B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R7 is hydrogen, halogen, -CX7 3, -CHX7 2, -CH2X7, -OCX7 3, -OCH2X7,
-OCHX7 2, -CN, -SOn5R7A, -SOV5NR7AR7B, -NHC(0)NR7AR7B, -N(0)m5, -NR7AR7B,
-NHNR7AR7B, -C(0)R7A, -C(0)-OR7A, -C(0)NR7AR7B, -C(0)NHNR7AR7B, -OR7A,
-NR7AS02R7B, -NR7AC(0)R7B, -NR7AC(0)0R7B, -NR7AOR7B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R8 is hydrogen, halogen, -CX8 3, -CHX8 2, -CH2X8, -OCX8 3, -OCH2X8,
-OCHX8 2, -CN, -SOn5R8A, -SOV5NR8AR8B, -NHC(0)NR8AR8B, -N(0)m5, -NR8AR8B,
-NHNR8AR8B, -C(0)R8A, -C(0)-OR8A, -C(0)NR8AR8B, -C(0)NHNR8AR8B, -OR8A,
-NR8AS02R8B, -NR8AC(0)R8B, -NR8AC(0)0R8B, -NR8AOR8B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R9 is hydrogen, halogen, -CX9 3, -CHX9 2, -CH2X9, -OCX9 3, -OCH2X9,
-OCHX9 2, -CN, -SOn5R9A, -SOV5NR9AR9B, -NHC(0)NR9AR9B, -N(0)m5, -NR9AR9B,
-NHNR9AR9B, -C(0)R9A, -C(0)-OR9A, -C(0)NR9AR9B, -C(0)NHNR9AR9B, -OR9A,
-NR9AS02R9B, -NR9AC(0)R9B, -NR9AC(0)0R9B, -NR9AOR9B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R10 is hydrogen, halogen, -CX10 3, -CHX10 2, -CH2X10, -OCX10 3, -OCH2X10,
-OCHX10 2, -CN, -SOnioR10A, -SOvioNR10AR10B, -NHC(O)NR10AR10B, -N(0)mio, -NR10AR10B, -NHNR10AR10B, -C(O)R10A, -C(O)-OR10A, -C(O)NR10AR10B, -C(O)NHNR10AR10B, -OR10A, -NR10ASO2R10B, -NR10AC(O)R10B, -NR10AC(O)OR10B, -NR10AOR10B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
each R1AA R4AB R2AA R2AB r2BA r2BB r3 A r3B R4A R4B p^5A p^5B RVA R7B R8A R8B
R9A, R9B, R10a, and R10B is independently hydrogen, -CX3, -CHX2, -CH2X,
-C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -S03H, -S04H,
-S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)0H, -NHOH, -OCX3, -OCHX2, -OCH2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl; R1AA and R1AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2AA and R2AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2BA and R2BB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R3A and R3B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R4A and R4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R5A and R5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R7A and R7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R10A and R10B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; ml A, m2A, m2B, m3, m4, m5, m7, m8, m9, and mlO are independently 1 or 2; vl A, v2A, v2B, v3, v4, v5, v7, v8, v9, and vlO are independently 1 or 2; nl A, n2A, n2B, n3, n4, n5, n7, n8, n9, and nlO are independently an integer from 0 to 4;
X, X1A, X2A, X2B, X3, X4, X5, X7, X8, X9, and X10 are independently -Cl, -Br, -I, or -F;
L6 is substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene;
L8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene;
L9 is a bond, -0-, -S-, -NH-, -C(0)-, -C(0)0-, -C(0)NH-, -OC(O)-,
-NHC(O)-, -NHC(0)NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene; wherein R2A and R2B may optionally be joined to form a substituted or unsubstituted heterocycloalkyl, or substituted or unsubstituted heteroaryl; and
R4 and R5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0484] Embodiment 7. The compound of embodiment6, having the formula:
Figure imgf000172_0001
R8 R9 (Ilia) or R8 9 (Va).
[0485] Embodiment 8. The compound of one of embodiments 6 to 7, wherein R4 is hydrogen.
[0486] Embodiment 9. The compound of one of embodiments 6 to 7, wherein R5 is hydrogen.
[0487] Embodiment 10. The compound of one of embodiments 6 to 7, having the formula:
Figure imgf000172_0002
[0488] Embodiment 11. The compound of one of embodiments 6 to 10, wherein R8 is substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0489] Embodiment 12. The compound of one of embodiments 6 to 10, wherein R8 is substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. [0490] Embodiment 13. The compound of one of embodiments 6 to 10, wherein R8 is substituted or unsubstituted phenyl, or substituted or unsubstituted 5 to 6 membered heteroaryl.
[0491] Embodiment 14. The compound of one of embodiments 6 to 10, wherein R8 is substituted or unsubstituted phenyl.
[0492] Embodiment 15. The compound of one of embodiments 6 to 7, having the formula:
Figure imgf000173_0001
R41 is independently halogen, -CX41 3, -CHX41 2, -CH2X41, -C(0)OH,
-C(0)NH2, -CN, -OH, -NH2, -COOH, -COME, -N02, -SH, -S03H, -S04H, -S02ME,
-MIME, -OME, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-MTC(0)OH, -NHOH, -OCX41 3, -OCHX41 2, -OCH2X41, -OPh, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; two adjacent R41 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; z4l is an integer from 0 to 5; and X41 is independently -Cl, -Br, -I, or -F. [0493] Embodiment 16. The compound of embodiment 15, wherein R41 is independently halogen or -OPh.
[0494] Embodiment 17. The compound of one of embodiments 15 to 16, wherein z4l is 2 [0495] Embodiment 18. The compound of one of embodiments 15 to 16, wherein z4l is
1
[0496] Embodiment 19. The compound of one of embodiments 15 to 16, wherein z4l is 0
[0497] Embodiment 20. The compound of one of embodiments 6 to 19, wherein L9 is a bond, or substituted or unsubstituted alkyl ene.
[0498] Embodiment 21. The compound of one of embodiments 6 to 19, wherein L9 is a bond or unsubstituted C1-C3 alkyl ene.
[0499] Embodiment 22. The compound of one of embodiments 6 to 19, wherein L9 is an unsubstituted methylene. [0500] Embodiment 23. The compound of one of embodiments 6 to 19, wherein L9 is a bond.
[0501] Embodiment 24. The compound of one of embodiments 6 to 23, wherein R9 is substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0502] Embodiment 25. The compound of one of embodiments 6 to 23, wherein R9 is unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.
[0503] Embodiment 26. The compound of one of embodiments 6 to 23, wherein R9 is unsubstituted Ci-C6 alkyl, unsubstituted 2 to 6 membered heteroalkyl, unsubstituted C3-C6 cycloalkyl, unsubstituted 3 to 6 membered heterocycloalkyl, unsubstituted phenyl, or unsubstituted 5 to 6 membered heteroaryl.
[0504] Embodiment 27. The compound of one of embodiments 6 to 23, wherein R9 is unsubstituted propyl, unsubstituted butyl, unsubstituted pentyl, unsubstituted propenyl, unsubstituted butenyl, unsubstituted pentenyl, unsubstituted propynyl, unsubstituted butynyl, unsubstituted pentynyl, unsubstituted cyclobutyl, unsubstituted cyclopentyl, unsubstituted tetrahydropyranyl, unsubstituted morpholinyl, or unsubstituted phenyl.
[0505] Embodiment 28. The compound of one of embodiments 6 to 23, wherein R9 is unsubstituted phenyl.
[0506] Embodiment 29. The compound of one of embodiments 6 to 28, wherein R2A is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0507] Embodiment 30. The compound of one of embodiments 6 to 28, wherein R2A is hydrogen, substituted or unsubstituted Ci-C6 alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl, substituted or unsubstituted C3-C6 cycloalkyl, substituted or unsubstituted 3 to 6 membered heterocycloalkyl, substituted or unsubstituted C3-C6 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl.
[0508] Embodiment 31. The compound of one of embodiments 6 to 28, wherein R2A is hydrogen.
[0509] Embodiment 32. The compound of one of embodiments 6 to 31, wherein R2B is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0510] Embodiment 33. The compound of one of embodiments 6 to 31, wherein R2B is hydrogen, substituted or unsubstituted Ci-C6 alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl, substituted or unsubstituted C3-C6 cycloalkyl, substituted or unsubstituted 3 to 6 membered heterocycloalkyl, substituted or unsubstituted C3-C6 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl.
[0511] Embodiment 34. The compound of one of embodiments 6 to 31, wherein R2B is hydrogen.
[0512] Embodiment 35. The compound of one of embodiments 6 to 28, wherein R2A and R2B are joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl. [0513] Embodiment 36. The compound of one of embodiments 6 to 28, wherein R2A and R2B are joined to form a substituted or unsubstituted heterocycloalkyl.
[0514] Embodiment 37. The compound of one of embodiments 6 to 28, wherein R2A and R2B are joined to form a substituted or unsubstituted 4 to 6 membered heterocycloalkyl. [0515] Embodiment 38. The compound of one of embodiments 6 to 37, wherein R1A is hydrogen, -CX1A 3, -CHX1A 2, -CH2X1A, -OCX1A 3, -OCH2X1A, -OCHX1A 2, -C(0)R1AA, -C(0)OR1AA, -C(0)NR1AAR1AB, -OR1aa, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. [0516] Embodiment 39. The compound of one of embodiments 6 to 37, wherein R1A is hydrogen, -CX1A 3, -CHX1A 2, -CH2X1A, or unsubstituted Ci-C3 alkyl.
[0517] Embodiment 40. The compound of one of embodiments 6 to 37, wherein R1A is unsubstituted Ci-C3 alkyl.
[0518] Embodiment 41. The compound of one of embodiments 6 to 37, wherein R1A is hydrogen.
[0519] Embodiment 42. The compound of one of embodiments 6 to 41, wherein R3 is hydrogen, -CX3 3, -CHX3 2, -CH2X3, or substituted or unsubstituted alkyl.
[0520] Embodiment 43. The compound of one of embodiments 6 to 41, wherein R3 is -CH2OH or -CH3. [0521] Embodiment 44. The compound of one of embodiments 6 to 41, wherein R3 is hydrogen.
[0522] Embodiment 45. A pharmaceutical composition comprising a compound, or a pharmaceutically acceptable salt thereof, of one of embodiments 6 to 44 and a
pharmaceutically acceptable excipient. [0523] Embodiment 46. A method of inhibiting an El enzyme, said method comprising contacting an El enzyme with a compound of one of embodiments 6 to 44, thereby inhibiting said El enzyme.
[0524] Embodiment 47. The method of embodiment 46, wherein said method comprises allowing said compound to covalently bind said El enzyme. [0525] Embodiment 48. The method of embodiment 46 or 47, wherein said method comprises allowing said compound to covalently bind an El cysteine amino acid
corresponding to Cys30 of Uba2 subunit 2.
[0526] Embodiment 49. The method of embodiment 48, wherein said method comprises allowing said El cysteine amino acid to bind to carbon C2 attached to R2A and R2B or to ring carbon Ci attached to R1A.
[0527] Embodiment 50. A method of treating cancer in a subject in need thereof, said method comprising administering to said subject a compound of one of embodiments 6 to 44.
[0528] Embodiment 51. The method of embodiment 50, wherein said method comprises allowing said compound to covalently bind an El enzyme.
[0529] Embodiment 52. The method of embodiment 50 or 51, wherein said method comprises allowing said compound to covalently bind an El cysteine amino acid
corresponding to Cys30 of Uba2 subunit 2.
[0530] Embodiment 53. The method of embodiment 52, wherein said method comprises allowing said El cysteine amino acid to bind to carbon C2 attached to R2A and R2B or to carbon Ci attached to R1A.
EXAMPLES
A. Example 1. General synthetic procedures
[0531] The compounds of this invention can be synthesized according to the following Schemes.
[0532] Scheme I:
Figure imgf000178_0001
[0533] The compounds of Formula I can be synthesized according to Scheme I. In step 1, carbonyl compound 1 can react with an amine to form imine intermediate 2, which will further react with a Grignard reagent to give compound 3. Compound 3 will undergo Diels- Alder reaction with an alkyne dienophile (at least one of R1 or R2 is an electron withdrawing group) to yield compound 4 (Formula I, wherein X2 = NH).
[0534] Scheme II:
Figure imgf000178_0002
[0535] In certain cases, compound 3 can be synthesized directly by mixing 2-furaldehyde
1, aniline and benzyl bromide with Zinc dust in THF as shown in Scheme II, where in R51, R52, R53, R54, R55, R56, R57, R58, R59, R60, is independently hydrogen, deuterium, amino, nitro, cyano, hydroxyl, halo, alkyl, haloalkyl, haloalkyl, alkoxy, haloalkoxy, carboxyalkyl, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0536] Scheme III:
Figure imgf000179_0001
[0537] Example I:
Figure imgf000179_0002
[0538] Step A (Scheme I):
Figure imgf000180_0001
1 2
[0539] A mixture of aniline (50 g, 536 mmol), compound 1 (furfural, 47 g, 488 mmol) and MgS04 (118 g, 976 mmol) in anhydrous DCM (800 mL) was stirred at 45°C for 18 hours. The mixture was filtered and the filtrate was concentrated, the residue was purified by silica gel column (Petroleum ether/ EtOAc = 50: 1) to give compound 2 (50 g, 292 mmol, 60% yield) as a yellow oil. ¾ NMR (CDCh): d 8.37 (s, 1H), 7.66 (s, 1H), 7.45 - 7.41 (m, 2H), 7.30 - 7.26 (m, 3H), 7.01 - 7.00 (m, 1H), 6.61 - 6.60 (m, 1H).
[0540] Step B (Scheme I):
Figure imgf000180_0002
To a solution of compound 2 (100 g, 585 mmol) in THF (1 L) was added benzylmagnesium bromide (1 M, 1.05 L, 1.05 mol) dropwise with stirring at 0°C. Then the mixture was stirred at 20°C for 18 hours. The reaction mixture was quenched by saturated NH4Cl aqueous solution (1 L) and extracted with EtOAc (300 mL x 3), the organic layer was washed with brine (300 mL x 2), dried over Na2S04 and concentrated. The crude product was purified by silica gel chromatography eluted with petroleum ether/ethyl acetate = 30: 1 to give compound 3 (20 g, 9.8% yield, 75% purity) as yellow oil. ¾ NMR: (CDCh) d 7.38 (s, 1H), 7.26 - 7.23
(m, 3H), 7.16 - 7.12 (m, 2H), 7.07 - 7.05 (m, 2H), 6.71 - 6.70 (m, 1H), 6.61 - 6.59 (m, 2H), 6.27 - 6.26 (m, 1H), 6.05 - 6.04 (m, 1H), 4.76 (t, 6.4 Hz, 1H), 3.96 (s, H), 3.22 - 3.19 (m, 2H). [0541] Step C (Scheme III)
Figure imgf000181_0001
Compound 3 (4.8 g, 18.25 mmol) in 100 mL anhydrous toluene was heated to 110 °C, then dimethyl acetyl enedicarboxylate (5.18 g, 36.5 mmol) was added and the mixture was refluxed overnight. TLC (hexanes/EtOAc = 3: 1) and LC-MS of a small pre-TLC indicated the formation of two adjacent spots with the same molecular weight. The solvents were evaporated in vacuo , and the crude product was sequentially recrystallized from methanol to give two portions: T and B. T. Bright yellow solid (2.75 g), less polar; LC/MS (M+l) 406.1; ¾ NMR (d6-DMSO): d 7.05-7.30 (m, 6H), 6.90 (m, 3H), 6.40 (m, 3H), 5.80 (d, 1H), 5.55 (m, 1H), 4.50 (m, 1H), 3.67 (s, 3H), 3.20 (s, 3H), 2.85 (m, 1H), 2.75 (m, 1H). B. Pale yellow solid (2.16 g), more polar; LC/MS (M+l) 406.1; ¾ NMR (d6-DMSO): d 7.25 (m, 1H), 7.21- 7.12 (m, 5H), 7.10-7.05 (m, 1H), 6.97-6.90 (m, 2H), 6.50-6.42 (m, 2H), 6.40 (m, 1H), 5.80 (d, 1H), 5.68 (s, 1H), 4.50 (m, 1H), 3.65 (s, 3H), 3.55 (s, 3H), 2.85 (m, 1H), 2.75 (m, 1H).
[0542] Step D (Scheme III):
Figure imgf000181_0002
Compound 6A portion T (910 mg, 2.25 mmol) was dissolved in 22.5 mL THF and the mixture was cooled to 0 °C, then 11.25 mL 0.2 M sodium hydroxide was added and the mixture was stirred at 0 °C for 1 hour. Then another portion of NaOH solution was added (11.25 mL, 0.2 M). After another hour, 20% HC1 was added dropwise to neutralize the reaction mixture. The organic solvents were then evaporated in vacuo , and the remaining aqueous layer were acidified to pH ~3 with 20% HC1 then extracted with CHCh. The organic layer was dried over anhydrous MgS04 and then concentrated to give a crude oil. The crude product was purified by silica gel chromatography eluted with methanol/ethyl acetate = 1 :9 to give compound 7A (810 mg) as yellow solid. LC/MS (M+l): 392.1; (M-l): 390.1. ¾ NMR (d6-DMSO): d 7.25 (m, 2H), 7.15 (m, 2H), 7.10 (m, 1H), 6.90 (m, 2H), 6.82 (m, 1H), 6.43 (m, 2H), 6.39 (m, 1H), 5.60 (m, 1H), 5.40 (m, 1H), 4.50 (m, 1H), 3.20 (s, 3H), 2.87 (m, 1H), 2.74 (m, 1H).
Figure imgf000182_0001
[0543] Compound 7A (190 mg, 0.486 mmol), EDCI (113 mg, 0.73 mmol) and HOBt (112 mg, 0.73 mmol) were mixed in 5 mL of anhydrous DMF at 0 °C in a ice water bath.
Propylamine (28.6 mg, 0.485 mmol) was added to the cold mixture and stirred at 0 °C for 3 hours. The reaction was then allowed to warm up to ambient temperature and stirred overnight. Next morning, the reaction mixture was extracted between ethyl acetate and brine. The organic layer was dried over anhydrous MgS04 and then concentrated to give a crude oil. The crude product was purified by silica gel chromatography eluted with hexanes/ethyl acetate = (4: 1 to 2: 1) to give compound 150 (110 mg) as yellow gum. LC/MS (M+l): 433.1; (M-l): 431.1. ¾ NMR (d6-DMSO): d 8.08 (t, 1H), 7.26 (m, 2H), 7.18-7.13 (m, 3H), 7.11- 7.07 (m, 1H), 6.90 (t, 2H), 6.75 (d, 1H), 6.47 (d, 2H), 6.41 (t, 1H), 5.68 (d, 1H), 5.42 (d, 1H), 4.70 (m, 1H), 3.31 (s, 3H), 2.06 (m, 2H), 2.88 (m, 1H), 2.76 (m, 1H), 1.40 (m, 2H), 0.81 (m, 3H).
[0544] Example II:
Figure imgf000183_0001
[0545] Step A:
Figure imgf000183_0002
1 [0546] A mixture of 2-Furaldehyde 1 (19.2 g, 200 mmol), benzyl chloride (37.8 g, 300 mmol), zinc dust (19.5 g, 300 mmol), cadmium chloride (36.6 g, 200 mmol), indium chloride (2.2 g, 10 mmol) in distilled water (500 mL) was stirred at room temperature overnight. The mixture was filtered and the filtrate was concentrated, the residue was purified by silica gel column (Hexanes/ EtOAc = 8: 1) to give compound 8A (15 g, 80 mmol, 40% yield) as a yellow oil.
[0547] Step B:
Figure imgf000183_0003
[0548] A solution of compound 8A (15 g, 80 mmol), phenol (7.5 g, 80 mmol),
triphenylphosphine (23 g, 88 mmol) in anhydrous THF (300 mL) was cooled 0°C, then diethyl azodi carboxyl ate (16.7 g, 96 mmol) was added slowly to the mixture. The reaction mixture was stirred at room temperature overnight and then concentrated. The product was purified by silica gel chromatography eluted with hexanes/ethyl acetate = 9: 1 to 6: 1 give compound 9A (15.5 g, 73% yield) as yellow oil. [0549] Step C:
Figure imgf000184_0001
10A
[0550] Compound 9 A (15 g, 56.8 mmol) in 100 mL anhydrous toluene was heated to 110 °C, then dimethyl acetyl enedicarboxylate (12 g, 85.2 mmol) was added and the mixture was refluxed overnight. The solvents were evaporated in vacuo , and the crude product was purified by silica gel chromatography eluted with hexanes/ethyl acetate = 5: 1 to given a yellow oil, which was sequentially recrystallized from methanol to give 10A as a white solid (4.3 g, 19% yield). ¾ NMR (d6-DMSO): d 7.4-6.6 (m, 12H), 5.7 (m, 1H), 5.4 (m, 1H), 3.7 (s, 3H), 3.55 (s, 3H), 3.1 (m, 2H).
[0551] Step D
Figure imgf000184_0002
10A 515
[0552] Compound 10A (4.3 g, 10.6 mmol) was dissolved in 100 mL anhydrous
dichloromethane and the mixture was cooled to 0 °C, then /«eto-Chloroperoxybenzoic acid (3.1 g) was added and the mixture was then stirred at room temperature overnight. The organic solvents were then evaporated in vacuo , and the remaining mixture was dissolved in ethyl acetate (50 mL) and then washed with saturated sodium bicarbonate (5 x 50 mL). The organic layer was dried over anhydrous MgS04 and then concentrated to give a crude oil. The crude product was purified by silica gel chromatography eluted with hexanes/ethyl acetate/triethylamine = 5: 1 :0.01 to give compound 515 (1.9 g, 42% yield) as white solid. ¾ NMR (CDCh): d 7.4-6.7 (m, 10H), 5.3 (m, 1H), 5.2 (m, 1H), 3.80 (s, 3H), 3.75 (m, 1H), 3.65 (m, 1H), 3.55 (s, 3H), 3.2 (m, 2H).
[0553] Step E:
Figure imgf000185_0001
[0554] Compound 515 (1.9 g, 4.5 mmol) was dissolved in THF (50 mL) and cooled to 0 °C, then NaOH (198 mg, 4.95 mmol) in distilled water (50 mL) was added. The reaction was then allowed to warm up to ambient temperature and stirred for 1 hour. The mixture was neutralized with 1 M HC1, and the THF was evaporated. The remaining aqueous layer was acidified to pH 4, then extracted with ethyl acetate (50 mL). The organic layer was washed with brine (50 mL), then dried over anhydrous MgS04 and then concentrated to give a crude oil. The crude product was purified by silica gel chromatography eluted with ethyl acetate/methanol/acetic acid = 9: 1 :0.5 to give compound 521 (1.5 g, 82%) as orange solid.
LC/MS (M-l): 407.2.
[0555] Step E:
Figure imgf000185_0002
[0556] Compound 521 (23 mg, 0.056 mmol), HATU (28 mg, 0.073 mmol) and p-anisidine (8 mg, 0.062 mmol) were mixed at 0 °C in DMF (2 mL), then the mixture was stirred at room temperature for 1 hour. The mixture was extracted between ethyl acetate (20 mL) and brine (20 mL), the organic layer was dried over MgS04 and was then concentrated, the residue was purified by silica gel column (Hexanes/ EtOAc = 3: 1) to give compound 8A (17 mg, 59% yield) as a yellow solid. LC/MS (M+l): 515.1. ¾ NMR (d6-DMSO): d 10.3 (s, 1H), 7.6-6.5
(m, 14H), 5.5 (m, 1H), 5.4 (s, 1H), 4.1 (m, 1H), 3.9 (m, 1H), 3.5 (s, 3H), 3.2 (s, 3H), 3.2-3.0 (m, 2H).
[0557] When incubating such compounds with the activating enzymes (El) of ubiquitin, SEIMO, Nedd8, ETrml, ISG15 or Atg7, it forms covalent adducts with the specific Cys residue (e.g., an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2, or an amino acid corresponding to the Cys residue highlighted and in bold in SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, or SEQ ID NO:7) as depicted herein.
[0558] For the compounds provided herein including embodiments thereof, a covalent adduct may be formed with a cysteine amino acid corresponding to a Cys residue highlighted and in bold from Ubal, Uba2, Uba3, Uba4, Uba7 or Atg7 as shown in the sequence alignment below.
Figure imgf000186_0001
B. Example 2. Compounds
[0559] Table I: compounds synthesized and biological activities.
[0560] Activities are listed as + (less active), ++ (active), +++ (most active)
Figure imgf000187_0001
Figure imgf000188_0001
ı87
Figure imgf000189_0001
Figure imgf000190_0001

Figure imgf000191_0001
Figure imgf000192_0001
Figure imgf000193_0001
Figure imgf000194_0001
Figure imgf000195_0001
Figure imgf000196_0001
ı95
Figure imgf000197_0001
Figure imgf000198_0001
ı97
Figure imgf000199_0001
ı98
Figure imgf000200_0001
Figure imgf000201_0001
Figure imgf000202_0001
Figure imgf000203_0001
Figure imgf000204_0001
Figure imgf000205_0001
Figure imgf000206_0001
Figure imgf000207_0001
Figure imgf000208_0001
Figure imgf000209_0001
Figure imgf000210_0001
209
Figure imgf000211_0001
Figure imgf000212_0001
Figure imgf000213_0001
Figure imgf000214_0001
213
Figure imgf000215_0001
Figure imgf000216_0001
Figure imgf000217_0001
Figure imgf000218_0001
Figure imgf000219_0001
Figure imgf000220_0001
Figure imgf000221_0001
Figure imgf000222_0001
221
Figure imgf000223_0001
Figure imgf000224_0001
Figure imgf000225_0001
224
Figure imgf000226_0001
225
Figure imgf000227_0001
Figure imgf000228_0001
227
Figure imgf000229_0001
Figure imgf000230_0001
Figure imgf000231_0001
230
Figure imgf000232_0001
Figure imgf000233_0001
Figure imgf000234_0001
IJ33
Figure imgf000235_0001
Figure imgf000236_0001
Figure imgf000237_0001
Figure imgf000238_0001

Figure imgf000239_0001
Figure imgf000240_0001
Figure imgf000241_0001
Figure imgf000242_0001
Figure imgf000243_0001
Figure imgf000244_0001
Figure imgf000245_0001
IJ44
Figure imgf000246_0001
Figure imgf000247_0001
Figure imgf000248_0001
Figure imgf000249_0001
Figure imgf000250_0001
Figure imgf000251_0001
Figure imgf000252_0001
Figure imgf000253_0001
Figure imgf000254_0001
Figure imgf000255_0001
Figure imgf000256_0001
Figure imgf000257_0001
Figure imgf000258_0001
Figure imgf000259_0001
Figure imgf000260_0001
Figure imgf000261_0001
Figure imgf000262_0001
Figure imgf000263_0001
Figure imgf000264_0001
Figure imgf000265_0001
Figure imgf000266_0001
Figure imgf000267_0001
Figure imgf000268_0001
Figure imgf000269_0001
Figure imgf000270_0001
Figure imgf000271_0001
Figure imgf000272_0001
Figure imgf000273_0001
C. Example 3. Methods of screening
[0561] More than 97% of the human proteome have not been addressed by FDA approved drugs of all diseases. An approach to accelerate the discovery of druggable sites and novel targets is by using compound libraries that can form covalent adducts with proteins in the proteome. Such a compound library can be used to screen a cellular disease model and compare with a non-disease model to identify compounds that have potential therapeutic benefit for the disease. Then, quantitative mass spectrometry approaches will be used to identify the specific site(s) in specific target(s) in the cells that the hit(s) covalently bind to through competition with an affinity labeled tool compound. [0562] Such novel target and druggable site identification outcome is affected by the functional groups that form covalent bonds with proteins, known as“warhead” in these libraries. The warhead in the compound library provided herein is different from others used for such studies, and thus is unique. It led to the discovery of Cys30 of the SAE2/Uba2 as a novel druggable site in this novel target.
[0563] Ref: Counihan JL*, Wiggenhom A*, Anderson KE, Nomura DK. (2018)
Chemoproteomics-enabled covalent ligand screening reveals ALDH3 Al as a lung cancer target. ACS Chemical Biology doi: l0.l02l/acschembio.8b0038l.
[0564] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.

Claims

WHAT IS CLAIMED IS:
1. A method of treating cancer in a subject in need thereof, said method comprising administering to said subject a pharmaceutically acceptable excipient and a therapeutically effective amount of a compound of formula:
Figure imgf000275_0001
wherein:
is a single bond or double bond;
L3 is -0-, -S-, -N-,— S(O)-, -S(0)2-, -C(O)— , -N(R7)-, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene;
R1 is hydrogen, halogen, -CXS, -CHXS, -CH2X1, -OCX , -OCH2X1,
-OCHX , -CN, -SOniR1A, -SOVINR1AR1b, -NHC(0)NR1AR1B, -N(0)mi, -NR1AR1B,
-NHNR1AR1B, -C(0)R1a, -C(0)-0R1a, -C(0)NR1AR1b, -C(0)NHNR1AR1b, -OR1a,
-NR1AS02R1B, -NR1AC(0)R1b, -NR1AC(0)0R1B, -NR1AOR1B, -N3, -L'-E1, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R2 is hydrogen, halogen, -CXS, -CHXS, -CH2X2, -OCXS, -OCH2X2,
-OCHX22, -CN, -SO„2R2A, -SOV2NR2AR2B, -NHC(0)NR2AR2B, -N(0)m2, -NR2AR2B,
-NHNR2AR2B, -C(0)R2A, -C(0)-0R2A, -C(0)NR2AR2B, -C(0)NHNR2AR2B, -OR2A,
-NR2AS02R2B, -NR2AC(0)R2B, -NR2AC(0)0R2B, -NR2AOR2B, -N3, -L2-E2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R3 is hydrogen, halogen, -CXS, -CHX3 2, -CH2X3, -OCXS, -OCH2X3,
-OCHXS, -CN, -SOn3R3A, -SOV3NR3AR3B, -NHC(0)NR3AR3B, -N(0)m3, -NR3AR3B,
-NHNR3AR3B, -C(0)R3A, -C(0)-0R3A, -C(0)NR3AR3B, -OR3A, -NR3ASO2R3B,
-NR3AC(0)R3B, -NR3AC(0)0R3B, -NR3AOR3B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R4 is hydrogen, halogen, -CX4 3, -CHX4 2, -CH2X4, -OCX4 3, -OCH2X4, -OCHX4 2, -CN, -SOn4R4A, -SOV4NR4AR4B, -NHC(0)NR4AR4B, -N(0)m4, -NR4AR4B,
-NHNR4AR4B, -C(0)R4A, -C(0)-OR4A, -C(0)NR4AR4B, -C(0)NHNR4AR4B, -OR4A,
-NR4AS02R4B, -NR4AC(0)R4B, -NR4AC(0)0R4B, -NR4AOR4B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R5 is hydrogen, halogen, -CX5 3, -CHX5 2, -CH2X5, -OCX5 3,-OCH2X5, -OCHX5 2, -CN, -SOn5R5A, -SOV5NR5AR5B, -NHC(0)NR5AR5B, -N(0)m5, -NR5AR5B,
-NHNR5AR5B, -C(0)R5A, -C(0)-0R5A, -C(0)NR5AR5B, -C(0)NHNR5AR5B, -OR5A,
-NR5AS02R5B, -NR5AC(0)R5B, -NR5AC(0)0R5B, -NR5AOR5B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R6 is hydrogen, halogen, -CX6 3, -CHX6 2, -CftX6, -OCX6 3, -OCH2X6, -OCHX6 2, -CN, -SOn6R6A, -SOV6NR6AR6B, -NHC(0)NR6AR6B, -N(0)m6, -NR6AR6B,
-NHNR6AR6B, -C(0)R6A, -C(0)-0R6A, -C(0)NR6AR6B, -C(0)NHNR6AR6B, -OR6A,
-NR6AS02R6B, -NR6AC(0)R6B, -NR6AC(0)0R6B, -NR6AOR6B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R7 is hydrogen, halogen, -CX7 3, -CHX7 2, -CH2X7, -OCX7 3, -OCH2X7, -OCHX7 2, -CN, -SOnvR7A, -SOVVNR7AR7B, -NHC(0)NR7AR7B, -N(0)mv, -NR7AR7B,
-NHNR7AR7B, -C(0)R7A, -C(0)-0R7A, -C(0)NR7AR7B, -C(0)NHNR7AR7B, -OR7A,
-NR7AS02R7B, -NR7AC(0)R7B, -NR7AC(0)0R7B, -NR7AOR7B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
E1 and E2 are independently an electron-withdrawing moiety; each R1A, R1b, R2A, R2B, R3A, R3B, R4A, R4B, R5A, R5B, R6A, R6B, R7A, and R7B is independently hydrogen, -CX3, -CHX2, -CH2X, -C(0)OH, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHSO2H, -NHC=(0)H, -NHC(0)0H, -NHOH, -OCX3, -OCHX2, -OCH2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted
heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R1A and R1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2A and R2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R4A and R4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R5A and R5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R6A and R6B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R7A and R7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
ml, m2, m3, m4, m5, m6, and m7 are independently 1 or 2;
vl, v2, v3, v4, v5, v6, and v7 are independently 1 or 2;
nl, n2, n3, n4, n5, n6, and n7 are independently an integer from 0 to 4;
X, X1, X2, X3, X4, X5, X6, and X7 are independently -Cl, -Br, -I, or -F;
L1 and L2 are independently a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-, -NHC(O)-, -NH-C(0)-NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene;
R1 and R2 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R4 and R5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; and wherein said compound is administered at a rate approximately equal to the half-life of an El enzyme.
2. The method of claim 1, wherein said compound is covalently attached to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2.
3. The method of claim 1, wherein at least one of R1 or R2 comprises an electron-withdrawing moiety.
4. The method of one of claims 1 to 3, wherein at least one of R1 or R2 are sufficiently electron withdrawing to allow said compound to covalently bind to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2, wherein said El cysteine amino acid is bound to ring carbon C2 attached to R2 or ring carbon Ci attached to R1.
5. The method of one of claims 1 to 3, wherein said compound covalently binds to an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2; and forms a complex of formula:
Figure imgf000278_0001
6. A compound of formula:
Figure imgf000279_0001
wherein
L3 is -0-, -S-, or -N(R7)-;
V is -O- or -N(R10)-;
R1A is hydrogen, halogen, -CX1A 3, -CHX1A 2, -CH2X1A, -OCX1A 3, -OCH2X1A, -OCHX1A 2, -CN, -SOniAR1AA, -SOVIANR1AAR1ab, -NHC(0)NR1AAR1AB, -N(0)miA,
-NR1AAR1AB, -NHNR1AAR1AB, -C(0)R1aa, -C(0)-OR1aa, -C(0)NR1AAR1AB, -OR1aa, -NR1AAS02R1AB, -NR1AAC(0)R1AB, -NR1AAC(0)OR1AB, -NR1AAOR1AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R2A is hydrogen, halogen, -CX2A 3, -CHX2A 2, -CH2X2A, -OCX2A 3, -OCH2X2A, -OCHX2A 2, -CN, -SOn2AR2AA, -SOV2ANR2AAR2AB, -NHC(0)NR2AAR2AB, -N(0)m2A,
-NR2AAR2AB, -NHNR2AAR2AB, -C(0)R2AA, -C(0)-OR2AA, -C(0)NR2AAR2AB, -OR2AA, -NR2AAS02R2AB, -NR2AAC(0)R2AB, -NR2AAC(0)0R2AB, -NR2AAOR2AB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R2B is hydrogen, halogen, -CX2B 3, -CHX2B 2, -CH2X2B, -OCX2B 3, -OCH2X2B, -OCHX2B 2, -CN, -SO„2BR2BA, -SOV2BNR2BAR2BB, -NHC(0)NR2BAR2BB, -N(0)m2B,
-NR2BAR2BB, -NHNR2BAR2BB, -C(0)R2BA, -C(0)-OR2BA, -C(0)NR2BAR2BB, -OR2BA,
-NR2BAS02R2BB, -NR2BAC(0)R2BB, -NR2BAC(0)0R2BB, -NR2BAOR2BB, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R3 is hydrogen, halogen, -CX3 3, -CHX3 2, -CH2X3, -OCX3 3, -OCH2X3,
-OCHX3 2, -CN, -SOn3R3A, -SOV3NR3AR3B, -NHC(0)NR3AR3B, -N(0)m3, -NR3AR3B,
-NHNR3AR3B, -C(0)R3A, -C(0)-OR3A, -C(0)NR3AR3B, -OR3A, -NR3ASO2R3B,
-NR3AC(0)R3B, -NR3AC(0)0R3B, -NR3AOR3B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl;
R4 is hydrogen, halogen, -CX4 3, -CHX4 2, -CH2X4, -OCX4 3, -OCH2X4,
-OCHX4 2, -CN, -SOn4R4A, -SOV4NR4AR4B, -NHC(0)NR4AR4B, -N(0)m4, -NR4AR4B,
-NHNR4AR4B, -C(0)R4A, -C(0)-OR4A, -C(0)NR4AR4B, -C(0)NHNR4AR4B, -OR4A,
-NR4AS02R4B, -NR4AC(0)R4B, -NR4AC(0)0R4B, -NR4AOR4B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R5 is hydrogen, halogen, -CX5 3, -CHX5 2, -CH2X5, -OCX5 3, -OCH2X5,
-OCHX5 2, -CN, -SOn5R5A, -SOV5NR5AR5B, -NHC(0)NR5AR5B, -N(0)m5, -NR5AR5B,
-NHNR5AR5B, -C(0)R5A, -C(0)-OR5A, -C(0)NR5AR5B, -C(0)NHNR5AR5B, -OR5A,
-NR5AS02R5B, -NR5AC(0)R5B, -NR5AC(0)0R5B, -NR5AOR5B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R7 is hydrogen, halogen, -CX7 3, -CHX7 2, -CH2X7, -OCX7 3, -OCH2X7,
-OCHX7 2, -CN, -SOn5R7A, -SOV5NR7AR7B, -NHC(0)NR7AR7B, -N(0)m5, -NR7AR7B,
-NHNR7AR7B, -C(0)R7A, -C(0)-OR7A, -C(0)NR7AR7B, -C(0)NHNR7AR7B, -OR7A,
-NR7AS02R7B, -NR7AC(0)R7B, -NR7AC(0)0R7B, -NR7AOR7B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R8 is hydrogen, halogen, -CX -CHX8 2, -CH2X8, -OCX8 3, -OCH2X8,
-OCHX8 2, -CN, -SOn5R8A, -SOV5NR8AR8B, -NHC(0)NR8AR8B, -N(0)m5, -NR8AR8B,
-NHNR8AR8B, -C(0)R8A, -C(0)-OR8A, -C(0)NR8AR8B, -C(0)NHNR8AR8B, -OR8A,
-NR8AS02R8B, -NR8AC(0)R8B, -NR8AC(0)0R8B, -NR8AOR8B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R9 is hydrogen, halogen, -CX9 3, -CHX9 2, -CH2X9, -OCX9 3, -OCH2X9,
-OCHX9 2, -CN, -SOn5R9A, -SOV5NR9AR9B, -NHC(0)NR9AR9B, -N(0)m5, -NR9AR9B,
-NHNR9AR9B, -C(0)R9A, -C(0)-OR9A, -C(0)NR9AR9B, -C(0)NHNR9AR9B, -OR9A,
-NR9AS02R9B, -NR9AC(0)R9B, -NR9AC(0)0R9B, -NR9AOR9B, -N3, substituted or
unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R10 is hydrogen, halogen, -CX10 3, -CHX10 2, -CH2X10, -OCX10 3, -OCH2X10, -OCHX10 2, -CN, -SOnioR10A, -SOvioNR10AR10B, -NHC(O)NR10AR10B, -N(0)mio, -NR10AR10B, -NHNR10AR10B, -C(O)R10A, -C(O)-OR10A, -C(O)NR10AR10B, -C(0)NHNR10AR10b, -OR10A, -NR10ASO2R10B, -NR10AC(O)R10B, -NR10AC(O)OR10B, -NR10AOR10B, -N3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
each R1AA p A B R2 AA r2AB r2BA r2BB r3 A R3B R4A p^4B r5 A R5B RVA
R7B, R8A, R8B, R9A, R9B, R10a, and R10B is independently hydrogen, -CX3, -CHX2, -CH2X,
-C(0)0H, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -SO3H, -SO4H,
-S02NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H, -NHC(0)0H, -NHOH, -OCX3, -OCHX2, -OCH2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or
unsubstituted heteroaryl; R1AA and R1AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2AA and R2AB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R2BA and R2BB substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R3A and R3B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R4A and R4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R5A and R5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R7A and R7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R8A and R8B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R9A and R9B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R10A and R10B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl;
mlA, m2A, m2B, m3, m4, m5, m7, m8, m9, and mlO are independently 1 or
2;
vl A, v2A, v2B, v3, v4, v5, v7, v8, v9, and vlO are independently 1 or 2; nlA, n2A, n2B, n3, n4, n5, n7, n8, n9, and nlO are independently an integer from 0 to 4;
X, X1A, X2A, X2B, X3, X4, X5, X7, X8, X9, and X10 are independently -Cl,
-Br, -I, or -F;
L6 is substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl ene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene;
L8 is a bond, -C(O)-, -C(0)NH-, -C(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene; L9 is a bond, -0-, -S-, -NH-, -C(O)-, -C(0)0-, -C(0)NH-, -OC(O)-,
-NHC(O)-, -NHC(0)NH-, -OC(0)NH-, -NHC(0)0-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkyl ene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted aryl ene, or substituted or unsubstituted heteroarylene;
wherein R2A and R2B may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; and
R4 and R5 may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
7. The compound of claim 6, having the formula:
Figure imgf000283_0001
8. The compound of claim 6, wherein R4 is hydrogen.
9. The compound of claim 6, wherein R5 is hydrogen.
10. The compound of claim 6, having the formula:
Figure imgf000284_0001
11. The compound of claim 6, wherein R8 is substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
12. The compound of claim 6, wherein R8 is substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
13. The compound of claim 6, wherein R8 is substituted or unsubstituted phenyl, or substituted or unsubstituted 5 to 6 membered heteroaryl.
14. The compound of claim 6, wherein R8 is substituted or unsubstituted phenyl.
15. The compound of claim 6, having the formula:
Figure imgf000285_0001
R41 is independently halogen, -CX41 3, -CHX41 2, -CH2X41, -C(0)0H, -C(0)NH2, -CN, -OH, -NH2, -COOH, -CONH2, -N02, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC=(0)NHNH2, -NHC=(0)NH2, -NHS02H, -NHC=(0)H,
-NHC(0)0H, -NHOH, -OCX41 3, -OCHX41 2, -OCH2X41, -OPh, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; two adjacent R41 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
z4l is an integer from 0 to 5; and
X41 is independently -Cl, -Br, -I, or -F.
16. The compound of claim 15, wherein R41 is independently halogen or
-OPh.
17. The compound of claim 15, wherein z4l is 2.
18. The compound of claim 15, wherein z4l is 1.
19. The compound of claim 15, wherein z4l is 0.
20. The compound of claim 6, wherein L9 is a bond, or substituted or unsubstituted alkylene.
21. The compound of claim 6, wherein L9 is a bond, or unsubstituted C1-C3 alkylene.
22. The compound of claim 6, wherein L9 is an unsubstituted methylene.
23. The compound of claim 6, wherein L9 is a bond.
24. The compound of claim 6, wherein R9 is substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
25. The compound of claim 6, wherein R9 is unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.
26. The compound of claim 6, wherein R9 is unsubstituted Ci-C6 alkyl, unsubstituted 2 to 6 membered heteroalkyl, unsubstituted C3-C6 cycloalkyl, unsubstituted 3 to 6 membered heterocycloalkyl, unsubstituted phenyl, or unsubstituted 5 to 6 membered heteroaryl.
27. The compound of claim 6, wherein R9 is unsubstituted propyl, unsubstituted butyl, unsubstituted pentyl, unsubstituted propenyl, unsubstituted butenyl, unsubstituted pentenyl, unsubstituted propynyl, unsubstituted butynyl, unsubstituted pentynyl, unsubstituted cyclobutyl, unsubstituted cyclopentyl, unsubstituted
tetrahydropyranyl, unsubstituted morpholinyl, or unsubstituted phenyl.
28. The compound of claim 6, wherein R9 is unsubstituted phenyl.
29. The compound of claim 6, wherein R2A is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
30. The compound of claim 6, wherein R2A is hydrogen, substituted or unsubstituted Ci-C6 alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl, substituted or unsubstituted C3-C6 cycloalkyl, substituted or unsubstituted 3 to 6 membered heterocycloalkyl, substituted or unsubstituted C3-C6 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl.
31. The compound of claim 6, wherein R2A is hydrogen.
32. The compound of claim 6, wherein R2B is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
33. The compound of claim 6, wherein R2B is hydrogen, substituted or unsubstituted Ci-C6 alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl, substituted or unsubstituted C3-C6 cycloalkyl, substituted or unsubstituted 3 to 6 membered heterocycloalkyl, substituted or unsubstituted C3-C6 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl.
34. The compound of claim 6, wherein R2B is hydrogen.
35. The compound of claim 6, wherein R2A and R2B are joined to form a substituted or unsubstituted heterocycloalkyl, or substituted or unsubstituted heteroaryl.
36. The compound of claim 6, wherein R2A and R2B are joined to form a substituted or unsubstituted heterocycloalkyl.
37. The compound of claim 6, wherein R2A and R2B are joined to form a substituted or unsubstituted 4 to 6 membered heterocycloalkyl.
38. The compound of claim 6, wherein R1A is hydrogen, -CX1A 3, -CHX1A 2, -CH2X1A, -OCX1A 3, -OCH2X1a, -OCHX1a 2, -C(0)R1aa, -C(0)OR1aa, -C(0)NR1AAR1AB, -OR1aa, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
39. The compound of claim 6, wherein R1A is hydrogen, -CX1A 3, -CHX1A 2, -CH2X1A, or unsubstituted C1-C3 alkyl.
40. The compound of claim 6, wherein R1A is unsubstituted C1-C3 alkyl.
41. The compound of claim 6, wherein R1A is hydrogen.
42. The compound of claim 6, wherein R3 is hydrogen, -CXT, -CHX3 2, -CEhX3, or substituted or unsubstituted alkyl.
43. The compound of claim 6, wherein R3 is -CH2OH or -CH3.
44. The compound of claim 6, wherein R3 is hydrogen.
45. A pharmaceutical composition comprising a compound, or a pharmaceutically acceptable salt thereof, of one of claims 6 to 44 and a pharmaceutically acceptable excipient.
46. A method of inhibiting an El enzyme, said method comprising contacting an El enzyme with a compound of one of claims 6 to 44, thereby inhibiting said El enzyme.
47. The method of claim 46, wherein said method comprises allowing said compound to covalently bind said El enzyme.
48. The method of claim 46, wherein said method comprises allowing said compound to covalently bind an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2.
49. The method of claim 48, wherein said method comprises allowing said El cysteine amino acid to bind to carbon C2 attached to R2A and R2B or to ring carbon Ci attached to R1A.
50. A method of treating cancer in a subject in need thereof, said method comprising administering to said subject a compound of one of claims 6 to 44.
51. The method of claim 50, wherein said method comprises allowing said compound to covalently bind an El enzyme.
52. The method of claim 50, wherein said method comprises allowing said compound to covalently bind an El cysteine amino acid corresponding to Cys30 of Uba2 subunit 2.
53. The method of claim 52, wherein said method comprises allowing said El cysteine amino acid to bind to carbon C2 attached to R2A and R2B or to carbon Ci attached to R1A
PCT/US2019/044404 2018-07-31 2019-07-31 Sumo inhibitor compounds and uses thereof Ceased WO2020028525A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/263,487 US11578079B2 (en) 2018-07-31 2019-07-31 SUMO inhibitor compounds and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862712822P 2018-07-31 2018-07-31
US62/712,822 2018-07-31

Publications (1)

Publication Number Publication Date
WO2020028525A1 true WO2020028525A1 (en) 2020-02-06

Family

ID=69230773

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/044404 Ceased WO2020028525A1 (en) 2018-07-31 2019-07-31 Sumo inhibitor compounds and uses thereof

Country Status (2)

Country Link
US (1) US11578079B2 (en)
WO (1) WO2020028525A1 (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024086194A1 (en) * 2022-10-18 2024-04-25 Suvalent Therapeutics, Inc. Combination therapy for treatment of cancer

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9238654B2 (en) * 2010-11-09 2016-01-19 City Of Hope Singleton inhibitors of sumoylation enzymes and methods for their use
US9447240B2 (en) * 2011-04-28 2016-09-20 Nissan Chemical Industries, Ltd. Polyimide precursor modified with dicarboxylic acid anhydride, imidized polyimide and liquid crystal aligning agent using it
US20160355504A1 (en) * 2013-07-02 2016-12-08 Millennium Pharmaceuticals, Inc. Heteroaryl inhibitors of sumo activating enzyme
US20170360940A1 (en) * 2014-12-02 2017-12-21 Georgia Tech Research Corporation Nucleophile-triggered degradable materials and methods of making and using the same

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9238654B2 (en) * 2010-11-09 2016-01-19 City Of Hope Singleton inhibitors of sumoylation enzymes and methods for their use
US9447240B2 (en) * 2011-04-28 2016-09-20 Nissan Chemical Industries, Ltd. Polyimide precursor modified with dicarboxylic acid anhydride, imidized polyimide and liquid crystal aligning agent using it
US20160355504A1 (en) * 2013-07-02 2016-12-08 Millennium Pharmaceuticals, Inc. Heteroaryl inhibitors of sumo activating enzyme
US20170360940A1 (en) * 2014-12-02 2017-12-21 Georgia Tech Research Corporation Nucleophile-triggered degradable materials and methods of making and using the same

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
XU ET AL., TARGETING THE UBIQUITIN E1 AS A NOVEL ANTI-CANCER STRATEGY IN CURRENT PHARMACEUTICAL DESIGN, vol. 19, 2013, pages 3201 - 3209, XP055682895 *

Also Published As

Publication number Publication date
US11578079B2 (en) 2023-02-14
US20220298171A1 (en) 2022-09-22

Similar Documents

Publication Publication Date Title
EP3452448B1 (en) Modulators of the integrated stress pathway
EP3902787A1 (en) Quinazoline derivatives as ectonucleotide pyrophosphatase phosphodiesterase 1 inhibitors
US12398151B2 (en) Sumo inhibitor compounds and uses thereof
US20220274964A1 (en) 5-bromo-indirubins
EP3448520A1 (en) Sigma receptor binders
US20150158832A1 (en) Compounds and methods of treating cancer
WO2017190107A1 (en) Sigma receptor binders
WO2017120585A1 (en) Deoxycytidine kinase binding compounds
US11578079B2 (en) SUMO inhibitor compounds and uses thereof
WO2020146779A1 (en) mTORC1 INHIBITORS FOR ACTIVATING AUTOPHAGY
US12590056B2 (en) IGF2BP2 inhibitors and uses thereof
CA3235013A1 (en) Hypoxia inducible factor-2(alpha) inhibitors for the treatment of bladder cancer
EP4100007A1 (en) Elongation factor 1-alpha inhibitors and uses thereof
US11213510B2 (en) Thioindirubins
AU2018215448A1 (en) Compositions and methods for modulating PPP2R1A
WO2024148272A1 (en) Aza bicyclic heteroaryl derivatives as ectonucleotide pyrophosphatase phosphodiesterase 1 inhibitors
US20230114304A1 (en) Depalmitoylating compositions and the use thereof
WO2022246118A2 (en) Pet imaging tracers
HK40068961A (en) Bicyclic heteroaryl derivatives as ectonucleotide pyrophosphatase phosphodiesterase 1 inhibitors
HK40012051B (en) Modulators of the integrated stress pathway
HK40012051A (en) Modulators of the integrated stress pathway
HK1220197B (en) 5-bromo-indirubins

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19845347

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 19845347

Country of ref document: EP

Kind code of ref document: A1