WO2020023679A1 - Novel cldn 18.2-specific monoclonal antibodies and methods of use thereof - Google Patents
Novel cldn 18.2-specific monoclonal antibodies and methods of use thereof Download PDFInfo
- Publication number
- WO2020023679A1 WO2020023679A1 PCT/US2019/043316 US2019043316W WO2020023679A1 WO 2020023679 A1 WO2020023679 A1 WO 2020023679A1 US 2019043316 W US2019043316 W US 2019043316W WO 2020023679 A1 WO2020023679 A1 WO 2020023679A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- cldn
- cell
- cells
- acid sequence
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 157
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims abstract description 131
- 150000007523 nucleic acids Chemical group 0.000 claims abstract description 91
- 239000013598 vector Substances 0.000 claims abstract description 83
- 239000000203 mixture Substances 0.000 claims abstract description 63
- 108091028043 Nucleic acid sequence Proteins 0.000 claims abstract description 54
- 206010061535 Ovarian neoplasm Diseases 0.000 claims abstract description 16
- 206010033128 Ovarian cancer Diseases 0.000 claims abstract description 14
- 239000000611 antibody drug conjugate Substances 0.000 claims abstract description 10
- 229940049595 antibody-drug conjugate Drugs 0.000 claims abstract description 10
- 239000013612 plasmid Substances 0.000 claims abstract description 7
- 210000004027 cell Anatomy 0.000 claims description 260
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 153
- 108090000623 proteins and genes Proteins 0.000 claims description 127
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 126
- 229920001184 polypeptide Polymers 0.000 claims description 118
- 241000282414 Homo sapiens Species 0.000 claims description 115
- 230000027455 binding Effects 0.000 claims description 111
- 206010028980 Neoplasm Diseases 0.000 claims description 106
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 105
- 239000000427 antigen Substances 0.000 claims description 95
- 108091007433 antigens Proteins 0.000 claims description 95
- 102000036639 antigens Human genes 0.000 claims description 95
- 102000004169 proteins and genes Human genes 0.000 claims description 92
- 239000012634 fragment Substances 0.000 claims description 76
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 69
- 102000040430 polynucleotide Human genes 0.000 claims description 64
- 108091033319 polynucleotide Proteins 0.000 claims description 64
- 239000002157 polynucleotide Substances 0.000 claims description 64
- 230000011664 signaling Effects 0.000 claims description 63
- 230000000139 costimulatory effect Effects 0.000 claims description 44
- 239000000523 sample Substances 0.000 claims description 44
- 150000001413 amino acids Chemical class 0.000 claims description 39
- 102000039446 nucleic acids Human genes 0.000 claims description 38
- 108020004707 nucleic acids Proteins 0.000 claims description 38
- 201000011510 cancer Diseases 0.000 claims description 37
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 35
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 35
- 239000012472 biological sample Substances 0.000 claims description 33
- 210000000822 natural killer cell Anatomy 0.000 claims description 33
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 claims description 32
- 239000003795 chemical substances by application Substances 0.000 claims description 30
- 238000002560 therapeutic procedure Methods 0.000 claims description 28
- -1 PD-l Proteins 0.000 claims description 25
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 claims description 22
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 claims description 22
- 241000700605 Viruses Species 0.000 claims description 20
- 230000002496 gastric effect Effects 0.000 claims description 20
- 230000001177 retroviral effect Effects 0.000 claims description 19
- 108060003951 Immunoglobulin Proteins 0.000 claims description 18
- 238000001514 detection method Methods 0.000 claims description 18
- 102000018358 immunoglobulin Human genes 0.000 claims description 18
- 239000003814 drug Substances 0.000 claims description 17
- 230000002611 ovarian Effects 0.000 claims description 17
- 239000003550 marker Substances 0.000 claims description 16
- 238000002965 ELISA Methods 0.000 claims description 15
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 15
- 201000002528 pancreatic cancer Diseases 0.000 claims description 15
- 238000003364 immunohistochemistry Methods 0.000 claims description 14
- 102000004190 Enzymes Human genes 0.000 claims description 13
- 108090000790 Enzymes Proteins 0.000 claims description 13
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 13
- 241001465754 Metazoa Species 0.000 claims description 12
- 206010017758 gastric cancer Diseases 0.000 claims description 12
- 229920001223 polyethylene glycol Polymers 0.000 claims description 12
- 201000011549 stomach cancer Diseases 0.000 claims description 12
- 208000020816 lung neoplasm Diseases 0.000 claims description 11
- 238000000746 purification Methods 0.000 claims description 11
- 239000013603 viral vector Substances 0.000 claims description 11
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 10
- 241000124008 Mammalia Species 0.000 claims description 10
- 206010030155 Oesophageal carcinoma Diseases 0.000 claims description 10
- 239000002202 Polyethylene glycol Substances 0.000 claims description 10
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 10
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 10
- 239000003623 enhancer Substances 0.000 claims description 9
- 238000001262 western blot Methods 0.000 claims description 9
- 208000000461 Esophageal Neoplasms Diseases 0.000 claims description 8
- 229940079593 drug Drugs 0.000 claims description 8
- 201000004101 esophageal cancer Diseases 0.000 claims description 8
- 201000005202 lung cancer Diseases 0.000 claims description 8
- 102100027207 CD27 antigen Human genes 0.000 claims description 7
- 108091035707 Consensus sequence Proteins 0.000 claims description 7
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 7
- 101000955999 Homo sapiens V-set domain-containing T-cell activation inhibitor 1 Proteins 0.000 claims description 7
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 claims description 7
- 230000000295 complement effect Effects 0.000 claims description 7
- 238000000684 flow cytometry Methods 0.000 claims description 7
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 claims description 6
- 241000282326 Felis catus Species 0.000 claims description 6
- 230000012010 growth Effects 0.000 claims description 6
- 230000002401 inhibitory effect Effects 0.000 claims description 6
- 150000002632 lipids Chemical class 0.000 claims description 6
- 208000037841 lung tumor Diseases 0.000 claims description 6
- 239000011159 matrix material Substances 0.000 claims description 6
- 239000007787 solid Substances 0.000 claims description 6
- 229940124597 therapeutic agent Drugs 0.000 claims description 6
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 claims description 5
- 102100038078 CD276 antigen Human genes 0.000 claims description 5
- 108010029697 CD40 Ligand Proteins 0.000 claims description 5
- 101150013553 CD40 gene Proteins 0.000 claims description 5
- 102100032937 CD40 ligand Human genes 0.000 claims description 5
- 241000283073 Equus caballus Species 0.000 claims description 5
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 claims description 5
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 claims description 5
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 claims description 5
- 102000017578 LAG3 Human genes 0.000 claims description 5
- 101000597780 Mus musculus Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 claims description 5
- 108010042215 OX40 Ligand Proteins 0.000 claims description 5
- 102000004473 OX40 Ligand Human genes 0.000 claims description 5
- 241001494479 Pecora Species 0.000 claims description 5
- 102100035283 Tumor necrosis factor ligand superfamily member 18 Human genes 0.000 claims description 5
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 claims description 5
- 208000025402 neoplasm of esophagus Diseases 0.000 claims description 5
- 239000003053 toxin Substances 0.000 claims description 5
- 231100000765 toxin Toxicity 0.000 claims description 5
- 108700012359 toxins Proteins 0.000 claims description 5
- 108010074708 B7-H1 Antigen Proteins 0.000 claims description 4
- 108010021064 CTLA-4 Antigen Proteins 0.000 claims description 4
- 229940045513 CTLA4 antagonist Drugs 0.000 claims description 4
- 206010061968 Gastric neoplasm Diseases 0.000 claims description 4
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 claims description 4
- 101000884279 Homo sapiens CD276 antigen Proteins 0.000 claims description 4
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 claims description 4
- 101001019455 Homo sapiens ICOS ligand Proteins 0.000 claims description 4
- 101001055145 Homo sapiens Interleukin-2 receptor subunit beta Proteins 0.000 claims description 4
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 claims description 4
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 claims description 4
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 claims description 4
- 102100034980 ICOS ligand Human genes 0.000 claims description 4
- 102100026879 Interleukin-2 receptor subunit beta Human genes 0.000 claims description 4
- 101150030213 Lag3 gene Proteins 0.000 claims description 4
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 claims description 4
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 claims description 4
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 claims description 4
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 claims description 4
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 claims description 4
- 230000001575 pathological effect Effects 0.000 claims description 4
- 239000008177 pharmaceutical agent Substances 0.000 claims description 4
- 239000000651 prodrug Substances 0.000 claims description 4
- 229940002612 prodrug Drugs 0.000 claims description 4
- 230000003115 biocidal effect Effects 0.000 claims description 3
- 238000011144 upstream manufacturing Methods 0.000 claims description 3
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 claims description 2
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 claims description 2
- 239000003242 anti bacterial agent Substances 0.000 claims description 2
- 229940127121 immunoconjugate Drugs 0.000 claims description 2
- 210000004072 lung Anatomy 0.000 claims description 2
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 claims 2
- 101000679575 Homo sapiens Trafficking protein particle complex subunit 2 Proteins 0.000 claims 2
- 102100038005 Immunoglobulin alpha Fc receptor Human genes 0.000 claims 2
- 102100022613 Trafficking protein particle complex subunit 2 Human genes 0.000 claims 2
- 230000008512 biological response Effects 0.000 claims 1
- 239000003607 modifier Substances 0.000 claims 1
- 206010060862 Prostate cancer Diseases 0.000 abstract description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 abstract description 3
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 79
- 235000018102 proteins Nutrition 0.000 description 79
- 230000014509 gene expression Effects 0.000 description 58
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 description 44
- 235000001014 amino acid Nutrition 0.000 description 41
- 229940024606 amino acid Drugs 0.000 description 37
- 210000004408 hybridoma Anatomy 0.000 description 33
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 32
- 210000001519 tissue Anatomy 0.000 description 32
- 230000009258 tissue cross reactivity Effects 0.000 description 32
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 31
- 201000010099 disease Diseases 0.000 description 31
- 210000003719 b-lymphocyte Anatomy 0.000 description 28
- 238000005516 engineering process Methods 0.000 description 28
- 238000011282 treatment Methods 0.000 description 27
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 23
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 23
- 241000699666 Mus <mouse, genus> Species 0.000 description 20
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 18
- 108020004414 DNA Proteins 0.000 description 18
- 125000003729 nucleotide group Chemical group 0.000 description 17
- 238000003556 assay Methods 0.000 description 16
- 239000002953 phosphate buffered saline Substances 0.000 description 15
- 230000006870 function Effects 0.000 description 14
- 208000032839 leukemia Diseases 0.000 description 14
- 238000004519 manufacturing process Methods 0.000 description 14
- 230000004913 activation Effects 0.000 description 13
- 210000002865 immune cell Anatomy 0.000 description 13
- 239000002773 nucleotide Substances 0.000 description 13
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 12
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 12
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 12
- 102100034343 Integrase Human genes 0.000 description 12
- 239000000872 buffer Substances 0.000 description 12
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 12
- 150000001875 compounds Chemical class 0.000 description 12
- 229940088598 enzyme Drugs 0.000 description 12
- 238000004806 packaging method and process Methods 0.000 description 12
- 241000894007 species Species 0.000 description 12
- 108091033409 CRISPR Proteins 0.000 description 11
- 241000699670 Mus sp. Species 0.000 description 11
- 230000003834 intracellular effect Effects 0.000 description 11
- 238000010354 CRISPR gene editing Methods 0.000 description 10
- 230000008827 biological function Effects 0.000 description 10
- 230000001413 cellular effect Effects 0.000 description 10
- 239000003153 chemical reaction reagent Substances 0.000 description 10
- 210000004698 lymphocyte Anatomy 0.000 description 10
- 239000000463 material Substances 0.000 description 10
- 230000008569 process Effects 0.000 description 10
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 9
- 239000002671 adjuvant Substances 0.000 description 9
- 239000000969 carrier Substances 0.000 description 9
- 238000003384 imaging method Methods 0.000 description 9
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 8
- 108091012583 BCL2 Proteins 0.000 description 8
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 8
- 108020005004 Guide RNA Proteins 0.000 description 8
- 108091008874 T cell receptors Proteins 0.000 description 8
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 238000011534 incubation Methods 0.000 description 8
- 230000001939 inductive effect Effects 0.000 description 8
- 230000000670 limiting effect Effects 0.000 description 8
- 230000001225 therapeutic effect Effects 0.000 description 8
- 238000013518 transcription Methods 0.000 description 8
- 230000035897 transcription Effects 0.000 description 8
- 230000003612 virological effect Effects 0.000 description 8
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 7
- 241000282465 Canis Species 0.000 description 7
- 102000004127 Cytokines Human genes 0.000 description 7
- 108090000695 Cytokines Proteins 0.000 description 7
- 241000282324 Felis Species 0.000 description 7
- 206010025323 Lymphomas Diseases 0.000 description 7
- 230000001086 cytosolic effect Effects 0.000 description 7
- 238000009093 first-line therapy Methods 0.000 description 7
- 108020001507 fusion proteins Proteins 0.000 description 7
- 102000037865 fusion proteins Human genes 0.000 description 7
- 238000009396 hybridization Methods 0.000 description 7
- 239000003446 ligand Substances 0.000 description 7
- 108020004999 messenger RNA Proteins 0.000 description 7
- 239000000546 pharmaceutical excipient Substances 0.000 description 7
- 238000012216 screening Methods 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 238000012360 testing method Methods 0.000 description 7
- 241001430294 unidentified retrovirus Species 0.000 description 7
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 6
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 6
- 241000725303 Human immunodeficiency virus Species 0.000 description 6
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 6
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 6
- 108010038807 Oligopeptides Proteins 0.000 description 6
- 102000015636 Oligopeptides Human genes 0.000 description 6
- 238000001042 affinity chromatography Methods 0.000 description 6
- 150000001720 carbohydrates Chemical class 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 238000012217 deletion Methods 0.000 description 6
- 230000037430 deletion Effects 0.000 description 6
- 239000003937 drug carrier Substances 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 238000003018 immunoassay Methods 0.000 description 6
- 238000001727 in vivo Methods 0.000 description 6
- 238000002372 labelling Methods 0.000 description 6
- 210000004962 mammalian cell Anatomy 0.000 description 6
- 230000004048 modification Effects 0.000 description 6
- 238000012986 modification Methods 0.000 description 6
- 239000002245 particle Substances 0.000 description 6
- 238000002823 phage display Methods 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 239000003755 preservative agent Substances 0.000 description 6
- 230000010076 replication Effects 0.000 description 6
- 238000000926 separation method Methods 0.000 description 6
- 238000006467 substitution reaction Methods 0.000 description 6
- 230000008685 targeting Effects 0.000 description 6
- 210000004881 tumor cell Anatomy 0.000 description 6
- 241000196324 Embryophyta Species 0.000 description 5
- 239000004471 Glycine Substances 0.000 description 5
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 5
- 108020004511 Recombinant DNA Proteins 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 235000014633 carbohydrates Nutrition 0.000 description 5
- 238000004113 cell culture Methods 0.000 description 5
- 238000004587 chromatography analysis Methods 0.000 description 5
- 239000003085 diluting agent Substances 0.000 description 5
- 230000004927 fusion Effects 0.000 description 5
- 238000001114 immunoprecipitation Methods 0.000 description 5
- 230000004068 intracellular signaling Effects 0.000 description 5
- 238000002955 isolation Methods 0.000 description 5
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 5
- 239000008194 pharmaceutical composition Substances 0.000 description 5
- 210000004986 primary T-cell Anatomy 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 230000002285 radioactive effect Effects 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 108091079001 CRISPR RNA Proteins 0.000 description 4
- 241000282472 Canis lupus familiaris Species 0.000 description 4
- 206010009944 Colon cancer Diseases 0.000 description 4
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 4
- 229920002307 Dextran Polymers 0.000 description 4
- 241000713730 Equine infectious anemia virus Species 0.000 description 4
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 4
- 208000036566 Erythroleukaemia Diseases 0.000 description 4
- 241000713800 Feline immunodeficiency virus Species 0.000 description 4
- 241000713813 Gibbon ape leukemia virus Species 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 description 4
- 241000713869 Moloney murine leukemia virus Species 0.000 description 4
- 241000288906 Primates Species 0.000 description 4
- 241000713311 Simian immunodeficiency virus Species 0.000 description 4
- 108091027967 Small hairpin RNA Proteins 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 208000021841 acute erythroid leukemia Diseases 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 238000002512 chemotherapy Methods 0.000 description 4
- 208000029742 colonic neoplasm Diseases 0.000 description 4
- 230000002950 deficient Effects 0.000 description 4
- 210000004443 dendritic cell Anatomy 0.000 description 4
- 238000002405 diagnostic procedure Methods 0.000 description 4
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 4
- 108010078428 env Gene Products Proteins 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 210000002540 macrophage Anatomy 0.000 description 4
- 244000005700 microbiome Species 0.000 description 4
- 210000001616 monocyte Anatomy 0.000 description 4
- 210000000056 organ Anatomy 0.000 description 4
- 230000037361 pathway Effects 0.000 description 4
- 229920001282 polysaccharide Polymers 0.000 description 4
- 238000003127 radioimmunoassay Methods 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 210000000952 spleen Anatomy 0.000 description 4
- 235000000346 sugar Nutrition 0.000 description 4
- 150000008163 sugars Chemical class 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 238000010361 transduction Methods 0.000 description 4
- 230000026683 transduction Effects 0.000 description 4
- 238000013519 translation Methods 0.000 description 4
- 230000014616 translation Effects 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- 239000004475 Arginine Substances 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 3
- 102000011727 Caspases Human genes 0.000 description 3
- 108010076667 Caspases Proteins 0.000 description 3
- 101710094648 Coat protein Proteins 0.000 description 3
- 108020004635 Complementary DNA Proteins 0.000 description 3
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 3
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 3
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 3
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 3
- 102000008100 Human Serum Albumin Human genes 0.000 description 3
- 108091006905 Human Serum Albumin Proteins 0.000 description 3
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 3
- 102100034353 Integrase Human genes 0.000 description 3
- 102000002698 KIR Receptors Human genes 0.000 description 3
- 108010043610 KIR Receptors Proteins 0.000 description 3
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- 241000713666 Lentivirus Species 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 3
- 229930195725 Mannitol Natural products 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- 241000714177 Murine leukemia virus Species 0.000 description 3
- 238000005481 NMR spectroscopy Methods 0.000 description 3
- 239000004698 Polyethylene Substances 0.000 description 3
- 108010029485 Protein Isoforms Proteins 0.000 description 3
- 102000001708 Protein Isoforms Human genes 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 229920002684 Sepharose Polymers 0.000 description 3
- 108020004459 Small interfering RNA Proteins 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 3
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 3
- 229940123237 Taxane Drugs 0.000 description 3
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 3
- 229940122803 Vinca alkaloid Drugs 0.000 description 3
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 3
- 230000000340 anti-metabolite Effects 0.000 description 3
- 229940100197 antimetabolite Drugs 0.000 description 3
- 239000002256 antimetabolite Substances 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 239000011324 bead Substances 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 235000020958 biotin Nutrition 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 210000001124 body fluid Anatomy 0.000 description 3
- 239000010839 body fluid Substances 0.000 description 3
- 210000001185 bone marrow Anatomy 0.000 description 3
- 230000022131 cell cycle Effects 0.000 description 3
- 238000002659 cell therapy Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 210000001072 colon Anatomy 0.000 description 3
- 239000013068 control sample Substances 0.000 description 3
- 238000007796 conventional method Methods 0.000 description 3
- 231100000599 cytotoxic agent Toxicity 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 3
- 239000012636 effector Substances 0.000 description 3
- 108700004025 env Genes Proteins 0.000 description 3
- 239000000284 extract Substances 0.000 description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 230000009368 gene silencing by RNA Effects 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 238000010362 genome editing Methods 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 150000004676 glycans Chemical class 0.000 description 3
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 239000000367 immunologic factor Substances 0.000 description 3
- 230000004957 immunoregulator effect Effects 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 230000010354 integration Effects 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 3
- 239000000594 mannitol Substances 0.000 description 3
- 235000010355 mannitol Nutrition 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 108091070501 miRNA Proteins 0.000 description 3
- 239000002679 microRNA Substances 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 210000000066 myeloid cell Anatomy 0.000 description 3
- 229920001542 oligosaccharide Polymers 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 210000002381 plasma Anatomy 0.000 description 3
- 239000005017 polysaccharide Substances 0.000 description 3
- 230000002335 preservative effect Effects 0.000 description 3
- 230000005855 radiation Effects 0.000 description 3
- 238000001959 radiotherapy Methods 0.000 description 3
- 206010038038 rectal cancer Diseases 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 230000000284 resting effect Effects 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000002924 silencing RNA Substances 0.000 description 3
- 239000004055 small Interfering RNA Substances 0.000 description 3
- 150000003384 small molecules Chemical class 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- 208000030507 AIDS Diseases 0.000 description 2
- 101500002116 Agrotis ipsilon Tachykinin-related peptide 6 Proteins 0.000 description 2
- 244000105975 Antidesma platyphyllum Species 0.000 description 2
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 2
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 2
- 206010004593 Bile duct cancer Diseases 0.000 description 2
- 206010005003 Bladder cancer Diseases 0.000 description 2
- 241000167854 Bourreria succulenta Species 0.000 description 2
- 241000713704 Bovine immunodeficiency virus Species 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 2
- 101150109517 Camlg gene Proteins 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 241000713756 Caprine arthritis encephalitis virus Species 0.000 description 2
- 108090000994 Catalytic RNA Proteins 0.000 description 2
- 102000053642 Catalytic RNA Human genes 0.000 description 2
- 102100040835 Claudin-18 Human genes 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 208000002699 Digestive System Neoplasms Diseases 0.000 description 2
- 101100166531 Drosophila melanogaster CycC gene Proteins 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 238000012286 ELISA Assay Methods 0.000 description 2
- 206010014733 Endometrial cancer Diseases 0.000 description 2
- 206010014759 Endometrial neoplasm Diseases 0.000 description 2
- 101710177291 Gag polyprotein Proteins 0.000 description 2
- 241000126130 Ganymedes Species 0.000 description 2
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 2
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 2
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 2
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 2
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 2
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 2
- 101150024129 IGKV4-1 gene Proteins 0.000 description 2
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 2
- 108010061833 Integrases Proteins 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 206010024305 Leukaemia monocytic Diseases 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 101710125418 Major capsid protein Proteins 0.000 description 2
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 101710101148 Probable 6-oxopurine nucleoside phosphorylase Proteins 0.000 description 2
- 102000030764 Purine-nucleoside phosphorylase Human genes 0.000 description 2
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- 108091028664 Ribonucleotide Proteins 0.000 description 2
- 241000714474 Rous sarcoma virus Species 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 206010041067 Small cell lung cancer Diseases 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- 208000031673 T-Cell Cutaneous Lymphoma Diseases 0.000 description 2
- 208000024770 Thyroid neoplasm Diseases 0.000 description 2
- 101710183280 Topoisomerase Proteins 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 2
- 206010046431 Urethral cancer Diseases 0.000 description 2
- 206010046458 Urethral neoplasms Diseases 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- 241000713325 Visna/maedi virus Species 0.000 description 2
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 229930013930 alkaloid Natural products 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- 229940125644 antibody drug Drugs 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 210000003445 biliary tract Anatomy 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 238000001574 biopsy Methods 0.000 description 2
- 239000007975 buffered saline Substances 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 230000020411 cell activation Effects 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- 235000019693 cherries Nutrition 0.000 description 2
- 239000000562 conjugate Substances 0.000 description 2
- 239000000356 contaminant Substances 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 238000000315 cryotherapy Methods 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 201000007241 cutaneous T cell lymphoma Diseases 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 239000002254 cytotoxic agent Substances 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 239000005547 deoxyribonucleotide Substances 0.000 description 2
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 2
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 2
- 229960005420 etoposide Drugs 0.000 description 2
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 210000004475 gamma-delta t lymphocyte Anatomy 0.000 description 2
- 201000010231 gastrointestinal system cancer Diseases 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 238000012239 gene modification Methods 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 230000005017 genetic modification Effects 0.000 description 2
- 235000013617 genetically modified food Nutrition 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- KWIUHFFTVRNATP-UHFFFAOYSA-N glycine betaine Chemical compound C[N+](C)(C)CC([O-])=O KWIUHFFTVRNATP-UHFFFAOYSA-N 0.000 description 2
- 235000009424 haa Nutrition 0.000 description 2
- 201000010536 head and neck cancer Diseases 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 230000004727 humoral immunity Effects 0.000 description 2
- 229910052739 hydrogen Inorganic materials 0.000 description 2
- 239000001257 hydrogen Substances 0.000 description 2
- 210000002861 immature t-cell Anatomy 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 230000003308 immunostimulating effect Effects 0.000 description 2
- 238000011503 in vivo imaging Methods 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000011221 initial treatment Methods 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 230000005865 ionizing radiation Effects 0.000 description 2
- 229960004768 irinotecan Drugs 0.000 description 2
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- 210000003292 kidney cell Anatomy 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- 201000005296 lung carcinoma Diseases 0.000 description 2
- 210000001165 lymph node Anatomy 0.000 description 2
- 201000001441 melanoma Diseases 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 201000006894 monocytic leukemia Diseases 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- 201000005962 mycosis fungoides Diseases 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- 230000006780 non-homologous end joining Effects 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 238000007899 nucleic acid hybridization Methods 0.000 description 2
- 238000002515 oligonucleotide synthesis Methods 0.000 description 2
- 150000002482 oligosaccharides Chemical class 0.000 description 2
- 238000011275 oncology therapy Methods 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 210000003463 organelle Anatomy 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000000816 peptidomimetic Substances 0.000 description 2
- 108700004029 pol Genes Proteins 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 229920000136 polysorbate Polymers 0.000 description 2
- 208000025638 primary cutaneous T-cell non-Hodgkin lymphoma Diseases 0.000 description 2
- 238000002601 radiography Methods 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 201000001275 rectum cancer Diseases 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 201000006845 reticulosarcoma Diseases 0.000 description 2
- 208000029922 reticulum cell sarcoma Diseases 0.000 description 2
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 125000002652 ribonucleotide group Chemical group 0.000 description 2
- 108091092562 ribozyme Proteins 0.000 description 2
- 102220250618 rs1417236795 Human genes 0.000 description 2
- 102220192602 rs145106685 Human genes 0.000 description 2
- 102200033501 rs387907005 Human genes 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 238000009094 second-line therapy Methods 0.000 description 2
- 238000013207 serial dilution Methods 0.000 description 2
- 208000000587 small cell lung carcinoma Diseases 0.000 description 2
- 150000005846 sugar alcohols Chemical class 0.000 description 2
- 239000013589 supplement Substances 0.000 description 2
- 210000001541 thymus gland Anatomy 0.000 description 2
- 201000002510 thyroid cancer Diseases 0.000 description 2
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 2
- 238000004448 titration Methods 0.000 description 2
- 229960000303 topotecan Drugs 0.000 description 2
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 241001515965 unidentified phage Species 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- OPUPHQHVRPYOTC-UHFFFAOYSA-N vgf3hm1rrf Chemical compound C1=NC(C(=O)C=2C3=CC=CN=2)=C2C3=NC=CC2=C1 OPUPHQHVRPYOTC-UHFFFAOYSA-N 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 239000000811 xylitol Substances 0.000 description 2
- 235000010447 xylitol Nutrition 0.000 description 2
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 2
- 229960002675 xylitol Drugs 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- HKZAAJSTFUZYTO-LURJTMIESA-N (2s)-2-[[2-[[2-[[2-[(2-aminoacetyl)amino]acetyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoic acid Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O HKZAAJSTFUZYTO-LURJTMIESA-N 0.000 description 1
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- AGNGYMCLFWQVGX-AGFFZDDWSA-N (e)-1-[(2s)-2-amino-2-carboxyethoxy]-2-diazonioethenolate Chemical compound OC(=O)[C@@H](N)CO\C([O-])=C\[N+]#N AGNGYMCLFWQVGX-AGFFZDDWSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- UFBJCMHMOXMLKC-UHFFFAOYSA-N 2,4-dinitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O UFBJCMHMOXMLKC-UHFFFAOYSA-N 0.000 description 1
- 125000001917 2,4-dinitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C(=C1*)[N+]([O-])=O)[N+]([O-])=O 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- IYKLQEMQEGWXOQ-UHFFFAOYSA-N 3-(7-amino-4-chloro-1-oxoisochromen-3-yl)oxypropyl carbamimidothioate Chemical compound NC1=CC=C2C(Cl)=C(OCCCSC(=N)N)OC(=O)C2=C1 IYKLQEMQEGWXOQ-UHFFFAOYSA-N 0.000 description 1
- 108010082808 4-1BB Ligand Proteins 0.000 description 1
- CKRLIWFOVCLXTP-UHFFFAOYSA-N 4-phenyl-1-propyl-3,6-dihydro-2h-pyridine Chemical compound C1N(CCC)CCC(C=2C=CC=CC=2)=C1 CKRLIWFOVCLXTP-UHFFFAOYSA-N 0.000 description 1
- 102100022464 5'-nucleotidase Human genes 0.000 description 1
- 102100031126 6-phosphogluconolactonase Human genes 0.000 description 1
- 108010029731 6-phosphogluconolactonase Proteins 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- 102100039819 Actin, alpha cardiac muscle 1 Human genes 0.000 description 1
- 229940080778 Adenosine deaminase inhibitor Drugs 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102100025683 Alkaline phosphatase, tissue-nonspecific isozyme Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 102000013142 Amylases Human genes 0.000 description 1
- 108010065511 Amylases Proteins 0.000 description 1
- 208000002267 Anti-neutrophil cytoplasmic antibody-associated vasculitis Diseases 0.000 description 1
- 101000651036 Arabidopsis thaliana Galactolipid galactosyltransferase SFR2, chloroplastic Proteins 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 108010011485 Aspartame Proteins 0.000 description 1
- 102100039339 Atrial natriuretic peptide receptor 1 Human genes 0.000 description 1
- 101710102163 Atrial natriuretic peptide receptor 1 Proteins 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 108091008875 B cell receptors Proteins 0.000 description 1
- NTTIDCCSYIDANP-UHFFFAOYSA-N BCCP Chemical compound BCCP NTTIDCCSYIDANP-UHFFFAOYSA-N 0.000 description 1
- 101710201279 Biotin carboxyl carrier protein Proteins 0.000 description 1
- 101710180532 Biotin carboxyl carrier protein of acetyl-CoA carboxylase Proteins 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 108010046080 CD27 Ligand Proteins 0.000 description 1
- 101710185679 CD276 antigen Proteins 0.000 description 1
- 210000004366 CD4-positive T-lymphocyte Anatomy 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 102100035793 CD83 antigen Human genes 0.000 description 1
- 238000010453 CRISPR/Cas method Methods 0.000 description 1
- 241000759905 Camptotheca acuminata Species 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 102000013392 Carboxylesterase Human genes 0.000 description 1
- 108010051152 Carboxylesterase Proteins 0.000 description 1
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 241000208328 Catharanthus Species 0.000 description 1
- 241000251730 Chondrichthyes Species 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 108050009324 Claudin-18 Proteins 0.000 description 1
- 102100031673 Corneodesmosin Human genes 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 108010015742 Cytochrome P-450 Enzyme System Proteins 0.000 description 1
- 102000003849 Cytochrome P450 Human genes 0.000 description 1
- 108010080611 Cytosine Deaminase Proteins 0.000 description 1
- 102000000311 Cytosine Deaminase Human genes 0.000 description 1
- 101710112752 Cytotoxin Proteins 0.000 description 1
- GUBGYTABKSRVRQ-CUHNMECISA-N D-Cellobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-CUHNMECISA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- QWIZNVHXZXRPDR-UHFFFAOYSA-N D-melezitose Natural products O1C(CO)C(O)C(O)C(O)C1OC1C(O)C(CO)OC1(CO)OC1OC(CO)C(O)C(O)C1O QWIZNVHXZXRPDR-UHFFFAOYSA-N 0.000 description 1
- 108020003215 DNA Probes Proteins 0.000 description 1
- 102000003915 DNA Topoisomerases Human genes 0.000 description 1
- 108090000323 DNA Topoisomerases Proteins 0.000 description 1
- 239000003298 DNA probe Substances 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 229940123780 DNA topoisomerase I inhibitor Drugs 0.000 description 1
- 229940124087 DNA topoisomerase II inhibitor Drugs 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 1
- 101100278318 Dictyostelium discoideum dohh-2 gene Proteins 0.000 description 1
- SHIBSTMRCDJXLN-UHFFFAOYSA-N Digoxigenin Natural products C1CC(C2C(C3(C)CCC(O)CC3CC2)CC2O)(O)C2(C)C1C1=CC(=O)OC1 SHIBSTMRCDJXLN-UHFFFAOYSA-N 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 101150016325 EPHA3 gene Proteins 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 102100030324 Ephrin type-A receptor 3 Human genes 0.000 description 1
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 description 1
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 206010073306 Exposure to radiation Diseases 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- 108091006027 G proteins Proteins 0.000 description 1
- 102000030782 GTP binding Human genes 0.000 description 1
- 108091000058 GTP-Binding Proteins 0.000 description 1
- 102000002464 Galactosidases Human genes 0.000 description 1
- 108010093031 Galactosidases Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 206010056740 Genital discharge Diseases 0.000 description 1
- 101100118916 Gibbon ape leukemia virus env gene Proteins 0.000 description 1
- 101710088083 Glomulin Proteins 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010018962 Glucosephosphate Dehydrogenase Proteins 0.000 description 1
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 101000678236 Homo sapiens 5'-nucleotidase Proteins 0.000 description 1
- 101000959247 Homo sapiens Actin, alpha cardiac muscle 1 Proteins 0.000 description 1
- 101000574445 Homo sapiens Alkaline phosphatase, tissue-nonspecific isozyme Proteins 0.000 description 1
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 1
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 description 1
- 101000749329 Homo sapiens Claudin-18 Proteins 0.000 description 1
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 1
- 101001034652 Homo sapiens Insulin-like growth factor 1 receptor Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 1
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000617823 Homo sapiens Solute carrier organic anion transporter family member 6A1 Proteins 0.000 description 1
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101100207070 Homo sapiens TNFSF8 gene Proteins 0.000 description 1
- 101000610605 Homo sapiens Tumor necrosis factor receptor superfamily member 10A Proteins 0.000 description 1
- 101000610604 Homo sapiens Tumor necrosis factor receptor superfamily member 10B Proteins 0.000 description 1
- 241000598436 Human T-cell lymphotropic virus Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 1
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 1
- 101710203526 Integrase Proteins 0.000 description 1
- 102000003816 Interleukin-13 Human genes 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 102000003812 Interleukin-15 Human genes 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- LKDRXBCSQODPBY-AMVSKUEXSA-N L-(-)-Sorbose Chemical compound OCC1(O)OC[C@H](O)[C@@H](O)[C@@H]1O LKDRXBCSQODPBY-AMVSKUEXSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 1
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 1
- 229920002774 Maltodextrin Polymers 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 241000713862 Moloney murine sarcoma virus Species 0.000 description 1
- 102000015728 Mucins Human genes 0.000 description 1
- 108010063954 Mucins Proteins 0.000 description 1
- 101000946846 Mus musculus T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 1
- 101100207071 Mus musculus Tnfsf8 gene Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 1
- 241000772415 Neovison vison Species 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 102000004459 Nitroreductase Human genes 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 108090001074 Nucleocapsid Proteins Proteins 0.000 description 1
- 241001195348 Nusa Species 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 240000007019 Oxalis corniculata Species 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 235000008562 Podophyllum peltatum Nutrition 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102100023832 Prolyl endopeptidase FAP Human genes 0.000 description 1
- 229940096437 Protein S Drugs 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 102000014128 RANK Ligand Human genes 0.000 description 1
- 108010025832 RANK Ligand Proteins 0.000 description 1
- 108091034057 RNA (poly(A)) Proteins 0.000 description 1
- 108091030071 RNAI Proteins 0.000 description 1
- 101001039269 Rattus norvegicus Glycine N-methyltransferase Proteins 0.000 description 1
- 101000946847 Rattus norvegicus T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 1
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 230000018199 S phase Effects 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 241000713880 Spleen focus-forming virus Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 208000000389 T-cell leukemia Diseases 0.000 description 1
- 208000028530 T-cell lymphoblastic leukemia/lymphoma Diseases 0.000 description 1
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 241001116500 Taxus Species 0.000 description 1
- 241000015728 Taxus canadensis Species 0.000 description 1
- GKLVYJBZJHMRIY-OUBTZVSYSA-N Technetium-99 Chemical compound [99Tc] GKLVYJBZJHMRIY-OUBTZVSYSA-N 0.000 description 1
- 102100038126 Tenascin Human genes 0.000 description 1
- 108010008125 Tenascin Proteins 0.000 description 1
- 102000002933 Thioredoxin Human genes 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 102000000591 Tight Junction Proteins Human genes 0.000 description 1
- 108010002321 Tight Junction Proteins Proteins 0.000 description 1
- 239000000365 Topoisomerase I Inhibitor Substances 0.000 description 1
- 239000000317 Topoisomerase II Inhibitor Substances 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- GYDJEQRTZSCIOI-UHFFFAOYSA-N Tranexamic acid Chemical compound NCC1CCC(C(O)=O)CC1 GYDJEQRTZSCIOI-UHFFFAOYSA-N 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 101710195626 Transcriptional activator protein Proteins 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 102100032100 Tumor necrosis factor ligand superfamily member 8 Human genes 0.000 description 1
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 description 1
- 102100040113 Tumor necrosis factor receptor superfamily member 10A Human genes 0.000 description 1
- 102100040112 Tumor necrosis factor receptor superfamily member 10B Human genes 0.000 description 1
- 102000007537 Type II DNA Topoisomerases Human genes 0.000 description 1
- 108010046308 Type II DNA Topoisomerases Proteins 0.000 description 1
- 108091008605 VEGF receptors Proteins 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- 241000863480 Vinca Species 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 108010031318 Vitronectin Proteins 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 210000005006 adaptive immune system Anatomy 0.000 description 1
- 239000002487 adenosine deaminase inhibitor Substances 0.000 description 1
- 238000005377 adsorption chromatography Methods 0.000 description 1
- GZCGUPFRVQAUEE-KVTDHHQDSA-N aldehydo-D-mannose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O GZCGUPFRVQAUEE-KVTDHHQDSA-N 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 238000004082 amperometric method Methods 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- 235000019418 amylase Nutrition 0.000 description 1
- 229940025131 amylases Drugs 0.000 description 1
- 239000002269 analeptic agent Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 229940044684 anti-microtubule agent Drugs 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 238000011091 antibody purification Methods 0.000 description 1
- 230000009831 antigen interaction Effects 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 210000000612 antigen-presenting cell Anatomy 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- IAOZJIPTCAWIRG-QWRGUYRKSA-N aspartame Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(=O)OC)CC1=CC=CC=C1 IAOZJIPTCAWIRG-QWRGUYRKSA-N 0.000 description 1
- 239000000605 aspartame Substances 0.000 description 1
- 235000010357 aspartame Nutrition 0.000 description 1
- 229960003438 aspartame Drugs 0.000 description 1
- 238000002820 assay format Methods 0.000 description 1
- 238000000594 atomic force spectroscopy Methods 0.000 description 1
- 229950011321 azaserine Drugs 0.000 description 1
- 229910052788 barium Inorganic materials 0.000 description 1
- DSAJWYNOEDNPEQ-UHFFFAOYSA-N barium atom Chemical compound [Ba] DSAJWYNOEDNPEQ-UHFFFAOYSA-N 0.000 description 1
- 230000037429 base substitution Effects 0.000 description 1
- 210000003651 basophil Anatomy 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 229960003237 betaine Drugs 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- 210000004900 c-terminal fragment Anatomy 0.000 description 1
- 229910052792 caesium Inorganic materials 0.000 description 1
- TVFDJXOCXUVLDH-UHFFFAOYSA-N caesium atom Chemical compound [Cs] TVFDJXOCXUVLDH-UHFFFAOYSA-N 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 210000000234 capsid Anatomy 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000015861 cell surface binding Effects 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000012707 chemical precursor Substances 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 238000009104 chemotherapy regimen Methods 0.000 description 1
- 108700010039 chimeric receptor Proteins 0.000 description 1
- 102000021178 chitin binding proteins Human genes 0.000 description 1
- 108091011157 chitin binding proteins Proteins 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000004737 colorimetric analysis Methods 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 230000009918 complex formation Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- NKLPQNGYXWVELD-UHFFFAOYSA-M coomassie brilliant blue Chemical compound [Na+].C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=2C=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=C1 NKLPQNGYXWVELD-UHFFFAOYSA-M 0.000 description 1
- 239000013256 coordination polymer Substances 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 208000031513 cyst Diseases 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 230000002435 cytoreductive effect Effects 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 229910052805 deuterium Inorganic materials 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 1
- SHIBSTMRCDJXLN-KCZCNTNESA-N digoxigenin Chemical compound C1([C@@H]2[C@@]3([C@@](CC2)(O)[C@H]2[C@@H]([C@@]4(C)CC[C@H](O)C[C@H]4CC2)C[C@H]3O)C)=CC(=O)OC1 SHIBSTMRCDJXLN-KCZCNTNESA-N 0.000 description 1
- 238000003113 dilution method Methods 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 238000007877 drug screening Methods 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- 238000000804 electron spin resonance spectroscopy Methods 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 101150030339 env gene Proteins 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000003979 eosinophil Anatomy 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 229960000752 etoposide phosphate Drugs 0.000 description 1
- LIQODXNTTZAGID-OCBXBXKTSA-N etoposide phosphate Chemical compound COC1=C(OP(O)(O)=O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 LIQODXNTTZAGID-OCBXBXKTSA-N 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 201000007386 factor VII deficiency Diseases 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 230000004761 fibrosis Effects 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 239000004052 folic acid antagonist Substances 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000005021 gait Effects 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000001641 gel filtration chromatography Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 108091008039 hormone receptors Proteins 0.000 description 1
- 230000005745 host immune response Effects 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 230000002631 hypothermal effect Effects 0.000 description 1
- 210000001822 immobilized cell Anatomy 0.000 description 1
- 230000008102 immune modulation Effects 0.000 description 1
- 108091008915 immune receptors Proteins 0.000 description 1
- 102000027596 immune receptors Human genes 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 230000007813 immunodeficiency Effects 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000002055 immunohistochemical effect Effects 0.000 description 1
- 238000013198 immunometric assay Methods 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 230000002584 immunomodulator Effects 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 239000002596 immunotoxin Substances 0.000 description 1
- 229910052738 indium Inorganic materials 0.000 description 1
- APFVFJFRJDLVQX-UHFFFAOYSA-N indium atom Chemical compound [In] APFVFJFRJDLVQX-UHFFFAOYSA-N 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 1
- 229960000367 inositol Drugs 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 239000011630 iodine Substances 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- SZVJSHCCFOBDDC-UHFFFAOYSA-N iron(II,III) oxide Inorganic materials O=[Fe]O[Fe]O[Fe]=O SZVJSHCCFOBDDC-UHFFFAOYSA-N 0.000 description 1
- 238000001155 isoelectric focusing Methods 0.000 description 1
- 101150066555 lacZ gene Proteins 0.000 description 1
- 239000000832 lactitol Substances 0.000 description 1
- 235000010448 lactitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-JVCRWLNRSA-N lactitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-JVCRWLNRSA-N 0.000 description 1
- 229960003451 lactitol Drugs 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 229940040129 luteinizing hormone Drugs 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 239000000845 maltitol Substances 0.000 description 1
- 235000010449 maltitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-WUJBLJFYSA-N maltitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-WUJBLJFYSA-N 0.000 description 1
- 229940035436 maltitol Drugs 0.000 description 1
- 229960001855 mannitol Drugs 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- QWIZNVHXZXRPDR-WSCXOGSTSA-N melezitose Chemical compound O([C@@]1(O[C@@H]([C@H]([C@@H]1O[C@@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)O)CO)CO)[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O QWIZNVHXZXRPDR-WSCXOGSTSA-N 0.000 description 1
- 210000001806 memory b lymphocyte Anatomy 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 239000011325 microbead Substances 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 229940051875 mucins Drugs 0.000 description 1
- 210000004898 n-terminal fragment Anatomy 0.000 description 1
- 210000000581 natural killer T-cell Anatomy 0.000 description 1
- 229960000801 nelarabine Drugs 0.000 description 1
- IXOXBSCIXZEQEQ-UHTZMRCNSA-N nelarabine Chemical compound C1=NC=2C(OC)=NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O IXOXBSCIXZEQEQ-UHTZMRCNSA-N 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 108020001162 nitroreductase Proteins 0.000 description 1
- 230000000683 nonmetastatic effect Effects 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 230000009437 off-target effect Effects 0.000 description 1
- 238000012858 packaging process Methods 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 230000003071 parasitic effect Effects 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 230000006461 physiological response Effects 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 108010089520 pol Gene Products Proteins 0.000 description 1
- 101150088264 pol gene Proteins 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920000447 polyanionic polymer Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000001566 pro-viral effect Effects 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 238000012514 protein characterization Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 239000000649 purine antagonist Substances 0.000 description 1
- 239000003790 pyrimidine antagonist Substances 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 210000003370 receptor cell Anatomy 0.000 description 1
- 230000033300 receptor internalization Effects 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 208000020615 rectal carcinoma Diseases 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 239000013074 reference sample Substances 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 108020004418 ribosomal RNA Proteins 0.000 description 1
- 235000002020 sage Nutrition 0.000 description 1
- 238000003118 sandwich ELISA Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 238000007447 staining method Methods 0.000 description 1
- 238000012289 standard assay Methods 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 210000001768 subcellular fraction Anatomy 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 101150047061 tag-72 gene Proteins 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 238000012956 testing procedure Methods 0.000 description 1
- JGVWCANSWKRBCS-UHFFFAOYSA-N tetramethylrhodamine thiocyanate Chemical compound [Cl-].C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=C(SC#N)C=C1C(O)=O JGVWCANSWKRBCS-UHFFFAOYSA-N 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- 108060008226 thioredoxin Proteins 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 238000009095 third-line therapy Methods 0.000 description 1
- 210000001578 tight junction Anatomy 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 239000011573 trace mineral Substances 0.000 description 1
- 235000013619 trace mineral Nutrition 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 229910052722 tritium Inorganic materials 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 238000004832 voltammetry Methods 0.000 description 1
- 229950007157 zolbetuximab Drugs 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Definitions
- This disclosure relates to novel CLDN 18.2 antibodies and chimeric antigen receptors (CAR) derived therefrom, cells or compositions comprising the same, and methods for using the same for therapy including the treatment of solid tumors.
- CAR chimeric antigen receptors
- Isoform 2 of claudin-l8 (CLDN 18.2), a tight junction molecule, is known to be a selective lineage marker. It has been observed to be expressed in a significant proportion of primary gastric cancers and metastases. Extopic activation has also been seen in pancreatic, esophageal, ovarian, and lung tumors. While it has a highly restricted expression in normal tissues, CLDN 18.2 is ectopically activated in a diversity of cancers. See Sahin et ah, Claudin-l8 splice variant 2 is a pan-cancer target suitable for therapeutic antibody development, Clin. Cancer Res. 2008;l4)23(:7624-34.
- antibodies against this isoform are useful in the treatment of treatment of gastrointestinal (GI) tumors, such as gastric, pancreatic, esophageal, ovarian, and lung tumors (e.g., IMAB362 (claudiximab, developed by Ganymed Pharmaceuticals AG)).
- GI gastrointestinal
- IMAB362 claudiximab, developed by Ganymed Pharmaceuticals AG
- This disclosure provides a novel antibody to CLDN 18.2 and compositions and methods of use thereof. More specifically, this disclosure provides a-new anti-CLDN 18.2 antibodies for the treatment of tumors expressing CLDN 18.2, such as for example, GI tumors that include, but are not limited to, gastric, pancreatic, esophageal, biliary tract, colorectal, colon, rectal, ovarian, and lung carcinomas.
- CLDN 18.2 is highly expressed on the majority of these tumors but has restricted off-target positivity and therefore a desirable safety profile.
- the compositions are particularly useful in the treatment of tumors or cancerous cell that express or overexpress CLDN 18.2.
- the present disclosure provides isolated antibodies, the antibodies comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibodies bind to an epitope of CLDN 18.2.
- the antibodies bind to an epitope of CLDN 18.2, but not CLDN 18.1.
- the antibody is a humanized antibody comprising one or more, two or more, three or more, four or more, five or more, six or more, seven or more or all eight of the CDRs identified in Table 3, with the antibodies disclosed in Table 4.
- the antibodies bind with high specificity, that is they bind to CLDN 18.2 with an affinity of more than 80%, or alternatively more than 85%, or alternatively more than 90%, or alternatively more than 95%, binding for CLDN 18.2-expressing cells versus less than 20%, or alternatively less than 15%, or alternatively less than 10%, or alternatively less than 5% binding to CLDN 18.1. Examples of such are shown in Figs la, lb and 9. There, the antibodies are more sepicific for the CLDN18.2 expressing tumor cells and would have lower toxicity since they do not bind to the CLDN18.1 -expressing normal cells.
- the antibody is a bispecific antibody has a binding specificity to a second target protein.
- the second target protein in some embodiments, is selected from the group consisting of IL-l, CD3, CD16, CD19, CD28, CD47, CD64, PD-l, PD-L1, CTLA-4, LAG-3, CD28, CD122, 4-1BB, TIM3, OX-40, OX40L, CD40, CD40L, LIGHT, ICOS, ICOSL, GITR, GITRL, TIGIT, CD27, VISTA, B7H3, B7H4, HEVM,
- the antibody is comprised in an antibody drug conjuates (ADC) formed between the anitbody and another agent, such as toxin or drug.
- ADC antibody drug conjuates
- the antibodies may be conjugated to therapeutic agents, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, and/or polyethylene glycol (PEG).
- this disclosure provides isolated anti-CLDN 18.2 antibodies or fragments thereof as disclosed herein and a detectable or purification label, alone or in combination with an CLDN 18.2 antigen or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, that in one aspect are bound to each other to form a antigen/antibody complex. Further provided herein is an ex vivo cell comprising this antigen/antibody complex.
- an CLDN 18.2 antigen or fragment e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3
- a chimeric antigen receptor comprising: (a) an antigen binding domain of a CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3); (b) a hinge domain; (c) a
- a chimeric antigen receptor comprising: (a) an antigen binding domain of a CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3); (b) a hinge domain; (c) a CD28 transmembrane domain; (d) one or more costimulatory regions selected from a CD28 costimulatory signaling region, a 4-1BB costimulatory signaling region, an ICOS costimulatory signaling region, and an 0X40 costimulatory region; and (e) a CD3 zeta signaling domain and alternatives thereof.
- a CLDN 18.2 antibody e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3
- a hinge domain e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2,
- the present disclosure provides a chimeric antigen receptor (CAR) comprising: (a) an antigen binding domain of an anti-CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3), (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) a CD28 and/or a 4-1BB costimulatory signaling region; and (e) a CD3 zeta signaling domain and alternatives thereof.
- an antigen binding domain of an anti-CLDN 18.2 antibody e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3
- VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3 e.g., VH1, VH2, VH3, VL1, VL2, VL3,
- the present disclosure provides an isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, chimeric antibody, humanized antibody, bispecific antibody, or the anti-CLDN 18.2 CAR.
- the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, chimeric antibody, bispecific antibody, humanized antibody, or the anti-CLDN 18.2 CAR.
- the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, chimeric antibody, bispecific antibody, humanized antibody, or the anti-CLDN 18.2 CAR.
- the present disclosure provides a composition comprising a carrier and one or more of: the anti-CLDN 18.2 antibody; and/or the bispecific antibody; and/or the chimeric antibody; and/or the humanized antibody; and/or the anti-CLDN 18.2 CAR; and/or the isolated nucleic acid encoding the anti-CLDN 18.2 antibody bispecific antibody, chimeric antibody, humanized antibody, or the anti- CLDN 18.2 CAR; and/or the vector comprising the isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, bispecific antibody, chimeric antibody, humanized antibody, or the anti-CLDN 18.2 CAR; and/or an isolated cell comprising the anti-CLDN 18.2 CAR.
- the disclosure provides a composition comprising, or alternatively consisting essentially of, or yet further consisting of a carrier and one or more of: an antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a nucleic acid encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a vecor comprising the nucleic acid encoding the antibody or fragment (e.g., VH1, VH2, VH3,
- VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof an isolated cell comprising an anti-CLDN 18.2 CAR and/or a polynucleotide encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof; and/or the isolated nucleic acid encoding the CAR; and/or the vector comprising the nucleic acid encoding the CAR; and/or the isolated cell expressing an anti- CLDN 18.2 CAR; and/or the anti-CLDN 18.2 antibody; and/or bispecific antibody; and/or humanized antibody.
- a polynucleotide encoding the antibody or fragment e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3
- compositions are also provided.
- the composition comprises an antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a fusion protein, or a CAR and/or car expressing-cell of the present disclosure and a pharmaceutically acceptable carrier.
- an isolated cell comprising one or more polynucleotide encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof or the fusion protein or bispecific antibody of the present disclosure.
- the present disclosure further provides a method of treating tumor or growth expressing CLND 18.2 antigen, such as for example cancer in a patient in need thereof, comprising administering to the patient a antibody or fragment (e.g., VH1, VH2, VLB,
- Non-limiting examples of cancers include GI cancers, bladder cancer, liver cancer, colon cancer, rectal cancer, colorectal cancer, endometrial cancer, biliary cancer, leukemia, lymphoma, pancreatic cancer, small cell lung cancer, non-small cell lung cancer, breast cancer, urethral cancer, head and neck cancer, gastrointestinal cancer, stomach cancer, oesophageal cancer, ovarian cancer, renal cancer, melanoma, prostate cancer and thyroid cancer.
- GI cancers include GI cancers, bladder cancer, liver cancer, colon cancer, rectal cancer, colorectal cancer, endometrial cancer, biliary cancer, leukemia, lymphoma, pancreatic cancer, small cell lung cancer, non-small cell lung cancer, breast cancer, urethral cancer, head and neck cancer, gastrointestinal cancer, stomach cancer, oesophageal cancer, ovarian cancer, renal cancer, melanoma, prostate cancer and thyroid cancer.
- FIG. 1A-1B show the binding specificity of anti-CLDNl8.2 hybridoma antibodies.
- CHO stable cell lines expressing either human CLDN18.1 or human CLDN18.2 were used in the FACS analysis. All anti-CLDNl8.2 hybridoma antibodies were used at 10 pg/ml.
- FIG. 2 shows that anti-CLDNl8.2 hybridoma antibody clone T29S9 binds to both CLDN18.1 and CLDN18.2 in the FACS analysis.
- T29S9 was used at 10 pg/ml in the analysis.
- FIG. 3 shows binding of anti-CLDNl8.2 hybridoma antibodies with titration to CHO-CLDN18.2 cells.
- FIG. 4 shows the CLDN18.2 hybridoma antibody binding to a plate coated with CLDN18.2 EC1 Protein.
- Human CLDNl8.2ECl-huFc protein was coated onto ELISA wells at 1 pg/ml.
- FIG. 5 shows the binding of Anti-CLDNl8.2 hybridoma antibodies to KATO III Cells.
- Anti-CLDNl8.2 hybridoma antibodies were used at 20 pg/ml in the FACS analysis.
- FIG. 6 shows binding of anti-CLDNl8.2 chimeric antibodies with titration to CHO-CLDN18.2 cells in the FACS analysis.
- FIG. 7 shows binding of anti-CLDNl8.2 chimeric antibodies to KATO III cells.
- Anti-CLDNl8.2 chimeric antibodies were used at 20 pg/ml in the FACS analysis.
- FIG. 8A-8E show anti-human CLDN18.2 antibody-induced receptor
- FIG. 9 shows humanized anti-CLDNl8.2 antibodies, HuT252S4, bind to cell surface human CLDN18.2 on CHO cells stably expressing CLDN18.2 at similar or higher affinity as the chimeric T252S4 antibody.
- the singular form“a”,“an”, and“the” include plural references unless the context clearly dictates otherwise.
- the term“a cell” includes a plurality of cells, including mixtures thereof.
- the term“animal” refers to living multi-cellular vertebrate organisms, a category that includes, for example, mammals and birds.
- the term“mammal” includes both human and non-human mammals.
- the term“antibody” collectively refers to immunoglobulins or immunoglobulin-like molecules including by way of example and without limitation, IgA, IgD, IgE, IgG and IgM, combinations thereof, and similar molecules produced during an immune response in any vertebrate, for example, in mammals such as humans, goats, rabbits and mice, as well as non-mammalian species, such as shark immunoglobulins.
- the term“antibody” includes intact immunoglobulins and“antibody fragments” or“antigen binding fragments” that specifically bind to a molecule of interest (or a group of highly similar molecules of interest) to the substantial exclusion of binding to other molecules (for example, antibodies and antibody fragments that have a binding constant for the molecule of interest that is at least 10 3 M 1 greater, at least 10 4 M 1 greater or at least 10 5 M 1 greater than a binding constant for other molecules in a biological sample).
- the term“antibody” also includes genetically engineered forms such as chimeric antibodies (for example, humanized murine antibodies), heteroconjugate antibodies (such as, bispecific antibodies).
- an immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds.
- Each heavy and light chain contains a constant region and a variable region, (the regions are also known as "domains").
- the heavy and the light chain variable regions specifically bind the antigen.
- Light and heavy chain variable regions contain a "framework" region interrupted by three hypervariable regions, also called “complementarity-determining regions" or "CDRs".
- framework region and CDRs have been defined (see, Rabat et al., Sequences of Proteins of Immunological Interest , U.S. Department of Health and Human Services, 1991, which is hereby incorporated by reference).
- the Rabat database is now maintained online.
- the sequences of the framework regions of different light or heavy chains are relatively conserved within a species.
- the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, largely adopts a b-sheet conformation and the CDRs form loops which connect, and in some cases form part of, the b-sheet structure.
- framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions.
- the CDRs are primarily responsible for binding to an epitope of an antigen.
- the CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located.
- a VH CDR3 is located in the variable domain of the heavy chain of the antibody in which it is found
- a VL CDR1 is the CDR1 from the variable domain of the light chain of the antibody in which it is found.
- An antibody that binds CLDN 18.2 will have a specific VH region and the VL region sequence, and thus specific CDR sequences.
- Antibodies with different specificities i.e.
- the term“antigen” refers to a compound, composition, or substance that may be specifically bound by the products of specific humoral or cellular immunity, such as an antibody molecule or T-cell receptor.
- Antigens can be any type of molecule including, for example, haptens, simple intermediary metabolites, sugars (e.g., oligosaccharides), lipids, and hormones as well as macromolecules such as complex carbohydrates (e.g., polysaccharides), phospholipids, and proteins.
- antigens include, but are not limited to, viral antigens, bacterial antigens, fungal antigens, protozoa and other parasitic antigens, tumor antigens, antigens involved in autoimmune disease, allergy and graft rejection, toxins, and other miscellaneous antigens.
- antigen binding domain refers to any protein or polypeptide domain that can specifically bind to an antigen target.
- the term“autologous,” in reference to cells refers to cells that are isolated and infused back into the same subject (recipient or host).“Allogeneic” refers to non-autologous cells.
- the term“B cell,” refers to a type of lymphocyte in the humoral immunity of the adaptive immune system. B cells principally function to make antibodies, serve as antigen presenting cells, release cytokines, and develop memory B cells after activation by antigen interaction. B cells are distinguished from other lymphocytes, such as T cells, by the presence of a B-cell receptor on the cell surface. B cells may either be isolated or obtained from a commercially available source.
- Non-limiting examples of commercially available B cell lines include lines AHH-l (ATCC® CRL-8l46TM(, BC-l (ATCC® CRL-2230TM(, BC-2 (ATCC® CRL-223 lTM(, BC-3 (ATCC® CRL-2277TM(, CA46 (ATCC® CRL-l648TM(, DG-75[D.G.-75] (ATCC® CRL-2625TM(, DS-l (ATCC® CRL-l 1102TM(, EB-3[EB3] (ATCC® CCL-85TM(, Z-138 (ATCC #CRL-300l), DB (ATCC CRL-2289), Toledo (ATCC CRL-2631), Pfiffer (ATCC CRL-2632), SR (ATCC CRL- 2262), JM-l (ATCC CRL-l 0421), NFS-5 C-l (ATCC CRL-1693); NFS-70 C10 (ATCC CRL-l 694), NFS-25 C-3 (ATCC
- cell lines deived from anaplastic and large cell lymphomas e.g., DEL, DL-40, FE-PD, JB6, Karpas 299, Ki-JK, Mac-2A Plyl, SR-786, SU-DFfL-l, -2, -4, -5, -6, -7, -8, -9, -10, and -16, DOFfH-2, NU-DFfL-l, U-937, Granda 519, USC-DFfL-l, RL; Hodgkin’s lymphomas, e g., DEV, FfD-70, FfDLM-2, FfD-MyZ, FfKB-l, KM-H2, L 428, L 540, L1236, SBH-l, SUP-HD1, SU/RH-HD-l.
- Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (atcc.org/) and the German Collection of
- a“cancer” is a disease state characterized by the presence in a subject of cells demonstrating abnormal uncontrolled replication and in some aspects, the term may be used interchangably with the term“tumor.”
- the term“cancer or tumor antigen” referes to an antigen known to be associated and expressed on the surface with a cancer cell or tumor cell or tissue, and the term“cancer or tumor targeting antibody” refers to an antibody that targets such an antigen.
- CAR chimeric antigen receptor
- transmembrane domain derived from a polypeptide different from a polypeptide from which the extracellular domain is derived, and at least one intracellular domain.
- The“chimeric antigen receptor (CAR)” is sometimes called a“chimeric receptor”, a“T-body”, or a “chimeric immune receptor (CIR).”
- The“extracellular domain capable of binding to an antigen” means any oligopeptide or polypeptide that can bind to a certain antigen.
- the “intracellular domain” or“intracellular signaling domain” means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell.
- the intracellular domain may comprise, alternatively consist essentially of, or yet further comprise one or more costimulatory signaling domains in addition to the primary signaling domain.
- the “transmembrane domain” means any oligopeptide or polypeptide known to span the cell membrane and that can function to link the extracellular and signaling domains.
- a chimeric antigen receptor may optionally comprise a“hinge domain” which serves as a linker between the extracellular and transmembrane domains.
- Non limiting examples of polynucleotides encoding such domains are provided herein, e.g.:
- Hinge domain IgGl heavy chain hinge sequence:
- Intracellular domain 4-1BB co-stimulatory signaling region:
- Intracellular domain CD28 co-stimulatory signaling region:
- Intracellular domain CD3 zeta signaling region:
- each exemplary domain component includes other proteins that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the proteins encoded by the above disclosed nucleic acid sequences. Further, non limiting examples of such domains are provided herein.
- CD8 a hinge domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD8 a hinge domain sequence as shown herein.
- the example sequences of CD8 a hinge domain for human, mouse, and other species are provided in Pinto, R.D. et al. (2006) Vet. Immunol. Immunopathol. 110: 169-177.
- the sequences associated with the CD8 a hinge domain are provided in Pinto, R.D. et al. (2006) Vet. Immunol. Immunopathol. 110: 169-177.
- Non-limiting examples of such include:
- PVKPTTTPAPRPPTQAPITTSQRVSLRPGTCQPSAGSTVEASGLDLSCDIY and equivalents of each thereof.
- CD8 a transmembrane domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD8 a transmembrane domain sequence as shown herein.
- the fragment sequences associated with the amino acid positions 183 to 203 of the human T-cell surface glycoprotein CD8 alpha chain (GenBank Accession No: NP 001759.3), or the amino acid positions 197 to 217 of the mouse T-cell surface glycoprotein CD8 alpha chain (GenBank Accession No: NP_00l074579.l), and the amino acid positions 190 to 210 of the rat T-cell surface glycoprotein CD8 alpha chain(GenBank Accession No: NP_ 113726.1) provide additional example sequences of the CD8 a transmembrane domain.
- the sequences associated with each of the listed accession numbers are provided as follows:
- Rat CD8 alpha transmembrane domain IWAPLAGICAVLLLSLVITLI, and equivalents of each thereof.
- CD28 transmembrane domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, at least 90% sequence identity, or alternatively at least 95% sequence identity with the CD28 transmembrane domain sequence as shown herein.
- XM 009444056.1 provide additional, non-limiting, example sequences of the CD28 transmembrane domain. The sequences associated with each of the listed accession numbers are provided herein.
- the term“4-1BB costimulatory signaling region” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the 4-1BB costimulatory signaling region sequence as shown herein.
- Non-limiting example sequences of the 4-1BB costimulatory signaling region are provided in U.S. Publication 20130266551A1 (filed as U.S. App. No. 13/826,258), such as the exemplary sequence provided below: [0059] 4-1BB costimulatory signaling region:
- CD28 costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD28 costimulatory signaling region sequence shown herein.
- the example sequences CD28 costimulatory signaling domain are provided in ET.S. Patent No. 5,686,281; Geiger, T.L. et ah, Blood 98: 2364-2371 (2001); Hombach, A. et ah, J Immunol 167: 6123-6131 (2001); Maher, J. et al.
- Non-limiting examples include residues 114-220 of the below CD28 Sequence: MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSC KYSYNLFSRE FRASLHKGLDSAVEVCVVYG NYSQQLQVYS KTGFNCDGKL GNESVTFYLQ NLYVNQTDIY F CKIEVM YPPP YLDNEK SN G TIIHVKGKHL CPSPLFPGPS KPFWVLVVVG GVLACYSLLVTVAFIIFWVR SKRSRLLHSD YMNMTPRRPG PTRKHYQPYA PPRDFAAYRS, and equivalents thereof.
- the term“ICOS costimulatory signaling region” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the ICOS costimulatory signaling region sequence as shown herein.
- Non-limiting example sequences of the ICOS costimulatory signaling region are provided in ET.S. Publication 2015/0017141A1 the exemplary polynucleotide encoding this sequence provided below.
- ICOS costimulatory signaling region encoded by polynucleotide encoded by polynucleotide:
- 0X40 costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, or duley 90% sequence identity, or alternatively at least 95% sequence identity with the 0X40 costimulatory signaling region sequence as shown herein.
- Non-limiting example sequences of the 0X40 costimulatory signaling region are disclosed in U.S. Publication 2012/20148552A1, and include an exemplary sequence encoding such is provided below.
- CD28 costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, or alternatively 90% sequence identity, or alternatively at least 95% sequence identity with the CD28 costimulatory signaling region sequence shown herein.
- CD3 zeta signaling domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD3 zeta signaling domain sequence as shown herein.
- Non-limiting example sequences of the CD3 zeta signaling domain are provided in U.S. Application No.
- A“composition” typically intends a combination of the active agent, e.g., compound or composition, and a naturally-occurring or non-naturally-occurring carrier, inert (for example, a detectable agent or label) or active, such as an adjuvant, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like and include pharmaceutically acceptable carriers.
- a naturally-occurring or non-naturally-occurring carrier for example, a detectable agent or label
- active such as an adjuvant, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like and include pharmaceutically acceptable carriers.
- Carriers also include pharmaceutical excipients and additives proteins, peptides, amino acids, lipids, and carbohydrates (e.g., sugars, including monosaccharides, di-, tri-, tetra-oligosaccharides, and oligosaccharides; derivatized sugars such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in combination 1-99.99% by weight or volume.
- Exemplary protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, and the like.
- amino acid/antibody components which can also function in a buffering capacity, include alanine, arginine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like.
- Carbohydrate excipients are also intended within the scope of this technology, examples of which include but are not limited to monosaccharides such as fructose, maltose, galactose, glucose, D- mannose, sorbose, and the like; di saccharides, such as lactose, sucrose, trehalose, cellobiose, and the like; polysaccharides, such as raffmose, melezitose, maltodextrins, dextrans, starches, and the like; and alditols, such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol) and myoinositol.
- monosaccharides such as fructose, maltose, galactose, glucose, D- mannose, sorbose, and the like
- di saccharides such as lactose, sucrose,
- compositions and methods include the recited elements, but do not exclude others.
- Consisting essentially of when used to define compositions and methods, shall mean excluding other elements of any essential significance to the combination for the intended use.
- a composition consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives and the like.
- Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions disclosed herein. Aspects defined by each of these transition terms are within the scope of the present disclosure.
- consensus sequence refers to an amino acid or nucleic acid sequence that is determined by aligning a series of multiple sequences and that defines an idealized sequence that represents the predominant choice of amino acid or base at each corresponding position of the multiple sequences.
- the consensus sequence for the series can differ from each of the sequences by zero, one, a few, or more substitutions. Also, depending on the sequences of the series of multiple sequences, more than one consensus sequence may be determined for the series. The generation of consensus sequences has been subjected to intensive mathematical analysis. Various software programs can be used to determine
- CRISPR refers to a technique of sequence specific genetic manipulation relying on the clustered regularly interspaced short palindromic repeats pathway. CRISPR can be used to perform gene editing and/or gene regulation, as well as to simply target proteins to a specific genomic location.
- Gene editing refers to a type of genetic engineering in which the nucleotide sequence of a target polynucleotide is changed through introduction of deletions, insertions, or base substitutions to the polynucleotide sequence.
- CRISPR-mediated gene editing utilizes the pathways of nonhomologous end-joining (NHEJ) or homologous recombination to perform the edits.
- NHEJ nonhomologous end-joining
- Gene regulation refers to increasing or decreasing the production of specific gene products such as protein or RNA.
- gRNA or“guide RNA” as used herein refers to the guide RNA sequences used to target specific genes for correction employing the CRISPR technique.
- Techniques of designing gRNAs and donor therapeutic polynucleotides for target specificity are well known in the art. For example, Doench, I, et al. Nature biotechnology 2014;
- gRNA comprises or alternatively consists essentially of, or yet further consists of a fusion polynucleotide comprising CRISPR RNA (crRNA) and trans-activating CRIPSPR RNA (tracrRNA); or a polynucleotide comprising CRISPR RNA (crRNA) and trans-activating CRIPSPR RNA (tracrRNA).
- a gRNA is synthetic (Kelley, M. et al. (2016) J of Biotechnology 233 (2016) 74-83).
- a biological equivalent of a gRNA includes but is not limited to polynucleotides or targeting molecules that can guide a Cas9 or equivalent thereof to a specific nucleotide sequence such as a specific region of a cell’s genome.
- Cytoreductive therapy includes but is not limited to
- Chemotherapy drugs that kill cancer cells only when they are dividing are termed cell-cycle specific. These drugs include agents that act in S-phase, including topoisomerase inhibitors and anti-metabolites.
- Topoisomerase inhibitors are drugs that interfere with the action of topoisomerase enzymes (topoisomerase I and II). During the process of chemo treatments, topoisomerase enzymes control the manipulation of the structure of DNA necessary for replication, and are thus cell cycle specific. Examples of topoisomerase I inhibitors include the camptothecan analogs listed above, irinotecan and topotecan. Examples of topoisomerase II inhibitors include amsacrine, etoposide, etoposide phosphate, and teniposide.
- Antimetabolites are usually analogs of normal metabolic substrates, often interfering with processes involved in chromosomal replication. They attack cells at very specific phases in the cycle. Antimetabolites include folic acid antagonists, e.g.,
- methotrexate pyrimidine antagonist, e.g., 5-fluorouracil, foxuridine, cytarabine, capecitabine, and gemcitabine; purine antagonist, e.g., 6-mercaptopurine and 6-thioguanine; adenosine deaminase inhibitor, e.g., cladribine, fludarabine, nelarabine and pentostatin; and the like.
- pyrimidine antagonist e.g., 5-fluorouracil, foxuridine, cytarabine, capecitabine, and gemcitabine
- purine antagonist e.g., 6-mercaptopurine and 6-thioguanine
- adenosine deaminase inhibitor e.g., cladribine, fludarabine, nelarabine and pentostatin; and the like.
- Plant alkaloids are derived from certain types of plants.
- the vinca alkaloids are made from the periwinkle plant (Catharanthus rosea).
- the taxanes are made from the bark of the Pacific Yew tree (taxus).
- the vinca alkaloids and taxanes are also
- the podophyllotoxins are derived from the May apple plant. Camptothecan analogs are derived from the Asian“Happy Tree” (Camptotheca acuminata). Podophyllotoxins and camptothecan analogs are also
- the plant alkaloids are generally cell-cycle specific.
- Examples of these agents include vinca alkaloids, e.g., vincristine, vinblastine and vinorelbine; taxanes, e.g., paclitaxel and docetaxel; podophyllotoxins, e.g., etoposide and tenisopide; and camptothecan analogs, e.g., irinotecan and topotecan.
- vinca alkaloids e.g., vincristine, vinblastine and vinorelbine
- taxanes e.g., paclitaxel and docetaxel
- podophyllotoxins e.g., etoposide and tenisopide
- camptothecan analogs e.g., irinotecan and topotecan.
- Cryotherapy includes, but is not limited to, therapies involving decreasing the temperature, for example, hypothermic therapy.
- Radiation therapy includes, but is not limited to, exposure to radiation, e.g., ionizing radiation, UV radiation, as known in the art.
- exemplary dosages include, but are not limited to, a dose of ionizing radiation at a range from at least about 2 Gy to not more than about 10 Gy and/or a dose of ultraviolet radiation at a range from at least about 5 J/m 2 to not more than about 50 J/m 2 , usually about 10 J/m 2 .
- the term“detectable marker” refers to at least one marker capable of directly or indirectly, producing a detectable signal.
- a non-exhaustive list of this marker includes enzymes which produce a detectable signal, for example by colorimetry, fluorescence, luminescence, such as horseradish peroxidase, alkaline phosphatase, b- galactosidase, glucose-6-phosphate dehydrogenase, chromophores such as fluorescent, luminescent dyes, groups with electron density detected by electron microscopy or by their electrical property such as conductivity, amperometry, voltammetry, impedance, detectable groups, for example whose molecules are of sufficient size to induce detectable
- such detection may be accomplished by optical methods such as diffraction, surface plasmon resonance, surface variation, the contact angle change or physical methods such as atomic force spectroscopy, tunnel effect, or radioactive molecules such as 32 P, 35 S or 125 1.
- optical methods such as diffraction, surface plasmon resonance, surface variation, the contact angle change or physical methods such as atomic force spectroscopy, tunnel effect, or radioactive molecules such as 32 P, 35 S or 125 1.
- an“effective amount” or“efficacious amount” refers to the amount of an agent, or combined amounts of two or more agents, that, when administered for the treatment of a mammal or other subject, is sufficient to effect such treatment for the disease.
- the “effective amount” will vary depending on the agent(s), the disease and its severity and the age, weight, etc., of the subject to be treated.
- the term“encode” as it is applied to nucleic acid sequences refers to a polynucleotide which is said to“encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof.
- the antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
- the term“enhancer”, as used herein, denotes sequence elements that augment, improve or ameliorate transcription of a nucleic acid sequence irrespective of its location and orientation in relation to the nucleic acid sequence to be expressed.
- An enhancer may enhance transcription from a single promoter or simultaneously from more than one promoter. As long as this functionality of improving transcription is retained or substantially retained (e.g., at least 70%, at least 80%, at least 90% or at least 95% of wild-type activity, that is, activity of a full-length sequence), any truncated, mutated or otherwise modified variants of a wild-type enhancer sequence are also within the above definition.
- the term“equivalent” or“biological equivalent” of an antibody means the ability of the antibody to selectively bind its epitope protein or fragment thereof as measured by ELISA or other suitable methods.
- Biologically equivalent antibodies include, but are not limited to, those antibodies, peptides, antibody fragments, antibody variant, antibody derivative and antibody mimetics that bind to the same epitope as the reference antibody.
- an equivalent intends at least about 70% homology or identity, or at least 80 % homology or identity and alternatively, or at least about 85 %, or alternatively at least about 90 %, or alternatively at least about 95 %, or alternatively 98 % percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid.
- an equivalent intends at least about 70% homology or identity, or at least 80 % homology or identity and alternatively, or at least about 85 %, or alternatively at least about 90 %, or alternatively at least about 95 %, or alternatively 98 % percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid.
- polynucleotides an equivalent thereof is a polynucleotide that hybridizes under stringent conditions to the reference polynucleotide or its complement.
- a polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) having a certain percentage (for example, 80%, 85%, 90%, or 95%) of“sequence identity” to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences.
- the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1.
- default parameters are used for alignment.
- a preferred alignment program is BLAST, using default parameters.
- polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins.
- expression may include splicing of the mRNA in a eukaryotic cell.
- the expression level of a gene may be determined by measuring the amount of mRNA or protein in a cell or tissue sample.
- the expression level of a gene from one sample may be directly compared to the expression level of that gene from a control or reference sample.
- the expression level of a gene from one sample may be directly compared to the expression level of that gene from the same sample following administration of a compound.
- first line or“second line” or“third line” refers to the order of treatment received by a patient.
- First line therapy regimens are treatments given first, whereas second or third line therapy are given after the first line therapy or after the second line therapy, respectively.
- the National Cancer Institute defines first line therapy as“the first treatment for a disease or condition.
- primary treatment can be surgery, chemotherapy, radiation therapy, or a combination of these therapies.
- First line therapy is also referred to those skilled in the art as“primary therapy and primary treatment.” See National Cancer Institute website at cancer.gov, last visited on May 1,
- a patient is given a subsequent chemotherapy regimen because the patient did not show a positive clinical or sub-clinical response to the first line therapy or the first line therapy has stopped.
- Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences.
- the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et ah, eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1.
- default parameters are used for alignment.
- a preferred alignment program is BLAST, using default parameters.
- the terms“homology” or“identical”, percent“identity” or“similarity” also refer to, or can be applied to, the complement of a test sequence.
- the terms also include sequences that have deletions and/or additions, as well as those that have substitutions.
- the preferred algorithms can account for gaps and the like.
- identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is at least 50-100 amino acids or nucleotides in length.
- An“unrelated” or“non-homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences disclosed herein.
- Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
- the hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein binding, or in any other sequence-specific manner.
- the complex may comprise two strands forming a duplex structure, three or more strands forming a multi -stranded complex, a single self-hybridizing strand, or any combination of these.
- a hybridization reaction may constitute a step in a more extensive process, such as the initiation of a PCR reaction, or the enzymatic cleavage of a polynucleotide by a ribozyme.
- Examples of stringent hybridization conditions include: incubation temperatures of about 25°C to about 37°C; hybridization buffer concentrations of about 6x SSC to about lOx SSC; formamide concentrations of about 0% to about 25%; and wash solutions from about 4x SSC to about 8x SSC.
- Examples of moderate hybridization conditions include: incubation temperatures of about 40°C to about 50°C; buffer concentrations of about 9x SSC to about 2x SSC; formamide concentrations of about 30% to about 50%; and wash solutions of about 5x SSC to about 2x SSC.
- high stringency conditions include: incubation temperatures of about 55°C to about 68°C; buffer concentrations of about lx SSC to about O.lx SSC; formamide concentrations of about 55% to about 75%; and wash solutions of about lx SSC, O. lx SSC, or deionized water.
- hybridization incubation times are from 5 minutes to 24 hours, with 1, 2, or more washing steps, and wash incubation times are about 1, 2, or 15 minutes.
- SSC is 0.15 M NaCl and 15 mM citrate buffer. It is understood that equivalents of SSC using other buffer systems can be employed.
- isolated refers to molecules or biologicals or cellular materials being substantially free from other materials.
- the term“isolated” refers to nucleic acid, such as DNA or RNA, or protein or polypeptide (e.g., an antibody or derivative thereof), or cell or cellular organelle, or tissue or organ, separated from other DNAs or RNAs, or proteins or polypeptides, or cells or cellular organelles, or tissues or organs, respectively, that are present in the natural source.
- isolated also refers to a nucleic acid or peptide that is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
- an“isolated nucleic acid” is meant to include nucleic acid fragments which are not naturally occurring as fragments and would not be found in the natural state.
- isolated is also used herein to refer to polypeptides which are isolated from other cellular proteins and is meant to encompass both purified and recombinant polypeptides.
- isolated is also used herein to refer to cells or tissues that are isolated from other cells or tissues and is meant to encompass both cultured and engineered cells or tissues.
- isolated cell generally refers to a cell that is
- Immuno cells includes, e.g., white blood cells (leukocytes) which are derived from hematopoietic stem cells (HSC) produced in the bone marrow, lymphocytes (T cells,
- B cells natural killer (NK) cells
- myeloid-derived cells neurotrophil, eosinophil, basophil, monocyte, macrophage, dendritic cells.
- linker sequence relates to any amino acid sequence comprising from 1 to 10, or alternatively, 8 amino acids, or alternatively 6 amino acids, or alternatively 5 amino acids that may be repeated from 1 to 10, or alternatively to about 8, or alternatively to about 6, or alternatively about 5, or 4 or alternatively 3, or alternatively 2 times.
- the linker may comprise up to 15 amino acid residues consisting of a pentapeptide repeated three times.
- the linker sequence is a (Glycine4Serine)3 flexible polypeptide linker comprising three copies of gly-gly-gly-gly-ser.
- A“normal cell corresponding to the tumor tissue type” refers to a normal cell from a same tissue type as the tumor tissue.
- a non-limiting example is a normal lung cell from a patient having lung tumor, or a normal colon cell from a patient having colon tumor.
- T cell refers to a type of lymphocyte that matures in the thymus. T cells play an important role in cell-mediated immunity and are distinguished from other lymphocytes, such as B cells, by the presence of a T-cell receptor on the cell surface. T-cells may either be isolated or obtained from a commercially available source.
- T cell includes all types of immune cells expressing CD3 including T-helper cells (CD4+ cells), cytotoxic T-cells (CD8+ cells), natural killer T-cells, T-regulatory cells (Treg) and gamma-delta T cells.
- A“cytotoxic cell” includes CD8+ T cells, natural-killer (NK) cells, and neutrophils, which cells are capable of mediating cytotoxicity responses.
- Non-limiting examples of commercially available T-cell lines include lines BCL2 (AAA) Jurkat
- T-cell lines e.g., such as Deglis, EBT-8, HPB-MLp-W, HUT 78, HUT 102, Karpas 384, Ki 225, My-La, Se-Ax, SKW-3, SMZ-l and T34; and immature T- cell lines, e.g., ALL-SIL, Bel3, CCRF-CEM, CML-T1, DND-41, DU.528, EU-9, HD-Mar, HPB-ALL, H-SB2, HT-l, JK-T1, Jurkat, Karpas 45, KE-37, KOPT-K1, K-Tl, L-KAW, Loucy, MAT, MOLT-l, MOLT 3, MOLT-4, MOLT 13,
- Null leukemia cell lines including but not limited to REH, NALL-l, KM-3, L92-221, are a another commercially available source of immune cells, as are cell lines derived from other leukemias and lymphomas, such as K562 erythroleukemia, THP-l monocytic leukemia, U937 lymphoma, HEL erythroleukemia, HL60 leukemia, HMC-l leukemia, KG-l leukemia, U266 myeloma.
- Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (atcc.org/) and the German Collection of Microorganisms and Cell Cultures (dsmz.de/).
- NK cell also known as natural killer cell, refers to a type of lymphocyte that originates in the bone marrow and play a critical role in the innate immune system. NK cells provide rapid immune responses against viral-infected cells, tumor cells or other stressed cell, even in the absence of antibodies and major histocompatibility complex on the cell surfaces. NK cells may either be isolated or obtained from a commercially available source. Non-limiting examples of commercial NK cell lines include lines NK-92 (ATCC® CRL-2407TM), NK-92MI (ATCC® CRL-2408TM).
- NK lines HANK1, KHYG-l, NKL, NK-YS, NOI- 90, and YT include but are not limited to NK lines HANK1, KHYG-l, NKL, NK-YS, NOI- 90, and YT.
- Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (atcc.org/) and the German Collection of Microorganisms and Cell Cultures (dsmz.de/).
- the term“operatively linked” refers to an association between the regulatory polynucleotide and the
- polynucleotide sequence to which it is linked such that, when a specific protein binds to the regulatory polynucleotide, the linked polynucleotide is transcribed.
- the term "overexpress" with respect to a cell, a tissue, or an organ expresses a protein to an amount that is greater than the amount that is produced in a control cell, a control issue, or an organ.
- a protein that is overexpressed may be endogenous to the host cell or exogenous to the host cell.
- polynucleotide and“oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogs thereof.
- Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown. The following are
- polynucleotides a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, RNAi, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers.
- a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present,
- nucleotide structure can be imparted before or after assembly of the polynucleotide.
- sequence of nucleotides can be interrupted by non-nucleotide components.
- a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
- the term also refers to both double- and single-stranded molecules. ETnless otherwise specified or required, any aspect of this technology that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the
- nucleic acid sequence and“polynucleotide” are used interchangeably to refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides.
- this term includes, but is not limited to, single-, double-, or multi- stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
- promoter refers to any sequence that regulates the expression of a coding sequence, such as a gene. Promoters may be constitutive, inducible, repressible, or tissue-specific, for example.
- A“promoter” is a control sequence that is a region of a polynucleotide sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors.
- the term“protein”,“peptide” and“polypeptide” are used interchangeably and in their broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics.
- the subunits may be linked by peptide bonds.
- the subunit may be linked by other bonds, e.g., ester, ether, etc.
- a protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise a protein’s or peptide’s sequence.
- amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and
- a purified nucleic acid, peptide, protein, biological complexes or other active compound is one that is isolated in whole or in part from proteins or other contaminants.
- substantially purified peptides, proteins, biological complexes, or other active compounds for use within the disclosure comprise more than 80% of all macromolecular species present in a preparation prior to admixture or formulation of the peptide, protein, biological complex or other active compound with a pharmaceutical carrier, excipient, buffer, absorption enhancing agent, stabilizer,
- the peptide, protein, biological complex or other active compound is purified to represent greater than 90%, often greater than 95% of all macromolecular species present in a purified preparation prior to admixture with other formulation ingredients.
- the purified preparation may be essentially homogeneous, wherein other macromolecular species are not detectable by conventional techniques.
- the term“purification marker” refers to at least one marker useful for purification or identification.
- a non-exhaustive list of this marker includes His, lacZ, GST, maltose-binding protein, NusA, BCCP, c-myc, CaM, FLAG, GFP, YFP, cherry, thioredoxin, poly(NANP), V5, Snap, HA, chitin-binding protein, Softag 1, Softag 3,
- Suitable direct or indirect fluorescence marker comprise FLAG, GFP, YFP, RFP, dTomato, cherry, Cy3, Cy 5, Cy 5.5, Cy 7, DNP, AMCA, Biotin, Digoxigenin, Tamra, Texas Red, rhodamine, Alexa fluors, FITC, TRITC or any other fluorescent dye or hapten.
- recombinant protein refers to a polypeptide which is produced by recombinant DNA techniques, wherein generally, DNA encoding the polypeptide is inserted into a suitable expression vector which is in turn used to transform a host cell to produce the heterologous protein.
- the term“specific binding” means the contact between an antibody and an antigen with a binding affinity of at least lO _6 M.
- antibodies bind with affinities of at least about lO _7 M, and preferably lO _8 M, lO _9 M, lO _10 M, l0 _11 M, or lO 12 M.
- fusion protein or“fusion polypeptide” intends any drug (small molecule, polypeptide or protein) fused or joined to an antibody or fragment thereof as disclosed herein.
- drug small molecule, polypeptide or protein fused or joined to an antibody or fragment thereof as disclosed herein.
- Non-limiting examples of such includes, for example, bispecific and antibody-drug conjugates
- A“solid tumor” is an abnormal mass of tissue that usually does not contain cysts or liquid areas. Solid tumors can be benign or malignant, metastatic or non-metastatic. Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors include sarcomas, carcinomas, and lymphomas.
- the term“suicide gene” is a gene capable of inducing cell apoptosis; non-limiting examples include HSV-TK (Herpes simplex virus thymidine kinase), cytosine deaminase, nitroreductase, carboxylesterase, cytochrome P450 or PNP (Purine nucleoside phosphorylase), truncated EGFR, or inducible caspase (“iCasp”).
- HSV-TK Herpes simplex virus thymidine kinase
- cytosine deaminase cytosine deaminase
- nitroreductase carboxylesterase
- cytochrome P450 or PNP Purine nucleoside phosphorylase
- iCasp inducible caspase
- Suicide genes may function along a variety of pathways, and, in some cases, may be inducible by an inducing agent such as a small molecule.
- the iCasp suicide gene comprises portion of a caspase protein operatively linked to a protein optimized to bind to an inducing agent; introduction of the inducing agent into a cell comprising the suicide gene results in the activation of caspase and the subsequent apoptosis of said cell.
- transduce or“transduction” as it is applied to the production of chimeric antigen receptor cells refers to the process whereby a foreign nucleotide sequence is introduced into a cell. In some embodiments, this transduction is done via a vector.
- “treating” or“treatment” of a disease in a subject refers to (1) preventing the symptoms or disease from occurring in a subject that is predisposed or does not yet display symptoms of the disease; (2) inhibiting the disease or arresting its development; or (3) ameliorating or causing regression of the disease or the symptoms of the disease.
- “treatment” is an approach for obtaining beneficial or desired results, including clinical results.
- beneficial or desired results can include one or more, but are not limited to, alleviation or amelioration of one or more symptoms, diminishment of extent of a condition (including a disease), stabilized (i.e., not worsening) state of a condition (including disease), delay or slowing of condition (including disease), progression, amelioration or palliation of the condition (including disease), states and remission (whether partial or total), whether detectable or undetectable.
- Treatments containing the disclosed compositions and methods can be first line, second line, third line, fourth line, fifth line therapy and are intended to be used as a sole therapy or in combination with other appropriate therapies.
- the term“treatment” excludes prevention.
- the term“vector” refers to a nucleic acid construct deigned for transfer between different hosts, including but not limited to a plasmid, a virus, a cosmid, a phage, a BAC, a YAC, etc.
- plasmid vectors may be prepared from commercially available vectors.
- viral vectors may be produced from baculoviruses, retroviruses, adenoviruses, AAVs, etc. according to techniques known in the art.
- the viral vector is a lentiviral vector.
- CLDN 18.2 refers to isoform 2 of claudin-l8. See Sahin U, Koslowski M, Dhaene K, Usener D, Brandenburg G, Seitz G, Huber C, Tureci O.
- Claudin-l8 splice variant 2 is a pan-cancer target suitable for therapeutic antibody development, Clin. Cancer Res. 2008;l4(23):7624-34.
- Non-limiting exemplary sequences of claudin 18 or the underlying gene may be found under Gene Cards ID: GC03P137998, HGNC: 2039, Entrez Gene: 51208, Ensembl: ENSG00000066405, OMIM: 609210, and ETniProtKB: P56856, which are incorporated by reference herein.
- This disclosure provides a novel antibody to CLDN 18.2 and compositions and methods of use thereof. More specifically, this disclosure provides new anti-CLDN 18.2 antibodies for the treatment of tumors expressing CLDN 18.2, such as for example, GI tumors that include, but are not limited to, gastric, pancreatic, esophageal, biliary tract, colorectal, ovarian, and lung carcinomas.
- CLDN 18.2 is highly expressed on the majority of these tumors but has restricted off-target positivity and therefore a desirable safety profile.
- the compositions are particularly useful in the treatment of tumors or cancerous cell that express or overexpress CLDN 18.2.
- the present disclosure provides isolated antibodies, the antibodies comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibodies bind to an epitope of CLDN 18.2.
- the antibodies bind to an epitope of CLDN 18.2, but not CLDN 18.1.
- the antibody is a humanized antibody comprising one or more, two or more, three or more, four or more, five or more, six or more, seven or more or all eight of the CDRs identified in Table 3.
- the antibodies bind with high specificity, that is they bind to CLDN 18.2 with an affinity of more than 80%, or alternatively more than 85%, or alternatively more than 90%, or alternatively more than 95%, binding for CLDN18.2-expressing cells versus less than 20%, or alternatively less than 15%, or alternatively less than 10%, or alternatively less than 5% binding to CLDN 18.1.
- Example of such are shown in Figs la, lb and 9.
- the antibodies are more sepicific for the CLDN18.2 expressing tumor cells and would have lower toxicity since they do not bind to the CLDN 18.1 -expressing normal cells.
- the antibody is a bispecific antibody has a binding specificity to a second target protein.
- the second target protein in some embodiments, is selected from the group consisting of IL-l, CD3, CD16, CD19, CD28, CD47, CD64, PD-l, PD-L1, CTLA-4, LAG-3, CD28, CD122, 4-1BB, TIM3, OX-40, OX40L, CD40, CD40L, LIGHT, ICOS, ICOSL, GITR, GITRL, TIGIT, CD27, VISTA, B7H3, B7H4, HEVM,
- the antibody is comprised in an antibody drug conjuates (ADC) formed between the anitbody and another agent, such as toxin or drug.
- ADC antibody drug conjuates
- the antibodies may be conjugated to therapeutic agents, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, and/or polyethylene glycol (PEG).
- this disclosure provides isolated anti-CLDN 18.2 antibodies or fragments thereof as disclosed herein and a detectable or purification label, alone or in combination with an CLDN 18.2 antigen or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, heavy and light chain heavy and light chain CDR 1, CDR 2, CDR3) thereof, that in one aspect are bound to each other to form an antigen/antibody complex. Further provided herein is an ex vivo cell comprising this antigen/antibody complex.
- an CLDN 18.2 antigen or fragment e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, heavy and light chain heavy and light chain CDR 1, CDR 2, CDR3
- a chimeric antigen receptor comprising: (a) an antigen binding domain of a CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3); (b) a hinge domain; (c) a
- a chimeric antigen receptor comprising: (a) an antigen binding domain of a CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3); (b) a hinge domain; (c) a CD28 transmembrane domain; (d) one or more costimulatory regions selected from a CD28 costimulatory signaling region, a 4-1BB costimulatory signaling region, an ICOS costimulatory signaling region, and an 0X40 costimulatory region; and (e) a CD3 zeta signaling domain and alternatives thereof.
- a CLDN 18.2 antibody e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3
- a hinge domain e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2,
- the present disclosure provides a chimeric antigen receptor (CAR) comprising: (a) an antigen binding domain of an anti-CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3), (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) a CD28 and/or a 4-1BB costimulatory signaling region; and (e) a CD3 zeta signaling domain and alternatives thereof.
- an antigen binding domain of an anti-CLDN 18.2 antibody e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3
- VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3 e.g., VH1, VH2, VH3, VL1, VL2, VL3,
- the present disclosure provides an isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, humanized antibody, bispecific antibody, or the anti-CLDN 18.2 CAR.
- the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, bispecific antibody, humanized antibody, or the anti-CLDN 18.2 CAR.
- the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti- CLDN 18.2 antibody, bispecific antibody, humanized antibody, or the anti-CLDN 18.2 CAR, operatively linked to sequences that direct and optionally enhance the expression of the nucleic acid sequence.
- sequences include promoters and enhancer sequences.
- the present disclosure provides a composition comprising a carrier and one or more of: the anti-CLDN 18.2 antibody; and/or the chimeric antibody; and/or the bispecific antibody; and/or the humanized antibody; and/or the anti-CLDN 18.2 CAR; and/or the isolated nucleic acid encoding the anti-CLDN 18.2 antibody bispecific antibody, and/or the chimeric antibody; and/or the anti-CLDN 18.2 humanized antibody, or the anti- CLDN 18.2 CAR; and/or the vector comprising the isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, bispecific antibody, and/or the chimeric antibody; and/or the humanized antibody, or the anti-CLDN 18.2 CAR; and/or an isolated cell comprising the anti-CLDN 18.2 CAR.
- the disclosure provides a composition comprising, or alternatively consisting essentially of, or yet further consisting of a carrier and one or more of: an antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a nucleic acid encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a vecor comprising the nucleic acid encoding the antibody or fragment (e.g., VH1, VH2, VH3,
- VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof an isolated cell comprising an anti-CLDN 18.2 CAR and/or a polynucleotide encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof; and/or the isolated nucleic acid encoding the CAR; and/or the vector comprising the nucleic acid encoding the CAR; and/or the isolated cell expressing an anti- CLDN 18.2 CAR; and/or the anti-CLDN 18.2 antibody; and/or the chimeric antibody; and/or bispecific antibody; and/or the humanized antibody.
- a polynucleotide encoding the antibody or fragment e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3 thereof
- the isolated nucleic acid encoding the CAR
- compositions are also provided.
- the composition comprises an antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a fusion protein, or a CAR and/or car expressing-cell of the present disclosure and a pharmaceutically acceptable carrier.
- an isolated cell comprising one or more polynucleotide encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof or the fusion protein or bispecific antibody of the present disclosure.
- the present disclosure further provides a method of treating tumor or growth expressing CLND 18.2 antigen, such as for example cancer or fibrosis in a patient in need thereof, comprising administering to the patient a antibody or fragment (e.g., VH1, VH2, VLB, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a fusion protein, or a CAR and/or car expressing-cell of the present disclosure.
- a antibody or fragment e.g., VH1, VH2, VLB, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3
- Non-limiting examples of cancers include GI cancers, bladder cancer, liver cancer, colon cancer, rectal cancer, endometrial cancer, biliary cancer, leukemia, lymphoma, pancreatic cancer, small cell lung cancer, non-small cell lung cancer, breast cancer, urethral cancer, head and neck cancer, gastrointestinal cancer, stomach cancer, oesophageal cancer, ovarian cancer, renal cancer, melanoma, prostate cancer and thyroid cancer.
- the methods can be combined with diagnostic methods to identify patients or subjects that are more likely to respond to the treatment.
- An immunoglobulin monomer comprises two heavy chains and two light chains connected by disulfide bonds. Each heavy chain is paired with one of the light chains to which it is directly bound via a disulfide bond. Each heavy chain comprises a constant region (which varies depending on the isotype of the antibody) and a variable region.
- the variable region comprises three hypervariable regions (or complementarity determining regions) which are designated CDRH1, CDRH2 and CDRH3 and which are supported within framework regions.
- Each light chain comprises a constant region and a variable region, with the variable region comprising three hypervariable regions (designated CDRL1, CDRL2 and CDRL3) supported by framework regions in an analogous manner to the variable region of the heavy chain.
- the hypervariable regions of each pair of heavy and light chains mutually cooperate to provide an antigen binding site that is capable of binding a target antigen.
- the binding specificity of a pair of heavy and light chains is defined by the sequence of CDR1, CDR2 and CDR3 of the heavy and light chains.
- the disclosure provides an isolated antibody comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibody binds to an epitope CLDN 18.2.
- HC heavy chain
- LC light chain
- the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence selected from (i) GFTFSSYA, (ii) GFTFSDYY, (iii) GFNIKDYF, (iv)
- GFTFSDYY (v) GYSFTGYN, (vi) GFSLTSYG, (vii) GYNMN or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence selected from (i) ISGGGST,
- the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence selected from (i) QNLLNSSNQKNY, (ii)
- KSSQNLLNSGNQKNYLT or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence selected from (i) FAS, (ii) RAS, (iii) KVS, (iv) WAS, (v)
- WASTMES or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence selected from (i) QQHYSTPLT, (ii) QQSNQGPLT, (iii) SQNTHVPRT, (iv) QQSNKVPLT, (v) QNDYIYPLP, or an equivalent of each thereof.
- the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GFTFSSYA or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of ISGGGST or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of GGNIYDGYPYYFDY or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QNLLNSSNQKNY or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of FAS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QQHYSTPLT or an equivalent thereof.
- the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GFTFSDYY or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of ISDGGGDT or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of ARHRGSLDY or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of ESVDNYGFSF or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of RAS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QQSNQGPLT or an equivalent thereof.
- the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GFNIKDYF or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of IDPENGDT or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of NVLGYGNYGHFYYAMDY or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSLVHSNGNTY or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of KVS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of SQNTHVPRT or an equivalent thereof.
- the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GFTFSDYY or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of ISNGGGST or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of ARHRGSLDF or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of ESVDNYGFSF or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of RAS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QQSNKVPLT or an equivalent thereof.
- the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GYSFTGYN or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of INPYNGGT or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of ARMGLGNAMDY or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QNLLNSGNQKNY or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of WAS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QNDYIYPLP or an equivalent thereof.
- the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GFSLTSYG or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of IWSDGRT or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of ARHGRYDPYAMDY or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of ESVDNYGFSF or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of RAS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QQSNQGPLT or an equivalent thereof.
- the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of KSSQNLLNSGNQKNYLTor an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of WASTMES or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QNDYIYPLP or an equivalent thereof;
- the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of GYNMN or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of
- the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of a heavy chain amino acid sequence of the anti- CLDN 18.2 antibody disclosed herein
- the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of the light chain amino acid sequence from anti-CLDN 18.2 antibody disclosed herein, or equivalents thereof, as follows (CDRs are underlined):
- DIVMTQ SP S SLAMS VGQKVTMSCK S SQM NSSNQKNYL AW YQQKPGQ SPKLL VY FAS TRES GVPDRF TGS GS GTDF TLTI S S VQ AEDL A V Y Y CQQHYSTPLTF GAGTKLEL
- Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (Chimeric T252S4):
- Anti-CLDN 18.2 Light Chain Amino Acid Sequence (Chimeric T252S4):
- Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (HuVHl T252S4):
- Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (HuVH2 T252S4):
- Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (HuVH3 T252S4):
- DIVMTOSPDSL AY SLGERATINCKS SONLLNSGNOKNYLTWY OOKPGOPPKLLIYW ASTMESGVPDRFSGSGSGTDFTLTISSLOAEDVAVYYCONDYIYPLPFGOGTKLEIK. or an equivalent thereof.
- Anti-CLDN 18.2 Light Chain Amino Acid Sequence (HuVL2 T252S4):
- the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of an heavy chain encoded by the nucleic acid sequence of the anti-CLDN 18.2 antibody disclosed herein
- the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of the light chain chain encoded by the nucleic acid sequence from anti-CLDN 18.2 antibody disclosed herein, or equivalents thereof, as follows (CDRs are underlined):
- GAGCTGAAA or an equivalent thereof.
- GGGAC AGATTT C AC ACTC AAGAT C
- GCTGGAAATCAGA or an equivalent thereof.
- AAGGCACCACTCTCACAGTCTCCTCA or an equivalent thereof.
- GAGCTGAAA or an equivalent thereof.
- GAGCTGAAA or an equivalent thereof.
- Anti-CLDN 18.2 Chimeric Heavy Chain Nucleic Acid Sequence (T252S4):
- Anti-CLDN 18.2 Humanized Heavy Chain Nucleic Acid Sequence 1 (Hu VHl T252S4):
- GAAGTCC AGCTCGT GC AGTCTGGT GCGGAGGT C AAAAAACCCGGCGAGTCTCT CAAAATTAGTTGCAAAGGCTCCGGTTATTCATTCACGGGTTACAATATGAACTG GGTTCGACAAATGCCGGGTAAGGGACTTGAATGGATGGGATTGATCAACCCCT
- Anti-CLDN 18.2 Humanized Heavy Chain Nucleic Acid Sequence 2 (Hu VH2 T252S4):
- Anti-CLDN 18.2 Humanized Heavy Chain Nucleic Acid Sequence 3 (Hu VH3 T252S4):
- Anti-CLDN 18.2 Chimeric Light Chain Nucleic Acid Sequence 3 (Chimeric VL T252S4):
- Anti-CLDN 18.2 Humanized Light Chain Nucleic Acid Sequence 1 (Hu VL1 T252S4):
- Anti-CLDN 18.2 Humanized Light Chain Nucleic Acid Sequence 3 (Hu VL2 T252S4):
- humanized antibodies having the above-identified VH and VL combinations also are provided in Table 4.
- the disclosure provides an isolated anti-CLDN 18.2 antibody which is generated against a CLDN 18.2 fragment.
- the isolated antibody includes one or more of the following characteristics:
- the light chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a light chain variable domain of any of the disclosed light chain sequences;
- the heavy chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a heavy chain variable domain of any of the disclosed heavy chain sequences;
- the light chain immunoglobulin variable domain sequence is at least 85% identical to a light chain variable domain of any of the disclosed light chain sequences;
- the HC immunoglobulin variable domain sequence is at least 85% identical to a heavy chain variable domain of any of the disclosed light chain sequences;
- the antibody binds an epitope that overlaps with an epitope bound by any of the disclosed sequences.
- the present disclosure provides an isolated antibody that is at least 85% identical to the anti-CLDN 18.2 antibody disclosed herein.
- the antibody binds human CLDN 18.2 with a dissociation constant (KD) of less than lO _4 M, l0 _5 M, lO _6 M, lO _7 M, lO _8 M, lO _9 M, lO _10 M, 10 _11 M, or lO _12 M.
- KD dissociation constant
- the antigen binding site specifically binds to human CLDN 18.2.
- the antibody is soluble Fab.
- the HC and LC variable domain sequences are components of the same polypeptide chain. In some of the aspects of the antibodies provided herein, the HC and LC variable domain sequences are components of different polypeptide chains.
- the antibody is a monoclonal antibody comprising an anti- CLDN 18.2 heavy chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide selected disclosed herein or an equivalent of each thereof, and an anti-CLDN 18.2 light chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide disclosed herein or an equivalent of each thereof.
- the anti-CLDN 18.2 antibody is a chimeric antibody, human or a humanized antibody.
- the antibody is a monoclonal antibody. [0190] In some of the aspects of the antibodies provided herein, the antibody is a full- length antibody. In other aspect, antigen binding fragments of the antibodies are provided.
- the antibody fragment is selected from the group consisting of Fab, F(ab)'2, Fab’, scF v , and F v.
- one or more amino acid residues in a CDR of the antibodies provided herein are substituted with another amino acid.
- the substitution may be “conservative” in the sense of being a substitution within the same family of amino acids.
- the naturally occurring amino acids may be divided into the following four families and conservative substitutions will take place within those families:
- Amino acids with basic side chains lysine, arginine, histidine;
- Amino acids with acidic side chains aspartic acid, glutamic acid;
- Amino acids with nonpolar side chains glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, cysteine.
- one or more amino acid residues are added to or deleted from one or more CDRs of an antibody. Such additions or deletions occur at the N or C termini of the CDR or at a position within the CDR.
- antibodies of the present disclosure comprising such varied CDR sequences still bind CLDN 18.2 with similar specificity and sensitivity profiles as the disclosed antibodies. This may be tested by way of the binding assays.
- antibodies may also be varied.
- antibodies may be provided with Fc regions of any isotype: IgA (IgAl, IgA2), IgD, IgE, IgG (IgGl, IgG2, IgG3, IgG4) or IgM.
- the antibody contains structural modifications to facilitate rapid binding and cell uptake and/or slow release.
- the CLDN 18.2 antibody contains a deletion in the CH2 constant heavy chain region of the antibody to facilitate rapid binding and cell uptake and/or slow release.
- a Fab fragment is used to facilitate rapid binding and cell uptake and/or slow release.
- a F(ab)'2 fragment is used to facilitate rapid binding and cell uptake and/or slow release.
- the antibodies, fragments, and equivalents thereof can be combined with a carrier, e.g., a pharmaceutically acceptable carrier or other agents to provide a formulation for use and/or storage.
- a carrier e.g., a pharmaceutically acceptable carrier or other agents to provide a formulation for use and/or storage.
- isolated polypeptide comprising, or alternatively consisting essentially of, or yet further consisting of, the amino acid sequence of CLDN 18.2 or a fragment thereof, that are useful to generate antibodies that bind to CLDN 18.2, as well as isolated polynucleotides that encode them.
- the isolated polypeptides or polynucleotides further comprise a label and/or contiguous polypeptide sequences (e.g., keyhole limpet haemocyanin (KLH) carrier protein) or in the case of polynucleotides, polynucleotides encoding the sequence, operatively coupled to polypeptide or
- KLH keyhole limpet haemocyanin
- polypeptides or polynucleotides can be combined with various carriers, e.g., phosphate buffered saline.
- various carriers e.g., phosphate buffered saline.
- host cells e.g., prokaryotic or eukaryotic cells, e.g., bacteria, yeast, mammalian (rat, simian, hamster, or human), comprising the isolated polypeptides or polynucleotides.
- the host cells can be combined with a carrier.
- nucleic acids encoding the antibodies and fragments thereof as disclosed herein. They can be combined with a vector or appropriate host cell, and /or a suitable carrier for diagnostic or therapeutic use.
- the nucleic acids are contained with a host cell for recombinant production of polypeptides and proteins.
- the host cells can be eukaryotic or prokaryotic.
- Antibodies their manufacture and uses are well known and disclosed in, for example, Harlow, E. and Lane, D., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999.
- the antibodies may be generated using standard methods known in the art. Examples of antibodies include (but are not limited to) monoclonal, single chain, and functional fragments of antibodies.
- Antibodies may be produced in a range of hosts, for example goats, rabbits, rats, mice, humans, and others. They may be immunized by injection with a target antigen or a fragment or oligopeptide thereof which has immunogenic properties, such as an N-terminal or C-terminal fragment of CLDN 18.2 or an isolated polypeptide. Depending on the host species, various adjuvants may be added and used to increase an immunological response.
- adjuvants include, but are not limited to, Freund's, mineral gels such as aluminum hydroxide, and surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol.
- BCG Bacillus Calmette-Guerin
- Corynebacterium parvum are particularly useful.
- this disclosure also provides the isolated polypeptide and an adjuvant.
- the antibodies of the present disclosure are polyclonal, i.e., a mixture of plural types of anti-CLDN 18.2 antibodies having different amino acid sequences.
- the polyclonal antibody comprises a mixture of plural types of anti-CLDN 18.2 antibodies having different CDRs.
- a mixture of cells which produce different antibodies is cultured, and an antibody purified from the resulting culture can be used (see WO 2004/061104).
- Monoclonal antibodies to CLDN 18.2 may be prepared using any technique which provides for the production of antibody molecules by continuous cell lines in culture. Such techniques include, but are not limited to, the hybridoma technique (see, e.g., Kohler & Milstein, Nature 256: 495-497 (1975)); the trioma technique; the human B-cell hybridoma technique (see, e.g., Kozbor, et ah, Immunol.
- Human monoclonal antibodies can be utilized in the practice of the present technology and can be produced by using human hybridomas (see, e.g., Cote, et al., Proc. Natl. Acad. Sci. 80: 2026-2030 (1983)) or by transforming human B- cells with Epstein Barr Virus in vitro (see, e.g., Cole, et al., in: MONOCLONAL
- ANTIBODIES AND CANCER THERAPY Alan R. Liss, Inc., pp. 77-96 (1985)).
- a population of nucleic acids that encode regions of antibodies can be isolated. PCR utilizing primers derived from sequences encoding conserved regions of antibodies is used to amplify sequences encoding portions of antibodies from the population and then reconstruct DNAs encoding antibodies or fragments thereof, such as variable domains, from the amplified sequences.
- Such amplified sequences also can be fused to DNAs encoding other proteins— e.g., a bacteriophage coat, or a bacterial cell surface protein— for expression and display of the fusion polypeptides on phage or bacteria.
- Amplified sequences can then be expressed and further selected or isolated based, e.g., on the affinity of the expressed antibody or fragment thereof for an antigen or epitope present on the CLDN 18.2 polypeptide.
- hybridomas expressing anti- CLDN 18.2 monoclonal antibodies can be prepared by immunizing a subject, e.g., with an isolated polypeptide comprising, or alternatively consisting essentially of, or yet further consisting of, the amino acid sequence of CLDN 18.2 or a fragment thereof, and then isolating hybridomas from the subject's spleen using routine methods. See, e.g., Milstein et al., (Galfire and Milstein, Methods Enzymol 73: 3-46 (1981)).
- a selected monoclonal antibody with the desired properties can be (i) used as expressed by the hybridoma, (ii) bound to a molecule such as polyethylene glycol (PEG) to alter its properties, or (iii) a cDNA encoding the monoclonal antibody can be isolated, sequenced and manipulated in various ways.
- PEG polyethylene glycol
- the anti- CLDN 18.2 monoclonal antibody is produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- Hybridoma techniques include those known in the art and taught in Harlow et
- anti-CLDN 18.2 antibodies can be prepared using various phage display methods known in the art.
- phage display methods functional antibody domains are displayed on the surface of a phage particle which carries polynucleotide sequences encoding them.
- Phage with a desired binding property are selected from a repertoire or combinatorial antibody library (e.g., human or murine) by selecting directly with an antigen, typically an antigen bound or captured to a solid surface or bead.
- Phage used in these methods are typically filamentous phage including fd and M13 with Fab, F v or disulfide stabilized F v antibody domains are recombinantly fused to either the phage gene III or gene VIII protein.
- Fab expression libraries see, e.g., Huse, et al., Science 246: 1275-1281, 1989
- methods can be adapted for the construction of Fab expression libraries (see, e.g., Huse, et al., Science 246: 1275-1281, 1989) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for a CLDN 18.2 polypeptide, e.g., a polypeptide or derivatives, fragments, analogs or homologs thereof.
- Other examples of phage display methods that can be used to make the isolated antibodies of the present disclosure include those disclosed in Huston et al., Proc. Natl. Acad. Sci.
- the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host including mammalian cells, insect cells, plant cells, yeast, and bacteria.
- F(ab')2 fragments can also be employed using methods known in the art such as those disclosed in WO 92/22324; Mullinax et al., BioTechniques 12: 864-869 (1992); Sawai et al., AJRI 34: 26-34 (1995); and Better et al., Science 240: 1041-1043 (1988).
- hybrid antibodies or hybrid antibody fragments that are cloned into a display vector can be selected against the appropriate antigen in order to identify variants that maintained good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle.
- a display vector can be selected against the appropriate antigen in order to identify variants that maintained good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle.
- Other vector formats could be used for this process, such as cloning the antibody fragment library into a lytic phage vector (modified T7 or Lambda Zap systems) for selection and/or screening.
- Antibodies may also be produced by inducing in vivo production in the lymphocyte population or by screening recombinant immunoglobulin libraries or panels of highly specific binding reagents (Orlandi et al.,
- Single chain antibodies comprise a heavy chain variable region and a light chain variable region connected with a linker peptide (typically around 5 to 25 amino acids in length).
- linker peptide typically around 5 to 25 amino acids in length.
- the variable regions of the heavy chain and the light chain may be derived from the same antibody or different antibodies.
- scF v s may be synthesized using recombinant techniques, for example by expression of a vector encoding the scF v in a host organism such as E. coli.
- DNA encoding scF v can be obtained by performing amplification using a partial DNA encoding the entire or a desired amino acid sequence of a DNA selected from a DNA encoding the heavy chain or the variable region of the heavy chain of the above-mentioned antibody and a DNA encoding the light chain or the variable region of the light chain thereof as a template, by PCR using a primer pair that defines both ends thereof, and further performing amplification combining a DNA encoding a polypeptide linker portion and a primer pair that defines both ends thereof, so as to ligate both ends of the linker to the heavy chain and the light chain, respectively.
- An expression vector containing the DNA encoding scF v and a host transformed by the expression vector can be obtained according to conventional methods known in the art.
- Antigen binding fragments may also be generated, for example the
- F(ab')2 fragments which can be produced by pepsin digestion of the antibody molecule and the Fab fragments which can be generated by reducing the disulfide bridges of the
- Fab expression libraries may be constructed to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity (Huse et ak, Science, 256: 1275-1281 (1989)).
- the antibodies of the present disclosure may be multimerized to increase the affinity for an antigen.
- the antibody to be multimerized may be one type of antibody or a plurality of antibodies which recognize a plurality of epitopes of the same antigen.
- binding of the IgG CH3 domain to two scF v molecules, binding to streptavidin, introduction of a helix-turn- helix motif and the like can be exemplified.
- the antibody compositions disclosed herein may be in the form of a conjugate formed between any of these antibodies and another agent (such as an antibody drug conjugate (ADC) or an immunoconjugate).
- ADC antibody drug conjugate
- Non-limitng examples suitable to conjugate or fuse with the antibodies disclosed herein include therapeutic agents, e.g. detectable labels such as radioactive labels, an immunomodulator, a hormone, an enzyme, an
- the antibodies may be conjugated to therapeutic agents, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, and/or polyethylene glycol (PEG).
- PEG polyethylene glycol
- bispecific Antibodies CLDN18.2 is over-expressed in cancer tissues but has restricted off-target positivity. It is contemplated that bi-functional molecules that combine an anti-CLDNl8.2 antibody or fragment with another molecule or fragment that has specificity (second specificity) to a cytokine, an immune checkpoint, or a cancer or tumor antigen would have synergistic effect in treatments.
- the antibody compositions disclosed herein may be in the form of a bispecific antibody comprising the binding domain of the disclosed antibody and the binding domain with a second specificity.
- the second specificity is to a molecule selected from IL-l, CD3, CD16,
- CD 19, CD28, and CD64 Other examples include PD-l, PD-L1, CTLA-4, LAG-3 (also known as CD223), CD28, CD122, 4-1BB (also known as CD137), TIM3, OX-40 or OX40L, CD40 or CD40L, CD47, LIGHT, ICOS/ICOSL, GITR/GITRL, TIGIT, CD27, VISTA, B7H3, B7H4, HEVM or BTLA (also known as CD272), killer-cell
- tumor antigens include EGFR, Her2, EpCAM, CD20, CD30, CD33, CD47, CD52, CD 133, CD73, CEA, gpA33, Mucins, TAG-72, CIX, PSMA, folate-binding protein, GD2, GD3, GM2, VEGF, VEGFR, Integrin, anb3, a5b1, ERBB2, ERBB3, MET, IGF1R, EPHA3, TRAILR1, TRAILR2, RANKL, FAP and Tenascin.
- each of the anti-CLDNl8.2 fragment and the second fragment each is independently selected from a Fab fragment, a single-chain variable fragment (scFv), or a single-domain antibody.
- the bispecific antibody further includes a Fc fragment.
- Bifunctional molecules that include not just antibody or antigen binding fragment are also provided.
- an antibody or antigen-binding fragment specific to CLDN18.2, such as those described here can be combined with an immune cytokine or ligand optionally through a peptide linker.
- the linked immune cytokines or ligands include, but not limited to, IL-l, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL- 10, IL-l 2, IL-13, IL-15, GM-CSF, TNF-alpha, CD40L, OX40L, CD27L, CD30L, 4-1BBL, LIGHT and GITRL.
- Such bi-functional molecules can lead to specific tumor site local immune modulation.
- Antibody Screening Various immunoassays may be used for screening to identify antibodies having the desired specificity. Numerous protocols for competitive binding or immunoradiometric assays using either polyclonal or monoclonal antibodies with established specificities are well known in the art. Such immunoassays typically involve the measurement of complex formation between CLDN 18.2, or any fragment or oligopeptide thereof and its specific antibody. A two-site, monoclonal-based immunoassay utilizing monoclonal antibodies specific to two non-interfering CLDN 18.2 epitopes may be used, but a competitive binding assay may also be employed (Maddox et al., J. Exp. Med., 158: 1211-1216 (1983)).
- IHC Automated immunohistochemistry screening of potential anti-CLDN 18.2 antibodies
- VMSI Ventana Medical Systems, Inc
- VMSI Ventana Medical Systems, Inc
- Discovery XT formalin-fixed, paraffin-embedded human tissue on glass slides.
- Tissue samples first undergo deparaffmization, antigen retrieval, followed by the addition of the potential anti- CLDN 18.2 antibody and a detection antibody.
- the detection antibody is visualized using a chromogen detection reagent from VMSI. Stained slides are manually screened under a microscope. Samples having a correct primary antibody staining pattern are selected as potential anti-CLDN 18.2 candidates.
- the antibodies disclosed herein can be purified to homogeneity.
- the separation and purification of the antibodies can be performed by employing conventional protein separation and purification methods.
- the antibody can be separated and purified by
- chromatography examples include affinity chromatography, ion exchange chromatography, hydrophobic chromatography, gel filtration chromatography, reverse phase chromatography, and adsorption chromatography.
- chromatography can be performed by employing liquid chromatography such as HPLC or FPLC.
- a Protein A column or a Protein G column may be used in affinity chromatography.
- Other exemplary columns include a Protein A column, Hyper D, POROS, Sepharose F. F. (Pharmacia) and the like.
- CAR T-cells are genetically engineered autologous T-cells in which single chain antibody fragments (scFv) or ligands are attached to the T-cell signaling domain capable of facilitating T-cell activation (Maher, J. (2012) ISRN Oncol. 2012:278093; Curran, K.J. et al. (2012) J. Gene Med. 14:405-415; Fedorov, V.D. et al. (2014) Cancer J. 20:160-165; Barrett, D.M. et al. (2014) Annu. Rev. Med. 65:333-347).
- CARs combine HLA- independent targeting specificity of a monoclonal antibody with the cytolytic activity and homing properties of activated T-cells.
- the antibodies disclosed herein are useful in methods known in the art relating to the localization and/or quantitation of a CLDN 18.2 polypeptide (e.g., for use in measuring levels of the CLDN 18.2 polypeptide within appropriate physiological samples, for use in diagnostic methods, for use in imaging the polypeptide, and the like).
- the antibodies disclosed herein are useful in isolating a CLDN 18.2 polypeptide by standard techniques, such as affinity chromatography or immunoprecipitation.
- a CLDN 18.2 antibody disclosed herein can facilitate the purification of natural CLDN 18.2 polypeptides from biological samples, e.g., mammalian sera or cells as well as recombinantly-produced CLDN 18.2 polypeptides expressed in a host system.
- CLDN 18.2 antibody can be used to detect a CLDN 18.2 polypeptide (e.g., in plasma, a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the
- the CLDN 18.2 antibodies disclosed herein can be used diagnostically to monitor CLDN 18.2 levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen and/or to determine and identify sujects or patient who are most likekly to respond to the treatment because the tumors or cancer cells express the antigen.
- the detection can be facilitated by coupling (i.e., physically linking) the CLDN 18.2 antibodies disclosed herein to a detectable substance.
- compositions comprising an antibody or antigen binding fragment as disclosed herein bound to a peptide comprising, for example, a human CLDN 18.2 protein or a fragment thereof.
- the peptide is associated with a cell.
- the composition may comprise a disaggregated cell sample labeled with an antibody or antibody fragment as disclosed herein, which composition is useful in, for example, affinity chromatography methods for isolating cells or for flow cytometry-based cellular analysis or cell sorting.
- the composition may comprise a fixed tissue sample or cell smear labeled with an antibody or antibody fragment as disclosed herein, which composition is useful in, for example, immunohistochemistry or cytology analysis.
- the antibody or the antibody fragment is bound to a solid support, which is useful in, for example: ELISAs; affinity chromatography or immunoprecipitation methods for isolating CLDN 18.2 proteins or fragments thereof,
- the peptide is bound to a solid support.
- the peptide may be bound to the solid support via a secondary antibody specific for the peptide, which is useful in, for example, sandwich ELISAs.
- the peptide may be bound to a chromatography column, which is useful in, for example, isolation or purification of antibodies according to the present technology.
- the peptide is disposed in a solution, such as a lysis solution or a solution containing a sub- cellular fraction of a fractionated cell, which is useful in, for example, ELISAs and affinity chromatography or immunoprecipitation methods of isolating CLDN 18.2 proteins or fragments thereof or complexes containing CLDN 18.2 and other cellular components.
- a solution such as a lysis solution or a solution containing a sub- cellular fraction of a fractionated cell
- a matrix such as, for example, a gel electrophoresis gel or a matrix commonly used for western blotting (such as membranes made of nitrocellulose or polyvinylidene difluoride), which compositions are useful for electrophoretic and/or immunoblotting techniques, such as Western blotting.
- An exemplary method for detecting the level of CLDN 18.2 polypeptides in a biological sample involves obtaining a biological sample from a subject and contacting the biological sample with a CLDN 18.2 antibody disclosed herein which is capable of detecting the CLDN 18.2 polypeptides.
- the CLDN 18.2 antibodies T155S2, T158S2, T224S8, T192S2, and T252S4, or fragments thereof are detectably labeled.
- labeled with regard to the antibody is intended to encompass direct labeling of the antibody by coupling (i.e., physically linking) a detectable substance to the antibody, as well as indirect labeling of the antibody by reactivity with another compound that is directly labeled.
- indirect labeling include detection of a primary antibody using a fluorescently- labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin.
- the detection method of the present disclosure can be used to detect expression levels of CLDN 18.2 polypeptides in a biological sample in vitro as well as in vivo.
- In vitro techniques for detection of CLDN 18.2 polypeptides include enzyme linked immunosorbent assays (ELISAs), Western blots, flow cytometry, immunoprecipitations, radioimmunoassay, and immunofluorescence (e.g., IHC).
- ELISAs enzyme linked immunosorbent assays
- Western blots Western blots
- flow cytometry e.g., immunoprecipitations
- radioimmunoassay e.g., IHC
- in vivo techniques for detection of CLDN 18.2 polypeptides include introducing into a subject a labeled anti-CLDN 18.2 antibody.
- the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
- the biological sample contains polypeptide molecules from the test subject.
- a CLDN 18.2 antibody disclosed herein can be used to assay CLDN 18.2 polypeptide levels in a biological sample (e.g. human plasma) using antibody-based techniques.
- a biological sample e.g. human plasma
- protein expression in tissues can be studied with classical immunohistochemical (IHC) staining methods. Jalkanen, M. et ak, J. Cell.
- immunoassays such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- Suitable antibody assay labels include enzyme labels, such as, glucose oxidase, and radioisotopes or other radioactive agents, such as iodine ( 125 I, 121 I, 13 3 ⁇ 4, carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( 112 In), and technetium ( 99 mTc), and fluorescent labels, such as fluorescein and rhodamine, and biotin.
- CLDN 18.2 polypeptide levels can also be detected in vivo by imaging.
- Labels that can be incorporated with anti- CLDN 18.2 antibodies for in vivo imaging of CLDN 18.2 polypeptide levels include those detectable by X-radiography, NMR or ESR.
- suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject.
- Suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which can be incorporated into the CLDN 18.2 antibody by labeling of nutrients for the relevant scF v clone.
- a CLDN 18.2 antibody which has been labeled with an appropriate detectable imaging moiety, such as a radioisotope (e.g., 131 I, 112 In, 99 mTc), a radio-opaque substance, or a material detectable by nuclear magnetic resonance, is introduced (e.g., parenterally, subcutaneously, or intraperitoneally) into the subject.
- a radioisotope e.g., 131 I, 112 In, 99 mTc
- a radio-opaque substance e.g., a radio-opaque substance, or a material detectable by nuclear magnetic resonance
- the quantity of imaging moiety needed to produce diagnostic images.
- the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of "mTc.
- the labeled CLDN 18.2 antibody will then preferentially accumulate at the location of cells which contain the specific target polypeptide.
- in vivo tumor imaging is described in S. W. Burchiel et al., Tumor Imaging: The Radiochemical Detection of Cancer 13 (1982).
- CLDN 18.2 antibodies containing structural modifications that facilitate rapid binding and cell uptake and/or slow release are useful in in vivo imaging detection methods.
- the CLDN 18.2 antibody contains a deletion in the CH2 constant heavy chain region of the antibody to facilitate rapid binding and cell uptake and/or slow release.
- a Fab fragment is used to facilitate rapid binding and cell uptake and/or slow release.
- a F(ab)'2 fragment is used to facilitate rapid binding and cell uptake and/or slow release.
- compositions disclosed herein are useful in diagnostic and prognostic methods.
- the present disclosure provides methods for using the antibodies disclosed herein in the diagnosis of CLDN l8.2-related medical conditions in a subject.
- Antibodies disclosed herein may be selected such that they have a high level of epitope binding specificity and high binding affinity to the CLDN 18.2 polypeptide.
- the higher the binding affinity of an antibody the more stringent wash conditions can be performed in an immunoassay to remove nonspecifically bound material without removing the target polypeptide.
- CLDN 18.2 antibodies of the present technology useful in diagnostic assays usually have binding affinities of at least 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , 10 11 , or 10 12 M.
- CLDN 18.2 antibodies used as diagnostic reagents have a sufficient kinetic on-rate to reach equilibrium under standard conditions in at least 12 hours, at least 5 hours, at least 1 hour, or at least 30 minutes.
- Some methods of the present technology employ polyclonal preparations of anti- CLDN 18.2 antibodies and polyclonal anti-CLDN 18.2 antibody compositions as diagnostic reagents, and other methods employ monoclonal isolates.
- the preparation typically contains an assortment of CLDN 18.2 antibodies, e.g., antibodies, with different epitope specificities to the target polypeptide.
- the monoclonal anti-CLDN 18.2 antibodies of the present disclosure are useful for detecting a single antigen in the presence or potential presence of closely related antigens.
- CLDN 18.2 antibodies of the present disclosure can be used as diagnostic reagents for any kind of biological sample.
- the CLDN 18.2 antibodies disclosed herein are useful as diagnostic reagents for human biological samples.
- CLDN 18.2 antibodies can be used to detect CLDN 18.2 polypeptides in a variety of standard assay formats. Such formats include immunoprecipitation, Western blotting, ELISA,
- Bio samples can be obtained from any tissue (including biopsies), cell or body fluid of a subject.
- CLDN 18.2 Prognostic Uses of CLDN 18.2 antibodies.
- the present disclosure also provides for prognostic (or predictive) assays for determining whether a subject is at risk of developing a medical disease or condition associated with increased CLDN 18.2
- polypeptide expression or activity e.g., detection of a precancerous cell.
- assays can be used for prognostic or predictive purpose to thereby prophylactically treat an individual prior to the onset of a medical disease or condition characterized by or associated with CLDN 18.2 polypeptide expression.
- Another aspect of the present disclosure provides methods for determining CLDN 18.2 expression in a subject to thereby select appropriate therapeutic or prophylactic compounds for that subject.
- the prognostic assays can be utilized to identify a subject having or at risk for developing gastric, pancreatic, esophageal, ovarian, or lung cancer.
- the present disclosure provides a method for identifying a disease or condition associated with increased CLDN 18.2 polypeptide expression levels in which a test sample is obtained from a subject and the CLDN 18.2 polypeptide detected, wherein the presence of increased levels of CLDN 18.2 polypeptides compared to a control sample is predictive for a subject having or at risk of developing a disease or condition associated with increased CLDN 18.2 polypeptide expression levels.
- the disease or condition associated with increased CLDN 18.2 polypeptide expression levels is selected from the group consisting of gastric, pancreatic, esophageal, ovarian, and lung cancer.
- the present disclosure provides methods for determining whether a subject can be effectively treated with a compound for a disorder or condition associated with increased CLDN 18.2 polypeptide expression wherein a biological sample is obtained from the subject and the CLDN 18.2 polypeptide is detected using the CLDN 18.2 antibody.
- the expression level of the CLDN 18.2 polypeptide in the biological sample obtained from the subject is determined and compared with the CLDN 18.2 expression levels found in a biological sample obtained from a subject who is free of the disease. Elevated levels of the CLDN 18.2 polypeptide in the sample obtained from the subject suspected of having the disease or condition compared with the sample obtained from the healthy subject is indicative of the CLDN l8.2-associated disease or condition in the subject being tested.
- the elevated expression level of CLDN 18.2 polypeptides is known to be indicative of whether a subject with the disease is likely to respond to a particular type of therapy or treatment.
- the method of detecting a CLDN 18.2 polypeptide in a biological sample can be used as a method of prognosis, e.g., to evaluate the likelihood that the subject will respond to the therapy or treatment.
- the level of the CLDN 18.2 polypeptide in a suitable tissue or body fluid sample from the subject is determined and compared with a suitable control, e.g., the level in subjects with the same disease but who have responded favorably to the treatment.
- the present disclosure provides for methods of monitoring the influence of agents (e.g., drugs, compounds, or small molecules) on the expression of CLDN 18.2 polypeptides.
- agents e.g., drugs, compounds, or small molecules
- Such assays can be applied in basic drug screening and in clinical trials.
- the effectiveness of an agent to decrease CLDN 18.2 polypeptide levels can be monitored in clinical trials of subjects exhibiting elevated expression of CLDN 18.2, e.g., patients diagnosed with cancer.
- An agent that affects the expression of CLDN 18.2 polypeptides can be identified by administering the agent and observing a response. In this way, the expression pattern of the CLDN 18.2 polypeptide can serve as a marker, indicative of the physiological response of the subject to the agent.
- this response state may be determined before, and at various points during, treatment of the subject with the agent.
- this method comprises contacting a tumor sample isolated from the patient with an effective amount of an CLDN 18.2 antibody and detecting the presence of any antibody bound to the tumor sample.
- the presence of antibody bound to the tumor sample indicates that the patient is likely to respond to the CLDN 18.2 CAR therapy and the absence of antibody bound to the tumor sample indicates that the patient is not likely to respond to the CLDN 18.2 therapy.
- the method comprises the additional step of administering an effective amount of the CLDN 18.2 CAR therapy to a patient that is determined likely to respond to the CLDN 18.2 CAR therapy.
- the present disclosure provides diagnostic methods for determining the expression level of CLDN 18.2.
- the present disclosure provides kits for performing these methods as well as instructions for carrying out the methods of the present disclosure such as collecting tissue and/or performing the screen, and/or analyzing the results.
- the kit comprises, or alternatively consists essentially of, or yet further consists of, a CLDN 18.2 antibody composition (e.g., monoclonal antibodies) disclosed herein, and instructions for use.
- the kits are useful for detecting the presence of CLDN 18.2 polypeptides in a biological sample e.g., any body fluid including, but not limited to, e.g., sputum, serum, plasma, lymph, cystic fluid, urine, stool, cerebrospinal fluid, acitic fluid or blood and including biopsy samples of body tissue.
- the test samples may also be a tumor cell, a normal cell adjacent to a tumor, a normal cell corresponding to the tumor tissue type, a blood cell, a peripheral blood lymphocyte, or combinations thereof.
- test sample used in the above-described method will vary based on the assay format, nature of the detection method and the tissues, cells or extracts used as the sample to be assayed.
- Methods for preparing protein extracts or membrane extracts of cells are known in the art and can be readily adapted in order to obtain a sample which is compatible with the system utilized.
- the kit can comprise: one or more CLDN 18.2 antibodies capable of binding a CLDN 18.2 polypeptide in a biological sample (e.g., an antibody or antigen binding fragment thereof having the same antigen-binding specificity of CLDN 18.2 antibody B7H4 5F6, B7H4 # 33-14, or B7H4 #36-1); means for determining the amount of the CLDN 18.2 polypeptide in the sample; and means for comparing the amount of the CLDN 18.2 polypeptide in the sample with a standard.
- One or more of the CLDN 18.2 antibodies may be labeled.
- the kit components, e.g., reagents
- the kit can further comprise instructions for using the kit to detect the CLDN 18.2 polypeptides.
- the kit comprises a first antibody, e.g., attached to a solid support, which binds to a CLDN 18.2 polypeptide; and, optionally; 2) a second, different antibody which binds to either the CLDN 18.2 polypeptide or the first antibody and is conjugated to a detectable label.
- the kit can also comprise, e.g., a buffering agent, a preservative or a protein- stabilizing agent.
- the kit can further comprise components necessary for detecting the detectable-label, e.g., an enzyme or a substrate.
- the kit can also contain a control sample or a series of control samples, which can be assayed and compared to the test sample.
- Each component of the kit can be enclosed within an individual container and all of the various containers can be within a single package, along with instructions for interpreting the results of the assays performed using the kit.
- the kits of the present disclosure may contain a written product on or in the kit container. The written product describes how to use the reagents contained in the kit.
- these suggested kit components may be packaged in a manner customary for use by those of skill in the art.
- these suggested kit components may be provided in solution or as a liquid dispersion or the like.
- the antibodies or CLDN 18.2 CARs also can be bound to many different carriers.
- this disclosure also provides compositions containing the antibodies and another substance, active or inert.
- examples of well-known carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses and magnetite.
- the nature of the carrier can be either soluble or insoluble for purposes of the disclosure. Those skilled in the art will know of other suitable carriers for binding antibodies, or will be able to ascertain such, using routine
- the present disclosure provides chimeric antigen receptors (CAR) that bind to CLDN 18.2 comprising, or consisting essentially of, an extracellular and intracellular domain.
- the extracellular domain comprises a target-specific binding element otherwise referred to as the antigen binding domain.
- the intracellular domain or cytoplasmic domain comprises a costimulatory signaling region and a zeta chain portion.
- the CAR may optionally further comprise a spacer domain of up to 300 amino acids, preferably 10 to 100 amino acids, more preferably 25 to 50 amino acids.
- the present disclosure provides a CAR that comprises, or alternatively consists essentially thereof, or yet consists of an antigen binding domain specific to CLDN 18.2.
- the antigen binding domain comprises, or alternatively consists essentially thereof, or yet consists of the antigen binding domain of an anti-CLDN 18.2 antibody.
- the heavy chain variable region and light chain variable region of an anti-CLDN 18.2 antibody comprises, or alternatively consists essentially thereof, or yet consists of the antigen binding domain the anti-CLDN 18.2 antibody.
- the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Transmembrane regions of particular use in this invention may be derived from CD8, CD28, CD3, CD45, CD4, CD5, CDS, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154, TCR.
- the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
- residues such as leucine and valine.
- a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic
- a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR.
- a glycine-serine doublet provides a particularly suitable linker.
- Cytoplasmic Domain The cytoplasmic domain or intracellular signaling domain of the CAR is responsible for activation of at least one of the traditional effector functions of an immune cell in which a CAR has been placed.
- the intracellular signaling domain refers to a portion of a protein which transduces the effector function signal and directs the immune cell to perform its specific function. An entire signaling domain or a truncated portion thereof may be used so long as the truncated portion is sufficient to transduce the effector function signal.
- Cytoplasmic sequences of the TCR and co-receptors as well as derivatives or variants thereof can function as intracellular signaling domains for use in a CAR.
- Intracellular signaling domains of particular use in this invention may be derived from FcR, TCR, CD3, CDS, CD22, CD79a, CD79b, CD66d. Since signals generated through the TCR are alone insufficient for full activation of a T cell, a secondary or co stimulatory signal may also be required. Thus, the intracellular region of a co-stimulatory signaling molecule, including but not limited CD27, CD28, 4- IBB (CD 137), 0X40, CD30,
- CD40, PD- 1, ICOS, lymphocyte function-associated antigen- 1 (LFA-l ), CD2, CD7, LIGHT, NKG2C, B7-H3, or a ligand that specifically binds with CD83, to may also be included in the cytoplasmic domain of the CAR.
- the cell activation moiety of the chimeric antigen receptor is a T-cell signaling domain comprising, or alternatively consisting essentially of, or yet further consisting of, one or more proteins or fragments thereof selected from the group consisting of CD8 protein, CD28 protein, 4-1BB protein, and CD3-zeta protein.
- the CAR comprises, or alternatively consists essentially thereof, or yet consists of an antigen binding domain of an anti-CLDN 18.2 antibody, a CD8 a hinge domain, a CD8 a transmembrane domain, a costimulatory signaling region, and a CD3 zeta signaling domain.
- the costimulatory signaling region comprises either or both a CD28 costimulatory signaling region and a 4-1BB costimulatory signaling region.
- the CAR can further comprise a detectable marker or purification marker.
- the cell is a prokaryotic or a eukaryotic cell.
- the cell is a T-cell, a B cell, a NK cell, a dendritic cell, a myeloid cell, a monocyte, a macrophage, any subsets thereof, or any other immune cell.
- the eukaryotic cell can be from any preferred species, e.g., an animal cell, a mammalian cell such as a human, a feline or a canine cell.
- the cells may be derived from patients, donors, or cell lines, such as those available off-the-shelf.
- the isolated cell comprises, or alternatively consists essentially of, or yet further consists of an exogenous CAR comprising, or alternatively consisting essentially of, or yet further consisting of, an antigen binding domain of a anti- CLDN 18.2 antibody, a CD8 a hinge domain, a CD8 a transmembrane domain, a CD28 costimulatory signaling region and/or a 4-1BB costimulatory signaling region, and a CD3 zeta signaling domain.
- the isolated cell is a T-cell, e.g., an animal T-cell, a mammalian T-cell, a feline T-cell, a canine T-cell or a human T-cell.
- the isolated cell is an NK-cell, e.g., an animal NK-cell, a mammalian NK- cell, a feline NK-cell, a canine NK-cell or a human NK-cell.
- the isolated cell is a B-cell, e.g., an animal B-cell, a mammalian B-cell, a feline B-cell, a canine B-cell or a human B-cell.
- methods of producing CAR expressing cells comprising, or alternatively consisting essentially of or yet further consisting of transducing a population of isolated cells with a nucleic acid sequence encoding a CAR.
- a subpopulation of cells that have been successfully transduced with said nucleic acid sequence is selected.
- the isolated cells are T-cells, an animal T-cell, a mammalian T-cell, a feline T-cell, a canine T-cell or a human T-cell, thereby producing CAR T-cells.
- the isolated cell is an NK-cell, e.g., an animal NK-cell, a mammalian NK-cell, a feline NK-cell, a canine NK-cell or a human NK-cell, thereby producing CAR NK-cells.
- the isolated cells are B-cells, an animal B-cell, a mammalian B-cell, a feline B-cell, a canine B-cell or a human B-cell, thereby producing CAR B-cells.
- cells Prior to expansion and genetic modification of the cells disclosed herein, cells may be obtained from a subject - for instance, in embodiments involving autologous therapy - or a commercially available culture.
- Cells can be obtained from a number of sources in a subject, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
- Isolation methods for use in relation to this disclosure include, but are not limited to Life Technologies Dynabeads® system; STEMcell Technologies EasySepTM, RoboSepTM, RosetteSepTM, SepMateTM; Miltenyi Biotec MACSTM cell separation kits, and other commercially available cell separation and isolation kits.
- Particular subpopulations of immune cells may be isolated through the use of beads or other binding agents available in such kits specific to unique cell surface markers.
- MACSTM CD4+ and CD8+ MicroBeads may be used to isolate CD4+ and CD8+ T-cells.
- Alemate non-limiting examples of cells that may be isolated accoriding to known techniques include bulked T- cells, NK T-cells, and gamma delta T-cells.
- cells may be obtained through commercially available cell cultures, including but not limited to, for T-cells, lines BCL2 (AAA) Jurkat (ATCC® CRL-2902TM), BCL2 (S70A) Jurkat (ATCC® CRL-2900TM), BCL2 (S87A) Jurkat (ATCC® CRL- 2901TM), BCL2 Jurkat (ATCC® CRL-2899TM), Neo Jurkat (ATCC® CRL-2898TM); for B cells, lines AHH-l (ATCC® CRL-8146TM), BC-l (ATCC® CRL-2230TM), BC-2 (ATCC® CRL-2231TM), BC-3 (ATCC® CRL-2277TM), CA46 (ATCC® CRL-1648TM), DG-75[D.G- 75] (ATCC® CRL-2625TM), DS-l (ATCC® CRL-11102TM), EB-3[EB3] (ATCC® CCL- 85TM), Z-138 (ATCC #CRL-300l
- T-cell lines e.g., Deglis, EBT-8, HPB-MLp-W, HUT 78, HUT 102, Karpas 384, Ki 225, My-La, Se-Ax, SKW-3, SMZ-l and T34; immature T- cell lines, e.g., ALL-SIL, Bel3, CCRF-CEM, CML-T1, DND-41, DU.528, EU-9, HD-Mar, HPB-ALL, H-SB2, HT-l, JK- Tl, Jurkat, Karpas 45, KE-37, KOPT-K1, K-Tl, L-KAW, Loucy, MAT, MOLT-l, MOLT 3, MOLT-4, MOLT 13, MOLT- 16, MT-l, MT-ALL, Pl 2/Ichikawa, Peer, PER0117, PER- 255, PF-382, PFI-285, RPMI-8402, ST-4, SUP-T
- Null leukemia cell lines including but not limited to REH, NALL-l, KM-3, L92-221, are a another commercially available source of immune cells, as are cell lines derived from other leukemias and lymphomas, such as K562 erythroleukemia, THEM monocytic leukemia, U937 lymphoma, HEL erythroleukemia, HL60 leukemia, HMC-l leukemia, KG-l leukemia, EG266 myeloma.
- Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC,
- T-cells expressing the disclosed CARs may be further modified to reduce or eliminate expression of endogenous TCRs. Reduction or elimination of endogenous TCRs can reduce off-target effects and increase the effectiveness of the T cells.
- T cells stably lacking expression of a functional TCR may be produced using a variety of approaches. T cells internalize, sort, and degrade the entire T cell receptor as a complex, with a half-life of about 10 hours in resting T cells and 3 hours in stimulated T cells (von Essen, M. et al. 2004. J. Immunol. 173 :384-393). Proper functioning of the TCR complex requires the proper stoichiometric ratio of the proteins that compose the TCR complex.
- TCR function also requires two functioning TCR zeta proteins with IT AM motifs.
- the activation of the TCR upon engagement of its MHC-peptide ligand requires the engagement of several TCRs on the same T cell, which all must signal properly.
- the T cell will not become activated sufficiently to begin a cellular response.
- TCR expression may eliminated using RNA interference (e.g., shRNA, siRNA, miRNA, etc.), CRISPR, or other methods that target the nucleic acids encoding specific TCRs (e.g., TCR-a and TCR-b) and/or CD3 chains in primary T cells.
- RNA interference e.g., shRNA, siRNA, miRNA, etc.
- CRISPR CRISPR
- TCR-a and TCR-b CD3 chains in primary T cells.
- RNA interference e.g., shRNA, siRNA, miRNA, etc.
- shRNA siRNA
- miRNA miRNA
- RNAs e.g., shRNA, siRNA, miRNA, etc.
- expression of inhibitory RNAs in primary T cells can be achieved using any conventional expression system, e.g., a lentiviral expression system.
- lentiviruses are useful for targeting resting primary T cells, not all T cells will express the shRNAs. Some of these T cells may not express sufficient amounts of the RNAs to allow enough inhibition of TCR expression to alter the functional activity of the T cell.
- T cells that retain moderate to high TCR expression after viral transduction can be removed, e.g., by cell sorting or separation techniques, so that the remaining T cells are deficient in cell surface TCR or CD3, enabling the expansion of an isolated population of T cells deficient in expression of functional TCR or CD3.
- CRISPR in primary T cells can be achieved using conventional CRISPR/Cas sytems and guide RNAs specific to the target TCRs. Suitable expression systems, e.g. lentiviral or adenoviral expression systems are known in the art. Similar to the delivery of inhibitor RNAs, the CRISPR system can be use to specifically target resting primary T cells or other suitable immune cells for CAR cell therapy. Further, to the extent that CRISPR editing is unsuccessful, cells can be selected for success according to the methods disclosed above.
- T cells that retain moderate to high TCR expression after viral transduction can be removed, e.g., by cell sorting or separation techniques, so that the remaining T cells are deficient in cell surface TCR or CD3, enabling the expansion of an isolated population of T cells deficient in expression of functional TCR or CD3.
- a CRISPR editing construct may be useful in both knocking out the endogenous TCR and knocking in the CAR constructs disclosed herein. Accordingly, it is appreciated that a CRISPR system can be designed for to accomplish one or both of these purposes.
- CAR cells may be prepared using vectors. Aspects of the present disclosure relate to an isolated nucleic acid sequence encoding (i) a CAR or (ii) a polynucleotide encoding an immunoregulatory molecule and vectors comprising, or alternatively consisting essentially of, or yet further consisting of, an either one or both of these nucleic acids and/or complements and/or equivalents of each thereof.
- the isolated nucleic acid sequence encodes for a CAR comprising, or alternatively consisting essentially of, or yet further consisting of an antigen binding domain of a cancer or tumor targeting antibody, a CD8 a hinge domain, a CD8 a transmembrane domain, a CD28 costimulatory signaling region and/or a 4-1BB
- the isolated nucleic acid sequence comprises, or alternatively consisting essentially thereof, or yet further consisting of, sequences encoding (a) an antigen binding domain of an anti- CLDN 18.2 antibody followed by (b) a CD8 a hinge domain, (c) a CD8 a transmembrane domain followed by (d) a CD28 costimulatory signaling region and/or a 4-1BB
- the isolated nucleic acid sequence encodes for a CAR and comprises, or alternatively consists essentially of, or yet further consists of, a Kozak consensus sequence upstream of the sequence encoding the antigen binding domain of the anti-CLDN 18.2 antibody.
- the isolated nucleic acid comprises a detectable label and/or a polynucleotide conferring antibiotic resistance.
- the label or polynucleotide are useful to select cells successfully transduced with the isolated nucleic acids.
- the isolated nucleic acid sequence is comprised within a vector.
- the vector is a plasmid.
- the vector is a viral vector. Non-limiting examples of such include without limitation a retroviral vector, a lentiviral vector, an adenoviral vector, and an adeno-associated viral vector.
- the vector is a lentiviral vector.
- nucleic acid encoding CARs or immunoregulatory molecules is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector.
- a similar method may be used to construct the isolated nucleic acid sequence comprising a polynucleotide encoding an immunoregulatory molecule.
- the vectors can be suitable for replication and integration eukaryotes. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York).
- the term“vector” intends a recombinant vector that retains the ability to infect and transduce non-dividing and/or slowly-dividing cells and integrate into the target cell’s genome.
- the vector is derived from or based on a wild- type virus.
- the vector is derived from or based on a wild-type lentivirus. Examples of such include without limitation, human immunodeficiency virus (HIV), equine infectious anemia virus (EIAV), simian immunodeficiency virus (SIV) and feline immunodeficiency virus (FIV).
- retrovirus can be used as a basis for a vector backbone such murine leukemia virus (MLV).
- MLV murine leukemia virus
- a viral vector according to the disclosure need not be confined to the components of a particular virus.
- the viral vector may comprise components derived from two or more different viruses, and may also comprise synthetic components. Vector components can be manipulated to obtain desired characteristics such as target cell specificity.
- the recombinant vectors of this disclosure are derived from primates and non primates.
- primate lentiviruses include the human immunodeficiency virus (HIV), the causative agent of human acquired immunodeficiency syndrome (AIDS), and the simian immunodeficiency virus (SIV).
- the non-primate lentiviral group includes the prototype "slow virus” visna/maedi virus (VMV), as well as the related caprine arthritis- encephalitis virus (CAEV), equine infectious anemia virus (EIAV) and the more recently described feline immunodeficiency virus (FIV) and bovine immunodeficiency virus (BIV).
- U.S. Patent No. 6,924,123 discloses that certain retroviral sequence facilitate integration into the target cell genome.
- each retroviral genome comprises genes called gag, pol and env which code for virion proteins and enzymes. These genes are flanked at both ends by regions called long terminal repeats (LTRs).
- LTRs are responsible for proviral integration, and transcription. They also serve as enhancer- promoter sequences. In other words, the LTRs can control the expression of the viral genes.
- Encapsidation of the retroviral RNAs occurs by virtue of a psi sequence located at the 5' end of the viral genome.
- the LTRs themselves are identical sequences that can be divided into three elements, which are called U3, R and U5.
- U3 is derived from the sequence unique to the 3' end of the RNA.
- R is derived from a sequence repeated at both ends of the RNA
- U5 is derived from the sequence unique to the 5'end of the RNA.
- the sizes of the three elements can vary considerably among different retroviruses.
- For the viral geno e- and the site of poly (A) addition (termination) is at the boundary between R and U5 in the right hand side LTR.
- U3 contains most of the transcriptional control elements of the provirus, which include the promoter and multiple enhancer sequences responsive to cellular and in some cases, viral transcriptional activator proteins.
- gag encodes the internal structural protein of the virus.
- Gag protein is proteolytically processed into the mature proteins MA (matrix), CA (capsid) and NC (nucleocapsid).
- the pol gene encodes the reverse transcriptase (RT), which contains DNA polymerase, associated RNase H and integrase (IN), which mediate replication of the genome.
- RT reverse transcriptase
- I integrase
- the vector RNA genome is expressed from a DNA construct encoding it, in a host cell.
- the components of the particles not encoded by the vector genome are provided in trans by additional nucleic acid sequences (the "packaging system", which usually includes either or both of the gag/pol and env genes) expressed in the host cell.
- the set of sequences required for the production of the viral vector particles may be introduced into the host cell by transient transfection, or they may be integrated into the host cell genome, or they may be provided in a mixture of ways. The techniques involved are known to those skilled in the art.
- Retroviral vectors for use in this disclosure include, but are not limited to
- Invitrogen s pLenti series versions 4, 6, and 6.2“ViraPower” system. Manufactured by Lentigen Corp.; pHIV-7-GFP, lab generated and used by the City of Hope Research Institute;“Lenti-X” lentiviral vector, pLVX, manufactured by Clontech; pLKO. l-puro, manufactured by Sigma- Aldrich; pLemiR, manufactured by Open Biosystems; and pLV, lab generated and used by Charite Medical School, Institute of Virology (CBF), Berlin, Germany.
- exogenous nucleic acids include but are not limited to gene delivery using one or more of RNA electroporation, nanotechnology, sleeping beauty vectors, retroviruses, and/or adenoviruses.
- assays include, for example, "molecular biological" assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR;
- biochemical assays such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELlSAs and Western blots) or by assays described herein to identify agents falling within the scope of the disclosure.
- Packaging vector and cell lines The isolated nucleic acids can be packaged into a retroviral packaging system by using a packaging vector and cell lines.
- the packaging vector includes, but is not limited to retroviral vector, lentiviral vector, adenoviral vector, and adeno-associated viral vector.
- the packaging vector contains elements and sequences that facilitate the delivery of genetic materials into cells.
- the retroviral constructs are packaging vectors comprising at least one retroviral helper DNA sequence derived from a replication-incompetent retroviral genome encoding in trans all virion proteins required to package a replication incompetent retroviral vector, and for producing virion proteins capable of packaging the replication-incompetent retroviral vector at high titer, without the production of replication-competent helper virus.
- the retroviral DNA sequence lacks the region encoding the native enhancer and/or promoter of the viral 5 '
- the retrovirus is a leukemia virus such as a Moloney Murine Leukemia Virus (MMLV), the Human Immunodeficiency
- MMLV Moloney Murine Leukemia Virus
- the foreign enhancer and promoter may be the human cytomegalovirus (HCMV) immediate early (IE) enhancer and promoter, the enhancer and promoter (U3 region) of the Moloney Murine Sarcoma Virus
- MMSV the U3 region of Rous Sarcoma Virus
- RSV Rous Sarcoma Virus
- SFFV Forming Virus
- the retroviral packaging vector may consist of two retroviral helper DNA sequences encoded byplasmid based expression vectors, for example where a first helper sequence contains a cDNA encoding the gag and pol proteins of ecotropic MMLV or GALV and a second helper sequence contains a cDNA encoding the env protein.
- the Env gene which determines the host range, may be derived from the genes encoding xenotropic, amphotropic, ecotropic, polytropic (mink focus forming) or 10A1 murine leukemia virus env proteins, or the Gibbon Ape Leukemia Virus (GALV env protein, the Human Immunodeficiency Virus env (gpl60) protein, the Vesicular Stomatitus Virus (VSV) G protein, the Human T cell leukemia (HTLV) type I and II env gene products, chimeric envelope gene derived from combinations of one or more of the aforementioned env genes or chimeric envelope genes encoding the cytoplasmic and transmembrane of the aforementioned env gene products and a monoclonal antibody directed against a specific surface molecule on a desired target cell.
- GLV env protein Gibbon Ape Leukemia Virus
- gpl60 Human Immunodeficiency Virus env
- VSV Ves
- the packaging vectors and retroviral vectors are transiently cotransfected into a first population of mammalian cells that are capable of producing virus, such as human embryonic kidney cells, for example 293 cells (ATCC No. CRL1573, ATCC, Rockville, Md.) to produce high titer recombinant retrovirus-containing supernatants.
- virus such as human embryonic kidney cells, for example 293 cells (ATCC No. CRL1573, ATCC, Rockville, Md.)
- this transiently transfected first population of cells is then cocultivated with mammalian target cells, for example human lymphocytes, to transduce the target cells with the foreign gene at high efficiencies.
- mammalian target cells for example human lymphocytes
- the supernatants from the above described transiently transfected first population of cells are incubated with mammalian target cells, for example human lymphocytes or hematopoietic stem cells, to transduce the target cells with the foreign gene at high efficiencies.
- mammalian target cells for example human lymphocytes or hematopoietic stem cells
- the packaging vectors are stably expressed in a first population of mammalian cells that are capable of producing virus, such as human embryonic kidney cells, for example 293 cells.
- Retroviral or lentiviral vectors are introduced into cells by either cotransfection with a selectable marker or infection with pseudotyped virus. In both cases, the vectors integrate.
- vectors can be introduced in an episomally maintained plasmid. High titer recombinant retrovirus-containing supernatants are produced.
- the cells can be activated and expanded using generally known methods such as those described in U.S. Patent Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681 ; 7, 144,575; 7,067,318; 7, 172,869; 7,232,566; 7, 175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041 and references such as Lapateva et al.
- Stimulation with the CLDN 18.2 antigen ex vivo can activate and expand the selected CAR expressing cell subpopulation.
- the cells may be activated in vivo by interaction with CLDN 18.2 antigen.
- soluble CD-40 ligand may be helpful in activating and expanding certain B-cell populations; similarly, irradiated feeder cells may be used in the procedure for activation and expansion of NK cells.
- Isolation methods for use in relation to this disclosure include, but are not limited to Life Technologies Dynabeads® system activation and expansion kits; BD Biosciences PhosflowTM activation kits, Miltenyi Biotec MACSTM activation/expansion kits, and other commercially available cell kits specific to activation moieties of the relevant cell.
- Particular subpopulations of immune cells may be activated or expanded through the use of beads or other agents available in such kits.
- a -CD3/a-CD28 Dynabeads® may be used to activate and expand a population of isolated T-cells.
- chimeric antigen receptors comprise an antigen recognition moiety and a cell activation moiety. Aspects of the present disclosure related to a chimeric antigen receptor (CAR) comprising an antigen binding domain specific to CLDN 18.2.
- CAR chimeric antigen receptor
- the CAR of the present disclosure is characterized in that it comprises, or alternatively consists essentially of, or yet further consists an antigen binding domain of an anti-luteinizing hormone receptor (“CLDN 18.2”) antibody, a CD8 a hinge domain; a CD8 a transmembrane domain; a CD28 and/or a 4-1BB costimulatory signaling region; and a CD3 zeta signaling domain.
- the antigen binding domain of the anti-CLDN 18.2 antibody comprises an anti-CLDN 18.2 heavy chain variable region and an anti-CLDN 18.2 light chain variable region.
- antibodies having the detailed elements are also within the scope of this disclosure.
- the isolated nucleic acid further comprises, or alternatively consists essentially of, or yet further consists of a Kozak consenus sequence located upstream of the antigen binding domain of the anti-CLDN 18.2 antibody.
- the isolated nucleic sequence further comprises, or alternatively consists essentially of, or yet further consists of polynucleotide encoding an antibiotic resistance marker.
- the disclosure provides a vector comprising, or alternatively consisting essentially of, or yet further consisting of the isolated nucleic acid sequence encoding the anti-CLDN 18.2 CAR polypeptide as disclosed above or a complement thereof.
- the polynucleotide can be incorporated into a vector.
- Non-limiting examples of such include a retroviral vector, a plasmid, a lentiviral vector, an adenoviral vector, and an adeno-associated viral vector.
- the disclosure is an isolated cell comprising, or alternatively consisting essentially of, or yet further consisting of an exogenously added polynucleotide encoding the anti-CLDN 18.2 CAR as described above alone or in combination with a vector as described above; and/or the exogenously added the anti-CLDN 18.2 CAR; as describe above.
- the isolated cell can be a T-cell or a natural killer (NK) cell.
- NK natural killer
- the CAR T-cells of the present invention may be used to treat tumors and cancers.
- the CAR-T cells of the present invention may be administered either alone or in combination with diluents, known anti-cancer therapeutics, and/or with other components such as cytokines or other cell populations that are immunostimulatory.
- Method aspects of the present disclosure relate to methods for inhibiting the growth of a tumor in a subject in need thereof and/or for treating a cancer patient in need thereof.
- the tumor is a solid tumor.
- the tumors/cancer is gastric, pancreatic, esophageal, ovarian, or lung tumors/cancer.
- the tumor or cancer expresses or overexpresses CLDN 18.2.
- these methods comprise, or alternatively consist essentially of, or yet further consist of, administering to the subject or patient an effective amount of the isolated cell.
- this isolated cell comprises a CLDN 18.2 CAR.
- the isolated cell is a T-cell or an NK cell.
- the isolated cell is autologous to the subject or patient being treated.
- the tumor expresses CLDN 18.2 antigen and the subject has been selected for the therapy by a diagnostic, such as the one described herein.
- the CAR cells as disclosed herein may be administered either alone or in combination with diluents, known anti-cancer therapeutics, and/or with other components such as cytokines or other cell populations that are immunostimulatory. They may be first line, second line, third line, fourth line, or further therapy. The can be combined with other therapies. Non-limiting examples of such include chemotherapies or biologies.
- compositions comprising the CLDN 18.2 CAR of the present invention may be administered in a manner appropriate to the disease to be treated or prevented.
- the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
- the disclosure provides a method of inhibiting the growth of a solid tumor in a subject in need thereof, comprising administering to the subject an effective amount of the isolated cell of anti-CLDN 18.2 CAR T-cell or NK-cell.
- the isolated T-cells or NK-cells are autologous to the subject being treated.
- the tumor is a gastric, colon, colorectal, pancreatic, esophageal, ovarian, or lung tumor.
- the method of inhibiting the growth of a tumor can be applied to a subject including but not limited to human, dog, cat, horse, and other species.
- the disclosure provides a method of treating a cancer patient in need thereof, comprising, or alternatively consisting essentially of, or yet further consisting of administering to the subject an effective amount of the isolated cell of anti-CLDN 18.2 T-cell or NK-cell.
- the isolated T-cells or NK-cells can be autologous to the subject being treated.
- the tumor is gastric, pancreatic, esophageal, ovarian, or lung cancer.
- the subject treated for cancer is a human patient.
- the disclosure provides a method for determining if a patient is likely to respond or is not likely to anti-CLDN 18.2 CAR therapy, comprising, or alternatively consisting essentially of, or yet further consisting of contacting a tumor sample isolated from the patient with an effective amount of an anti-CLDN 18.2 antibody and detecting the presence of any antibody bound to the tumor sample, wherein the presence of antibody bound to the tumor sample indicates that the patient is likely to respond to the anti- CLDN 18.2 CAR therapy and the absence of antibody bound to the tumor sample indicates that the patient is not likely to respond to the anti-CAR therapy.
- the method further comprises administering an effective amount of the anti-CLDN 18.2 CAR therapy to the patient that is determined likely to respond to the anti-CLDN 18.2 CAR therapy.
- the patient can suffer from gastric, pancreatic, esophageal, ovarian, or lung cancer.
- the present disclosure also provides diagnostic methods for determining the expression level of CLDN 18.2.
- the present disclosure provides kits for performing these methods as well as instructions for carrying out the methods of the present disclosure such as collecting tissue and/or performing the screen, and/or analyzing the results.
- the disclosure provides a method of detecting CLDN 18.2 in a biological sample comprising, or alternatively consisting essentially of, or yet further consisting of contacting the sample with an anti-CLDN 18.2 antibody or an antigen binding fragment capable of binding a peptide comprising SEQ ID NOs: 42 and 43, and detecting a complex formed by the binding of the antibody or antigen binding fragment to CLDN 18.2.
- the sample comprises a cell sample or a tissue sample.
- the sample is obtained from a subject that is diagnosed as having, suspected as having, or at risk of having cancer.
- the cancer is gastric, pancreatic, esophageal, ovarian, or lung cancer.
- the cancer cell or tumor cell expresses or overexpresses CLDN 18.2.
- the detection comprises, or alternatively consists essentially of, or yet further consists of one or more of immunohistochemistry (IHC), Western blotting, Flow cytometry or ELISA.
- IHC immunohistochemistry
- Western blotting Western blotting
- Flow cytometry ELISA
- the method comprises, or alternatively consists essentially of, or yet further consists of isolating the biological sample from the subject.
- the subject is a mammal.
- the mammal is selected from the group of: a human, an animal, a non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
- the disclosure provides a method of detecting a pathological cell in a sample isolated from a subject, comprising, or alternatively consisting essentially of, or yet further consisting of (a) detecting the level of CLDN 18.2 in a biological sample from the subject by detecting a complex formed by an anti-CLDN 18.2 antibody or an antigenbinding fragment capable of binding a peptide comprising CLDN 18.2 and (b) comparing the levels of CLDN 18.2 observed in step (a) with the levels of CLDN 18.2 observed in a control biological sample; wherein the pathological cell is detected when the level of CLDN 18.2 is elevated compared to that observed in the control biological sample.
- the biological sample of the subject comprises, or alternatively consists essentially of, or yet further consists of one or more of a sample isolated from gastric, pancreatic, esophageal, ovarian, or lung tissue.
- the detection comprises, or alternatively consists essentially of, or yet further consists of one or more of immunohistochemistry (IHC), Western Blotting, Flow cytometry or ELISA.
- IHC immunohistochemistry
- Western Blotting Western Blotting
- Flow cytometry ELISA
- the method comprises, or alternatively consists essentially of, or yet further consists of isolating the biological sample from the subject.
- the subject is a mammal.
- the mammal is selected from the group of: a human, an animal, a non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
- compositions comprising a carrier and one or more of the products - e.g., an isolated cell comprising a CLDN 18.2 CAR, an isolated nucleic acid, a vector, an isolated cell of any anti-CLDN 18.2 antibody or CAR cell, an anti-CLDN 18.2 described in the embodiments disclosed herein.
- compositions of the present invention including but not limited to any one of the claimed compositions may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
- Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
- Compositions of the present disclosure may be formulated for oral, intravenous, topical, enteral, and/or parenteral administration. In certain embodiments, the compositions of the present disclosure are formulated for intravenous administration.
- compositions of the present invention including but not limited to any one of the claimed compositions may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
- Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
- Compositions of the present invention are preferably formulated for intravenous administration.
- compositions of the present invention may be administered in a manner appropriate to the disease to be treated or prevented.
- the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
- the following examples are provided to illustrate, and not limit the disclosure.
- Example 1 Generation of mouse monoclonal antibodies against human CLDN18.2
- Antigens a) cDNA encoding human CLDN18.2EC1 (extra-cellular domain 1) human Fc protein; b) human CLDN18.2EC1 (extra-cellular domain 1) human Fc protein; c) CHO cells expressing full length human CLDN18.2.
- microtiter plates were coated with human CLDN18.2 EC1 human Fc protein at 1 pg/ml in PBS, 1 OOmI/well at 4°C overnight and blocked with
- 96 well microtiter plates were seeded with human CLDN18.2/CHO cells or CLDN18.1/CHO cells at 200,000 cells/well. Dilutions of serum from immunized mice were added to each well. The cells were mixed well and incubated at 4°C for 15 min. The cells were then washed with PBS three times, followed by incubation with PE-labeled anti -mouse Fc gamma specific antibody (Jackson Immuno-Re search) at 4°C for l5min. The cells were washed again with PBS three times and analyzed using an FACS Caliber instrument (Becton-Dickinson). Mice with sufficient specific titers to CLDN18.2 were boosted with 30ug human CLDN18.2EC1 huFc protein 3-4 days before fusions.
- Hybridoma fusions were done using BTX2001 electro-cell manipulator (Harvard Apparatus) and the standard protocol for hybridoma electro-fusion.
- Total mouse lymphocytes isolated from both lymph nodes and the spleens were fused with SP2/0 cells (ATCC) and hybridoma were selected using media containing Azaserine (Sigma).
- Hybridoma supernatants were screened using both the ELISA and FACS assays. Positive wells were further subcloned using the limited dilution method.
- Hybridoma clones T13S2, T88S1, T138S2, T155S2, T158S2, T192S2, T224S8, T252S4 and LN27S4 were selected for hybridoma sequencing. Briefly, RNAs were extracted from hybridoma cells using Trizolreagents (Invitrogen) and cDNAs were prepared using the PrimeScriptTM Reverse Transcriptase). Antibody heavy and light chain V regions were PCR amplified using the cDNAs and the mouse Ig-Primer Set (Novagen, TB326 Rev.B 0503) and sequences were obtained using the standard DNA sequencing techniques.
- amino acid and polynucleotide sequences of the variable regions of the antibodies are provided in Table 1 and Table 2 below.
- Antibody CDRs are underlined.
- the binding of anti-human CLDN18.2 antibody to human CLDN18.2 can also be evaluated in ELISA assays. Briefly, 96 well microtiter plates were coated with human CLDN18.2 huFc protein at 1 m/ml in PBS, 100 m l/well at 4°C overnight and then blocked with 100 m l/well of 2% BSA at RT for 1 hour. Five-fold dilutions of purified mouse hybridoma antibodies starting from 20 m g/ml were added to each well and incubated for 1- 2 hours at RT.
- the plates were washed with PBS/Tween and then incubate with goat-anti mouse IgG antibody conjugated with Horse Radish Peroxidase (HRP) for 1 hour at RT. After washing, the plates were developed with TMB substrate and analyzed by
- FACS assay was also used to evaluate the binding of anti-CLDNl8.2 antibodies to human gastric cancer cell line KATO III. As shown in Fig. 5, the six anti-CLDNl8.2 hybridoma antibodies can bind to KATO III cells at various levels.
- Example 4 Anti-human CLDN18.2 mouse/human chimeric antibody binding affinity to human CLDN18.2 and KATO III cells
- mouse antibody heavy and light chain V regions were cloned into transient expression vectors containing human antibody heavy chain IgGl and light chain constant regions.
- the resulting antibody heavy and light chain expression constructs were used to transfect HEK293 cells.
- the culture supernatants were harvested and loaded onto protein A
- Sepharose columns (GE Healthcare). The columns were washed and antibodies were then eluted with eluting buffer (0.1 M glycine buffer, pH 3.0). Collected fractions were neutralized with 1 MTris-HCl, pH 8.0, pooled together and then dialyzed against PBS.
- eluting buffer 0.1 M glycine buffer, pH 3.0. Collected fractions were neutralized with 1 MTris-HCl, pH 8.0, pooled together and then dialyzed against PBS.
- CHO cells expressing human CLDN18.2 were first incubated with five fold serial diluted mouse/human chimeric mAbs starting at 100 pg/ml on ice for 30 min. The cells were then washed with PBS three times, followed by incubation with PE-labeled anti-human Fc gamma specific antibody (Jackson Immuno-Research) at 4°C for l5min. The cells were washed again with PBS three times and analyzed using an FACS Caliber instrument (Becton-Dickinson). As shown in Fig. 6, all six chimeric antibodies bind to CHO-CLDN18.2 cells at similar affinity as their hybridoma counterparts. D10C is an anti-human CLDN18.2 antibody identified by GanyMed and is used as a control.
- Example 6 Humanization of mouse anti-human CLDN18.2 antibody T252S4
- the mAh T252S4 variable region genes were employed to create a humanized MAb.
- the amino acid sequences of the VH and VK of MAb T252S4 were compared against the available database of human Ig gene sequences to find the overall best-matching human germline Ig gene sequences.
- the closest human match was the IGKV4-1 gene, and for the heavy chain the closest human match was the IGVH5-51 gene.
- the humanized VH and VK genes were produced synthetically and then respectively cloned into vectors containing the human gamma 1 and human kappa constant domains.
- the pairing of the human VH and the human VK created 6 humanized antibodies (see Table 4).
- Example 7 Humanized T252S4 antibodies specifically bind to cell surface human
- humanized T252S4 antibodies were produced from HEK293 cells. Briefly, the three HuT252S4 antibody heavy chain V regions (Hl, H2, and H3) and two light chain V regions (Ll and L2) were paired in different combinations (Table 5) to transfect HEK293 cells, resulting in six humanized T252S4 antibodies. The chimeric T252S4 H/L was also expressed for comparison. The culture supernatants were harvested and loaded onto protein A Sepharose columns (GE Healthcare). The columns were washed and antibodies were then eluted with eluting buffer (0.1 M glycine buffer, pH 3.0).
- eluting buffer 0.1 M glycine buffer, pH 3.0
- HuT252S4H2/Ll HuT252S4H3/Ll, HuT252S4Hl/L2, HuT252S4H2/L2, and
- HuT252S4H3/L2 had high binding affinities to cell surface CLDN18.2.
- the humanized T252S4 antibodies with EC50 ranging from 0.47 to 1 pg/ml, had similar affinities with or higher affinities than the chimeric T252S4 antibody (EC50 at 1 pg/ml) binding to cell surface CLDN18.2 (Fig. 9).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biotechnology (AREA)
- Urology & Nephrology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Microbiology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Provided herein are novel anti-CLDN 18.2 antibodies and chimeric antigen receptors (CAR), cells or compositions comprising the same, vector or plasmid encoding anti-CLDN 18.2 CAR, anti-CLDN 18.2 antibody-drug conjugates (ADCs), bispecific antibodies containing anti-CLDN 18.2 antibody, and methods for producing the same, or using the same for detecting or treating ovarian cancer or prostate cancer. Also provided herein are anti-CLDN 18.2 antibody, compositions comprising the same, nucleic acid sequence encoding the same, and a kit for detecting CLDN 18.2.
Description
NOVEL CLDN 18.2-SPECIFIC MONOCLONAL ANTIBODIES AND METHODS
OF USE THEREOF
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application claims priority under 35 U.S.C. § 119(e) of U.S. provisional application Serial No.: 62/703,036, filed July 25, 2018, the content of which is hereby incorporated by reference into the present disclosure.
TECHNICAL FIELD
[0002] This disclosure relates to novel CLDN 18.2 antibodies and chimeric antigen receptors (CAR) derived therefrom, cells or compositions comprising the same, and methods for using the same for therapy including the treatment of solid tumors.
BACKGROUND
[0003] Isoform 2 of claudin-l8 (CLDN 18.2), a tight junction molecule, is known to be a selective lineage marker. It has been observed to be expressed in a significant proportion of primary gastric cancers and metastases. Extopic activation has also been seen in pancreatic, esophageal, ovarian, and lung tumors. While it has a highly restricted expression in normal tissues, CLDN 18.2 is ectopically activated in a diversity of cancers. See Sahin et ah, Claudin-l8 splice variant 2 is a pan-cancer target suitable for therapeutic antibody development, Clin. Cancer Res. 2008;l4)23(:7624-34. Accordingly, antibodies against this isoform are useful in the treatment of treatment of gastrointestinal (GI) tumors, such as gastric, pancreatic, esophageal, ovarian, and lung tumors (e.g., IMAB362 (claudiximab, developed by Ganymed Pharmaceuticals AG)).
SUMMARY OF THE DISCLOSURE
[0004] This disclosure provides a novel antibody to CLDN 18.2 and compositions and methods of use thereof. More specifically, this disclosure provides a-new anti-CLDN 18.2 antibodies for the treatment of tumors expressing CLDN 18.2, such as for example, GI tumors that include, but are not limited to, gastric, pancreatic, esophageal, biliary tract, colorectal, colon, rectal, ovarian, and lung carcinomas. The target, CLDN 18.2, is highly expressed on the majority of these tumors but has restricted off-target positivity and
therefore a desirable safety profile. Thus, in one aspect, the compositions are particularly useful in the treatment of tumors or cancerous cell that express or overexpress CLDN 18.2.
[0005] In one aspect, the present disclosure provides isolated antibodies, the antibodies comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibodies bind to an epitope of CLDN 18.2. In one aspect, the antibodies bind to an epitope of CLDN 18.2, but not CLDN 18.1. In one aspect, the antibody is a humanized antibody comprising one or more, two or more, three or more, four or more, five or more, six or more, seven or more or all eight of the CDRs identified in Table 3, with the antibodies disclosed in Table 4. In another apsect, the antibodies bind with high specificity, that is they bind to CLDN 18.2 with an affinity of more than 80%, or alternatively more than 85%, or alternatively more than 90%, or alternatively more than 95%, binding for CLDN 18.2-expressing cells versus less than 20%, or alternatively less than 15%, or alternatively less than 10%, or alternatively less than 5% binding to CLDN 18.1. Examples of such are shown in Figs la, lb and 9. There, the antibodies are more sepicific for the CLDN18.2 expressing tumor cells and would have lower toxicity since they do not bind to the CLDN18.1 -expressing normal cells.
[0006] In some embodiments, the antibody is a bispecific antibody has a binding specificity to a second target protein. The second target protein, in some embodiments, is selected from the group consisting of IL-l, CD3, CD16, CD19, CD28, CD47, CD64, PD-l, PD-L1, CTLA-4, LAG-3, CD28, CD122, 4-1BB, TIM3, OX-40, OX40L, CD40, CD40L, LIGHT, ICOS, ICOSL, GITR, GITRL, TIGIT, CD27, VISTA, B7H3, B7H4, HEVM,
BTLA and KIR. In some embodiments, the antibody is comprised in an antibody drug conjuates (ADC) formed between the anitbody and another agent, such as toxin or drug. In some embodiments, the antibodies may be conjugated to therapeutic agents, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, and/or polyethylene glycol (PEG).
[0007] In a further aspect, this disclosure provides isolated anti-CLDN 18.2 antibodies or fragments thereof as disclosed herein and a detectable or purification label, alone or in combination with an CLDN 18.2 antigen or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, that in one aspect are bound to
each other to form a antigen/antibody complex. Further provided herein is an ex vivo cell comprising this antigen/antibody complex.
[0008] Aspects of the disclosure relate to a chimeric antigen receptor (CAR) comprising: (a) an antigen binding domain of a CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3); (b) a hinge domain; (c) a
transmembrane domain; and (d) an intracellular domain. Further aspects of the disclosure relate to a chimeric antigen receptor (CAR) comprising: (a) an antigen binding domain of a CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3); (b) a hinge domain; (c) a CD28 transmembrane domain; (d) one or more costimulatory regions selected from a CD28 costimulatory signaling region, a 4-1BB costimulatory signaling region, an ICOS costimulatory signaling region, and an 0X40 costimulatory region; and (e) a CD3 zeta signaling domain and alternatives thereof.
[0009] In a further aspect, the present disclosure provides a chimeric antigen receptor (CAR) comprising: (a) an antigen binding domain of an anti-CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3), (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) a CD28 and/or a 4-1BB costimulatory signaling region; and (e) a CD3 zeta signaling domain and alternatives thereof.
[0010] In another aspect, the present disclosure provides an isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, chimeric antibody, humanized antibody, bispecific antibody, or the anti-CLDN 18.2 CAR.
[0011] In another aspect, the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, chimeric antibody, bispecific antibody, humanized antibody, or the anti-CLDN 18.2 CAR.
[0012] In another aspect, the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, chimeric antibody, bispecific antibody, humanized antibody, or the anti-CLDN 18.2 CAR.
[0013] In another aspect, the present disclosure provides a composition comprising a carrier and one or more of: the anti-CLDN 18.2 antibody; and/or the bispecific antibody; and/or the chimeric antibody; and/or the humanized antibody; and/or the anti-CLDN 18.2
CAR; and/or the isolated nucleic acid encoding the anti-CLDN 18.2 antibody bispecific antibody, chimeric antibody, humanized antibody, or the anti- CLDN 18.2 CAR; and/or the vector comprising the isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, bispecific antibody, chimeric antibody, humanized antibody, or the anti-CLDN 18.2 CAR; and/or an isolated cell comprising the anti-CLDN 18.2 CAR.
[0014] In one aspect, the disclosure provides a composition comprising, or alternatively consisting essentially of, or yet further consisting of a carrier and one or more of: an antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a nucleic acid encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a vecor comprising the nucleic acid encoding the antibody or fragment (e.g., VH1, VH2, VH3,
VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, an isolated cell comprising an anti-CLDN 18.2 CAR and/or a polynucleotide encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof; and/or the isolated nucleic acid encoding the CAR; and/or the vector comprising the nucleic acid encoding the CAR; and/or the isolated cell expressing an anti- CLDN 18.2 CAR; and/or the anti-CLDN 18.2 antibody; and/or bispecific antibody; and/or humanized antibody.
[0015] Compositions are also provided. In one embodiment, the composition comprises an antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a fusion protein, or a CAR and/or car expressing-cell of the present disclosure and a pharmaceutically acceptable carrier. Also provided is an isolated cell comprising one or more polynucleotide encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof or the fusion protein or bispecific antibody of the present disclosure.
[0016] The present disclosure further provides a method of treating tumor or growth expressing CLND 18.2 antigen, such as for example cancer in a patient in need thereof, comprising administering to the patient a antibody or fragment (e.g., VH1, VH2, VLB,
VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a fusion protein, or a CAR and/or car expressing-cell of the present disclosure. Non-limiting examples of cancers include GI cancers, bladder cancer, liver cancer, colon cancer, rectal cancer,
colorectal cancer, endometrial cancer, biliary cancer, leukemia, lymphoma, pancreatic cancer, small cell lung cancer, non-small cell lung cancer, breast cancer, urethral cancer, head and neck cancer, gastrointestinal cancer, stomach cancer, oesophageal cancer, ovarian cancer, renal cancer, melanoma, prostate cancer and thyroid cancer.
BRIEF DESCRIPTION OF THE DRAWINGS
[0017] FIG. 1A-1B show the binding specificity of anti-CLDNl8.2 hybridoma antibodies. CHO stable cell lines expressing either human CLDN18.1 or human CLDN18.2 were used in the FACS analysis. All anti-CLDNl8.2 hybridoma antibodies were used at 10 pg/ml.
[0018] FIG. 2 shows that anti-CLDNl8.2 hybridoma antibody clone T29S9 binds to both CLDN18.1 and CLDN18.2 in the FACS analysis. T29S9 was used at 10 pg/ml in the analysis.
[0019] FIG. 3 shows binding of anti-CLDNl8.2 hybridoma antibodies with titration to CHO-CLDN18.2 cells.
[0020] FIG. 4 shows the CLDN18.2 hybridoma antibody binding to a plate coated with CLDN18.2 EC1 Protein. Human CLDNl8.2ECl-huFc protein was coated onto ELISA wells at 1 pg/ml.
[0021] FIG. 5 shows the binding of Anti-CLDNl8.2 hybridoma antibodies to KATO III Cells. Anti-CLDNl8.2 hybridoma antibodies were used at 20 pg/ml in the FACS analysis.
[0022] FIG. 6 shows binding of anti-CLDNl8.2 chimeric antibodies with titration to CHO-CLDN18.2 cells in the FACS analysis.
[0023] FIG. 7 shows binding of anti-CLDNl8.2 chimeric antibodies to KATO III cells. Anti-CLDNl8.2 chimeric antibodies were used at 20 pg/ml in the FACS analysis.
[0024] FIG. 8A-8E show anti-human CLDN18.2 antibody-induced receptor
internalization in CHO-CLDN18.2 cells.
[0025] FIG. 9 shows humanized anti-CLDNl8.2 antibodies, HuT252S4, bind to cell surface human CLDN18.2 on CHO cells stably expressing CLDN18.2 at similar or higher affinity as the chimeric T252S4 antibody.
DETAILED DESCRIPTION
[0026] It is to be understood that the present disclosure is not limited to particular aspects described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular aspects only, and is not intended to be limiting, since the scope of the present disclosure will be limited only by the appended claims.
[0027] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art to which this technology belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present technology, the preferred methods, devices and materials are now described. All technical and patent publications cited herein are incorporated herein by reference in their entirety. Nothing herein is to be construed as an admission that the present technology is not entitled to antedate such disclosure by virtue of prior invention.
[0028] The practice of the present technology will employ, unless otherwise indicated, conventional techniques of tissue culture, immunology, molecular biology, microbiology, cell biology, and recombinant DNA, which are within the skill of the art. See, e.g., Green and Sambrook eds. (2012) Molecular Cloning: A Laboratory Manual, 4th edition; the series Ausubel et al. eds. (2015) Current Protocols in Molecular Biology; the series Methods in Enzymology (Academic Press, Inc., N.Y.); MacPherson et al. (2015) PCR 1 : A Practical Approach (IRL Press at Oxford University Press); MacPherson et al. (1995) PCR 2: A Practical Approach; McPherson et al. (2006) PCR: The Basics (Garland Science); Harlow and Lane eds. (1999) Antibodies, A Laboratory Manual; Greenfield ed. (2014) Antibodies, A Laboratory Manual; Freshney (2010) Culture of Animal Cells: A Manual of Basic Technique, 6th edition; Gait ed. (1984) Oligonucleotide Synthesis; U.S. Pat. No. 4,683,195; Hames and Higgins eds. (1984) Nucleic Acid Hybridization; Anderson (1999) Nucleic Acid Hybridization; Herdewijn ed. (2005) Oligonucleotide Synthesis: Methods and Applications; Hames and Higgins eds. (1984) Transcription and Translation; Buzdin and Lukyanov ed. (2007) Nucleic Acids Hybridization: Modem Applications; Immobilized Cells and
Enzymes (IRL Press (1986)); Grandi ed. (2007) In Vitro Transcription and Translation Protocols, 2nd edition; Guisan ed. (2006) Immobilization of Enzymes and Cells; Perbal
(1988) A Practical Guide to Molecular Cloning, 2nd edition; Miller and Calos eds, (1987) Gene Transfer Vectors for Mammalian Cells (Cold Spring Harbor Laboratory); Makrides ed. (2003) Gene Transfer and Expression in Mammalian Cells; Mayer and Walker eds. (1987) Immunochemical Methods in Cell and Molecular Biology (Academic Press, London); Lundblad and Macdonald eds. (2010) Handbook of Biochemistry and Molecular Biology, 4th edition; and Herzenberg et al. eds (1996) Weir's Handbook of Experimental Immunology, 5th edition; and the more recent editions each thereof available at the time of filing.
[0029] All numerical designations, fus e.g., pH, temperature, time, concentration, and molecular weight, including ranges, are approximations which are varied ( + ) or ( - ) by increments of 1.0 or 0.1, as appropriate, or alternatively by a variation of +/- 15 %, or alternatively 10%, or alternatively 5%, or alternatively 2%. It is to be understood, although not always explicitly stated, that all numerical designations are preceded by the term “about.” It also is to be understood, although not always explicitly stated, that the reagents described herein are merely exemplary and that equivalents of such are known in the art.
[0030] It is to be inferred without explicit recitation and unless otherwise intended, that when the present technology relates to a polypeptide, protein, polynucleotide or antibody, an equivalent or a biologically equivalent of such is intended within the scope of the present technology.
Definitions
[0031] As used in the specification and claims, the singular form“a”,“an”, and“the” include plural references unless the context clearly dictates otherwise. For example, the term“a cell” includes a plurality of cells, including mixtures thereof.
[0032] As used herein, the term“animal” refers to living multi-cellular vertebrate organisms, a category that includes, for example, mammals and birds. The term“mammal” includes both human and non-human mammals.
[0033] The terms“subject,”“host,”“individual,” and“patient” are as used
interchangeably herein to refer to human and veterinary subjects, for example, humans, animals, non-human primates, dogs, cats, sheep, mice, horses, and cows. In some embodiments, the subject is a human.
[0034] As used herein, the term“antibody” collectively refers to immunoglobulins or immunoglobulin-like molecules including by way of example and without limitation, IgA, IgD, IgE, IgG and IgM, combinations thereof, and similar molecules produced during an immune response in any vertebrate, for example, in mammals such as humans, goats, rabbits and mice, as well as non-mammalian species, such as shark immunoglobulins.
Unless specifically noted otherwise, the term“antibody” includes intact immunoglobulins and“antibody fragments” or“antigen binding fragments” that specifically bind to a molecule of interest (or a group of highly similar molecules of interest) to the substantial exclusion of binding to other molecules (for example, antibodies and antibody fragments that have a binding constant for the molecule of interest that is at least 103 M 1 greater, at least 104 M 1 greater or at least 105 M 1 greater than a binding constant for other molecules in a biological sample). The term“antibody” also includes genetically engineered forms such as chimeric antibodies (for example, humanized murine antibodies), heteroconjugate antibodies (such as, bispecific antibodies). See also, Pierce Catalog and Handbook, 1994- 1995 (Pierce Chemical Co., Rockford, Ill.); Owen et ah, Kuby Immunology, 7th Ed., W.H. Freeman & Co., 2013; Murphy, Janeway’s Immunobiology, 8th Ed., Garland Science, 2014; Male et ah, Immunology (Roitt), 8th Ed., Saunders, 2012; Parham, The Immune System , 4th Ed., Garland Science, 2014.
[0035] In terms of antibody structure, an immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds. There are two types of light chain, lambda (l) and kappa (K). There are five main heavy chain classes (or isotypes) which determine the functional activity of an antibody molecule: IgM, IgD, IgG, IgA and IgE. Each heavy and light chain contains a constant region and a variable region, (the regions are also known as "domains"). In combination, the heavy and the light chain variable regions specifically bind the antigen. Light and heavy chain variable regions contain a "framework" region interrupted by three hypervariable regions, also called "complementarity-determining regions" or "CDRs". The extent of the framework region and CDRs have been defined (see, Rabat et al., Sequences of Proteins of Immunological Interest , U.S. Department of Health and Human Services, 1991, which is hereby incorporated by reference). The Rabat database is now maintained online. The sequences of the framework regions of different light or heavy chains are relatively conserved within a species. The framework region of an antibody, that is the combined framework regions of the constituent light and heavy chains,
largely adopts a b-sheet conformation and the CDRs form loops which connect, and in some cases form part of, the b-sheet structure. Thus, framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions.
[0036] The CDRs are primarily responsible for binding to an epitope of an antigen. The CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located. Thus, a VH CDR3 is located in the variable domain of the heavy chain of the antibody in which it is found, whereas a VL CDR1 is the CDR1 from the variable domain of the light chain of the antibody in which it is found. An antibody that binds CLDN 18.2 will have a specific VH region and the VL region sequence, and thus specific CDR sequences. Antibodies with different specificities (i.e. different combining sites for different antigens) have different CDRs. Although it is the CDRs that vary from antibody to antibody, only a limited number of amino acid positions within the CDRs are directly involved in antigen binding. These positions within the CDRs are called specificity determining residues (SDRs).
[0037] As used herein, the term“antigen” refers to a compound, composition, or substance that may be specifically bound by the products of specific humoral or cellular immunity, such as an antibody molecule or T-cell receptor. Antigens can be any type of molecule including, for example, haptens, simple intermediary metabolites, sugars (e.g., oligosaccharides), lipids, and hormones as well as macromolecules such as complex carbohydrates (e.g., polysaccharides), phospholipids, and proteins. Common categories of antigens include, but are not limited to, viral antigens, bacterial antigens, fungal antigens, protozoa and other parasitic antigens, tumor antigens, antigens involved in autoimmune disease, allergy and graft rejection, toxins, and other miscellaneous antigens.
[0038] As used herein, the term“antigen binding domain” refers to any protein or polypeptide domain that can specifically bind to an antigen target.
[0039] As used herein, the term“autologous,” in reference to cells refers to cells that are isolated and infused back into the same subject (recipient or host).“Allogeneic” refers to non-autologous cells.
[0040] As used herein, the term“B cell,” refers to a type of lymphocyte in the humoral immunity of the adaptive immune system. B cells principally function to make antibodies, serve as antigen presenting cells, release cytokines, and develop memory B cells after activation by antigen interaction. B cells are distinguished from other lymphocytes, such as T cells, by the presence of a B-cell receptor on the cell surface. B cells may either be isolated or obtained from a commercially available source. Non-limiting examples of commercially available B cell lines include lines AHH-l (ATCC® CRL-8l46™(, BC-l (ATCC® CRL-2230™(, BC-2 (ATCC® CRL-223 l™(, BC-3 (ATCC® CRL-2277™(, CA46 (ATCC® CRL-l648™(, DG-75[D.G.-75] (ATCC® CRL-2625™(, DS-l (ATCC® CRL-l 1102™(, EB-3[EB3] (ATCC® CCL-85™(, Z-138 (ATCC #CRL-300l), DB (ATCC CRL-2289), Toledo (ATCC CRL-2631), Pfiffer (ATCC CRL-2632), SR (ATCC CRL- 2262), JM-l (ATCC CRL-l 0421), NFS-5 C-l (ATCC CRL-1693); NFS-70 C10 (ATCC CRL-l 694), NFS-25 C-3 (ATCC CRL-1695), AND SUP-B15 (ATCC CRL-1929). Further examples include but are not limited to cell lines deived from anaplastic and large cell lymphomas, e.g., DEL, DL-40, FE-PD, JB6, Karpas 299, Ki-JK, Mac-2A Plyl, SR-786, SU-DFfL-l, -2, -4, -5, -6, -7, -8, -9, -10, and -16, DOFfH-2, NU-DFfL-l, U-937, Granda 519, USC-DFfL-l, RL; Hodgkin’s lymphomas, e g., DEV, FfD-70, FfDLM-2, FfD-MyZ, FfKB-l, KM-H2, L 428, L 540, L1236, SBH-l, SUP-HD1, SU/RH-HD-l. Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (atcc.org/) and the German Collection of Microorganisms and Cell Cultures (dsmz.de/).
[0041] As used herein, a“cancer” is a disease state characterized by the presence in a subject of cells demonstrating abnormal uncontrolled replication and in some aspects, the term may be used interchangably with the term“tumor.” The term“cancer or tumor antigen” referes to an antigen known to be associated and expressed on the surface with a cancer cell or tumor cell or tissue, and the term“cancer or tumor targeting antibody” refers to an antibody that targets such an antigen.
[0042] The term“chimeric antigen receptor” (CAR), as used herein, refers to a fused protein comprising an extracellular domain capable of binding to an antigen, a
transmembrane domain derived from a polypeptide different from a polypeptide from which the extracellular domain is derived, and at least one intracellular domain. The“chimeric antigen receptor (CAR)” is sometimes called a“chimeric receptor”, a“T-body”, or a
“chimeric immune receptor (CIR).” The“extracellular domain capable of binding to an antigen” means any oligopeptide or polypeptide that can bind to a certain antigen. The “intracellular domain” or“intracellular signaling domain” means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell. In certain embodiments, the intracellular domain may comprise, alternatively consist essentially of, or yet further comprise one or more costimulatory signaling domains in addition to the primary signaling domain. The “transmembrane domain” means any oligopeptide or polypeptide known to span the cell membrane and that can function to link the extracellular and signaling domains. A chimeric antigen receptor may optionally comprise a“hinge domain” which serves as a linker between the extracellular and transmembrane domains. Non limiting examples of polynucleotides encoding such domains are provided herein, e.g.:
[0043] Hinge domain: IgGl heavy chain hinge sequence:
CTCGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCG
[0044] Transmembrane domain: CD28 transmembrane region:
TTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAA
CAGTGGCCTTTATTATTTTCTGGGTG
[0045] Intracellular domain: 4-1BB co-stimulatory signaling region:
AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACC AGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAG A AG A AGG AGG AT GT G A AC T G
[0046] Intracellular domain: CD28 co-stimulatory signaling region:
AGGAGT AAGAGGAGC AGGCTCCTGC AC AGT GACT AC AT GAAC AT GACTCCCCG CCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTT CGCAGCCTATCGCTCC
[0047] Intracellular domain: CD3 zeta signaling region:
AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAA
CCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGG
ACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAA
CCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCT
ACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGG
CCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACAT
GCAGGCCCTGCCCCCTCGCTAA,
or equivalents of each thereof.
[0048] Further embodiments of each exemplary domain component include other proteins that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the proteins encoded by the above disclosed nucleic acid sequences. Further, non limiting examples of such domains are provided herein.
[0049] As used herein, the term“CD8 a hinge domain” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD8 a hinge domain sequence as shown herein. The example sequences of CD8 a hinge domain for human, mouse, and other species are provided in Pinto, R.D. et al. (2006) Vet. Immunol. Immunopathol. 110: 169-177. The sequences associated with the CD8 a hinge domain are provided in Pinto, R.D. et al. (2006) Vet. Immunol. Immunopathol. 110: 169-177.
[0050] Non-limiting examples of such include:
Human CD8 alpha hinge domain:
PAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIY
[0051] Mouse CD8 alpha hinge domain:
KVNSTTTKP VLRTP SP VHPT GT SQPQRPEDCRPRGS VKGT GLDF ACDIY
[0052] Cat CD8 alpha hinge domain:
PVKPTTTPAPRPPTQAPITTSQRVSLRPGTCQPSAGSTVEASGLDLSCDIY, and equivalents of each thereof.
[0053] As used herein, the term“CD8 a transmembrane domain” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid
sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD8 a transmembrane domain sequence as shown herein. The fragment sequences associated with the amino acid positions 183 to 203 of the human T-cell surface glycoprotein CD8 alpha chain (GenBank Accession No: NP 001759.3), or the amino acid positions 197 to 217 of the mouse T-cell surface glycoprotein CD8 alpha chain (GenBank Accession No: NP_00l074579.l), and the amino acid positions 190 to 210 of the rat T-cell surface glycoprotein CD8 alpha chain(GenBank Accession No: NP_ 113726.1) provide additional example sequences of the CD8 a transmembrane domain. The sequences associated with each of the listed accession numbers are provided as follows:
[0054] Human CD8 alpha transmembrane domain: IYIWAPLAGTCGVLLLSLVIT
[0055] Mouse CD8 alpha transmembrane domain: IWAPLAGICVALLLSLIITLI
[0056] Rat CD8 alpha transmembrane domain: IWAPLAGICAVLLLSLVITLI, and equivalents of each thereof.
[0057] As used herein, the term“CD28 transmembrane domain” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, at least 90% sequence identity, or alternatively at least 95% sequence identity with the CD28 transmembrane domain sequence as shown herein. The fragment sequences associated with the GenBank Accession Nos: XM_0067l2862.2 and
XM 009444056.1 provide additional, non-limiting, example sequences of the CD28 transmembrane domain. The sequences associated with each of the listed accession numbers are provided herein.
[0058] As used herein, the term“4-1BB costimulatory signaling region” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the 4-1BB costimulatory signaling region sequence as shown herein. Non-limiting example sequences of the 4-1BB costimulatory signaling region are provided in U.S. Publication 20130266551A1 (filed as U.S. App. No. 13/826,258), such as the exemplary sequence provided below:
[0059] 4-1BB costimulatory signaling region:
KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL, and an equivalent thereof.
[0060] As used herein, the term“CD28 costimulatory signaling region” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD28 costimulatory signaling region sequence shown herein. The example sequences CD28 costimulatory signaling domain are provided in ET.S. Patent No. 5,686,281; Geiger, T.L. et ah, Blood 98: 2364-2371 (2001); Hombach, A. et ah, J Immunol 167: 6123-6131 (2001); Maher, J. et al. Nat Biotechnol 20: 70-75 (2002); Haynes, N.M. et al., J Immunol 169: 5780-5786 (2002); Haynes, N.M. et al., Blood 100: 3155-3163 (2002). Non-limiting examples include residues 114-220 of the below CD28 Sequence: MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSC KYSYNLFSRE FRASLHKGLDSAVEVCVVYG NYSQQLQVYS KTGFNCDGKL GNESVTFYLQ NLYVNQTDIY F CKIEVM YPPP YLDNEK SN G TIIHVKGKHL CPSPLFPGPS KPFWVLVVVG GVLACYSLLVTVAFIIFWVR SKRSRLLHSD YMNMTPRRPG PTRKHYQPYA PPRDFAAYRS, and equivalents thereof.
[0061] As used herein, the term“ICOS costimulatory signaling region” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the ICOS costimulatory signaling region sequence as shown herein. Non-limiting example sequences of the ICOS costimulatory signaling region are provided in ET.S. Publication 2015/0017141A1 the exemplary polynucleotide encoding this sequence provided below.
[0062] ICOS costimulatory signaling region encoded by polynucleotide:
ACAAAAAAGA AGTATTCATC CAGTGTGCAC GACCCTAACG GTGAATACAT GTTCATGAGA GCAGTGAACA CAGCCAAAAA ATCCAGACTC ACAGATGTGA CCCTA, and equivalents thereof.
[0063] As used herein, the term“0X40 costimulatory signaling region” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, or alternativley 90% sequence identity, or alternatively at least 95% sequence identity with the 0X40 costimulatory signaling region sequence as shown herein. Non-limiting example sequences of the 0X40 costimulatory signaling region are disclosed in U.S. Publication 2012/20148552A1, and include an exemplary sequence encoding such is provided below.
[0064] 0X40 costimulatory signaling region encoded by polynucleotide:
AGGGACCAG AGGCTGCCCC CCGATGCCCA CAAGCCCCCT GGGGGAGGCA GTTTCCGGAC CCCCATCCAA GAGGAGCAGG CCGACGCCCA CTCCACCCTG GCCAAGATC, and equivalents thereof.
[0065] As used herein, the term“CD28 costimulatory signaling region” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, or alternatively 90% sequence identity, or alternatively at least 95% sequence identity with the CD28 costimulatory signaling region sequence shown herein.
The example sequences CD28 costimulatory signaling domain are provided in U.S. Patent No. 5,686,281; Geiger, T.L. et al. (2001) Blood 98: 2364-2371; Hombach, A. et al. (2001) J Immunol 167: 6123-6131; Maher, J. et al. (2002) Nat Biotechnol 20: 70-75; Haynes, N.M. et al. (2002) J Immunol 169: 5780-5786 (2002); Haynes, N.M. et al. (2002) Blood 100: 3155-3163. Non-limiting examples include residues 114-220 of the below and the sequence encoded:
CD28 Sequence: MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSC KYSYNLFSRE FRASLHKGLDSAVEVCVVYG NYSQQLQVYS KTGFNCDGKL GNESVTFYLQ NLYVNQTDIY F CKIEVM YPPP YLDNEK SN G TIIHVKGKHL CPSPLFPGPS KPFWVLVVVG GVL AC Y SLL VT V AFIIF WVR SKRSRLLHSD YMNMTPRRPG PTRKHYQPYA PPRDFAAYRS, and equivalents thereof.
[0066] As used herein, the term“CD3 zeta signaling domain” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity,
preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD3 zeta signaling domain sequence as shown herein. Non-limiting example sequences of the CD3 zeta signaling domain are provided in U.S. Application No. 13/826,258, e.g.: RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRR KNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYD ALHMQALPPR, and equivalents thereof.
[0067] A“composition” typically intends a combination of the active agent, e.g., compound or composition, and a naturally-occurring or non-naturally-occurring carrier, inert (for example, a detectable agent or label) or active, such as an adjuvant, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like and include pharmaceutically acceptable carriers. Carriers also include pharmaceutical excipients and additives proteins, peptides, amino acids, lipids, and carbohydrates (e.g., sugars, including monosaccharides, di-, tri-, tetra-oligosaccharides, and oligosaccharides; derivatized sugars such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in combination 1-99.99% by weight or volume. Exemplary protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, and the like. Representative amino acid/antibody components, which can also function in a buffering capacity, include alanine, arginine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like. Carbohydrate excipients are also intended within the scope of this technology, examples of which include but are not limited to monosaccharides such as fructose, maltose, galactose, glucose, D- mannose, sorbose, and the like; di saccharides, such as lactose, sucrose, trehalose, cellobiose, and the like; polysaccharides, such as raffmose, melezitose, maltodextrins, dextrans, starches, and the like; and alditols, such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol) and myoinositol.
[0068] As used herein, the term“comprising” is intended to mean that the compositions and methods include the recited elements, but do not exclude others.“Consisting essentially of’ when used to define compositions and methods, shall mean excluding other elements of any essential significance to the combination for the intended use. For example, a composition consisting essentially of the elements as defined herein would not
exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives and the like.
“Consisting of’ shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions disclosed herein. Aspects defined by each of these transition terms are within the scope of the present disclosure.
[0069] The term“consensus sequence” as used herein refers to an amino acid or nucleic acid sequence that is determined by aligning a series of multiple sequences and that defines an idealized sequence that represents the predominant choice of amino acid or base at each corresponding position of the multiple sequences. Depending on the sequences of the series of multiple sequences, the consensus sequence for the series can differ from each of the sequences by zero, one, a few, or more substitutions. Also, depending on the sequences of the series of multiple sequences, more than one consensus sequence may be determined for the series. The generation of consensus sequences has been subjected to intensive mathematical analysis. Various software programs can be used to determine
a consensus sequence.
[0070] As used herein, the term“CRISPR” refers to a technique of sequence specific genetic manipulation relying on the clustered regularly interspaced short palindromic repeats pathway. CRISPR can be used to perform gene editing and/or gene regulation, as well as to simply target proteins to a specific genomic location. Gene editing refers to a type of genetic engineering in which the nucleotide sequence of a target polynucleotide is changed through introduction of deletions, insertions, or base substitutions to the polynucleotide sequence. In some aspects, CRISPR-mediated gene editing utilizes the pathways of nonhomologous end-joining (NHEJ) or homologous recombination to perform the edits. Gene regulation refers to increasing or decreasing the production of specific gene products such as protein or RNA.
[0071] The term“gRNA” or“guide RNA” as used herein refers to the guide RNA sequences used to target specific genes for correction employing the CRISPR technique. Techniques of designing gRNAs and donor therapeutic polynucleotides for target specificity are well known in the art. For example, Doench, I, et al. Nature biotechnology 2014;
32(12): 1262-7, Mohr, S. et al. (2016) FEBS Journal 283: 3232-38, and Graham, D., et al. Genome Biol. 2015; 16: 260. gRNA comprises or alternatively consists essentially of, or
yet further consists of a fusion polynucleotide comprising CRISPR RNA (crRNA) and trans-activating CRIPSPR RNA (tracrRNA); or a polynucleotide comprising CRISPR RNA (crRNA) and trans-activating CRIPSPR RNA (tracrRNA). In some aspects, a gRNA is synthetic (Kelley, M. et al. (2016) J of Biotechnology 233 (2016) 74-83). As used herehin, a biological equivalent of a gRNA includes but is not limited to polynucleotides or targeting molecules that can guide a Cas9 or equivalent thereof to a specific nucleotide sequence such as a specific region of a cell’s genome.
[0072] “Cytoreductive therapy,” as used herein, includes but is not limited to
chemotherapy, cryotherapy, and radiation therapy. Agents that act to reduce cellular proliferation are known in the art and widely used. Chemotherapy drugs that kill cancer cells only when they are dividing are termed cell-cycle specific. These drugs include agents that act in S-phase, including topoisomerase inhibitors and anti-metabolites.
[0073] Topoisomerase inhibitors are drugs that interfere with the action of topoisomerase enzymes (topoisomerase I and II). During the process of chemo treatments, topoisomerase enzymes control the manipulation of the structure of DNA necessary for replication, and are thus cell cycle specific. Examples of topoisomerase I inhibitors include the camptothecan analogs listed above, irinotecan and topotecan. Examples of topoisomerase II inhibitors include amsacrine, etoposide, etoposide phosphate, and teniposide.
[0074] Antimetabolites are usually analogs of normal metabolic substrates, often interfering with processes involved in chromosomal replication. They attack cells at very specific phases in the cycle. Antimetabolites include folic acid antagonists, e.g.,
methotrexate; pyrimidine antagonist, e.g., 5-fluorouracil, foxuridine, cytarabine, capecitabine, and gemcitabine; purine antagonist, e.g., 6-mercaptopurine and 6-thioguanine; adenosine deaminase inhibitor, e.g., cladribine, fludarabine, nelarabine and pentostatin; and the like.
[0075] Plant alkaloids are derived from certain types of plants. The vinca alkaloids are made from the periwinkle plant (Catharanthus rosea). The taxanes are made from the bark of the Pacific Yew tree (taxus). The vinca alkaloids and taxanes are also
known as antimicrotubule agents. The podophyllotoxins are derived from the May apple plant. Camptothecan analogs are derived from the Asian“Happy Tree” (Camptotheca
acuminata). Podophyllotoxins and camptothecan analogs are also
classified as topoisomerase inhibitors. The plant alkaloids are generally cell-cycle specific.
[0076] Examples of these agents include vinca alkaloids, e.g., vincristine, vinblastine and vinorelbine; taxanes, e.g., paclitaxel and docetaxel; podophyllotoxins, e.g., etoposide and tenisopide; and camptothecan analogs, e.g., irinotecan and topotecan.
[0077] Cryotherapy includes, but is not limited to, therapies involving decreasing the temperature, for example, hypothermic therapy.
[0078] Radiation therapy includes, but is not limited to, exposure to radiation, e.g., ionizing radiation, UV radiation, as known in the art. Exemplary dosages include, but are not limited to, a dose of ionizing radiation at a range from at least about 2 Gy to not more than about 10 Gy and/or a dose of ultraviolet radiation at a range from at least about 5 J/m2to not more than about 50 J/m2, usually about 10 J/m2.
[0079] As used herein, the term“detectable marker” refers to at least one marker capable of directly or indirectly, producing a detectable signal. A non-exhaustive list of this marker includes enzymes which produce a detectable signal, for example by colorimetry, fluorescence, luminescence, such as horseradish peroxidase, alkaline phosphatase, b- galactosidase, glucose-6-phosphate dehydrogenase, chromophores such as fluorescent, luminescent dyes, groups with electron density detected by electron microscopy or by their electrical property such as conductivity, amperometry, voltammetry, impedance, detectable groups, for example whose molecules are of sufficient size to induce detectable
modifications in their physical and/or chemical properties, such detection may be accomplished by optical methods such as diffraction, surface plasmon resonance, surface variation, the contact angle change or physical methods such as atomic force spectroscopy, tunnel effect, or radioactive molecules such as 32 P, 35 S or 125 1.
[0080] An“effective amount” or“efficacious amount” refers to the amount of an agent, or combined amounts of two or more agents, that, when administered for the treatment of a mammal or other subject, is sufficient to effect such treatment for the disease. The “effective amount” will vary depending on the agent(s), the disease and its severity and the age, weight, etc., of the subject to be treated.
[0081] The term“encode” as it is applied to nucleic acid sequences refers to a polynucleotide which is said to“encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof. The antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
[0082] As used herein, the term“enhancer”, as used herein, denotes sequence elements that augment, improve or ameliorate transcription of a nucleic acid sequence irrespective of its location and orientation in relation to the nucleic acid sequence to be expressed.
An enhancer may enhance transcription from a single promoter or simultaneously from more than one promoter. As long as this functionality of improving transcription is retained or substantially retained (e.g., at least 70%, at least 80%, at least 90% or at least 95% of wild-type activity, that is, activity of a full-length sequence), any truncated, mutated or otherwise modified variants of a wild-type enhancer sequence are also within the above definition.
[0083] In one aspect, the term“equivalent” or“biological equivalent” of an antibody means the ability of the antibody to selectively bind its epitope protein or fragment thereof as measured by ELISA or other suitable methods. Biologically equivalent antibodies include, but are not limited to, those antibodies, peptides, antibody fragments, antibody variant, antibody derivative and antibody mimetics that bind to the same epitope as the reference antibody.
[0084] It is to be inferred without explicit recitation and unless otherwise intended, that when the present disclosure relates to a polypeptide, protein, polynucleotide or antibody, an equivalent or a biologically equivalent of such is intended within the scope of this disclosure. As used herein, the term“biological equivalent thereof’ is intended to be synonymous with“equivalent thereof’ when referring to a reference protein, antibody, polypeptide or nucleic acid, intends those having minimal homology while still maintaining desired structure or functionality. Unless specifically recited herein, it is contemplated that any polynucleotide, polypeptide or protein mentioned herein also includes equivalents thereof. For example, an equivalent intends at least about 70% homology or identity, or at least 80 % homology or identity and alternatively, or at least about 85 %, or alternatively at
least about 90 %, or alternatively at least about 95 %, or alternatively 98 % percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid. Alternatively, when referring to
polynucleotides, an equivalent thereof is a polynucleotide that hybridizes under stringent conditions to the reference polynucleotide or its complement.
[0085] A polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) having a certain percentage (for example, 80%, 85%, 90%, or 95%) of“sequence identity” to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences. The alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1. Preferably, default parameters are used for alignment. A preferred alignment program is BLAST, using default parameters. In particular, preferred programs are BLASTN and BLASTP, using the following default parameters: Genetic code = standard; filter = none; strand = both; cutoff = 60; expect = 10; Matrix = BLOSUM62; Descriptions = 50 sequences; sort by = HIGH SCORE; Databases = non-redundant, GenBank + EMBL + DDBJ + PDB + GenBank CDS translations +
SwissProtein + SPupdate + PIR. Details of these programs can be found at the following Internet address: ncbi.nlm.nih.gov/cgi-bin/BLAST.
[0086] As used herein, the term“expression” refers to the process by which
polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell. The expression level of a gene may be determined by measuring the amount of mRNA or protein in a cell or tissue sample. In one aspect, the expression level of a gene from one sample may be directly compared to the expression level of that gene from a control or reference sample. In another aspect, the expression level of a gene from one sample may be directly compared to the expression level of that gene from the same sample following administration of a compound.
[0087] The phrase“first line” or“second line” or“third line” refers to the order of treatment received by a patient. First line therapy regimens are treatments given first,
whereas second or third line therapy are given after the first line therapy or after the second line therapy, respectively. The National Cancer Institute defines first line therapy as“the first treatment for a disease or condition. In patients with cancer, primary treatment can be surgery, chemotherapy, radiation therapy, or a combination of these therapies. First line therapy is also referred to those skilled in the art as“primary therapy and primary treatment.” See National Cancer Institute website at cancer.gov, last visited on May 1,
2008. Typically, a patient is given a subsequent chemotherapy regimen because the patient did not show a positive clinical or sub-clinical response to the first line therapy or the first line therapy has stopped.
[0088] As used herein,“homology” or“identical”, percent“identity” or“similarity”, when used in the context of two or more nucleic acids or polypeptide sequences, refers to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, e.g., at least 60% identity, preferably at least 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region (e.g., nucleotide sequence encoding an antibody described herein or amino acid sequence of an antibody described herein).
Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences. The alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et ah, eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1. Preferably, default parameters are used for alignment. A preferred alignment program is BLAST, using default parameters. In particular, preferred programs are BLASTN and BLASTP, using the following default parameters: Genetic code = standard; filter = none; strand = both; cutoff = 60; expect = 10; Matrix = BLOSUM62; Descriptions = 50 sequences; sort by = HIGH SCORE; Databases = non-redundant, GenBank + EMBL + DDBJ + PDB + GenBank CDS translations +
SwissProtein + SPupdate + PIR. Details of these programs can be found at the following Internet address: ncbi.nlm.nih.gov/cgi-bin/BLAST. The terms“homology” or“identical”, percent“identity” or“similarity” also refer to, or can be applied to, the complement of a test
sequence. The terms also include sequences that have deletions and/or additions, as well as those that have substitutions. As described herein, the preferred algorithms can account for gaps and the like. Preferably, identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is at least 50-100 amino acids or nucleotides in length. An“unrelated” or“non-homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences disclosed herein.
[0089] “Hybridization” refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues. The hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein binding, or in any other sequence-specific manner. The complex may comprise two strands forming a duplex structure, three or more strands forming a multi -stranded complex, a single self-hybridizing strand, or any combination of these. A hybridization reaction may constitute a step in a more extensive process, such as the initiation of a PCR reaction, or the enzymatic cleavage of a polynucleotide by a ribozyme.
[0090] Examples of stringent hybridization conditions include: incubation temperatures of about 25°C to about 37°C; hybridization buffer concentrations of about 6x SSC to about lOx SSC; formamide concentrations of about 0% to about 25%; and wash solutions from about 4x SSC to about 8x SSC. Examples of moderate hybridization conditions include: incubation temperatures of about 40°C to about 50°C; buffer concentrations of about 9x SSC to about 2x SSC; formamide concentrations of about 30% to about 50%; and wash solutions of about 5x SSC to about 2x SSC. Examples of high stringency conditions include: incubation temperatures of about 55°C to about 68°C; buffer concentrations of about lx SSC to about O.lx SSC; formamide concentrations of about 55% to about 75%; and wash solutions of about lx SSC, O. lx SSC, or deionized water. In general,
hybridization incubation times are from 5 minutes to 24 hours, with 1, 2, or more washing steps, and wash incubation times are about 1, 2, or 15 minutes. SSC is 0.15 M NaCl and 15 mM citrate buffer. It is understood that equivalents of SSC using other buffer systems can be employed.
[0091] The term“isolated” as used herein refers to molecules or biologicals or cellular materials being substantially free from other materials. In one aspect, the term“isolated”
refers to nucleic acid, such as DNA or RNA, or protein or polypeptide (e.g., an antibody or derivative thereof), or cell or cellular organelle, or tissue or organ, separated from other DNAs or RNAs, or proteins or polypeptides, or cells or cellular organelles, or tissues or organs, respectively, that are present in the natural source. The term“isolated” also refers to a nucleic acid or peptide that is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Moreover, an“isolated nucleic acid” is meant to include nucleic acid fragments which are not naturally occurring as fragments and would not be found in the natural state. The term“isolated” is also used herein to refer to polypeptides which are isolated from other cellular proteins and is meant to encompass both purified and recombinant polypeptides. The term“isolated” is also used herein to refer to cells or tissues that are isolated from other cells or tissues and is meant to encompass both cultured and engineered cells or tissues.
[0092] As used herein, the term“isolated cell” generally refers to a cell that is
substantially separated from other cells of a tissue.
[0093] “Immune cells” includes, e.g., white blood cells (leukocytes) which are derived from hematopoietic stem cells (HSC) produced in the bone marrow, lymphocytes (T cells,
B cells, natural killer (NK) cells) and myeloid-derived cells (neutrophil, eosinophil, basophil, monocyte, macrophage, dendritic cells).
[0094] As used herein the term“linker sequence” relates to any amino acid sequence comprising from 1 to 10, or alternatively, 8 amino acids, or alternatively 6 amino acids, or alternatively 5 amino acids that may be repeated from 1 to 10, or alternatively to about 8, or alternatively to about 6, or alternatively about 5, or 4 or alternatively 3, or alternatively 2 times. For example, the linker may comprise up to 15 amino acid residues consisting of a pentapeptide repeated three times. In one aspect, the linker sequence is a (Glycine4Serine)3 flexible polypeptide linker comprising three copies of gly-gly-gly-gly-ser.
[0095] A“normal cell corresponding to the tumor tissue type” refers to a normal cell from a same tissue type as the tumor tissue. A non-limiting example is a normal lung cell from a patient having lung tumor, or a normal colon cell from a patient having colon tumor.
[0096] As used herein, the term“T cell,” refers to a type of lymphocyte that matures in the thymus. T cells play an important role in cell-mediated immunity and are distinguished
from other lymphocytes, such as B cells, by the presence of a T-cell receptor on the cell surface. T-cells may either be isolated or obtained from a commercially available source.
“T cell” includes all types of immune cells expressing CD3 including T-helper cells (CD4+ cells), cytotoxic T-cells (CD8+ cells), natural killer T-cells, T-regulatory cells (Treg) and gamma-delta T cells. A“cytotoxic cell” includes CD8+ T cells, natural-killer (NK) cells, and neutrophils, which cells are capable of mediating cytotoxicity responses. Non-limiting examples of commercially available T-cell lines include lines BCL2 (AAA) Jurkat
(ATCC® CRL-2902™), BCL2 (S70A) Jurkat (ATCC® CRL-2900™), BCL2 (S87A)
Jurkat (ATCC® CRL-2901™), BCL2 Jurkat (ATCC® CRL-2899™), Neo Jurkat (ATCC® CRL-2898™), TALL- 104 cytotoxic human T cell line (ATCC # CRL-l 1386). Further examples include but are not limited to mature T-cell lines, e.g., such as Deglis, EBT-8, HPB-MLp-W, HUT 78, HUT 102, Karpas 384, Ki 225, My-La, Se-Ax, SKW-3, SMZ-l and T34; and immature T- cell lines, e.g., ALL-SIL, Bel3, CCRF-CEM, CML-T1, DND-41, DU.528, EU-9, HD-Mar, HPB-ALL, H-SB2, HT-l, JK-T1, Jurkat, Karpas 45, KE-37, KOPT-K1, K-Tl, L-KAW, Loucy, MAT, MOLT-l, MOLT 3, MOLT-4, MOLT 13,
MOLT- 16, MT-l, MT-ALL, Pl2/Ichikawa, Peer, PER0117, PER-255, PF-382, PFI-285, RPMI-8402, ST-4, SUP-T1 to T14, TALL-l, TALL-101, TALL- 103/2, TALL- 104, TALL- 105, TALL- 106, TALL-107, TALL-197, TK-6, TLBR-l, -2, -3, and -4, CCRF-HSB-2 (CCL-120.1), J.RT3-T3.5 (ATCC TIB-153), J45.01 (ATCC CRL-1990), J.CaMl .6 (ATCC CRL-2063), RS4;l 1 (ATCC CRL-1873), CCRF-CEM (ATCC CRM-CCL-l 19); and cutaneous T-cell lymphoma lines, e.g., HuT78 (ATCC CRM-TIB-161), MJ[Gl l] (ATCC CRL-8294), HuTl02 (ATCC TIB-162). Null leukemia cell lines, including but not limited to REH, NALL-l, KM-3, L92-221, are a another commercially available source of immune cells, as are cell lines derived from other leukemias and lymphomas, such as K562 erythroleukemia, THP-l monocytic leukemia, U937 lymphoma, HEL erythroleukemia, HL60 leukemia, HMC-l leukemia, KG-l leukemia, U266 myeloma. Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (atcc.org/) and the German Collection of Microorganisms and Cell Cultures (dsmz.de/).
[0097] As used herein, the term“NK cell,” also known as natural killer cell, refers to a type of lymphocyte that originates in the bone marrow and play a critical role in the innate immune system. NK cells provide rapid immune responses against viral-infected cells,
tumor cells or other stressed cell, even in the absence of antibodies and major histocompatibility complex on the cell surfaces. NK cells may either be isolated or obtained from a commercially available source. Non-limiting examples of commercial NK cell lines include lines NK-92 (ATCC® CRL-2407™), NK-92MI (ATCC® CRL-2408™). Further examples include but are not limited to NK lines HANK1, KHYG-l, NKL, NK-YS, NOI- 90, and YT. Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (atcc.org/) and the German Collection of Microorganisms and Cell Cultures (dsmz.de/).
[0098] As used herein in reference to a regulatory polynucleotide, the term“operatively linked” refers to an association between the regulatory polynucleotide and the
polynucleotide sequence to which it is linked such that, when a specific protein binds to the regulatory polynucleotide, the linked polynucleotide is transcribed.
[0099] As used herein, the term "overexpress" with respect to a cell, a tissue, or an organ expresses a protein to an amount that is greater than the amount that is produced in a control cell, a control issue, or an organ. A protein that is overexpressed may be endogenous to the host cell or exogenous to the host cell.
[0100] The terms“polynucleotide” and“oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogs thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown. The following are
non-limiting examples of polynucleotides: a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, RNAi, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers. A polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present,
modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide. The sequence of nucleotides can be interrupted by non-nucleotide components. A polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component. The term also refers to both double- and single-stranded molecules. ETnless otherwise specified or required, any aspect of this
technology that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the
double-stranded form.
[0101] As used herein, the terms“nucleic acid sequence” and“polynucleotide” are used interchangeably to refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. Thus, this term includes, but is not limited to, single-, double-, or multi- stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
[0102] The term“promoter” as used herein refers to any sequence that regulates the expression of a coding sequence, such as a gene. Promoters may be constitutive, inducible, repressible, or tissue-specific, for example. A“promoter” is a control sequence that is a region of a polynucleotide sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors.
[0103] The term“protein”,“peptide” and“polypeptide” are used interchangeably and in their broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics. The subunits may be linked by peptide bonds. In another aspect, the subunit may be linked by other bonds, e.g., ester, ether, etc. A protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise a protein’s or peptide’s sequence. As used herein the term“amino acid” refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and
peptidomimetics.
[0104] As used herein, the term“purified” does not require absolute purity; rather, it is intended as a relative term. Thus, for example, a purified nucleic acid, peptide, protein, biological complexes or other active compound is one that is isolated in whole or in part from proteins or other contaminants. Generally, substantially purified peptides, proteins, biological complexes, or other active compounds for use within the disclosure comprise more than 80% of all macromolecular species present in a preparation prior to admixture or
formulation of the peptide, protein, biological complex or other active compound with a pharmaceutical carrier, excipient, buffer, absorption enhancing agent, stabilizer,
preservative, adjuvant or other co-ingredient in a complete pharmaceutical formulation for therapeutic administration. More typically, the peptide, protein, biological complex or other active compound is purified to represent greater than 90%, often greater than 95% of all macromolecular species present in a purified preparation prior to admixture with other formulation ingredients. In other cases, the purified preparation may be essentially homogeneous, wherein other macromolecular species are not detectable by conventional techniques.
[0105] As used herein, the term“purification marker” refers to at least one marker useful for purification or identification. A non-exhaustive list of this marker includes His, lacZ, GST, maltose-binding protein, NusA, BCCP, c-myc, CaM, FLAG, GFP, YFP, cherry, thioredoxin, poly(NANP), V5, Snap, HA, chitin-binding protein, Softag 1, Softag 3,
Strep, or S-protein. Suitable direct or indirect fluorescence marker comprise FLAG, GFP, YFP, RFP, dTomato, cherry, Cy3, Cy 5, Cy 5.5, Cy 7, DNP, AMCA, Biotin, Digoxigenin, Tamra, Texas Red, rhodamine, Alexa fluors, FITC, TRITC or any other fluorescent dye or hapten.
[0106] As used herein, the term“recombinant protein” refers to a polypeptide which is produced by recombinant DNA techniques, wherein generally, DNA encoding the polypeptide is inserted into a suitable expression vector which is in turn used to transform a host cell to produce the heterologous protein.
[0107] As used herein, the term“specific binding” means the contact between an antibody and an antigen with a binding affinity of at least lO_6M. In certain aspects, antibodies bind with affinities of at least about lO_7M, and preferably lO_8M, lO_9M, lO_10M, l0_11 M, or lO 12M.
[0108] As used herein, the term“fusion protein” or“fusion polypeptide” intends any drug (small molecule, polypeptide or protein) fused or joined to an antibody or fragment thereof as disclosed herein. Non-limiting examples of such includes, for example, bispecific and antibody-drug conjugates
[0109] A“solid tumor” is an abnormal mass of tissue that usually does not contain cysts or liquid areas. Solid tumors can be benign or malignant, metastatic or non-metastatic.
Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors include sarcomas, carcinomas, and lymphomas.
[0110] As used herein, the term“suicide gene” is a gene capable of inducing cell apoptosis; non-limiting examples include HSV-TK (Herpes simplex virus thymidine kinase), cytosine deaminase, nitroreductase, carboxylesterase, cytochrome P450 or PNP (Purine nucleoside phosphorylase), truncated EGFR, or inducible caspase (“iCasp”).
Suicide genes may function along a variety of pathways, and, in some cases, may be inducible by an inducing agent such as a small molecule. For example, the iCasp suicide gene comprises portion of a caspase protein operatively linked to a protein optimized to bind to an inducing agent; introduction of the inducing agent into a cell comprising the suicide gene results in the activation of caspase and the subsequent apoptosis of said cell.
[0111] The term“transduce” or“transduction” as it is applied to the production of chimeric antigen receptor cells refers to the process whereby a foreign nucleotide sequence is introduced into a cell. In some embodiments, this transduction is done via a vector.
[0112] As used herein,“treating” or“treatment” of a disease in a subject refers to (1) preventing the symptoms or disease from occurring in a subject that is predisposed or does not yet display symptoms of the disease; (2) inhibiting the disease or arresting its development; or (3) ameliorating or causing regression of the disease or the symptoms of the disease. As understood in the art,“treatment” is an approach for obtaining beneficial or desired results, including clinical results. For the purposes of the present technology, beneficial or desired results can include one or more, but are not limited to, alleviation or amelioration of one or more symptoms, diminishment of extent of a condition (including a disease), stabilized (i.e., not worsening) state of a condition (including disease), delay or slowing of condition (including disease), progression, amelioration or palliation of the condition (including disease), states and remission (whether partial or total), whether detectable or undetectable. Treatments containing the disclosed compositions and methods can be first line, second line, third line, fourth line, fifth line therapy and are intended to be used as a sole therapy or in combination with other appropriate therapies. In one aspect, the term“treatment” excludes prevention.
[0113] As used herein, the term“vector” refers to a nucleic acid construct deigned for transfer between different hosts, including but not limited to a plasmid, a virus, a cosmid, a
phage, a BAC, a YAC, etc. In some embodiments, plasmid vectors may be prepared from commercially available vectors. In other embodiments, viral vectors may be produced from baculoviruses, retroviruses, adenoviruses, AAVs, etc. according to techniques known in the art. In one embodiment, the viral vector is a lentiviral vector.
[0114] As used herein the term“CLDN 18.2” refers to isoform 2 of claudin-l8. See Sahin U, Koslowski M, Dhaene K, Usener D, Brandenburg G, Seitz G, Huber C, Tureci O.
Claudin-l8 splice variant 2 is a pan-cancer target suitable for therapeutic antibody development, Clin. Cancer Res. 2008;l4(23):7624-34. Non-limiting exemplary sequences of claudin 18 or the underlying gene may be found under Gene Cards ID: GC03P137998, HGNC: 2039, Entrez Gene: 51208, Ensembl: ENSG00000066405, OMIM: 609210, and ETniProtKB: P56856, which are incorporated by reference herein.
[0115] The sequences associated with each of the above listed GenBank Accession Nos. and references are herein incorporated by reference.
MODES FOR CARRYING OUT THE DISCLOSURE
[0116] This disclosure provides a novel antibody to CLDN 18.2 and compositions and methods of use thereof. More specifically, this disclosure provides new anti-CLDN 18.2 antibodies for the treatment of tumors expressing CLDN 18.2, such as for example, GI tumors that include, but are not limited to, gastric, pancreatic, esophageal, biliary tract, colorectal, ovarian, and lung carcinomas. The target, CLDN 18.2, is highly expressed on the majority of these tumors but has restricted off-target positivity and therefore a desirable safety profile. Thus, in one aspect, the compositions are particularly useful in the treatment of tumors or cancerous cell that express or overexpress CLDN 18.2.
[0117] In one aspect, the present disclosure provides isolated antibodies, the antibodies comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibodies bind to an epitope of CLDN 18.2. In one aspect, the antibodies bind to an epitope of CLDN 18.2, but not CLDN 18.1. In one aspect, the antibody is a humanized antibody comprising one or more, two or more, three or more, four or more, five or more, six or more, seven or more or all eight of the CDRs identified in Table 3. In another aspect, the antibodies bind with high specificity, that is they bind to CLDN 18.2 with an affinity of more than 80%, or alternatively more than 85%, or alternatively more than 90%, or alternatively more than
95%, binding for CLDN18.2-expressing cells versus less than 20%, or alternatively less than 15%, or alternatively less than 10%, or alternatively less than 5% binding to CLDN 18.1. Example of such are shown in Figs la, lb and 9. There, the antibodies are more sepicific for the CLDN18.2 expressing tumor cells and would have lower toxicity since they do not bind to the CLDN 18.1 -expressing normal cells.
[0118] In some embodiments, the antibody is a bispecific antibody has a binding specificity to a second target protein. The second target protein, in some embodiments, is selected from the group consisting of IL-l, CD3, CD16, CD19, CD28, CD47, CD64, PD-l, PD-L1, CTLA-4, LAG-3, CD28, CD122, 4-1BB, TIM3, OX-40, OX40L, CD40, CD40L, LIGHT, ICOS, ICOSL, GITR, GITRL, TIGIT, CD27, VISTA, B7H3, B7H4, HEVM,
BTLA and KIR. In some embodiments, the antibody is comprised in an antibody drug conjuates (ADC) formed between the anitbody and another agent, such as toxin or drug. In some embodiments, the antibodies may be conjugated to therapeutic agents, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, and/or polyethylene glycol (PEG).
[0119] In a further aspect, this disclosure provides isolated anti-CLDN 18.2 antibodies or fragments thereof as disclosed herein and a detectable or purification label, alone or in combination with an CLDN 18.2 antigen or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, heavy and light chain heavy and light chain CDR 1, CDR 2, CDR3) thereof, that in one aspect are bound to each other to form an antigen/antibody complex. Further provided herein is an ex vivo cell comprising this antigen/antibody complex.
[0120] Aspects of the disclosure relate to a chimeric antigen receptor (CAR) comprising: (a) an antigen binding domain of a CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3); (b) a hinge domain; (c) a
transmembrane domain; and (d) an intracellular domain. Further aspects of the disclosure relate to a chimeric antigen receptor (CAR) comprising: (a) an antigen binding domain of a CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3); (b) a hinge domain; (c) a CD28 transmembrane domain; (d) one or more costimulatory regions selected from a CD28 costimulatory signaling region, a 4-1BB
costimulatory signaling region, an ICOS costimulatory signaling region, and an 0X40 costimulatory region; and (e) a CD3 zeta signaling domain and alternatives thereof.
[0121] In a further aspect, the present disclosure provides a chimeric antigen receptor (CAR) comprising: (a) an antigen binding domain of an anti-CLDN 18.2 antibody (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3), (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) a CD28 and/or a 4-1BB costimulatory signaling region; and (e) a CD3 zeta signaling domain and alternatives thereof.
[0122] In another aspect, the present disclosure provides an isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, humanized antibody, bispecific antibody, or the anti-CLDN 18.2 CAR.
[0123] In another aspect, the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, bispecific antibody, humanized antibody, or the anti-CLDN 18.2 CAR.
[0124] In another aspect, the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti- CLDN 18.2 antibody, bispecific antibody, humanized antibody, or the anti-CLDN 18.2 CAR, operatively linked to sequences that direct and optionally enhance the expression of the nucleic acid sequence. These sequences include promoters and enhancer sequences.
[0125] In another aspect, the present disclosure provides a composition comprising a carrier and one or more of: the anti-CLDN 18.2 antibody; and/or the chimeric antibody; and/or the bispecific antibody; and/or the humanized antibody; and/or the anti-CLDN 18.2 CAR; and/or the isolated nucleic acid encoding the anti-CLDN 18.2 antibody bispecific antibody, and/or the chimeric antibody; and/or the anti-CLDN 18.2 humanized antibody, or the anti- CLDN 18.2 CAR; and/or the vector comprising the isolated nucleic acid sequence encoding the anti-CLDN 18.2 antibody, bispecific antibody, and/or the chimeric antibody; and/or the humanized antibody, or the anti-CLDN 18.2 CAR; and/or an isolated cell comprising the anti-CLDN 18.2 CAR.
[0126] In one aspect, the disclosure provides a composition comprising, or alternatively consisting essentially of, or yet further consisting of a carrier and one or more of: an
antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a nucleic acid encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a vecor comprising the nucleic acid encoding the antibody or fragment (e.g., VH1, VH2, VH3,
VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, an isolated cell comprising an anti-CLDN 18.2 CAR and/or a polynucleotide encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof; and/or the isolated nucleic acid encoding the CAR; and/or the vector comprising the nucleic acid encoding the CAR; and/or the isolated cell expressing an anti- CLDN 18.2 CAR; and/or the anti-CLDN 18.2 antibody; and/or the chimeric antibody; and/or bispecific antibody; and/or the humanized antibody.
[0127] Compositions are also provided. In one embodiment, the composition comprises an antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a fusion protein, or a CAR and/or car expressing-cell of the present disclosure and a pharmaceutically acceptable carrier. Also provided is an isolated cell comprising one or more polynucleotide encoding the antibody or fragment (e.g., VH1, VH2, VH3, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof or the fusion protein or bispecific antibody of the present disclosure.
[0128] The present disclosure further provides a method of treating tumor or growth expressing CLND 18.2 antigen, such as for example cancer or fibrosis in a patient in need thereof, comprising administering to the patient a antibody or fragment (e.g., VH1, VH2, VLB, VL1, VL2, VL3, heavy and light chain CDR 1, CDR 2, CDR3) thereof, a fusion protein, or a CAR and/or car expressing-cell of the present disclosure. Non-limiting examples of cancers include GI cancers, bladder cancer, liver cancer, colon cancer, rectal cancer, endometrial cancer, biliary cancer, leukemia, lymphoma, pancreatic cancer, small cell lung cancer, non-small cell lung cancer, breast cancer, urethral cancer, head and neck cancer, gastrointestinal cancer, stomach cancer, oesophageal cancer, ovarian cancer, renal cancer, melanoma, prostate cancer and thyroid cancer. The methods can be combined with diagnostic methods to identify patients or subjects that are more likely to respond to the treatment.
Antibodies and Uses Thereof
I. Compositions
[0129] The general structure of antibodies is known in the art and will only be briefly summarized here. An immunoglobulin monomer comprises two heavy chains and two light chains connected by disulfide bonds. Each heavy chain is paired with one of the light chains to which it is directly bound via a disulfide bond. Each heavy chain comprises a constant region (which varies depending on the isotype of the antibody) and a variable region. The variable region comprises three hypervariable regions (or complementarity determining regions) which are designated CDRH1, CDRH2 and CDRH3 and which are supported within framework regions. Each light chain comprises a constant region and a variable region, with the variable region comprising three hypervariable regions (designated CDRL1, CDRL2 and CDRL3) supported by framework regions in an analogous manner to the variable region of the heavy chain.
[0130] The hypervariable regions of each pair of heavy and light chains mutually cooperate to provide an antigen binding site that is capable of binding a target antigen. The binding specificity of a pair of heavy and light chains is defined by the sequence of CDR1, CDR2 and CDR3 of the heavy and light chains. Thus once a set of CDR sequences (i.e. the sequence of CDR1, CDR2 and CDR3 for the heavy and light chains) is determined which gives rise to a particular binding specificity, the set of CDR sequences can, in principle, be inserted into the appropriate positions within any other antibody framework regions linked with any antibody constant regions in order to provide a different antibody with the same antigen binding specificity.
[0131] In one embodiment, the disclosure provides an isolated antibody comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibody binds to an epitope CLDN 18.2.
[0132] In one aspect, the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence selected from (i) GFTFSSYA, (ii) GFTFSDYY, (iii) GFNIKDYF, (iv)
GFTFSDYY, (v) GYSFTGYN, (vi) GFSLTSYG, (vii) GYNMN or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence selected from (i) ISGGGST,
(ii) ISDGGGDT, (iii) IDPENGDT, (iv) ISNGGGST, (v) INPYNGGT, (vi) IWSDGRT, (vii)
LINPYNGGTRYNQKFKG, or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence selected from (i) ARGGNIYDGYPYYFDY, (ii)
GGNIYDGYPYYFDY, (iii) ARHRGSLDY, (iv) NVLGY GNY GHF Y Y AMD Y, (v) ARHRGSLDF, (vi) ARMGLGNAMDY, (vii) ARHGR YDP Y AMD Y, (viii)
MGLGNAMDY, or an equivalent of each thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence selected from (i) QNLLNSSNQKNY, (ii)
ESVDNYGFSF, (iii) QSLVHSNGNTY, (iv) QNLLNSGNQKNY, (v)
KSSQNLLNSGNQKNYLT, or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence selected from (i) FAS, (ii) RAS, (iii) KVS, (iv) WAS, (v)
WASTMES, or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence selected from (i) QQHYSTPLT, (ii) QQSNQGPLT, (iii) SQNTHVPRT, (iv) QQSNKVPLT, (v) QNDYIYPLP, or an equivalent of each thereof.
[0133] In one aspect, the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GFTFSSYA or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of ISGGGST or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of GGNIYDGYPYYFDY or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QNLLNSSNQKNY or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of FAS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QQHYSTPLT or an equivalent thereof.
[0134] In one aspect, the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GFTFSDYY or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of ISDGGGDT or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of ARHRGSLDY or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of ESVDNYGFSF or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of RAS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QQSNQGPLT or an equivalent thereof.
[0135] In one aspect, the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GFNIKDYF or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of IDPENGDT or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of NVLGYGNYGHFYYAMDY or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSLVHSNGNTY or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of KVS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of SQNTHVPRT or an equivalent thereof.
[0136] In one aspect, the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GFTFSDYY or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of ISNGGGST or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of ARHRGSLDF or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of ESVDNYGFSF or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of RAS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QQSNKVPLT or an equivalent thereof.
[0137] In one aspect, the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GYSFTGYN or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of INPYNGGT or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of ARMGLGNAMDY or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QNLLNSGNQKNY or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of WAS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QNDYIYPLP or an equivalent thereof.
[0138] In one aspect, the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid
sequence of GFSLTSYG or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of IWSDGRT or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of ARHGRYDPYAMDY or an equivalent thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of ESVDNYGFSF or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of RAS or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QQSNQGPLT or an equivalent thereof.
[0139] In one aspect, the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of KSSQNLLNSGNQKNYLTor an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of WASTMES or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of QNDYIYPLP or an equivalent thereof;
and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of GYNMN or an equivalent thereof; and/or a CDR2 comprising the amino acid sequence of
LINPYNGGTRYNQKFKG or an equivalent thereof; and/or a CDR3 comprising the amino acid sequence of MGLGNAMDYor an equivalent thereof.
[0140] In one aspect, the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of a heavy chain amino acid sequence of the anti- CLDN 18.2 antibody disclosed herein, and the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of the light chain amino acid sequence from anti-CLDN 18.2 antibody disclosed herein, or equivalents thereof, as follows (CDRs are underlined):
[0141] Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (T155S2):
EVKLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVROTPEKRLEWVASISGGGS TYYPDSVKGRFTISRDNARNILYLOMSYLRSEDTAVYYCARGGNIYDGYPYYFDY WGQGTTLTVSS, or an equivalent thereof.
[0142] Anti-CLDN 18.2 Light Chain Amino Acid Sequence (T155S2):
DIVMTQ SP S SLAMS VGQKVTMSCK S SQM NSSNQKNYL AW YQQKPGQ SPKLL VY FAS TRES GVPDRF TGS GS GTDF TLTI S S VQ AEDL A V Y Y CQQHYSTPLTF GAGTKLEL
K, or an equivalent thereof.
[0143] Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (T158S2):
E VKL YE S GGGL V OPGGSLKL S CAT S GF TF SD YYMF WIRO TPEKRLEW V ASI SDGGG DTYYPDTVKGRFTISRDNAKNTLYLOMSRLKSEDTAMYYCARHRGSLDYWGOGT TLTVSS, or an equivalent thereof.
[0144] Anti-CLDN 18.2 Light Chain Amino Acid Sequence (T158S2):
DIVLTOSPASLAVSLGORATISCRASESVDNYGFSFLHWYOOKPGOPPKLLIYRASN LASGIPARFSGSGSRTDFTLTINPVETDDVATYYCOOSNOGPLTFGAGTKLELK. or an equivalent thereof.
[0145] Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (T224S8):
EVOLOOSGTELVRSGASVKLSCTTSGFNIKDYFLHWVKORPEOGLEWIGWIDPENG DTK Y APKF ODK VTMTVDT S SNT ACLHLS SLT SDDT AVYY CNVLGY GNY GHF YY A MDYWGQGTSVTVSS, or an equivalent thereof.
[0146] Anti-CLDN 18.2 Light Chain Amino Acid Sequence (T224S8):
DVVMTOTPLSLPVSLGDOASISCRSSOSLVHSNGNTYLHWYLOKPGOSPKLLIYKV SNRF SGVPDRF SGSESGTDFTLKISRVEAEDLGIYF C SONTHVPRTF GGGTKLEIR. or an equivalent thereof.
[0147] Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (T192S2):
E VKL VE S GGGL V OPGGSLKL S CAT S GF TF SD YYMYWVRO TPEKRLEW V A YI SN GG GSTYYPDTVKGRFTISRDNAKNTLYLOMSRLKSEDTAMYYCARHRGSLDFWGOGT TLTVSS, or an equivalent thereof.
[0148] Anti-CLDN 18.2 Light Chain Amino Acid Sequence (T192S2):
DIVLTOSPASLAVSLGORATISCRASESVDNYGFSFMHWYOOKPGOPPKLLIYRASN LESGIPARF SGS W SRTDFTLTINP VETDD V AT YYCOO SNKVPLTF GAGTKLELK. or an equivalent thereof.
[0149] Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (T252S4):
EVOLOOSGPELVKPGASMKISCKASGYSFTGYNMNWVKOTHGKNLEWIGLINPYN GGTRYNOKFKGKATLTVDKSSSTAYMELLSLTSEDSAVYFCARMGLGNAMDYWG QGTSVTVSS, or an equivalent thereof.
[0150] Anti-CLDN 18.2 Light Chain Amino Acid Sequence (T252S4):
DIVMT O SP S SLT VT AGEK VTMSCKS SONLLNSGNOKNYLTW Y OOKPGOPPKLLI Y
W AS TME SGVPDRF TGS GS GTDFTLTI S S V O AEDL A V Y Y C OND YI YPLPF G AGTKLE LK, or an equivalent thereof.
[0151] Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (T88S 1):
OVOLKESGPGLVAPSOSLSITCTISGFSLTSYGIHWVROPPGKGLEWLVVIWSDGRT TYNSALKSRLSISKDNSKSOVFLKMNSLOTDDTAMYYCARHGRYDPYAMDYWGO GTSVTVSS, or an equivalent thereof.
[0152] Anti-CLDN 18.2 Light Chain Amino Acid Sequence (T88S 1):
DIVLTOSPASLAVSLGORATISCRASESVDNYGFSFLHWYOOKPGOPPKLLIYRASN LASGIPARFSGSGSRTDFTLTINPVETDDVATYYCOOSNOGPLTFGAGTKLELK. or an equivalent thereof.
[0153] Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (Chimeric T252S4):
EVOLOOSGPELVKPGASMKISCKASGYSFTGYNMNWVKOTHGKNLEWIGLINPYN GGTRYNOKFKGKATLTVDKSSSTAYMELLSLTSEDSAVYFCARMGLGNAMDYWG QGTSVTVSS, or an equivalent thereof.
[0154] Anti-CLDN 18.2 Light Chain Amino Acid Sequence (Chimeric T252S4):
DIVMT O SP S SLT VT AGEK VTMSCKS SONLLNSGNOKNYLTW Y OOKPGOPPKLLI Y W AS TME SGVPDRF TGS GS GTDFTLTI S S V O AEDL A V Y Y C OND YI YPLPF G AGTKLE LK, or an equivalent thereof.
[0155] Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (HuVHl T252S4):
EVOLVOSGAEVKKPGESLKISCKGSGYSFTGYNMNWVROMPGKGLEWMGLINPY NGGTRYNOKFKGOVTISADKSISTAYLOWSSLKASDTAMYFCARMGLGNAMDYW GQGTTVTVSS, or an equivalent thereof.
[0156] Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (HuVH2 T252S4):
EVOLVOSGAEVKKPGESLKISCKGSGYSFTGYNMNWVROMPGKNLEWIGLINPYN GGTRYNOKFKGOVTISADKSISTAYLQWSSLKASDTAMYFCARMGLGNAMDYWG QGTTVTVSS, or an equivalent thereof.
[0157] Anti-CLDN 18.2 Heavy Chain Amino Acid Sequence (HuVH3 T252S4):
EVOLVOSGAEVKKPGESLKISCKGSGYSFTGYNMNWVROMPGKNLEWIGLINPYN GGTRYN OKFKGK ATL S VDK SI S T A YLO W S SLK ASDT AMYF C ARMGLGN AMD YW GQGTTVTVSS, or an equivalent thereof.
[0158] Anti-CLDN 18.2 Light Chain Amino Acid Sequence (HuVLl T252S4):
DIVMTOSPDSL AY SLGERATINCKS SONLLNSGNOKNYLTWY OOKPGOPPKLLIYW ASTMESGVPDRFSGSGSGTDFTLTISSLOAEDVAVYYCONDYIYPLPFGOGTKLEIK. or an equivalent thereof.
[0159] Anti-CLDN 18.2 Light Chain Amino Acid Sequence (HuVL2 T252S4):
DI VMT O SPD SLAV SLGERATIN CK S S ONLLO S GN OKNYLTW Y OOKPGOPPKLLIYW ASTRESGVPDRFSGSGSGTDFTLTISSLOAEDVAVYYCONDYIYPLPFGOGTKLEIK. or an equivalent thereof.
[0160] In one aspect, the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of an heavy chain encoded by the nucleic acid sequence of the anti-CLDN 18.2 antibody disclosed herein, and the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of the light chain chain encoded by the nucleic acid sequence from anti-CLDN 18.2 antibody disclosed herein, or equivalents thereof, as follows (CDRs are underlined):
[0161] Anti-CLDN 18.2 Heavy Chain Nucleic Acid Sequence (T155S2):
GAAGTGAAGCTGGTGGAGTCTGGGGGAGGCTTAGTGAAGCCTGGAGGGTCCCT
GAAACTCTCCTGTGCAGCCTCTGGATTCACTTTCAGTAGCTATGCCATGTCTTGG
GTTCGCCAGACTCCAGAGAAGAGGCTGGAGTGGGTCGCATCCATTAGTGGTGG
TGGTAGCACCTACTATCCAGACAGTGTGAAGGGCCGATTCACCATCTCCAGAGA
TAATGCCAGGAACATCCTGTACCTGCAAATGAGCTATCTGAGGTCTGAGGACAC
GGCCGTGTATTACTGTGCAAGAGGAGGGAATATCTATGATGGTTACCCGTACTA
CTTTGACTACTGGGGCCAAGGCACCACTCTCACAGTCTCCTCA. or an equivalent thereof.
[0162] Anti-CLDN 18.2 Light Chain Nucleic Acid Sequence (T155S2):
GACATTGTGATGACCCAGTCTCCATCCTCCCTGGCTATGTCAGTAGGACAGAAG
GTCACTATGAGCTGCAAGTCCAGTCAGAACCTTTTAAATAGTAGCAATCAAAAG
AACTATTTGGCCTGGTACCAGCAGAAACCAGGACAGTCTCCTAAACTTCTGGTA
TACTTTGCATCCACTAGGGAATCTGGGGTCCCTGATCGCTTCACAGGCAGTGGA
TCTGGGACAGATTTCACTCTTACCATCAGCAGTGTGCAGGCTGAAGACCTGGCA
GTTTATTACTGTCAGCAACATTATAGCACTCCGCTCACGTTCGGTGCTGGGACC
AAGCTGGAGCTGAAA, or an equivalent thereof.
[0163] Anti-CLDN 18.2 Heavy Chain Nucleic Acid Sequence (T158S2):
GAAGT GAAGCTGGT GGAGTCTGGGGGAGGCTT AGT GC AGCCTGGAGGGTCCCT
GAAACTCTCCTGTGCAACCTCTGGATTCACTTTCAGTGACTATTACATGTTTTGG
ATTCGCCAGACTCCAGAGAAGAGGCTGGAGTGGGTCGCCTCCATTAGTGATGGT
GGTGGTGACACCTATTATCCAGACACTGTAAAGGGCCGATTCACCATCTCCAGA
GACAATGCCAAGAACACCCTGTACCTGCAAATGAGCCGTCTGAAGTCTGAGGA
CACAGCCATGTATTACTGTGCAAGACATAGGGGCTCTCTTGACTACTGGGGCCA
AGGCACCACTCTCACAGTCTCCTCA, or an equivalent thereof.
[0164] Anti-CLDN 18.2 Light Chain Nucleic Acid Sequence (T158S2):
GACATTGTGCTGACCCAATCTCCAGCTTCTTTGGCTGTGTCTCTAGGGCAGAGG
GCCACCATCTCCTGCAGAGCCAGCGAGAGTGTGGATAACTATGGCTTTAGTTTT
CTGCACTGGTACCAGCAGAAACCAGGACAGCCACCCAAACTCCTCATCTATCGT
GCATCCAACCTAGCATCTGGGATCCCTGCCAGGTTCAGTGGCAGTGGGTCTAGG
ACAGACTTCACCCTCACCATTAATCCTGTGGAGACTGATGATGTTGCAACCTAT
TACTGTCAGCAAAGTAATCAGGGTCCACTCACGTTCGGTGCTGGGACCAAGCTG
GAGCTGAAA, or an equivalent thereof.
[0165] Anti-CLDN 18.2 Heavy Chain Nucleic Acid Sequence (T224S8):
GAGGTTCAGCTGCAGCAGTCTGGGACAGAGCTTGTGAGGTCAGGGGCCTCAGT
CAAGTTGTCCTGCACAACTTCTGGCTTCAACATTAAAGACTACTTTTTACACTGG
GTGAAGCAGAGGCCTGAACAGGGCCTGGAGTGGATTGGATGGATTGATCCTGA
GAATGGTGATACTAAATATGCCCCGAAGTTCCAGGACAAGGTCACCATGACTGT
GGACACATCCTCCAACACAGCCTGCCTGCACCTCAGCAGCCTGACATCTGATGA
CACTGCCGTCTATTACTGTAATGTACTAGGCTACGGTAATTACGGACATTTTTAC
TATGCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCT. or an equivalent thereof.
[0166] Anti-CLDN 18.2 Light Chain Nucleic Acid Sequence (T224S8):
GATGTTGTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAG
GCCTCCATCTCTTGCAGATCTAGTCAGAGCCTTGTACACAGTAATGGAAACACC
TATTTACATTGGTACCTGCAGAAGCCAGGCCAGTCTCCAAAGCTCCTGATCTAC
AAAGTTTCCAACCGATTTTCTGGGGTCCCAGACAGGTTCAGTGGCAGTGAATCA
GGGAC AGATTT C AC ACTC AAGAT C AGC AGAGT GGAGGCTGAGGATCTGGGAAT
TTATTTCTGCTCTCAAAATACACATGTTCCTCGGACGTTCGGTGGAGGCACCAA
GCTGGAAATCAGA, or an equivalent thereof.
[0167] Anti-CLDN 18.2 Heavy Chain Nucleic Acid Sequence (T192S2):
GAAGT GAAGCTGGT GGAGTCTGGGGGAGGCTT AGT GC AGCCTGGAGGGTCCCT
GAAACTCTCCTGTGCAACCTCTGGATTCACTTTCAGTGACTATTACATGTATTGG
GTTCGCCAGACTCCAGAGAAGAGGCTGGAGTGGGTCGCATACATTAGTAATGG
TGGTGGTTCCACCTATTATCCAGACACTGTGAAGGGCCGATTCACCATCTCCAG
AGACAATGCCAAGAACACCCTGTACCTGCAAATGAGCCGTCTGAAGTCTGAGG
ACACAGCCATGTATTACTGTGCAAGACATAGGGGCTCTCTTGACTTCTGGGGCC
AAGGCACCACTCTCACAGTCTCCTCA, or an equivalent thereof.
[0168] Anti-CLDN 18.2 Light Chain Nucleic Acid Sequence (T192S2):
GACATAGTGCTGACACAGTCTCCTGCTTCCTTAGCTGTATCTCTGGGGCAGAGG
GCCACCATCTCCTGCAGAGCCAGCGAAAGTGTTGATAATTATGGCTTTAGTTTT
ATGCACTGGTACCAGCAGAAACCAGGACAGCCACCCAAACTCCTCATCTATCGT
GCATCCAACCTAGAATCTGGGATCCCTGCCAGGTTCAGTGGCAGTTGGTCTAGG
ACAGACTTCACCCTCACCATTAATCCTGTGGAGACTGATGATGTTGCAACCTAT
TACTGTCAGCAAAGTAATAAGGTTCCGCTCACGTTCGGTGCTGGGACCAAGCTG
GAGCTGAAA, or an equivalent thereof.
[0169] Anti-CLDN 18.2 Heavy Chain Nucleic Acid Sequence (T252S4):
GAGGTCCAGCTGCAACAGTCTGGACCTGAGCTGGTGAAGCCTGGAGCTTCAAT GAAGATATCCTGCAAGGCTTCTGGTTACTCATTCACTGGCTACAACATGAACTG GGT GAAGC AGACCC ATGGAA AGAACCTTGAGT GGATT GGACTT ATT AATCCTT A C AAT GGT GGT ACT AGGT AC AACC AGAAGTTC AAGGGC AAGGCC AC ATT AACTG TAGACAAGTCATCCAGCACAGCCTACATGGAGCTCCTCAGTCTGACATCTGAGG ACTCTGCAGTCTATTTCTGTGCAAGGATGGGACTTGGAAATGCTATGGACTACT GGGGTCAAGGAACCTCAGTCACCGTCTCCTCA, or an equivalent thereof.
[0170] Anti-CLDN 18.2 Light Chain Nucleic Acid Sequence (T252S4):
GACATTGTGATGACACAGTCTCCATCCTCCCTGACTGTGACAGCAGGAGAGAAG GTCACTATGAGCTGCAAGTCCAGTCAGAATCTGTTAAACAGTGGAAATCAAAA GAACTACTTGACCTGGTACCAGCAGAAACCAGGGCAGCCTCCTAAACTGTTGAT
CTACTGGGCATCCACTATGGAATCTGGGGTCCCTGATCGCTTCACAGGCAGTGG
ATCTGGAACAGATTTCACTCTCACCATCAGCAGTGTGCAGGCTGAAGACCTGGC AGTTTATTACTGTCAGAATGATTATATTTATCCGCTCCCGTTCGGTGCTGGGACC AAGCTGGAGCTGAAA, or an equivalent thereof.
[0171] Anti-CLDN 18.2 Heavy Chain Nucleic Acid Sequence (T88S1):
CAGGTGCAGCTGAAGGAGTCAGGACCTGGCCTGGTGGCGCCCTCACAGAGCCT
GTCCATCACATGCACCATCTCAGGGTTCTCATTAACCAGCTATGGTATACACTG
GGTTCGCCAGCCTCCAGGAAAGGGTCTGGAGTGGCTGGTAGTGATATGGAGTG
ATGGAAGAACAACCTATAATTCAGCTCTCAAATCCAGACTGAGCATCAGCAAG
GACAACTCCAAGAGCCAAGTTTTCTTAAAAATGAACAGTCTCCAAACTGATGAC
ACAGCCATGTACTACTGTGCCAGACATGGTAGATACGACCCCTATGCTATGGAC
TACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA. or an equivalent thereof.
[0172] Anti-CLDN 18.2 Light Chain Nucleic Acid Sequence (T88S1):
GACATTGTGCTGACCCAATCTCCAGCTTCTTTGGCTGTGTCTCTAGGGCAGAGG
GCCACCATCTCCTGCAGAGCCAGCGAGAGTGTGGATAACTATGGCTTTAGTTTT
CTGCACTGGTACCAGCAGAAACCAGGACAGCCACCCAAACTCCTCATCTATCGT
GCATCCAACCTAGCATCTGGGATCCCTGCCAGGTTCAGTGGCAGTGGGTCTAGG
ACAGACTTCACCCTCACCATTAATCCTGTGGAGACTGATGATGTTGCAACCTAT
TACTGTCAGCAAAGTAATCAGGGTCCACTCACGTTCGGTGCTGGGACCAAGCTG
GAGCTGAAA, or an equivalent thereof.
[0173] Anti-CLDN 18.2 Chimeric Heavy Chain Nucleic Acid Sequence (T252S4):
GAGGTCCAGCTGCAACAGTCTGGACCTGAGCTGGTGAAGCCTGGAGCTTCAAT
GAAGATATCCTGCAAGGCTTCTGGTTACTCATTCACTGGCTACAACATGAACTG
GGT GAAGC AGACCC ATGGAA AGAACCTTGAGT GGATT GGACTT ATT AATCCTT A
C AAT GGT GGT ACT AGGT AC AACC AGAAGTTC AAGGGC AAGGCC AC ATT AACTG
TAGACAAGTCATCCAGCACAGCCTACATGGAGCTCCTCAGTCTGACATCTGAGG
ACTCTGCAGTCTATTTCTGTGCAAGGATGGGACTTGGAAATGCTATGGACTACT
GGGGTCAAGGAACCTCAGTCACCGTCTCCTCA
[0174] Anti-CLDN 18.2 Humanized Heavy Chain Nucleic Acid Sequence 1 (Hu VHl T252S4):
GAAGTCC AGCTCGT GC AGTCTGGT GCGGAGGT C AAAAAACCCGGCGAGTCTCT CAAAATTAGTTGCAAAGGCTCCGGTTATTCATTCACGGGTTACAATATGAACTG
GGTTCGACAAATGCCGGGTAAGGGACTTGAATGGATGGGATTGATCAACCCCT
ATAACGGAGGTACCAGATACAACCAAAAATTTAAGGGCCAGGTGACTATTAGT
GCAGATAAAAGTATCTCCACCGCTTACCTCCAATGGTCTAGTTTGAAGGCGTCT
GACACTGCTATGTACTTTTGCGCGAGAATGGGGTTGGGAAATGCGATGGACTAC
TGGGGTCAGGGCACTACGGTTACGGTCTCCTCT
[0175] Anti-CLDN 18.2 Humanized Heavy Chain Nucleic Acid Sequence 2 (Hu VH2 T252S4):
G AGGT AC AGC T C GT GCA AT C T GGGGC C G A AGT A A AG A A AC C T GG AG A A AGT C T
T A A A AT A AGC T GC A AGGGC AGT GGGT AT AGC TT C AC GGGCT AC A AT AT GA AC T
GGGTTAGACAAATGCCAGGTAAGAACCTCGAATGGATAGGATTGATCAACCCA
TACAATGGTGGTACGCGCTACAACCAGAAATTCAAAGGTCAGGTTACCATCTCT
GCGGATAAAAGCATCTCAACGGCGTATCTTCAATGGTCCTCACTGAAAGCATCC
GAC AC AGC AAT GT ATTTTTGCGCT AGAAT GGGATTGGGT AAT GCC ATGGACT AC
TGGGGCCAAGGCACCACGGTTACAGTCTCTTCC
[0176] Anti-CLDN 18.2 Humanized Heavy Chain Nucleic Acid Sequence 3 (Hu VH3 T252S4):
GAAGTTCAGCTGGTGCAAAGTGGGGCTGAGGTAAAGAAGCCTGGCGAGAGCCT
C AAGATTTCTT GC AAGGGT AGCGGAT AC AGTTTT ACGGGAT AT A AC AT GAATT G
GGTTCGCCAGATGCCGGGGAAGAACCTTGAATGGATAGGACTGATAAACCCCT
ATAATGGGGGAACCCGATATAATCAGAAGTTTAAGGGAAAAGCAACTTTGTCA
GTTGACAAGTCTATCAGCACGGCCTATCTTCAGTGGTCCAGTCTGAAAGCAAGC
GAC ACGGC T AT GT AC TTTT GT GC AC GC AT GGGGC TT GGT A ACGC A AT GGAC T AT
TGGGGACAAGGAACTACCGTCACTGTCTCTTCA
[0177] Anti-CLDN 18.2 Chimeric Light Chain Nucleic Acid Sequence 3 (Chimeric VL T252S4):
GACATTGTGATGACACAGTCTCCATCCTCCCTGACTGTGACAGCAGGAGAGAAG
GTCACTATGAGCTGCAAGTCCAGTCAGAATCTGTTAAACAGTGGAAATCAAAA
GAACTACTTGACCTGGTACCAGCAGAAACCAGGGCAGCCTCCTAAACTGTTGAT
CTACTGGGCATCCACTATGGAATCTGGGGTCCCTGATCGCTTCACAGGCAGTGG
ATCTGGAACAGATTTCACTCTCACCATCAGCAGTGTGCAGGCTGAAGACCTGGC
AGTTTATTACTGTCAGAATGATTATATTTATCCGCTCCCGTTCGGTGCTGGGACC
AAGCTGGAGCTGAAA
[0178] Anti-CLDN 18.2 Humanized Light Chain Nucleic Acid Sequence 1 (Hu VL1 T252S4):
GACATCGTGATGACCCAGTCCCCGGACAGTCTGGCAGTCAGTCTTGGGGAAAG
AGCTACCATAAACTGCAAATCCAGCCAAAACCTTCTTAATAGCGGCAACCAAA
AGAATTACTTGACTTGGTATCAGCAAAAACCGGGTCAGCCGCCCAAACTCTTGA
TATACTGGGCGTCTACGATGGAAAGCGGCGTCCCCGACCGCTTCAGCGGGAGT
GGGTCAGGGACTGATTTCACTTTGACAATCAGTTCCCTTCAGGCAGAGGACGTA
GCAGTCTACTACTGTCAGAATGATTATATATATCCTCTTCCGTTCGGCCAGGGG
ACGAAGTT GGAGAT C AAA
[0179] Anti-CLDN 18.2 Humanized Light Chain Nucleic Acid Sequence 3 (Hu VL2 T252S4):
GACATCGTGATGACTCAAAGTCCTGACTCCCTTGCTGTTTCACTTGGCGAAAGG
GCCACTATCAACTGTAAGAGTTCTCAGAATCTCTTGCAATCAGGAAACCAGAAG
AATTACTTGACCTGGTATCAACAGAAGCCTGGACAACCACCTAAGCTCTTGATT
TACTGGGCTAGTACAAGGGAGTCCGGCGTCCCAGACAGATTTTCCGGTTCTGGA
TCAGGCACGGACTTCACTCTGACAATCTCTAGTCTTCAAGCCGAGGATGTGGCC
GTTTATTATTGCCAGAACGATTACATTTACCCTTTGCCATTTGGTCAAGGTACTA
AGTTGGAGATAAAA
[0180] In one aspect, humanized antibodies having the above-identified VH and VL combinations also are provided in Table 4.
[0181] In one aspect, the disclosure provides an isolated anti-CLDN 18.2 antibody which is generated against a CLDN 18.2 fragment.
[0182] In another aspect of the present technology, the isolated antibody includes one or more of the following characteristics:
(a) the light chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a light chain variable domain of any of the disclosed light chain sequences;
(b) the heavy chain immunoglobulin variable domain sequence comprises one or
more CDRs that are at least 85% identical to a CDR of a heavy chain variable domain of any of the disclosed heavy chain sequences;
(c) the light chain immunoglobulin variable domain sequence is at least 85% identical to a light chain variable domain of any of the disclosed light chain sequences;
(d) the HC immunoglobulin variable domain sequence is at least 85% identical to a heavy chain variable domain of any of the disclosed light chain sequences; and
(e) the antibody binds an epitope that overlaps with an epitope bound by any of the disclosed sequences.
[0183] In one aspect, the present disclosure provides an isolated antibody that is at least 85% identical to the anti-CLDN 18.2 antibody disclosed herein.
[0184] In some of the aspects of the antibodies provided herein, the antibody binds human CLDN 18.2 with a dissociation constant (KD) of less than lO_4M, l0_5 M, lO_6M, lO_7M, lO_8M, lO_9M, lO_10M, 10_11 M, or lO_12M. In some of the aspects of the antibodies provided herein, the antigen binding site specifically binds to human CLDN 18.2.
[0185] In some of the aspects of the antibodies provided herein, the antibody is soluble Fab.
[0186] In some of the aspects of the antibodies provided herein, the HC and LC variable domain sequences are components of the same polypeptide chain. In some of the aspects of the antibodies provided herein, the HC and LC variable domain sequences are components of different polypeptide chains.
[0187] In another embodiment, the antibody is a monoclonal antibody comprising an anti- CLDN 18.2 heavy chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide selected disclosed herein or an equivalent of each thereof, and an anti-CLDN 18.2 light chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide disclosed herein or an equivalent of each thereof.
[0188] In another aspect, the anti-CLDN 18.2 antibody is a chimeric antibody, human or a humanized antibody.
[0189] In some of the aspects of the antibodies provided herein, the antibody is a monoclonal antibody.
[0190] In some of the aspects of the antibodies provided herein, the antibody is a full- length antibody. In other aspect, antigen binding fragments of the antibodies are provided.
[0191] In some of the aspects of the antibodies provided herein, the antibody fragment is selected from the group consisting of Fab, F(ab)'2, Fab’, scFv, and Fv.
[0192] In other aspects, one or more amino acid residues in a CDR of the antibodies provided herein are substituted with another amino acid. The substitution may be “conservative” in the sense of being a substitution within the same family of amino acids. The naturally occurring amino acids may be divided into the following four families and conservative substitutions will take place within those families:
1) Amino acids with basic side chains: lysine, arginine, histidine;
2) Amino acids with acidic side chains: aspartic acid, glutamic acid;
3) Amino acids with uncharged polar side chains: asparagine, glutamine, serine, threonine, tyrosine;
4) Amino acids with nonpolar side chains: glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, cysteine.
[0193] In another aspect, one or more amino acid residues are added to or deleted from one or more CDRs of an antibody. Such additions or deletions occur at the N or C termini of the CDR or at a position within the CDR.
[0194] By varying the amino acid sequence of the CDRs of an antibody by addition, deletion or substitution of amino acids, various effects such as increased binding affinity for the target antigen may be obtained.
[0195] It is to be appreciated that antibodies of the present disclosure comprising such varied CDR sequences still bind CLDN 18.2 with similar specificity and sensitivity profiles as the disclosed antibodies. This may be tested by way of the binding assays.
[0196] The constant regions of antibodies may also be varied. For example, antibodies may be provided with Fc regions of any isotype: IgA (IgAl, IgA2), IgD, IgE, IgG (IgGl, IgG2, IgG3, IgG4) or IgM.
[0197] Human IgD constant region, Uniprot: P01880
APTKAPDVFPIISGCRHPKDNSPVVLACLITGYHPTSVTVTWYMGTQSQPQRTFPEI
QRRDSYYMTSSQLSTPLQQWRQGEYKCVVQHTASKSKKEIFRWPESPKAQASSVP
T AQPQ AEGSL AK ATT AP ATTRNT GRGGEEKKKEKEKEEQEERETKTPECP SHT QPL GVYLLTP AV QDLWLRDK ATFTCF VV GSDLKD AHLTWEVAGKVPTGGVEEGLLER HSNGSQSQHSRLTLPRSLWNAGTSVTCTLNHPSLPPQRLMALREPAAQAPVKLSLN LLAS SDPPEAASWLLCEVSGF SPPNILLMWLEDQREVNTSGF AP ARPPPQPGSTTFW AWSVLRVPAPPSPQPATYTCVVSHEDSRTLLNASRSLEVSYVTDHGPMK, or an equivalent thereof.
[0198] Human IgGl constant region, Uniprot: P01857
AS TKGP S VFPL AP S SK S T S GGT AALGCL VKD YFPEP VT V S WN S GALT S GVHTFP A VL Q S S GL Y SL S SWT VP S S SLGTQT YICNVNHKP SNTK VDKK VEPK S CDKTHT CPPCP A PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVV S VLTVLHQDWLNGKEYKCKV SNKALP APIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK, or an equivalent thereof.
[0199] Human IgG2 constant region, Einiprot: P01859
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL Q S SGL Y SL S SWT VP S SNF GTQT YT CNVDHKP SNTKVDKT VERKCC VECPPCP APP V AGP S VFLFPPKPKDTLMI SRTPE VT C V VVD V SHEDPE V QFNW YVDGVEVHN AKT KPREEQFNSTFRVV S VLTVVHQDWLNGKEYKCKV SNKGLP APIEKTISKTKGQPRE PQ VYTLPP SREEMTKNQ V SLT CL VKGF YP SDIS VEWESN GQPENNYKTTPPMLD SD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK, or an equivalent thereof.
[0200] Human IgG3 constant region, Uniprot: P01860
ASTKGPSVFPLAPCSRSTSGGTAALGCLVKD YFPEP VTVSWNSGALTSGVHTFPAV LQ S SGL Y SLS S VVTVP S S SLGTQT YTCNVNHKP SNTK VDKRVELKTPLGDTTHTCPR CPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYN STFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPS REEMTKN Q V SLTCL VKGF YP SDI AVEWE S S GQPENNYNTTPPMLD SDGSFFL Y SKL TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK, or an equivalent thereof.
[0201] Human IgM constant region, Uniprot: P01871
GS AS APTLFPL VSCEN SP SDT S S VAV GCL AQDFLPD SITLS WK YKNN SDIS STRGFP S VLRGGK Y A AT S Q VLLP SKD VMQGTDEH V V CK V QHPN GNKEKNVPLP VI AELPPK V SVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQVGSGVTTDQVQAEAK ESGPTTYKVTSTLTIKESDWLGQ SMFTCRVDHRGLTFQQNAS SMC VPDQDTAIRVF AIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSA V GE ASICEDD WN S GERF TCT VTHTDLP SPLKQTI SRPKGV ALHRPD VYLLPP AREQL NLRE S ATIT CL VT GF SP AD VF V Q WMQRGQPL SPEK Y VT S APMPEPQ APGRYF AHSIL TV SEEEWNT GET YT C V AHE ALPNR VTERT VDK S T GKPTL YN V SL VMSDT AGTC Y, or an equivalent thereof.
[0202] Human IgG4 constant region, ETniprot: P01861
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL Q S S GL Y SL S SWT VP S S SLGTKT YT CNVDHKP SNTK VDKRVE SKY GPPCP S CP APEF LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKT KPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPRE PQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFL Y SRLT VDK SRW QEGN VF S C S VMHE ALHNH YT QK SL SL SLGK, or an equivalent thereof.
[0203] Human IgAl constant region, Uniprot: P01876
ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQ DASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPST PPTP SP S C CHPRL SLHRP ALEDLLLGSE ANLTCTLT GLRD AS GVTF TWTP S S GK S A V QGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRP EVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQE P SQGTTTF AVT SILRVAAEDWKKGDTF SCM V GHEALPL AFTQKTIDRL AGKPTHVN VSVVMAEVDGTCY, or an equivalent thereof.
[0204] Human IgA2 constant region, Uniprot: P01877
ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQ DASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRL SLHRP ALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCY S VS S VLPGC AQPWNHGETFTCT AAHPELKTPLT ANITKSGNTFRPEVHLLPPP SEEL
ALNEL VTLT CL ARGF SPKD VLVRWLQGSQELPREKYLTW ASRQEP SQGTTTF AVT S ILR V AAED WKKGDTF S CM V GHE ALPL AF T QKTIDRM AGKPTHVN V S VVM AE VDG TCY, or an equivalent thereof.
[0205] Human Ig kappa constant region, ETniprot: P01834 SEQ ID NO: 52
TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVT EQD SKD ST Y SL S S TLTL SK AD YEKHK V Y ACE VTHQGL S SP VTK SFNRGEC, or an equivalent thereof.
[0206] In some aspects of the antibodies provided herein, the antibody contains structural modifications to facilitate rapid binding and cell uptake and/or slow release. In some aspects, the CLDN 18.2 antibody contains a deletion in the CH2 constant heavy chain region of the antibody to facilitate rapid binding and cell uptake and/or slow release. In some aspects, a Fab fragment is used to facilitate rapid binding and cell uptake and/or slow release. In some aspects, a F(ab)'2 fragment is used to facilitate rapid binding and cell uptake and/or slow release.
[0207] The antibodies, fragments, and equivalents thereof can be combined with a carrier, e.g., a pharmaceutically acceptable carrier or other agents to provide a formulation for use and/or storage.
[0208] Further provided is an isolated polypeptide comprising, or alternatively consisting essentially of, or yet further consisting of, the amino acid sequence of CLDN 18.2 or a fragment thereof, that are useful to generate antibodies that bind to CLDN 18.2, as well as isolated polynucleotides that encode them. In one aspect, the isolated polypeptides or polynucleotides further comprise a label and/or contiguous polypeptide sequences (e.g., keyhole limpet haemocyanin (KLH) carrier protein) or in the case of polynucleotides, polynucleotides encoding the sequence, operatively coupled to polypeptide or
polynucleotide. The polypeptides or polynucleotides can be combined with various carriers, e.g., phosphate buffered saline. Further provided are host cells, e.g., prokaryotic or eukaryotic cells, e.g., bacteria, yeast, mammalian (rat, simian, hamster, or human), comprising the isolated polypeptides or polynucleotides. The host cells can be combined with a carrier.
[0209] Yet further provided are the isolated nucleic acids encoding the antibodies and fragments thereof as disclosed herein. They can be combined with a vector or appropriate
host cell, and /or a suitable carrier for diagnostic or therapeutic use. In one aspect, the nucleic acids are contained with a host cell for recombinant production of polypeptides and proteins. The host cells can be eukaryotic or prokaryotic.
II. Processes for Preparing Compositions
[0210] Antibodies, their manufacture and uses are well known and disclosed in, for example, Harlow, E. and Lane, D., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999. The antibodies may be generated using standard methods known in the art. Examples of antibodies include (but are not limited to) monoclonal, single chain, and functional fragments of antibodies.
[0211] Antibodies may be produced in a range of hosts, for example goats, rabbits, rats, mice, humans, and others. They may be immunized by injection with a target antigen or a fragment or oligopeptide thereof which has immunogenic properties, such as an N-terminal or C-terminal fragment of CLDN 18.2 or an isolated polypeptide. Depending on the host species, various adjuvants may be added and used to increase an immunological response. Such adjuvants include, but are not limited to, Freund's, mineral gels such as aluminum hydroxide, and surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol. Among adjuvants used in humans, BCG (Bacille Calmette-Guerin) and Corynebacterium parvum are particularly useful. Thus, this disclosure also provides the isolated polypeptide and an adjuvant.
[0212] In certain aspects, the antibodies of the present disclosure are polyclonal, i.e., a mixture of plural types of anti-CLDN 18.2 antibodies having different amino acid sequences. In one aspect, the polyclonal antibody comprises a mixture of plural types of anti-CLDN 18.2 antibodies having different CDRs. As such, a mixture of cells which produce different antibodies is cultured, and an antibody purified from the resulting culture can be used (see WO 2004/061104).
[0213] Monoclonal Antibody Production. Monoclonal antibodies to CLDN 18.2 may be prepared using any technique which provides for the production of antibody molecules by continuous cell lines in culture. Such techniques include, but are not limited to, the hybridoma technique (see, e.g., Kohler & Milstein, Nature 256: 495-497 (1975)); the trioma technique; the human B-cell hybridoma technique (see, e.g., Kozbor, et ah, Immunol. Today
4: 72 (1983)) and the EBV hybridoma technique to produce human monoclonal antibodies (see, e g., Cole, et al., in: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96 (1985)). Human monoclonal antibodies can be utilized in the practice of the present technology and can be produced by using human hybridomas (see, e.g., Cote, et al., Proc. Natl. Acad. Sci. 80: 2026-2030 (1983)) or by transforming human B- cells with Epstein Barr Virus in vitro (see, e.g., Cole, et al., in: MONOCLONAL
ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96 (1985)). For example, a population of nucleic acids that encode regions of antibodies can be isolated. PCR utilizing primers derived from sequences encoding conserved regions of antibodies is used to amplify sequences encoding portions of antibodies from the population and then reconstruct DNAs encoding antibodies or fragments thereof, such as variable domains, from the amplified sequences. Such amplified sequences also can be fused to DNAs encoding other proteins— e.g., a bacteriophage coat, or a bacterial cell surface protein— for expression and display of the fusion polypeptides on phage or bacteria. Amplified sequences can then be expressed and further selected or isolated based, e.g., on the affinity of the expressed antibody or fragment thereof for an antigen or epitope present on the CLDN 18.2 polypeptide. Alternatively, hybridomas expressing anti- CLDN 18.2 monoclonal antibodies can be prepared by immunizing a subject, e.g., with an isolated polypeptide comprising, or alternatively consisting essentially of, or yet further consisting of, the amino acid sequence of CLDN 18.2 or a fragment thereof, and then isolating hybridomas from the subject's spleen using routine methods. See, e.g., Milstein et al., (Galfire and Milstein, Methods Enzymol 73: 3-46 (1981)). Screening the hybridomas using standard methods will produce monoclonal antibodies of varying specificity (i.e., for different epitopes) and affinity. A selected monoclonal antibody with the desired properties, e.g., CLDN 18.2 binding, can be (i) used as expressed by the hybridoma, (ii) bound to a molecule such as polyethylene glycol (PEG) to alter its properties, or (iii) a cDNA encoding the monoclonal antibody can be isolated, sequenced and manipulated in various ways. In one aspect, the anti- CLDN 18.2 monoclonal antibody is produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell. Hybridoma techniques include those known in the art and taught in Harlow et
al., Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory, Cold Spring Harbor,
N.Y., 349 (1988); Hammerling et al., Monoclonal Antibodies And T-Cell Hybridomas, 563- 681 (1981).
[0214] Phage Display Technique. As noted above, the antibodies of the present disclosure can be produced through the application of recombinant DNA and phage display
technology. For example, anti-CLDN 18.2 antibodies, can be prepared using various phage display methods known in the art. In phage display methods, functional antibody domains are displayed on the surface of a phage particle which carries polynucleotide sequences encoding them. Phage with a desired binding property are selected from a repertoire or combinatorial antibody library (e.g., human or murine) by selecting directly with an antigen, typically an antigen bound or captured to a solid surface or bead. Phage used in these methods are typically filamentous phage including fd and M13 with Fab, Fv or disulfide stabilized Fv antibody domains are recombinantly fused to either the phage gene III or gene VIII protein. In addition, methods can be adapted for the construction of Fab expression libraries (see, e.g., Huse, et al., Science 246: 1275-1281, 1989) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for a CLDN 18.2 polypeptide, e.g., a polypeptide or derivatives, fragments, analogs or homologs thereof. Other examples of phage display methods that can be used to make the isolated antibodies of the present disclosure include those disclosed in Huston et al., Proc. Natl. Acad. Sci.
U.S. A., 85: 5879-5883 (1988); Chaudhary et al., Proc. Natl. Acad. Sci. U.S.A., 87: 1066- 1070 (1990); Brinkman et al., J. Immunol. Methods 182: 41-50 (1995); Ames et al., J.
Immunol. Methods 184: 177-186 (1995); Kettleborough et al., Eur. J. Immunol. 24: 952- 958 (1994); Persic et al., Gene 187: 9-18 (1997); Burton et al., Advances in
Immunology 57: 191-280 (1994); PCT/GB91/01134; WO 90/02809; WO 91/10737; WO 92/01047; WO 92/18619; WO 93/11236; WO 95/15982; WO 95/20401; WO 96/06213;
WO 92/01047 (Medical Research Council et al.); WO 97/08320 (Morphosys); WO
92/01047 (CAT/MRC); WO 91/17271 (Affymax); and U.S. Pat. Nos. 5,698,426, 5,223,409, 5,403,484, 5,580,717, 5,427,908, 5,750,753, 5,821,047, 5,571,698, 5,427,908, 5,516,637, 5,780,225, 5,658,727 and 5,733,743.
[0215] Methods useful for displaying polypeptides on the surface of bacteriophage particles by attaching the polypeptides via disulfide bonds have been described by Lohning,
U.S. Pat. No. 6,753,136. As described in the above references, after phage selection, the antibody coding regions from the phage can be isolated and used to generate whole
antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host including mammalian cells, insect cells, plant cells, yeast, and bacteria. For example, techniques to recombinantly produce Fab, Fab' and
F(ab')2 fragments can also be employed using methods known in the art such as those disclosed in WO 92/22324; Mullinax et al., BioTechniques 12: 864-869 (1992); Sawai et al., AJRI 34: 26-34 (1995); and Better et al., Science 240: 1041-1043 (1988).
[0216] Generally, hybrid antibodies or hybrid antibody fragments that are cloned into a display vector can be selected against the appropriate antigen in order to identify variants that maintained good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle. See e.g. Barbas III et al., Phage Display, A Laboratory Manual (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 2001). However, other vector formats could be used for this process, such as cloning the antibody fragment library into a lytic phage vector (modified T7 or Lambda Zap systems) for selection and/or screening.
[0217] Alternate Methods of Antibody Production. Antibodies may also be produced by inducing in vivo production in the lymphocyte population or by screening recombinant immunoglobulin libraries or panels of highly specific binding reagents (Orlandi et al.,
PNAS 86: 3833-3837 (1989); Winter, G. et al., Nature, 349: 293-299 (1991)).
[0218] Alternatively, techniques for the production of single chain antibodies may be used. Single chain antibodies (scFvs) comprise a heavy chain variable region and a light chain variable region connected with a linker peptide (typically around 5 to 25 amino acids in length). In the scFv, the variable regions of the heavy chain and the light chain may be derived from the same antibody or different antibodies. scFvs may be synthesized using recombinant techniques, for example by expression of a vector encoding the scFv in a host organism such as E. coli. DNA encoding scFv can be obtained by performing amplification using a partial DNA encoding the entire or a desired amino acid sequence of a DNA selected from a DNA encoding the heavy chain or the variable region of the heavy chain of the above-mentioned antibody and a DNA encoding the light chain or the variable region of the light chain thereof as a template, by PCR using a primer pair that defines both ends thereof, and further performing amplification combining a DNA encoding a polypeptide linker portion and a primer pair that defines both ends thereof, so as to ligate both ends of
the linker to the heavy chain and the light chain, respectively. An expression vector containing the DNA encoding scFv and a host transformed by the expression vector can be obtained according to conventional methods known in the art.
[0219] Antigen binding fragments may also be generated, for example the
F(ab')2 fragments which can be produced by pepsin digestion of the antibody molecule and the Fab fragments which can be generated by reducing the disulfide bridges of the
F(ab')2 fragments. Alternatively, Fab expression libraries may be constructed to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity (Huse et ak, Science, 256: 1275-1281 (1989)).
[0220] Antibody Modifications. The antibodies of the present disclosure may be multimerized to increase the affinity for an antigen. The antibody to be multimerized may be one type of antibody or a plurality of antibodies which recognize a plurality of epitopes of the same antigen. As a method of multimerization of the antibody, binding of the IgG CH3 domain to two scFv molecules, binding to streptavidin, introduction of a helix-turn- helix motif and the like can be exemplified.
[0221] The antibody compositions disclosed herein may be in the form of a conjugate formed between any of these antibodies and another agent (such as an antibody drug conjugate (ADC) or an immunoconjugate). Non-limitng examples suitable to conjugate or fuse with the antibodies disclosed herein include therapeutic agents, e.g. detectable labels such as radioactive labels, an immunomodulator, a hormone, an enzyme, an
oligonucleotide, a photoactive therapeutic or diagnostic agent, a cytotoxic agent, a drug or a toxin, an ultrasound enhancing agent, a non-radioactive label, a combination thereof and other such agents known in the art. In some embodiments, the antibodies may be conjugated to therapeutic agents, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, and/or polyethylene glycol (PEG).
[0222] Bispecific Antibodies. CLDN18.2 is over-expressed in cancer tissues but has restricted off-target positivity. It is contemplated that bi-functional molecules that combine an anti-CLDNl8.2 antibody or fragment with another molecule or fragment that has specificity (second specificity) to a cytokine, an immune checkpoint, or a cancer or tumor antigen would have synergistic effect in treatments. Thus, the antibody compositions disclosed herein may be in the form of a bispecific antibody comprising the binding domain
of the disclosed antibody and the binding domain with a second specificity. In some embodiments, the second specificity is to a molecule selected from IL-l, CD3, CD16,
CD 19, CD28, and CD64. Other examples include PD-l, PD-L1, CTLA-4, LAG-3 (also known as CD223), CD28, CD122, 4-1BB (also known as CD137), TIM3, OX-40 or OX40L, CD40 or CD40L, CD47, LIGHT, ICOS/ICOSL, GITR/GITRL, TIGIT, CD27, VISTA, B7H3, B7H4, HEVM or BTLA (also known as CD272), killer-cell
immunoglobulin-like receptors (KIRs). An abundance of tumor antigens are known in the art and new tumor antigens can be readily identified by screening. Non-limiting examples of tumor antigens include EGFR, Her2, EpCAM, CD20, CD30, CD33, CD47, CD52, CD 133, CD73, CEA, gpA33, Mucins, TAG-72, CIX, PSMA, folate-binding protein, GD2, GD3, GM2, VEGF, VEGFR, Integrin, anb3, a5b1, ERBB2, ERBB3, MET, IGF1R, EPHA3, TRAILR1, TRAILR2, RANKL, FAP and Tenascin.
[0223] Different formats of bispecific antibodies are also provided. In some embodiments, each of the anti-CLDNl8.2 fragment and the second fragment each is independently selected from a Fab fragment, a single-chain variable fragment (scFv), or a single-domain antibody. In some embodiments, the bispecific antibody further includes a Fc fragment.
[0224] Bifunctional molecules that include not just antibody or antigen binding fragment are also provided. As a tumor antigen targeting molecule, an antibody or antigen-binding fragment specific to CLDN18.2, such as those described here, can be combined with an immune cytokine or ligand optionally through a peptide linker. The linked immune cytokines or ligands include, but not limited to, IL-l, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL- 10, IL-l 2, IL-13, IL-15, GM-CSF, TNF-alpha, CD40L, OX40L, CD27L, CD30L, 4-1BBL, LIGHT and GITRL. Such bi-functional molecules can lead to specific tumor site local immune modulation.
[0225] Antibody Screening. Various immunoassays may be used for screening to identify antibodies having the desired specificity. Numerous protocols for competitive binding or immunoradiometric assays using either polyclonal or monoclonal antibodies with established specificities are well known in the art. Such immunoassays typically involve the measurement of complex formation between CLDN 18.2, or any fragment or oligopeptide thereof and its specific antibody. A two-site, monoclonal-based immunoassay utilizing monoclonal antibodies specific to two non-interfering CLDN 18.2 epitopes may be
used, but a competitive binding assay may also be employed (Maddox et al., J. Exp. Med., 158: 1211-1216 (1983)).
[0226] Automated immunohistochemistry (IHC) screening of potential anti-CLDN 18.2 antibodies can be performed using a Ventana Medical Systems, Inc (VMSI) Discovery XT and formalin-fixed, paraffin-embedded human tissue on glass slides. Tissue samples first undergo deparaffmization, antigen retrieval, followed by the addition of the potential anti- CLDN 18.2 antibody and a detection antibody. The detection antibody is visualized using a chromogen detection reagent from VMSI. Stained slides are manually screened under a microscope. Samples having a correct primary antibody staining pattern are selected as potential anti-CLDN 18.2 candidates.
[0227] Antibody Purification. The antibodies disclosed herein can be purified to homogeneity. The separation and purification of the antibodies can be performed by employing conventional protein separation and purification methods.
[0228] By way of example only, the antibody can be separated and purified by
appropriately selecting and combining use of chromatography columns, filters,
ultrafiltration, salt precipitation, dialysis, preparative polyacrylamide gel electrophoresis, isoelectric focusing electrophoresis, and the like. Strategies for Protein Purification and Characterization: A Laboratory Course Manual, Daniel R. Marshak et al. eds., Cold Spring Harbor Laboratory Press (1996); Antibodies: A Laboratory Manual. Ed Harlow and David Lane, Cold Spring Harbor Laboratory (1988).
[0229] Examples of chromatography include affinity chromatography, ion exchange chromatography, hydrophobic chromatography, gel filtration chromatography, reverse phase chromatography, and adsorption chromatography. In one aspect, chromatography can be performed by employing liquid chromatography such as HPLC or FPLC.
[0230] In one aspect, a Protein A column or a Protein G column may be used in affinity chromatography. Other exemplary columns include a Protein A column, Hyper D, POROS, Sepharose F. F. (Pharmacia) and the like.
[0231] CAR T-cells are genetically engineered autologous T-cells in which single chain antibody fragments (scFv) or ligands are attached to the T-cell signaling domain capable of facilitating T-cell activation (Maher, J. (2012) ISRN Oncol. 2012:278093; Curran, K.J. et
al. (2012) J. Gene Med. 14:405-415; Fedorov, V.D. et al. (2014) Cancer J. 20:160-165; Barrett, D.M. et al. (2014) Annu. Rev. Med. 65:333-347). CARs combine HLA- independent targeting specificity of a monoclonal antibody with the cytolytic activity and homing properties of activated T-cells. These properties enable the recognition of target cells with reduced HLA expression or down-regulated antigen processing pathways, two common methods tumors employ to evade the host immune response (Jakobsen, M.K. et al. (1995) J. Immunother. Emphasis Tumor Immunol. 17:222-228; Lou, Y. et al. (2008) Clin. Cancer Res. 14: 1494-1501; Singh, R. et al. (2007) Cancer Res. 67: 1887-1892). CAR- modified T-cells have shown great promise in preclinical and clinical settings as novel therapeutics in various diseases including ovarian carcinomas (Chu, C.S. et al. (2008) Expert Rev. Anticancer Ther. 8:243-257; Chekmasova, A. A. et al. (2010) Discov. Med. 9:62-70; Porter, D.L. et al. (2011) NEJM 365:725-733). To date, CAR T-cells generated against a variety of targets. In addition, antibodies to CLDN 18.2 have been disclosed and approved for treatment of certain cancers. Consistent with these principles and discoveries, this disclosure provides the following embodiments.
III. Methods of ETse
[0232] General. The antibodies disclosed herein are useful in methods known in the art relating to the localization and/or quantitation of a CLDN 18.2 polypeptide (e.g., for use in measuring levels of the CLDN 18.2 polypeptide within appropriate physiological samples, for use in diagnostic methods, for use in imaging the polypeptide, and the like). The antibodies disclosed herein are useful in isolating a CLDN 18.2 polypeptide by standard techniques, such as affinity chromatography or immunoprecipitation. A CLDN 18.2 antibody disclosed herein can facilitate the purification of natural CLDN 18.2 polypeptides from biological samples, e.g., mammalian sera or cells as well as recombinantly-produced CLDN 18.2 polypeptides expressed in a host system. Moreover, CLDN 18.2 antibody can be used to detect a CLDN 18.2 polypeptide (e.g., in plasma, a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the
polypeptide. The CLDN 18.2 antibodies disclosed herein can be used diagnostically to monitor CLDN 18.2 levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen and/or to determine and identify sujects or patient who are most likekly to respond to the treatment because the tumors or cancer cells express
the antigen. The detection can be facilitated by coupling (i.e., physically linking) the CLDN 18.2 antibodies disclosed herein to a detectable substance.
[0233] In another aspect, provided herein is a composition comprising an antibody or antigen binding fragment as disclosed herein bound to a peptide comprising, for example, a human CLDN 18.2 protein or a fragment thereof. In one aspect, the peptide is associated with a cell. For example, the composition may comprise a disaggregated cell sample labeled with an antibody or antibody fragment as disclosed herein, which composition is useful in, for example, affinity chromatography methods for isolating cells or for flow cytometry-based cellular analysis or cell sorting. As another example, the composition may comprise a fixed tissue sample or cell smear labeled with an antibody or antibody fragment as disclosed herein, which composition is useful in, for example, immunohistochemistry or cytology analysis. In another aspect, the antibody or the antibody fragment is bound to a solid support, which is useful in, for example: ELISAs; affinity chromatography or immunoprecipitation methods for isolating CLDN 18.2 proteins or fragments thereof,
CLDN 18.2-positive cells, or complexes containing CLDN 18.2 and other cellular components. In another aspect, the peptide is bound to a solid support. For example, the peptide may be bound to the solid support via a secondary antibody specific for the peptide, which is useful in, for example, sandwich ELISAs. As another example, the peptide may be bound to a chromatography column, which is useful in, for example, isolation or purification of antibodies according to the present technology. In another aspect, the peptide is disposed in a solution, such as a lysis solution or a solution containing a sub- cellular fraction of a fractionated cell, which is useful in, for example, ELISAs and affinity chromatography or immunoprecipitation methods of isolating CLDN 18.2 proteins or fragments thereof or complexes containing CLDN 18.2 and other cellular components. In another aspect, the peptide is associated with a matrix, such as, for example, a gel electrophoresis gel or a matrix commonly used for western blotting (such as membranes made of nitrocellulose or polyvinylidene difluoride), which compositions are useful for electrophoretic and/or immunoblotting techniques, such as Western blotting.
[0234] Detection of CLDN 18.2 Polypeptide. An exemplary method for detecting the level of CLDN 18.2 polypeptides in a biological sample involves obtaining a biological sample from a subject and contacting the biological sample with a CLDN 18.2 antibody disclosed herein which is capable of detecting the CLDN 18.2 polypeptides.
[0235] In one aspect, the CLDN 18.2 antibodies T155S2, T158S2, T224S8, T192S2, and T252S4, or fragments thereof are detectably labeled. The term“labeled”, with regard to the antibody is intended to encompass direct labeling of the antibody by coupling (i.e., physically linking) a detectable substance to the antibody, as well as indirect labeling of the antibody by reactivity with another compound that is directly labeled. Non-limiting examples of indirect labeling include detection of a primary antibody using a fluorescently- labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin.
[0236] The detection method of the present disclosure can be used to detect expression levels of CLDN 18.2 polypeptides in a biological sample in vitro as well as in vivo. In vitro techniques for detection of CLDN 18.2 polypeptides include enzyme linked immunosorbent assays (ELISAs), Western blots, flow cytometry, immunoprecipitations, radioimmunoassay, and immunofluorescence (e.g., IHC). Furthermore, in vivo techniques for detection of CLDN 18.2 polypeptides include introducing into a subject a labeled anti-CLDN 18.2 antibody. By way of example only, the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
In one aspect, the biological sample contains polypeptide molecules from the test subject.
[0237] Immunoassay and Imaging. A CLDN 18.2 antibody disclosed herein can be used to assay CLDN 18.2 polypeptide levels in a biological sample (e.g. human plasma) using antibody-based techniques. For example, protein expression in tissues can be studied with classical immunohistochemical (IHC) staining methods. Jalkanen, M. et ak, J. Cell.
Biol. 101 : 976-985 (1985); Jalkanen, M. et ak, J. Cell. Biol. 105: 3087-3096 (1987). Other antibody-based methods useful for detecting protein gene expression include
immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA). Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase, and radioisotopes or other radioactive agents, such as iodine (125I, 121I, 13 ¾, carbon (14C), sulfur (35S), tritium (3H), indium (112In), and technetium (99mTc), and fluorescent labels, such as fluorescein and rhodamine, and biotin.
[0238] In addition to assaying CLDN 18.2 polypeptide levels in a biological sample, CLDN 18.2 polypeptide levels can also be detected in vivo by imaging. Labels that can be incorporated with anti- CLDN 18.2 antibodies for in vivo imaging of CLDN 18.2
polypeptide levels include those detectable by X-radiography, NMR or ESR. For X- radiography, suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject. Suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which can be incorporated into the CLDN 18.2 antibody by labeling of nutrients for the relevant scFv clone.
[0239] A CLDN 18.2 antibody which has been labeled with an appropriate detectable imaging moiety, such as a radioisotope (e.g.,131I, 112In, 99mTc), a radio-opaque substance, or a material detectable by nuclear magnetic resonance, is introduced (e.g., parenterally, subcutaneously, or intraperitoneally) into the subject. It will be understood in the art that the size of the subject and the imaging system used will determine the quantity of imaging moiety needed to produce diagnostic images. In the case of a radioisotope moiety, for a human subject, the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of "mTc. The labeled CLDN 18.2 antibody will then preferentially accumulate at the location of cells which contain the specific target polypeptide. For example, in vivo tumor imaging is described in S. W. Burchiel et al., Tumor Imaging: The Radiochemical Detection of Cancer 13 (1982).
[0240] In some aspects, CLDN 18.2 antibodies containing structural modifications that facilitate rapid binding and cell uptake and/or slow release are useful in in vivo imaging detection methods. In some aspects, the CLDN 18.2 antibody contains a deletion in the CH2 constant heavy chain region of the antibody to facilitate rapid binding and cell uptake and/or slow release. In some aspects, a Fab fragment is used to facilitate rapid binding and cell uptake and/or slow release. In some aspects, a F(ab)'2 fragment is used to facilitate rapid binding and cell uptake and/or slow release.
[0241] Diagnostic Uses of CLDN 18.2 antibodies. The CLDN 18.2 antibody
compositions disclosed herein are useful in diagnostic and prognostic methods. As such, the present disclosure provides methods for using the antibodies disclosed herein in the diagnosis of CLDN l8.2-related medical conditions in a subject. Antibodies disclosed herein may be selected such that they have a high level of epitope binding specificity and high binding affinity to the CLDN 18.2 polypeptide. In general, the higher the binding affinity of an antibody, the more stringent wash conditions can be performed in an
immunoassay to remove nonspecifically bound material without removing the target polypeptide. Accordingly, CLDN 18.2 antibodies of the present technology useful in diagnostic assays usually have binding affinities of at least 10 6, 10 7, 10 8, 10 9, 10 10, 10 11, or 10 12 M. In certain aspects, CLDN 18.2 antibodies used as diagnostic reagents have a sufficient kinetic on-rate to reach equilibrium under standard conditions in at least 12 hours, at least 5 hours, at least 1 hour, or at least 30 minutes.
[0242] Some methods of the present technology employ polyclonal preparations of anti- CLDN 18.2 antibodies and polyclonal anti-CLDN 18.2 antibody compositions as diagnostic reagents, and other methods employ monoclonal isolates. In methods employing polyclonal human anti-CLDN 18.2 antibodies prepared in accordance with the methods described above, the preparation typically contains an assortment of CLDN 18.2 antibodies, e.g., antibodies, with different epitope specificities to the target polypeptide. The monoclonal anti-CLDN 18.2 antibodies of the present disclosure are useful for detecting a single antigen in the presence or potential presence of closely related antigens.
[0243] The CLDN 18.2 antibodies of the present disclosure can be used as diagnostic reagents for any kind of biological sample. In one aspect, the CLDN 18.2 antibodies disclosed herein are useful as diagnostic reagents for human biological samples. CLDN 18.2 antibodies can be used to detect CLDN 18.2 polypeptides in a variety of standard assay formats. Such formats include immunoprecipitation, Western blotting, ELISA,
radioimmunoassay, flow cytometry, IHC and immunometric assays. See Harlow &
Lane, Antibodies, A Laboratory Manual (Cold Spring Harbor Publications, New York, 1988); U.S. Pat. Nos. 3,791,932; 3,839,153; 3,850,752; 3,879,262; 4,034,074, 3,791,932; 3,817,837; 3,839, 153; 3,850,752; 3,850,578; 3,853,987; 3,867,517; 3,879,262; 3,901,654; 3,935,074; 3,984,533; 3,996,345; 4,034,074; and 4,098,876. Biological samples can be obtained from any tissue (including biopsies), cell or body fluid of a subject.
[0244] Prognostic Uses of CLDN 18.2 antibodies. The present disclosure also provides for prognostic (or predictive) assays for determining whether a subject is at risk of developing a medical disease or condition associated with increased CLDN 18.2
polypeptide expression or activity (e.g., detection of a precancerous cell). Such assays can be used for prognostic or predictive purpose to thereby prophylactically treat an individual
prior to the onset of a medical disease or condition characterized by or associated with CLDN 18.2 polypeptide expression.
[0245] Another aspect of the present disclosure provides methods for determining CLDN 18.2 expression in a subject to thereby select appropriate therapeutic or prophylactic compounds for that subject.
[0246] Alternatively, the prognostic assays can be utilized to identify a subject having or at risk for developing gastric, pancreatic, esophageal, ovarian, or lung cancer. Thus, the present disclosure provides a method for identifying a disease or condition associated with increased CLDN 18.2 polypeptide expression levels in which a test sample is obtained from a subject and the CLDN 18.2 polypeptide detected, wherein the presence of increased levels of CLDN 18.2 polypeptides compared to a control sample is predictive for a subject having or at risk of developing a disease or condition associated with increased CLDN 18.2 polypeptide expression levels. In some aspects, the disease or condition associated with increased CLDN 18.2 polypeptide expression levels is selected from the group consisting of gastric, pancreatic, esophageal, ovarian, and lung cancer.
[0247] In another aspect, the present disclosure provides methods for determining whether a subject can be effectively treated with a compound for a disorder or condition associated with increased CLDN 18.2 polypeptide expression wherein a biological sample is obtained from the subject and the CLDN 18.2 polypeptide is detected using the CLDN 18.2 antibody. The expression level of the CLDN 18.2 polypeptide in the biological sample obtained from the subject is determined and compared with the CLDN 18.2 expression levels found in a biological sample obtained from a subject who is free of the disease. Elevated levels of the CLDN 18.2 polypeptide in the sample obtained from the subject suspected of having the disease or condition compared with the sample obtained from the healthy subject is indicative of the CLDN l8.2-associated disease or condition in the subject being tested.
[0248] There are a number of disease states in which the elevated expression level of CLDN 18.2 polypeptides is known to be indicative of whether a subject with the disease is likely to respond to a particular type of therapy or treatment. Thus, the method of detecting a CLDN 18.2 polypeptide in a biological sample can be used as a method of prognosis, e.g., to evaluate the likelihood that the subject will respond to the therapy or treatment. The level of the CLDN 18.2 polypeptide in a suitable tissue or body fluid sample from the subject is
determined and compared with a suitable control, e.g., the level in subjects with the same disease but who have responded favorably to the treatment.
[0249] In one aspect, the present disclosure provides for methods of monitoring the influence of agents (e.g., drugs, compounds, or small molecules) on the expression of CLDN 18.2 polypeptides. Such assays can be applied in basic drug screening and in clinical trials. For example, the effectiveness of an agent to decrease CLDN 18.2 polypeptide levels can be monitored in clinical trials of subjects exhibiting elevated expression of CLDN 18.2, e.g., patients diagnosed with cancer. An agent that affects the expression of CLDN 18.2 polypeptides can be identified by administering the agent and observing a response. In this way, the expression pattern of the CLDN 18.2 polypeptide can serve as a marker, indicative of the physiological response of the subject to the agent.
Accordingly, this response state may be determined before, and at various points during, treatment of the subject with the agent.
[0250] Further aspects of the present disclosure relate to methods for determining if a patient is likely to respond or is not likely to CLDN 18.2 CAR therapy. In specific embodiments, this method comprises contacting a tumor sample isolated from the patient with an effective amount of an CLDN 18.2 antibody and detecting the presence of any antibody bound to the tumor sample. In further embodiments, the presence of antibody bound to the tumor sample indicates that the patient is likely to respond to the CLDN 18.2 CAR therapy and the absence of antibody bound to the tumor sample indicates that the patient is not likely to respond to the CLDN 18.2 therapy. In some embodiments, the method comprises the additional step of administering an effective amount of the CLDN 18.2 CAR therapy to a patient that is determined likely to respond to the CLDN 18.2 CAR therapy.
[0251] Automated Embodiments. A person of ordinary skill in the art will appreciate that aspects of the methods for using the CLDN 18.2 antibodies disclosed herein can be automated. Particular aspects of CLDN 18.2 staining procedures can be conducted using various automated processes.
IV. Kits
[0252] As set forth herein, the present disclosure provides diagnostic methods for determining the expression level of CLDN 18.2. In one particular aspect, the present
disclosure provides kits for performing these methods as well as instructions for carrying out the methods of the present disclosure such as collecting tissue and/or performing the screen, and/or analyzing the results.
[0253] The kit comprises, or alternatively consists essentially of, or yet further consists of, a CLDN 18.2 antibody composition (e.g., monoclonal antibodies) disclosed herein, and instructions for use. The kits are useful for detecting the presence of CLDN 18.2 polypeptides in a biological sample e.g., any body fluid including, but not limited to, e.g., sputum, serum, plasma, lymph, cystic fluid, urine, stool, cerebrospinal fluid, acitic fluid or blood and including biopsy samples of body tissue. The test samples may also be a tumor cell, a normal cell adjacent to a tumor, a normal cell corresponding to the tumor tissue type, a blood cell, a peripheral blood lymphocyte, or combinations thereof. The test sample used in the above-described method will vary based on the assay format, nature of the detection method and the tissues, cells or extracts used as the sample to be assayed. Methods for preparing protein extracts or membrane extracts of cells are known in the art and can be readily adapted in order to obtain a sample which is compatible with the system utilized.
[0254] In some aspects, the kit can comprise: one or more CLDN 18.2 antibodies capable of binding a CLDN 18.2 polypeptide in a biological sample (e.g., an antibody or antigen binding fragment thereof having the same antigen-binding specificity of CLDN 18.2 antibody B7H4 5F6, B7H4 # 33-14, or B7H4 #36-1); means for determining the amount of the CLDN 18.2 polypeptide in the sample; and means for comparing the amount of the CLDN 18.2 polypeptide in the sample with a standard. One or more of the CLDN 18.2 antibodies may be labeled. The kit components, (e.g., reagents) can be packaged in a suitable container. The kit can further comprise instructions for using the kit to detect the CLDN 18.2 polypeptides. In certain aspects, the kit comprises a first antibody, e.g., attached to a solid support, which binds to a CLDN 18.2 polypeptide; and, optionally; 2) a second, different antibody which binds to either the CLDN 18.2 polypeptide or the first antibody and is conjugated to a detectable label.
[0255] The kit can also comprise, e.g., a buffering agent, a preservative or a protein- stabilizing agent. The kit can further comprise components necessary for detecting the detectable-label, e.g., an enzyme or a substrate. The kit can also contain a control sample or a series of control samples, which can be assayed and compared to the test sample. Each
component of the kit can be enclosed within an individual container and all of the various containers can be within a single package, along with instructions for interpreting the results of the assays performed using the kit. The kits of the present disclosure may contain a written product on or in the kit container. The written product describes how to use the reagents contained in the kit.
[0256] As amenable, these suggested kit components may be packaged in a manner customary for use by those of skill in the art. For example, these suggested kit components may be provided in solution or as a liquid dispersion or the like.
V. Carriers
[0257] The antibodies or CLDN 18.2 CARs also can be bound to many different carriers. Thus, this disclosure also provides compositions containing the antibodies and another substance, active or inert. Examples of well-known carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses and magnetite. The nature of the carrier can be either soluble or insoluble for purposes of the disclosure. Those skilled in the art will know of other suitable carriers for binding antibodies, or will be able to ascertain such, using routine
experimentation.
Chimeric Antigen Receptors and Uses Thereof
I. Compositions
[0258] The present disclosure provides chimeric antigen receptors (CAR) that bind to CLDN 18.2 comprising, or consisting essentially of, an extracellular and intracellular domain. The extracellular domain comprises a target-specific binding element otherwise referred to as the antigen binding domain. The intracellular domain or cytoplasmic domain comprises a costimulatory signaling region and a zeta chain portion. The CAR may optionally further comprise a spacer domain of up to 300 amino acids, preferably 10 to 100 amino acids, more preferably 25 to 50 amino acids.
[0259] Antigen Binding Domain. In certain aspects, the present disclosure provides a CAR that comprises, or alternatively consists essentially thereof, or yet consists of an antigen binding domain specific to CLDN 18.2. In some embodiments, the antigen binding domain comprises, or alternatively consists essentially thereof, or yet consists of the antigen
binding domain of an anti-CLDN 18.2 antibody. In further embodiments, the heavy chain variable region and light chain variable region of an anti-CLDN 18.2 antibody comprises, or alternatively consists essentially thereof, or yet consists of the antigen binding domain the anti-CLDN 18.2 antibody. These antibodies and their sequences are disclosed herein. As is apparent to the skilled artisan, the antibody fragments against CLDN 18.2 as disclosed herein can be used to generate a CAR. Thus, the relevant disclosure is incorporated herein.
[0260] Transmembrane Domain. The transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Transmembrane regions of particular use in this invention may be derived from CD8, CD28, CD3, CD45, CD4, CD5, CDS, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154, TCR.
Alternatively, the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. Preferably a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic
transmembrane domain. Optionally, a short oligo- or polypeptide linker, preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR. A glycine-serine doublet provides a particularly suitable linker.
[0261] Cytoplasmic Domain. The cytoplasmic domain or intracellular signaling domain of the CAR is responsible for activation of at least one of the traditional effector functions of an immune cell in which a CAR has been placed. The intracellular signaling domain refers to a portion of a protein which transduces the effector function signal and directs the immune cell to perform its specific function. An entire signaling domain or a truncated portion thereof may be used so long as the truncated portion is sufficient to transduce the effector function signal. Cytoplasmic sequences of the TCR and co-receptors as well as derivatives or variants thereof can function as intracellular signaling domains for use in a CAR. Intracellular signaling domains of particular use in this invention may be derived from FcR, TCR, CD3, CDS, CD22, CD79a, CD79b, CD66d. Since signals generated through the TCR are alone insufficient for full activation of a T cell, a secondary or co stimulatory signal may also be required. Thus, the intracellular region of a co-stimulatory signaling molecule, including but not limited CD27, CD28, 4- IBB (CD 137), 0X40, CD30,
CD40, PD- 1, ICOS, lymphocyte function-associated antigen- 1 (LFA-l ), CD2, CD7,
LIGHT, NKG2C, B7-H3, or a ligand that specifically binds with CD83, to may also be included in the cytoplasmic domain of the CAR.
[0262] In some embodiments, the cell activation moiety of the chimeric antigen receptor is a T-cell signaling domain comprising, or alternatively consisting essentially of, or yet further consisting of, one or more proteins or fragments thereof selected from the group consisting of CD8 protein, CD28 protein, 4-1BB protein, and CD3-zeta protein.
[0263] In specific embodiments, the CAR comprises, or alternatively consists essentially thereof, or yet consists of an antigen binding domain of an anti-CLDN 18.2 antibody, a CD8 a hinge domain, a CD8 a transmembrane domain, a costimulatory signaling region, and a CD3 zeta signaling domain. In further embodiments, the costimulatory signaling region comprises either or both a CD28 costimulatory signaling region and a 4-1BB costimulatory signaling region.
[0264] In some embodiments, the CAR can further comprise a detectable marker or purification marker.
II. Process for Preparing CARs
[0265] Aspects of the present disclosure relate to an isolated cell comprising a CAR and methods of producing such cells. The cell is a prokaryotic or a eukaryotic cell. In one aspect, the cell is a T-cell, a B cell, a NK cell, a dendritic cell, a myeloid cell, a monocyte, a macrophage, any subsets thereof, or any other immune cell. The eukaryotic cell can be from any preferred species, e.g., an animal cell, a mammalian cell such as a human, a feline or a canine cell. The cells may be derived from patients, donors, or cell lines, such as those available off-the-shelf.
[0266] In specific embodiments, the isolated cell comprises, or alternatively consists essentially of, or yet further consists of an exogenous CAR comprising, or alternatively consisting essentially of, or yet further consisting of, an antigen binding domain of a anti- CLDN 18.2 antibody, a CD8 a hinge domain, a CD8 a transmembrane domain, a CD28 costimulatory signaling region and/or a 4-1BB costimulatory signaling region, and a CD3 zeta signaling domain. In certain embodiments, the isolated cell is a T-cell, e.g., an animal T-cell, a mammalian T-cell, a feline T-cell, a canine T-cell or a human T-cell. In certain embodiments, the isolated cell is an NK-cell, e.g., an animal NK-cell, a mammalian NK-
cell, a feline NK-cell, a canine NK-cell or a human NK-cell. In certain embodiments, the isolated cell is a B-cell, e.g., an animal B-cell, a mammalian B-cell, a feline B-cell, a canine B-cell or a human B-cell. It is appreciated that the same or similar embodiments for each species apply with respect to dendritic cells, myeloid cells, monocytes, macrophages, any subsets of these or the T-cells, NK-cells, and B-cells described, and/or any other immune cells.
[0267] In certain embodiments, methods of producing CAR expressing cells are disclosed the method comprising, or alternatively consisting essentially of or yet further consisting of transducing a population of isolated cells with a nucleic acid sequence encoding a CAR. In a further aspect, a subpopulation of cells that have been successfully transduced with said nucleic acid sequence is selected. In some embodiments, the isolated cells are T-cells, an animal T-cell, a mammalian T-cell, a feline T-cell, a canine T-cell or a human T-cell, thereby producing CAR T-cells. In certain embodiments, the isolated cell is an NK-cell, e.g., an animal NK-cell, a mammalian NK-cell, a feline NK-cell, a canine NK-cell or a human NK-cell, thereby producing CAR NK-cells. In some embodiments, the isolated cells are B-cells, an animal B-cell, a mammalian B-cell, a feline B-cell, a canine B-cell or a human B-cell, thereby producing CAR B-cells. It is appreciated that the same or similar embodiments for each species apply with respect to dendritic cells, myeloid cells, monocytes, macrophages, any subsets of these or the T-cells, NK-cells, and B-cells described, and/or any other immune cells.
[0268] Sources of Isolated Cells. Prior to expansion and genetic modification of the cells disclosed herein, cells may be obtained from a subject - for instance, in embodiments involving autologous therapy - or a commercially available culture.
[0269] Cells can be obtained from a number of sources in a subject, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
[0270] Methods of isolating relevant cells are well known in the art and can be readily adapted to the present application; an exemplary method is described in the examples below. Isolation methods for use in relation to this disclosure include, but are not limited to Life Technologies Dynabeads® system; STEMcell Technologies EasySep™, RoboSep™, RosetteSep™, SepMate™; Miltenyi Biotec MACS™ cell separation kits, and other
commercially available cell separation and isolation kits. Particular subpopulations of immune cells may be isolated through the use of beads or other binding agents available in such kits specific to unique cell surface markers. For example, MACS™ CD4+ and CD8+ MicroBeads may be used to isolate CD4+ and CD8+ T-cells. Alemate non-limiting examples of cells that may be isolated accoriding to known techniques include bulked T- cells, NK T-cells, and gamma delta T-cells.
[0271] Alternatively, cells may be obtained through commercially available cell cultures, including but not limited to, for T-cells, lines BCL2 (AAA) Jurkat (ATCC® CRL-2902™), BCL2 (S70A) Jurkat (ATCC® CRL-2900™), BCL2 (S87A) Jurkat (ATCC® CRL- 2901™), BCL2 Jurkat (ATCC® CRL-2899™), Neo Jurkat (ATCC® CRL-2898™); for B cells, lines AHH-l (ATCC® CRL-8146™), BC-l (ATCC® CRL-2230™), BC-2 (ATCC® CRL-2231™), BC-3 (ATCC® CRL-2277™), CA46 (ATCC® CRL-1648™), DG-75[D.G- 75] (ATCC® CRL-2625™), DS-l (ATCC® CRL-11102™), EB-3[EB3] (ATCC® CCL- 85™), Z-138 (ATCC #CRL-300l), DB (ATCC CRL-2289), Toledo (ATCC CRL-2631), Pfiffer (ATCC CRL-2632), SR (ATCC CRL-2262), JM-l (ATCC CRL-10421), NFS-5 C-l (ATCC CRL-1693); NFS-70 C10 (ATCC CRL-1694), NFS-25 C-3 (ATCC CRL-1695), and SUP-B15 (ATCC CRL-1929); and, for NK cells, lines NK-92 (ATCC® CRL-2407™), NK-92MI (ATCC® CRL-2408™). Further examples include but are not limited to mature T-cell lines, e.g., Deglis, EBT-8, HPB-MLp-W, HUT 78, HUT 102, Karpas 384, Ki 225, My-La, Se-Ax, SKW-3, SMZ-l and T34; immature T- cell lines, e.g., ALL-SIL, Bel3, CCRF-CEM, CML-T1, DND-41, DU.528, EU-9, HD-Mar, HPB-ALL, H-SB2, HT-l, JK- Tl, Jurkat, Karpas 45, KE-37, KOPT-K1, K-Tl, L-KAW, Loucy, MAT, MOLT-l, MOLT 3, MOLT-4, MOLT 13, MOLT- 16, MT-l, MT-ALL, Pl 2/Ichikawa, Peer, PER0117, PER- 255, PF-382, PFI-285, RPMI-8402, ST-4, SUP-T1 to T14, TALL-l, TALL-101, TALL- 103/2, TALL- 104, TALL-105, TALL-106, TALL-107, TALL-197, TK-6, TLBR-l, -2, -3, and -4, CCRF-HSB-2 (CCL-120.1), J.RT3-T3.5 (ATCC TIB-153), J45.01 (ATCC CRL- 1990), J.CaMl.6 (ATCC CRL-2063), RS4;l l (ATCC CRL-1873), CCRF-CEM (ATCC CRM-CCL-119); cutaneous T-cell lymphoma lines, e.g., HuT78 (ATCC CRM-TIB-161), MJ[Gl 1] (ATCC CRL-8294), HuTl02 (ATCC TIB-162); B-cell lines deived from anaplastic and large cell lymphomas, e.g., DEL, DL-40, FE-PD, JB6, Karpas 299, Ki-JK, Mac-2 A Plyl, SR-786, SU-DHL-l, -2, -4, -5, -6, -7, -8, -9, -10, and -16, DOHH-2, NU-DHL-l, U-937, Granda 519, USC-DHL-l, RL; Hodgkin’s lymphomas, e.g., DEV, HD-70, HDLM-
2, HD-MyZ, HKB-l, KM-H2, L 428, L 540, L1236, SBH-l, SUP-HD1, and SU/RH-HD-l; and NK lines such as HANK1, KHYG-l, NKL, NK-YS, NOI-90, and YT. Null leukemia cell lines, including but not limited to REH, NALL-l, KM-3, L92-221, are a another commercially available source of immune cells, as are cell lines derived from other leukemias and lymphomas, such as K562 erythroleukemia, THEM monocytic leukemia, U937 lymphoma, HEL erythroleukemia, HL60 leukemia, HMC-l leukemia, KG-l leukemia, EG266 myeloma. Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC,
(http://www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures (https://www.dsmz.de/).
[0272] In some embodiments, T-cells expressing the disclosed CARs may be further modified to reduce or eliminate expression of endogenous TCRs. Reduction or elimination of endogenous TCRs can reduce off-target effects and increase the effectiveness of the T cells. T cells stably lacking expression of a functional TCR may be produced using a variety of approaches. T cells internalize, sort, and degrade the entire T cell receptor as a complex, with a half-life of about 10 hours in resting T cells and 3 hours in stimulated T cells (von Essen, M. et al. 2004. J. Immunol. 173 :384-393). Proper functioning of the TCR complex requires the proper stoichiometric ratio of the proteins that compose the TCR complex. TCR function also requires two functioning TCR zeta proteins with IT AM motifs. The activation of the TCR upon engagement of its MHC-peptide ligand requires the engagement of several TCRs on the same T cell, which all must signal properly. Thus, if a TCR complex is destabilized with proteins that do not associate properly or cannot signal optimally, the T cell will not become activated sufficiently to begin a cellular response.
[0273] Accordingly, in some embodiments, TCR expression may eliminated using RNA interference (e.g., shRNA, siRNA, miRNA, etc.), CRISPR, or other methods that target the nucleic acids encoding specific TCRs (e.g., TCR-a and TCR-b) and/or CD3 chains in primary T cells. By blocking expression of one or more of these proteins, the T cell will no longer produce one or more of the key components of the TCR complex, thereby destabilizing the TCR complex and preventing cell surface expression of a functional TCR.
Even though some TCR complexes can be recycled to the cell surface when RNA interference is used, the RNA (e.g., shRNA, siRNA, miRNA, etc.) will prevent new production of TCR proteins resulting in degradation and removal of the entire TCR
complex, resulting in the production of a T cell having a stable deficiency in functional TCR expression.
[0274] Expression of inhibitory RNAs (e.g., shRNA, siRNA, miRNA, etc.) in primary T cells can be achieved using any conventional expression system, e.g., a lentiviral expression system. Although lentiviruses are useful for targeting resting primary T cells, not all T cells will express the shRNAs. Some of these T cells may not express sufficient amounts of the RNAs to allow enough inhibition of TCR expression to alter the functional activity of the T cell. Thus, T cells that retain moderate to high TCR expression after viral transduction can be removed, e.g., by cell sorting or separation techniques, so that the remaining T cells are deficient in cell surface TCR or CD3, enabling the expansion of an isolated population of T cells deficient in expression of functional TCR or CD3.
[0275] Expression of CRISPR in primary T cells can be achieved using conventional CRISPR/Cas sytems and guide RNAs specific to the target TCRs. Suitable expression systems, e.g. lentiviral or adenoviral expression systems are known in the art. Similar to the delivery of inhibitor RNAs, the CRISPR system can be use to specifically target resting primary T cells or other suitable immune cells for CAR cell therapy. Further, to the extent that CRISPR editing is unsuccessful, cells can be selected for success according to the methods disclosed above. For example, as noted above, T cells that retain moderate to high TCR expression after viral transduction can be removed, e.g., by cell sorting or separation techniques, so that the remaining T cells are deficient in cell surface TCR or CD3, enabling the expansion of an isolated population of T cells deficient in expression of functional TCR or CD3. It is further appreciated that a CRISPR editing construct may be useful in both knocking out the endogenous TCR and knocking in the CAR constructs disclosed herein. Accordingly, it is appreciated that a CRISPR system can be designed for to accomplish one or both of these purposes.
[0276] Vectors. CAR cells may be prepared using vectors. Aspects of the present disclosure relate to an isolated nucleic acid sequence encoding (i) a CAR or (ii) a polynucleotide encoding an immunoregulatory molecule and vectors comprising, or alternatively consisting essentially of, or yet further consisting of, an either one or both of these nucleic acids and/or complements and/or equivalents of each thereof.
[0277] In some embodiments, the isolated nucleic acid sequence encodes for a CAR comprising, or alternatively consisting essentially of, or yet further consisting of an antigen binding domain of a cancer or tumor targeting antibody, a CD8 a hinge domain, a CD8 a transmembrane domain, a CD28 costimulatory signaling region and/or a 4-1BB
costimulatory signaling region, and a CD3 zeta signaling domain. In specific embodiments, the isolated nucleic acid sequence comprises, or alternatively consisting essentially thereof, or yet further consisting of, sequences encoding (a) an antigen binding domain of an anti- CLDN 18.2 antibody followed by (b) a CD8 a hinge domain, (c) a CD8 a transmembrane domain followed by (d) a CD28 costimulatory signaling region and/or a 4-1BB
costimulatory signaling region followed by (e) a CD3 zeta signaling domain.
[0278] In some embodiments, the isolated nucleic acid sequence encodes for a CAR and comprises, or alternatively consists essentially of, or yet further consists of, a Kozak consensus sequence upstream of the sequence encoding the antigen binding domain of the anti-CLDN 18.2 antibody.
[0279] In some embodiments, the isolated nucleic acid comprises a detectable label and/or a polynucleotide conferring antibiotic resistance. In one aspect, the label or polynucleotide are useful to select cells successfully transduced with the isolated nucleic acids.
[0280] In some embodiments, the isolated nucleic acid sequence is comprised within a vector. In certain embodiments, the vector is a plasmid. In other embodiments, the vector is a viral vector. Non-limiting examples of such include without limitation a retroviral vector, a lentiviral vector, an adenoviral vector, and an adeno-associated viral vector. In specific embodiments, the vector is a lentiviral vector.
[0281] The preparation of exemplary vectors and the generation of CAR expressing cells using said vectors is discussed in detail in the examples below. In summary, the expression of natural or synthetic nucleic acids encoding CARs or immunoregulatory molecules is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector. A similar method may be used to construct the isolated nucleic acid sequence comprising a polynucleotide encoding an immunoregulatory molecule. The vectors can be suitable for replication and integration eukaryotes. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al.
(2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York).
[0282] In one aspect, the term“vector” intends a recombinant vector that retains the ability to infect and transduce non-dividing and/or slowly-dividing cells and integrate into the target cell’s genome. In several aspects, the vector is derived from or based on a wild- type virus. In further aspects, the vector is derived from or based on a wild-type lentivirus. Examples of such include without limitation, human immunodeficiency virus (HIV), equine infectious anemia virus (EIAV), simian immunodeficiency virus (SIV) and feline immunodeficiency virus (FIV). Alternatively, it is contemplated that other retrovirus can be used as a basis for a vector backbone such murine leukemia virus (MLV). It will be evident that a viral vector according to the disclosure need not be confined to the components of a particular virus. The viral vector may comprise components derived from two or more different viruses, and may also comprise synthetic components. Vector components can be manipulated to obtain desired characteristics such as target cell specificity.
[0283] The recombinant vectors of this disclosure are derived from primates and non primates. Examples of primate lentiviruses include the human immunodeficiency virus (HIV), the causative agent of human acquired immunodeficiency syndrome (AIDS), and the simian immunodeficiency virus (SIV). The non-primate lentiviral group includes the prototype "slow virus" visna/maedi virus (VMV), as well as the related caprine arthritis- encephalitis virus (CAEV), equine infectious anemia virus (EIAV) and the more recently described feline immunodeficiency virus (FIV) and bovine immunodeficiency virus (BIV). Prior art recombinant lentiviral vectors are known in the art, e.g., see U.S. Patent Nos. 6,924,123; 7,056,699; 7,419,829 and 7,442,551, incorporated herein by reference.
[0284] U.S. Patent No. 6,924,123 discloses that certain retroviral sequence facilitate integration into the target cell genome. This patent teaches that each retroviral genome comprises genes called gag, pol and env which code for virion proteins and enzymes. These genes are flanked at both ends by regions called long terminal repeats (LTRs). The LTRs are responsible for proviral integration, and transcription. They also serve as enhancer- promoter sequences. In other words, the LTRs can control the expression of the viral genes. Encapsidation of the retroviral RNAs occurs by virtue of a psi sequence located at the 5' end of the viral genome. The LTRs themselves are identical sequences that can be divided into
three elements, which are called U3, R and U5. U3 is derived from the sequence unique to the 3' end of the RNA. R is derived from a sequence repeated at both ends of the RNA, and U5 is derived from the sequence unique to the 5'end of the RNA. The sizes of the three elements can vary considerably among different retroviruses. For the viral geno e- and the site of poly (A) addition (termination) is at the boundary between R and U5 in the right hand side LTR. U3 contains most of the transcriptional control elements of the provirus, which include the promoter and multiple enhancer sequences responsive to cellular and in some cases, viral transcriptional activator proteins.
[0285] With regard to the structural genes gag, pol and env themselves, gag encodes the internal structural protein of the virus. Gag protein is proteolytically processed into the mature proteins MA (matrix), CA (capsid) and NC (nucleocapsid). The pol gene encodes the reverse transcriptase (RT), which contains DNA polymerase, associated RNase H and integrase (IN), which mediate replication of the genome.
[0286] For the production of viral vector particles, the vector RNA genome is expressed from a DNA construct encoding it, in a host cell. The components of the particles not encoded by the vector genome are provided in trans by additional nucleic acid sequences (the "packaging system", which usually includes either or both of the gag/pol and env genes) expressed in the host cell. The set of sequences required for the production of the viral vector particles may be introduced into the host cell by transient transfection, or they may be integrated into the host cell genome, or they may be provided in a mixture of ways. The techniques involved are known to those skilled in the art.
[0287] Retroviral vectors for use in this disclosure include, but are not limited to
Invitrogen’s pLenti series versions 4, 6, and 6.2“ViraPower” system. Manufactured by Lentigen Corp.; pHIV-7-GFP, lab generated and used by the City of Hope Research Institute;“Lenti-X” lentiviral vector, pLVX, manufactured by Clontech; pLKO. l-puro, manufactured by Sigma- Aldrich; pLemiR, manufactured by Open Biosystems; and pLV, lab generated and used by Charite Medical School, Institute of Virology (CBF), Berlin, Germany.
[0288] Further methods of introducing exogenous nucleic acids into the art are known and include but are not limited to gene delivery using one or more of RNA electroporation, nanotechnology, sleeping beauty vectors, retroviruses, and/or adenoviruses.
[0289] Regardless of the method used to introduce exogenous nucleic acids into a host cell or otherwise expose a cell to the inhibitor of the present disclosure, in order to confirm the presence of the recombinant DNA sequence in the host cell, a variety of assays may be performed. Such assays include, for example, "molecular biological" assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR;
"biochemical" assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELlSAs and Western blots) or by assays described herein to identify agents falling within the scope of the disclosure.
[0290] Packaging vector and cell lines. The isolated nucleic acids can be packaged into a retroviral packaging system by using a packaging vector and cell lines. The packaging vector includes, but is not limited to retroviral vector, lentiviral vector, adenoviral vector, and adeno-associated viral vector. The packaging vector contains elements and sequences that facilitate the delivery of genetic materials into cells. For example, the retroviral constructs are packaging vectors comprising at least one retroviral helper DNA sequence derived from a replication-incompetent retroviral genome encoding in trans all virion proteins required to package a replication incompetent retroviral vector, and for producing virion proteins capable of packaging the replication-incompetent retroviral vector at high titer, without the production of replication-competent helper virus. The retroviral DNA sequence lacks the region encoding the native enhancer and/or promoter of the viral 5 '
LTR of the virus, and lacks both the psi function sequence responsible for packaging helper genome and the 3 ' LTR, but encodes a foreign polyadenylation site, for example the SV40 polyadenylation site, and a foreign enhancer and/or promoter which directs efficient transcription in a cell type where virus production is desired. The retrovirus is a leukemia virus such as a Moloney Murine Leukemia Virus (MMLV), the Human Immunodeficiency
Virus (HIV), or the Gibbon Ape Leukemia virus (GALV). The foreign enhancer and promoter may be the human cytomegalovirus (HCMV) immediate early (IE) enhancer and promoter, the enhancer and promoter (U3 region) of the Moloney Murine Sarcoma Virus
(MMSV), the U3 region of Rous Sarcoma Virus (RSV), the U3 region of Spleen Focus
Forming Virus (SFFV), or the HCMV IE enhancer joined to the native Moloney Murine
Leukemia Virus (MMLV) promoter. The retroviral packaging vector may consist of two retroviral helper DNA sequences encoded byplasmid based expression vectors, for example where a first helper sequence contains a cDNA encoding the gag and pol proteins of
ecotropic MMLV or GALV and a second helper sequence contains a cDNA encoding the env protein. The Env gene, which determines the host range, may be derived from the genes encoding xenotropic, amphotropic, ecotropic, polytropic (mink focus forming) or 10A1 murine leukemia virus env proteins, or the Gibbon Ape Leukemia Virus (GALV env protein, the Human Immunodeficiency Virus env (gpl60) protein, the Vesicular Stomatitus Virus (VSV) G protein, the Human T cell leukemia (HTLV) type I and II env gene products, chimeric envelope gene derived from combinations of one or more of the aforementioned env genes or chimeric envelope genes encoding the cytoplasmic and transmembrane of the aforementioned env gene products and a monoclonal antibody directed against a specific surface molecule on a desired target cell.
[0291] In the packaging process, the packaging vectors and retroviral vectors are transiently cotransfected into a first population of mammalian cells that are capable of producing virus, such as human embryonic kidney cells, for example 293 cells (ATCC No. CRL1573, ATCC, Rockville, Md.) to produce high titer recombinant retrovirus-containing supernatants. In another method of the disclosure this transiently transfected first population of cells is then cocultivated with mammalian target cells, for example human lymphocytes, to transduce the target cells with the foreign gene at high efficiencies. In yet another method of the invention the supernatants from the above described transiently transfected first population of cells are incubated with mammalian target cells, for example human lymphocytes or hematopoietic stem cells, to transduce the target cells with the foreign gene at high efficiencies.
[0292] In another aspect, the packaging vectors are stably expressed in a first population of mammalian cells that are capable of producing virus, such as human embryonic kidney cells, for example 293 cells. Retroviral or lentiviral vectors are introduced into cells by either cotransfection with a selectable marker or infection with pseudotyped virus. In both cases, the vectors integrate. Alternatively, vectors can be introduced in an episomally maintained plasmid. High titer recombinant retrovirus-containing supernatants are produced.
[0293] Activation and Expansion of CAR Cells. Whether prior to or after genetic modification of the cells to express a desirable CAR, the cells can be activated and expanded using generally known methods such as those described in U.S. Patent Nos.
6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681 ; 7, 144,575; 7,067,318; 7, 172,869; 7,232,566; 7, 175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041 and references such as Lapateva et al. (2014) Crit Rev Oncog 19(1-2): 121-32; Tam et al. (2003) Cytotherapy 5(3):259-72; Garcia-Marquez et al. (2014) Cytotherapy 16(11): 1537- 44. Stimulation with the CLDN 18.2 antigen ex vivo can activate and expand the selected CAR expressing cell subpopulation. Alternatively, the cells may be activated in vivo by interaction with CLDN 18.2 antigen.
[0294] In the case of certain immune cells, additional cell populations, soluble ligands and/or cytokines, or stimulating agents may be required to activate and expand cells. The relevant reagents are well known in the art and are selected according to known
immunological principles. For instance, soluble CD-40 ligand may be helpful in activating and expanding certain B-cell populations; similarly, irradiated feeder cells may be used in the procedure for activation and expansion of NK cells.
[0295] Methods of activating relevant cells are well known in the art and can be readily adapted to the present application; an exemplary method is described in the examples below. Isolation methods for use in relation to this disclosure include, but are not limited to Life Technologies Dynabeads® system activation and expansion kits; BD Biosciences Phosflow™ activation kits, Miltenyi Biotec MACS™ activation/expansion kits, and other commercially available cell kits specific to activation moieties of the relevant cell.
Particular subpopulations of immune cells may be activated or expanded through the use of beads or other agents available in such kits. For example, a -CD3/a-CD28 Dynabeads® may be used to activate and expand a population of isolated T-cells.
[0296] As disclosed above, chimeric antigen receptors comprise an antigen recognition moiety and a cell activation moiety. Aspects of the present disclosure related to a chimeric antigen receptor (CAR) comprising an antigen binding domain specific to CLDN 18.2.
[0297] In one embodiment, the CAR of the present disclosure is characterized in that it comprises, or alternatively consists essentially of, or yet further consists an antigen binding domain of an anti-luteinizing hormone receptor (“CLDN 18.2”) antibody, a CD8 a hinge domain; a CD8 a transmembrane domain; a CD28 and/or a 4-1BB costimulatory signaling region; and a CD3 zeta signaling domain.
[0298] In another embodiment, the antigen binding domain of the anti-CLDN 18.2 antibody comprises an anti-CLDN 18.2 heavy chain variable region and an anti-CLDN 18.2 light chain variable region. As apparent to the skilled artisan, antibodies having the detailed elements are also within the scope of this disclosure.
[0299] In some embodiments, the isolated nucleic acid further comprises, or alternatively consists essentially of, or yet further consists of a Kozak consenus sequence located upstream of the antigen binding domain of the anti-CLDN 18.2 antibody.
[0300] In some aspect of the disclosure, the isolated nucleic sequence further comprises, or alternatively consists essentially of, or yet further consists of polynucleotide encoding an antibiotic resistance marker.
[0301] In another embodiment, the disclosure provides a vector comprising, or alternatively consisting essentially of, or yet further consisting of the isolated nucleic acid sequence encoding the anti-CLDN 18.2 CAR polypeptide as disclosed above or a complement thereof. In a further aspect, the polynucleotide can be incorporated into a vector. Non-limiting examples of such include a retroviral vector, a plasmid, a lentiviral vector, an adenoviral vector, and an adeno-associated viral vector.
[0302] In one embodiment, the disclosure is an isolated cell comprising, or alternatively consisting essentially of, or yet further consisting of an exogenously added polynucleotide encoding the anti-CLDN 18.2 CAR as described above alone or in combination with a vector as described above; and/or the exogenously added the anti-CLDN 18.2 CAR; as describe above.
[0303] In one aspect of the disclosure, the isolated cell can be a T-cell or a natural killer (NK) cell.
III. Methods of Use
[0304] Therapeutic Application. The CAR T-cells of the present invention may be used to treat tumors and cancers. The CAR-T cells of the present invention may be administered either alone or in combination with diluents, known anti-cancer therapeutics, and/or with other components such as cytokines or other cell populations that are immunostimulatory.
[0305] Method aspects of the present disclosure relate to methods for inhibiting the growth of a tumor in a subject in need thereof and/or for treating a cancer patient in need
thereof. In some embodiments, the tumor is a solid tumor. In some embodiments, the tumors/cancer is gastric, pancreatic, esophageal, ovarian, or lung tumors/cancer. In some embodiments, the tumor or cancer expresses or overexpresses CLDN 18.2. In certain embodiments, these methods comprise, or alternatively consist essentially of, or yet further consist of, administering to the subject or patient an effective amount of the isolated cell. In further embodiments, this isolated cell comprises a CLDN 18.2 CAR. In still further embodiments, the isolated cell is a T-cell or an NK cell. In some embodiments, the isolated cell is autologous to the subject or patient being treated. In a further aspect, the tumor expresses CLDN 18.2 antigen and the subject has been selected for the therapy by a diagnostic, such as the one described herein.
[0306] The CAR cells as disclosed herein may be administered either alone or in combination with diluents, known anti-cancer therapeutics, and/or with other components such as cytokines or other cell populations that are immunostimulatory. They may be first line, second line, third line, fourth line, or further therapy. The can be combined with other therapies. Non-limiting examples of such include chemotherapies or biologies.
Appropriate treatment regimes will be determined by the treating physician or veterinarian.
[0307] Pharmaceutical compositions comprising the CLDN 18.2 CAR of the present invention may be administered in a manner appropriate to the disease to be treated or prevented. The quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
[0308] In another aspect, the disclosure provides a method of inhibiting the growth of a solid tumor in a subject in need thereof, comprising administering to the subject an effective amount of the isolated cell of anti-CLDN 18.2 CAR T-cell or NK-cell. In one embodiment, the isolated T-cells or NK-cells are autologous to the subject being treated. In another embodiment, the tumor is a gastric, colon, colorectal, pancreatic, esophageal, ovarian, or lung tumor. The method of inhibiting the growth of a tumor can be applied to a subject including but not limited to human, dog, cat, horse, and other species.
[0309] In another aspect, the disclosure provides a method of treating a cancer patient in need thereof, comprising, or alternatively consisting essentially of, or yet further consisting of administering to the subject an effective amount of the isolated cell of anti-CLDN 18.2
T-cell or NK-cell. The isolated T-cells or NK-cells can be autologous to the subject being treated. The tumor is gastric, pancreatic, esophageal, ovarian, or lung cancer. In one embodiment, the subject treated for cancer is a human patient.
[0310] In one embodiment, the disclosure provides a method for determining if a patient is likely to respond or is not likely to anti-CLDN 18.2 CAR therapy, comprising, or alternatively consisting essentially of, or yet further consisting of contacting a tumor sample isolated from the patient with an effective amount of an anti-CLDN 18.2 antibody and detecting the presence of any antibody bound to the tumor sample, wherein the presence of antibody bound to the tumor sample indicates that the patient is likely to respond to the anti- CLDN 18.2 CAR therapy and the absence of antibody bound to the tumor sample indicates that the patient is not likely to respond to the anti-CAR therapy. In another embodiment, the method further comprises administering an effective amount of the anti-CLDN 18.2 CAR therapy to the patient that is determined likely to respond to the anti-CLDN 18.2 CAR therapy. In this method, the patient can suffer from gastric, pancreatic, esophageal, ovarian, or lung cancer.
[0311] The present disclosure also provides diagnostic methods for determining the expression level of CLDN 18.2. In one particular aspect, the present disclosure provides kits for performing these methods as well as instructions for carrying out the methods of the present disclosure such as collecting tissue and/or performing the screen, and/or analyzing the results.
[0312] In one embodiment, the disclosure provides a method of detecting CLDN 18.2 in a biological sample comprising, or alternatively consisting essentially of, or yet further consisting of contacting the sample with an anti-CLDN 18.2 antibody or an antigen binding fragment capable of binding a peptide comprising SEQ ID NOs: 42 and 43, and detecting a complex formed by the binding of the antibody or antigen binding fragment to CLDN 18.2.
[0313] In one aspect, the sample comprises a cell sample or a tissue sample.
[0314] In one aspect, the sample is obtained from a subject that is diagnosed as having, suspected as having, or at risk of having cancer.
[0315] In another aspect, the cancer is gastric, pancreatic, esophageal, ovarian, or lung cancer. In a further aspect, the cancer cell or tumor cell expresses or overexpresses CLDN 18.2.
[0316] In one aspect, the detection comprises, or alternatively consists essentially of, or yet further consists of one or more of immunohistochemistry (IHC), Western blotting, Flow cytometry or ELISA.
[0317] In one aspect, the method comprises, or alternatively consists essentially of, or yet further consists of isolating the biological sample from the subject.
[0318] In one aspect, the subject is a mammal.
[0319] In another aspect, the mammal is selected from the group of: a human, an animal, a non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
[0320] In one embodiment, the disclosure provides a method of detecting a pathological cell in a sample isolated from a subject, comprising, or alternatively consisting essentially of, or yet further consisting of (a) detecting the level of CLDN 18.2 in a biological sample from the subject by detecting a complex formed by an anti-CLDN 18.2 antibody or an antigenbinding fragment capable of binding a peptide comprising CLDN 18.2 and (b) comparing the levels of CLDN 18.2 observed in step (a) with the levels of CLDN 18.2 observed in a control biological sample; wherein the pathological cell is detected when the level of CLDN 18.2 is elevated compared to that observed in the control biological sample.
[0321] In one aspect, the biological sample of the subject comprises, or alternatively consists essentially of, or yet further consists of one or more of a sample isolated from gastric, pancreatic, esophageal, ovarian, or lung tissue.
[0322] In another aspect, the detection comprises, or alternatively consists essentially of, or yet further consists of one or more of immunohistochemistry (IHC), Western Blotting, Flow cytometry or ELISA.
[0323] In one aspect, the method comprises, or alternatively consists essentially of, or yet further consists of isolating the biological sample from the subject.
[0324] In one aspect, the subject is a mammal.
[0325] In another aspect, the mammal is selected from the group of: a human, an animal, a
non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
IV. Carriers
[0326] Additional aspects of the invention relate to compositions comprising a carrier and one or more of the products - e.g., an isolated cell comprising a CLDN 18.2 CAR, an isolated nucleic acid, a vector, an isolated cell of any anti-CLDN 18.2 antibody or CAR cell, an anti-CLDN 18.2 described in the embodiments disclosed herein.
[0327] Briefly, pharmaceutical compositions of the present invention including but not limited to any one of the claimed compositions may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. Compositions of the present disclosure may be formulated for oral, intravenous, topical, enteral, and/or parenteral administration. In certain embodiments, the compositions of the present disclosure are formulated for intravenous administration.
[0328] Briefly, pharmaceutical compositions of the present invention including but not limited to any one of the claimed compositions may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. Compositions of the present invention are preferably formulated for intravenous administration.
[0329] Pharmaceutical compositions of the present invention may be administered in a manner appropriate to the disease to be treated or prevented. The quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
[0330] The following examples are provided to illustrate, and not limit the disclosure.
EXAMPLES
Example 1 : Generation of mouse monoclonal antibodies against human CLDN18.2
[0331] Anti-human CLDN18.2 mouse monoclonal antibodies were generated using the hybridoma technology.
[0332] Antigens: a) cDNA encoding human CLDN18.2EC1 (extra-cellular domain 1) human Fc protein; b) human CLDN18.2EC1 (extra-cellular domain 1) human Fc protein; c) CHO cells expressing full length human CLDN18.2.
[0333] Immunization: To generate mouse monoclonal antibodies to human CLDN18.2, 4- 6 week female Swiss Webster mice were first immunized with cDNAs encoding human CLDN18.2EC1 human Fc protein at 40ug/mouse. Day 21 and 35 post first immunization, the immunized mice were boosted with 30ugs of human CLDN18.2EC1 human Fc protein each mouse. The immunized mice were further boosted with CHO cells expressing full length human CLDN18.2. To select mice producing antibodies that bound to human CLDN18.2, sera from immunized mice were tested by ELISA and FACS analysis.
[0334] For ELISA assays, microtiter plates were coated with human CLDN18.2 EC1 human Fc protein at 1 pg/ml in PBS, 1 OOmI/well at 4°C overnight and blocked with
1 OOmI/well of 2% BSA for 1 hour at RT. Dilutions of serum from immunized mice were added to each well and incubated for 1-2 hours at RT. The plates were washed with
PBS/Tween and then incubate with anti-mouse IgG antibody conjugated with Horse Radish Peroxidase (HRP) for 1 hour at RT. After washing, the plates were developed with TMB peroxidase substrate and analyzed by spectrophotometer at OD 450nm.
[0335] For FACS based titer analysis, 96 well microtiter plates were seeded with human CLDN18.2/CHO cells or CLDN18.1/CHO cells at 200,000 cells/well. Dilutions of serum from immunized mice were added to each well. The cells were mixed well and incubated at 4°C for 15 min. The cells were then washed with PBS three times, followed by incubation with PE-labeled anti -mouse Fc gamma specific antibody (Jackson Immuno-Re search) at 4°C for l5min. The cells were washed again with PBS three times and analyzed using an FACS Caliber instrument (Becton-Dickinson). Mice with sufficient specific titers to
CLDN18.2 were boosted with 30ug human CLDN18.2EC1 huFc protein 3-4 days before fusions.
[0336] Hybridoma fusions were done using BTX2001 electro-cell manipulator (Harvard Apparatus) and the standard protocol for hybridoma electro-fusion. Total mouse lymphocytes isolated from both lymph nodes and the spleens were fused with SP2/0 cells (ATCC) and hybridoma were selected using media containing Azaserine (Sigma).
Hybridoma supernatants were screened using both the ELISA and FACS assays. Positive wells were further subcloned using the limited dilution method.
[0337] Hybridoma clones T13S2, T88S1, T138S2, T155S2, T158S2, T192S2, T224S8, T252S4 and LN27S4 were selected for hybridoma sequencing. Briefly, RNAs were extracted from hybridoma cells using Trizolreagents (Invitrogen) and cDNAs were prepared using the PrimeScript™ Reverse Transcriptase). Antibody heavy and light chain V regions were PCR amplified using the cDNAs and the mouse Ig-Primer Set (Novagen, TB326 Rev.B 0503) and sequences were obtained using the standard DNA sequencing techniques.
[0338] The amino acid and polynucleotide sequences of the variable regions of the antibodies are provided in Table 1 and Table 2 below.
Table 1. CDR combinations for anti- CLDN18.2 antibodies
Table 2. Anti-CLDN18.2 mAb heavy and light chain variable region sequences.
Antibody CDRs are underlined.
Example 2: Anti-CLDNl8.2 mouse monoclonal antibody binding specificity and affinity
[0339] To evaluate the binding specificity of anti-CLDNl8.2 mouse hybridoma antibodies, the purified antibodies were analyzed by FACS analysis using CHO cells expressing either human CLDN18.1 or human CLDN18.2. The FACS analysis was done as described previously. As shown in Fig. la and lb, all 9 hybridoma antibodies bind to CHO cells expressing human CLDN 18.2 but not to CHO cells expressing human CLDN 18.1.
One of the hybridoma antibody T29S9 bind to both CLDN18.1 and 18.2 (Fig. 2).
[0340] To evaluate the binding affinity of anti-CLDNl8.2 mouse hybridoma antibodies to cell surface expressed human CLDN18.2, serial dilutions of anti-CLDNl8.2 purified antibodies were analyzed by FACS using CHO cells expressing human CLDN18.2. As
shown in Fig. 3, some of the antibodies had high binding affinity to cell surface CLDN18.2, such as T138S2, T155S2, T158S2, T192S2, and T252S4 while others had medium to low binding affinities, such as T13S2, T88S1, T224S8 and LN27S4.
[0341] The binding of anti-human CLDN18.2 antibody to human CLDN18.2 can also be evaluated in ELISA assays. Briefly, 96 well microtiter plates were coated with human CLDN18.2 huFc protein at 1 m/ml in PBS, 100 m l/well at 4°C overnight and then blocked with 100 m l/well of 2% BSA at RT for 1 hour. Five-fold dilutions of purified mouse hybridoma antibodies starting from 20 m g/ml were added to each well and incubated for 1- 2 hours at RT. The plates were washed with PBS/Tween and then incubate with goat-anti mouse IgG antibody conjugated with Horse Radish Peroxidase (HRP) for 1 hour at RT. After washing, the plates were developed with TMB substrate and analyzed by
spectrophotometer at OD 450nm. As shown in Fig. 4, all antibodies can bind to plated coated human CLDN18.2 protein at various degrees. It was interesting to observe that some of the antibodies which bind to cell surface CLDN18.2 with high affinities, such as T138S2 and T158S2, did not bind to plate-coated CLDN18.2 very well (Fig. 4).
Example 3: Anti-CLDNl8.2 mouse monoclonal antibody binding to KATO III cells
[0342] FACS assay was also used to evaluate the binding of anti-CLDNl8.2 antibodies to human gastric cancer cell line KATO III. As shown in Fig. 5, the six anti-CLDNl8.2 hybridoma antibodies can bind to KATO III cells at various levels.
Example 4: Anti-human CLDN18.2 mouse/human chimeric antibody binding affinity to human CLDN18.2 and KATO III cells
[0343] To produce anti-human CLDN18.2 mouse/human chimeric antibodies, mouse antibody heavy and light chain V regions were cloned into transient expression vectors containing human antibody heavy chain IgGl and light chain constant regions. The resulting antibody heavy and light chain expression constructs were used to transfect HEK293 cells. The culture supernatants were harvested and loaded onto protein A
Sepharose columns (GE Healthcare). The columns were washed and antibodies were then eluted with eluting buffer (0.1 M glycine buffer, pH 3.0). Collected fractions were neutralized with 1 MTris-HCl, pH 8.0, pooled together and then dialyzed against PBS.
Purity of the antibodies was analyzed by sodium dodecyl sulfate polyacrylamide gel
electrophoresis (SDS-PAGE) under both reducing and non-reducing conditions. Protein bands were visualized by Coomassie brilliant blue staining.
[0344] To evaluate the binding affinity of anti-human CLDN18.2 mouse/human chimeric antibodies to human CLDN18.2, CHO cells expressing human CLDN18.2 were first incubated with five fold serial diluted mouse/human chimeric mAbs starting at 100 pg/ml on ice for 30 min. The cells were then washed with PBS three times, followed by incubation with PE-labeled anti-human Fc gamma specific antibody (Jackson Immuno-Research) at 4°C for l5min. The cells were washed again with PBS three times and analyzed using an FACS Caliber instrument (Becton-Dickinson). As shown in Fig. 6, all six chimeric antibodies bind to CHO-CLDN18.2 cells at similar affinity as their hybridoma counterparts. D10C is an anti-human CLDN18.2 antibody identified by GanyMed and is used as a control.
[0345] The binding affinities of anti-human CLDN18.2 chimeric antibodies to human gastric cancer cell line KATO III were also evaluated by FACS. As shown in Fig.7, the anti-CLDNl8.2 chimeric antibodies bound to only a small fraction of KATO III cells.
However, most of the antibodies tested bound to KATO III cells at higher levels compared to the D10C antibody (Fig. 7).
Example 5: Anti-human CLDN18.2 antibody -induced receptor internalization in target cells
[0346] The anti-human CLDN18.2 antibody-induced CLDN18/2 internalization was evaluated. Anti-human CLDN18.2 antibodies, CT155S2, CT158S2, cT224S8, CT192S2, and cT252S4, were conjugated with FITC per manufacturer's instructions (Sigma). CHO- CLDN18.2 cells were stained with the FITC-labeled antibodies at 4°C for 20 min and washed with PBS twice, followed by incubation at 37°C for 0 hr (for cell surface binding) or 3 hr (for antibody internalization). The cells were then analyzed by fluorescence microscopy. As shown in Figs. 8a-8e, all of the tested anti-human CLDN18.2 antibodies, including CT155S2, CT158S2, cT224S8, CT192S2, and cT252S4, effectively induced CLDN18.2 internalization on CHO-CLDN18.2 cells (Figs. 8a-8e). These data
demonstrated that the anti-CLDNl8.2 antibodies conjugated with a cytotoxin or cytotoxic agents can be internalized by target cancer cells expressing CLDN18.2. Thus the anti- CLDN18.2 antibody -toxin conjugates can be used as antibody-drug conjugates (ADCs) for treatment of cancer and other diseases.
Example 6: Humanization of mouse anti-human CLDN18.2 antibody T252S4
[0347] The mAh T252S4 variable region genes were employed to create a humanized MAb. In the first step of this process, the amino acid sequences of the VH and VK of MAb T252S4 were compared against the available database of human Ig gene sequences to find the overall best-matching human germline Ig gene sequences. For the light chain, the closest human match was the IGKV4-1 gene, and for the heavy chain the closest human match was the IGVH5-51 gene.
[0348] Humanized variable domain sequences were then designed where the CDR1, CDR2, and CDR3 sequences (underlined sequences in Table 3) of the T252S4 light chain were grafted onto framework sequences of the IGKV4-1 gene, and the CDR1, CDR2, and CDR3 sequences (underlined sequences in Table 3) of the T252S4 heavy chain were grafted onto framework sequences of the IGVH5-51. A 3D model was then generated to determine if there were any framework positions where replacing the mouse amino acid to the human amino acid could affect binding and/or CDR conformation. The amino acid and nucleotide sequences of some of the humanized antibody are listed in Table 3 below.
Table 3. Humanized T252S4antibody sequences (CDRs are underlined)
[0349] The humanized VH and VK genes were produced synthetically and then respectively cloned into vectors containing the human gamma 1 and human kappa constant domains. The pairing of the human VH and the human VK created 6 humanized antibodies (see Table 4).
Table 4. Humanized T252S4 antibodies with their VH and VL regions
Example 7: Humanized T252S4 antibodies specifically bind to cell surface human
CLDN18.2 on CHO cells stably expressing CLDN18.2
[0350] To evaluate the binding activities of the humanized T252S4 antibodies to human CLDN18.2 on cell surface, humanized T252S4 antibodies were produced from HEK293 cells. Briefly, the three HuT252S4 antibody heavy chain V regions (Hl, H2, and H3) and two light chain V regions (Ll and L2) were paired in different combinations (Table 5) to transfect HEK293 cells, resulting in six humanized T252S4 antibodies. The chimeric T252S4 H/L was also expressed for comparison. The culture supernatants were harvested and loaded onto protein A Sepharose columns (GE Healthcare). The columns were washed and antibodies were then eluted with eluting buffer (0.1 M glycine buffer, pH 3.0).
Collected fractions were neutralized with 1 M Tris-HCl, pH 8.0, pooled together and then dialyzed against PBS. Purity of the antibodies was analyzed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) under both reducing and non-reducing conditions.
[0351] To evaluate the binding activities of the humanized T252S4 antibodies to cell surface-expressed human CLDN18.2, serial dilutions of purified humanized anti-CLDNl8.2 antibodies were analyzed by FACS using CHO cells expressing human CLDN18.2. As shown in Fig. 9, all humanized T252S4 antibodies, including HuT252S4 Hl/Ll,
HuT252S4H2/Ll, HuT252S4H3/Ll, HuT252S4Hl/L2, HuT252S4H2/L2, and
HuT252S4H3/L2, had high binding affinities to cell surface CLDN18.2. The humanized T252S4 antibodies, with EC50 ranging from 0.47 to 1 pg/ml, had similar affinities with or
higher affinities than the chimeric T252S4 antibody (EC50 at 1 pg/ml) binding to cell surface CLDN18.2 (Fig. 9).
Equivalents
[0352] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this technology belongs.
[0353] The present technology illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms“comprising,”“including,”“containing,” etc. shall be read expansively and without limitation. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the present technology claimed.
[0354] Thus, it should be understood that the materials, methods, and examples provided here are representative of preferred aspects, are exemplary, and are not intended as limitations on the scope of the present technology.
[0355] The present technology has been described broadly and generically herein. Each of the narrower species and sub-generic groupings falling within the generic disclosure also form part of the present technology. This includes the generic description of the present technology with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
[0356] In addition, where features or aspects of the present technology are described in terms of Markush groups, those skilled in the art will recognize that the present technology is also thereby described in terms of any individual member or subgroup of members of the Markush group.
[0357] All publications, patent applications, patents, and other references mentioned herein are expressly incorporated by reference in their entirety, to the same extent as if each were incorporated by reference individually. In case of conflict, the present specification, including definitions, will control.
[0358] Other aspects are set forth within the following claims.
Claims
1. An isolated antibody comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibody binds to an epitope of CLDN 18.2, and does not bind to CLDN 18.1.
2. The antibody of claim 1, wherein the HC comprises one or more of:
(a) a CDR1 comprising an amino acid sequence selected from: (i) GFTFSSYA, (ii) GFTFSDYY, (iii) GFNIKDYF, (iv) GYSFTGYN, (v) GFSLTSYG, (vi) GYNMN or an equivalent of each thereof;
(b) a CDR2 comprising an amino acid sequence selected from: (i) ISGGGST, (ii) ISDGGGDT, (iii) IDPENGDT, (iv) ISNGGGST, (v) INPYNGGT, (vi)
IWSDGRT, (vii) LINP YN GGTRYN QKFKG, or an equivalent of each thereof; and/or
(c) a CDR3 comprising an amino acid sequence selected from: (i)
ARGGNIYDGYPYYFDY, (ii) GGNIYDGYPYYFDY, (iii) ARHRGSLDY, (iv) NVLGY GNY GHF YY AMD Y, (v) ARHRGSLDF, (vi) ARMGLGNAMDY, (vii) ARHGRYDPYAMDY, (viii) MGLGNAMDY, or an equivalent of each thereof; the LC comprises one or more of:
(a) a CDR1 comprising an amino acid sequence selected from: (i)
QNLLNSSNQKNY, (ii) ESVDNYGFSF, (iii) QSLVHSNGNTY, (iv)
QNLLNSGNQKNY, (v) KSSQNLLNSGNQKNYLT or an equivalent of each thereof;
(b) a CDR2 comprising an amino acid sequence selected from:and/or a CDR2 comprising the amino acid sequence selected from (i) FAS, (ii) RAS, (iii) KVS, (iv) WAS, (v) WASTMES, or an equivalent of each thereof; and/or
(c) a CDR3 comprising an amino acid sequence selected from: (i)
QQHYSTPLT, (ii) QQSNQGPLT, (iii) SQNTHVPRT, (iv) QQSNKVPLT, (v) QNDYIYPLP, or an equivalent of each thereof.
3. The antibody of claim 1, wherein the HC variable region comprises a polypeptide selected from:
(a) EVKLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLE WVASISGGGSTYYPDSVKGRFTISRDNARNILYLQMSYLRSEDTAVYYCAR GGNI YDGYP YYFD YWGQGTTLT VS S
(b) E VKL VE S GGGL V QPGGSLKL S CAT S GFTF SD YYMF WIRQTPEKRLEW VASISDGGGDTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCAR HRGSLD YWGQGTTLT VS S
(c) E V QLQQ S GTEL VRS GAS VKL S CTT S GFNIKD YFLHW VKQRPEQ GLE WIGWIDPEN GDTK Y APKF QDK VTMT VDT S SNT ACLHL S SLT SDD T A V Y Y CN VLGY GNY GHF YY AMD YW GQGT S VT V S S
(d) E VKL VE S GGGL V QPGGSLKL S CAT S GFTF SD YYMYW VRQTPEKRLE W V A YI SN GGGS T Y YPDT VKGRFTI SRDN AKNTL YLQM SRLK SEDT AM Y Y C ARHRGSLDF W GQ GTTLT V S S
(e) EVQLQQSGPELVKPGASMKISCKASGYSFTGYNMNWVKQTHGKNL EWIGLINP YN GGTRYN QKFKGK ATLT VDK S S S T A YMELL SLT SED S A V YF C ARMGLGNAMD YW GQGTS VT V S S
(f) QVQLKESGPGLVAPSQSLSITCTISGFSLTSYGIHWVRQPPGKGLEWL VVIWSDGRTTYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCARHG RYDP Y AMD YW GQGTS VTV S S
(g) EVQLQQSGPELVKPGASMKISCKASGYSFTGYNMNWVKQTHGK NLEWIGLINP YN GGTRYN QKFKGK ATLT VDK S S ST A YMELL SLT SED S A V Y FCAR MGLGNAMDY WGQGTSVTVSS
(h) EVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN
WVRQMPGKGLEWMGLINPYNGGTRYNQKFKGQVTISADKSISTAYLQWSS LKASDTAMYFCAR MGLGNAMDY WGQGTTVTVSS
(i) EVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN
WVRQMPGKNLEWIG LINPYNGGTRYNQKFKG QVTISADKSISTAYLQWSSLKASDTAMYFCAR MGLGNAMDY WGQGTTVTVSS
the LC variable region comprises a polypeptide selected from:
(a) DIVMTQSP S SL AMS VGQK VTMSCKS SQNLLNS SNQKNYL AW YQQKP GQSPKLLVYFASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQQHY STPLTF GAGTKLELK
(b) DIVLTQSPASLAVSLGQRATISCRASESVDNYGFSFLHWYQQKPGQPP KLLIYRASNLASGIPARFSGSGSRTDFTLTINPVETDDVATYYCQQSNQGPLT F GAGTKLELK
(c) DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQ SPKLLI YK V SNRF S GVPDRF S GSE S GTDF TLKISRVE AEDLGI YF C S QNTHVPR TF GGGTKLEIR
(d) DIVLTQSPASLAVSLGQRATISCRASESVDNYGFSFMHWYQQKPGQP PKLLIYRASNLESGIPARFSGSWSRTDFTLTINPVETDDVATYYCQQSNKVPL TF GAGTKLELK
(e) DIVMTQSPSSLTVTAGEKVTMSC KSSQNLLNSGNQKNYLT
WYQQKPGQPPKLLIYWASTMESGVPDRFTGSGSGTDFTLTISSVQAEDLAV YYC QNDYIYPLP F GAGTKLELK
(f) DI VMT Q SPD SLAV SLGERATIN C KSSQNLLNSGNQKNYLT
WYQQKPGQPPKLLIYWASTMESGVPDRFSGSGSGTDFTLTISSLQAEDVAV YYC QNDYIYPLP FGQGTKLEIK
(g) DIVMTQSPSSLTVTAGEKVTMSC KSSQNLLNSGNQKNYLT
WYQQKPGQPPKLLIYWASTMESGVPDRFTGSGSGTDFTLTISSVQAEDLAV YYC QNDYIYPLP F GAGTKLELK
(h) DI VMT Q SPD SLAV SLGERATIN C KSSQNLLNSGNQKNYLT
WYQQKPGQPPKLLIYWASTMESGVPDRFSGSGSGTDFTLTISSLQAEDVAV YYC QNDYIYPLP FGQGTKLEIK
(i) DI VMT Q SPD SLAV SLGERATIN C KSSQNLLNSGNQKNYLT
WYQQKPGQPPKLLIYWASTMESGVPDRFSGSGSGTDFTLTISSLQAEDVAV YYC QNDYIYPLP FGQGTKLEIK, or an equivalent thereof.
4. The antibody of claim 1, wherein the antibody is a humanized antibody comprising the heav and light chain combinations shown in Table 4.
5. The antibody of claims 1 to 3, wherein the antibody is a bispecific antibody, chimeric or humanized antibody and/or is comprised in an immunoconjugate or an antibody drug conjugate (ADC).
6. The antibody of claim 5, wherein the bispecific antibody has a binding specific to a second targe protein selected from the group of IL-l, CD3, CD 16, CD 19, CD20, CD28, CD64, PD-l, PD-L1, CTLA-4, LAG-3, CD28, CD122, 4-1BB, TIM3, OX-40, OX40L, CD40, CD40L, LIGHT, ICOS, ICOSL, GITR, GITRL, TIGIT, CD27, VISTA, B7H3, B7H4, HEVM, BTLA and KIR.
7. The antibody of claim 5, wherein the immmunoconjugate or the antibody drug conjugate (ADC) comprises the antibody and an additoinal agent.
8. The antibody of claim 7, wherein the additional agent is selected from the group of a toxin, a drug, a therapeutic agent, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, a pharmaceutical agent, and/or polyethylene glycol (PEG).
9. The antibody of any of claims 1 to 8, wherein the antibody is selected from the group consisting of a monoclonal antibody, a chimeric antibody or a humanized antibody.
10. The antibody of any of claims 1 to 8, wherein the antibody comprises an antigen binding fragment selected from the group consisting of Fab, F(ab’)2, Fab’, scFv, and Fv.
11. The antibody of any of claims 1 to 10, wherein the antibody is generated against a CLDN 18.2 fragment or an equivalent thereof.
12. The antibody of any of claims 1 to 11, wherein an equivalent comprises an polypeptide having at least 80% amino acid identity to polypeptide or a polypeptide that is encoded by a polynucleotide that hybridizes under conditions of high stringency to the complement of a polynucleotide encoding the polypeptide.
13. A chimeric antigen receptor (CAR) comprising: (a) an antigen binding domain of an CLDN 18.2 antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) a 4-1BB costimulatory signaling region; and (e) a CD3 zeta signaling domain.
14. The CAR of claim 13, wherein the antigen binding domain of the anti-CLDN 18.2 antibody comprises an anti-CLDN 18.2 heavy chain (HC) variable region and an anti- CLDN 18.2 light chain (LC) variable region.
15. The CAR of claim 14, further comprising a linker polypeptide located between the anti-CLDN 18.2 HC variable region and the anti-CLDN 18.2 LC variable region.
16. The CAR of claim 14 or 15, wherein the HC comprises one or more of:
(a) a CDR1 comprising an amino acid sequence selected from: (i) GFTFSSYA, (ii) GFTFSDYY, (iii) GFNIKDYF, (iv) GYSFTGYN, (v) GFSLTSYG, (vi) GYNMN or an equivalent of each thereof;
(b) a CDR2 comprising an amino acid sequence selected from: (i) ISGGGST, (ii) ISDGGGDT, (iii) IDPENGDT, (iv) ISNGGGST, (v) INPYNGGT, (vi)
IWSDGRT, (vii) LINP YN GGTRYN QKFKG, or an equivalent of each thereof; and/or
(c) a CDR3 comprising an amino acid sequence selected from: (i)
ARGGNIYDGYPYYFDY, (ii) 0 GGNIYDGYPYYFDY, (iii) ARHRGSLDY, (iv) NVLGY GNY GHF YY AMD Y, (v) ARHRGSLDF, (vi) ARMGLGNAMDY, (vii) ARHGRYDPYAMDY, (viii) MGLGNAMDY, or an equivalent of each thereof; the LC comprises one or more of:
(a) a CDR1 comprising an amino acid sequence selected from: (i)
QNLLNSSNQKNY, (ii) ESVDNYGFSF, (iii) QSLVHSNGNTY, (iv)
QNLLNSGNQKNY, (v) KSSQNLLNSGNQKNYLT or an equivalent of each thereof;
-(b) a CDR2 comprising an amino acid sequence selected from:and/or a CDR2 comprising the amino acid sequence selected from (i) FAS, (ii) RAS, (iii) KVS, (iv) WAS, (v) WASTMES, or an equivalent of each thereof; and/or
(c) a CDR3 comprising an amino acid sequence selected from: (i)
QQHYSTPLT, (ii) QQSNQGPLT, (iii) SQNTHVPRT, (iv) QQSNKVPLT, (v) QNDYIYPLP, or an equivalent of each thereof.
17. The CAR of claim 14 or 15, wherein the HC variable region comprises a polypeptide selected from:
(a) EVKLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLE WVASISGGGSTYYPDSVKGRFTISRDNARNILYLQMSYLRSEDTAVYYCAR GGNI YDGYP YYFD YWGQGTTLT VS S
(b) E VKL VE S GGGL V QPGGSLKL S CAT S GFTF SD YYMF WIRQTPEKRLEW VASISDGGGDTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCAR HRGSLD YWGQGTTLT VS S
(c) E V QLQQ S GTEL VRS GAS VKL S CTT S GFNIKD YFLFtW VKQRPEQ GLE WIGWIDPEN GDTK Y APKF QDK VTMT VDT S SNT ACLHL S SLT SDD T A V Y Y CN VLGY GNY GHF YY AMD YW GQGT S VT V S S
(d) E VKL VE S GGGL V QPGGSLKL S CAT S GFTF SD YYMYW VRQTPEKRLE W V A YI SN GGGS T Y YPDT VKGRFTI SRDNAKNTL YLQM SRLK SEDT AM Y Y C ARHRGSLDF W GQ GTTLT V S S
(e) EVQLQQSGPELVKPGASMKISCKASGYSFTGYNMNWVKQTHGKNL EWIGLINP YN GGTRYN QKFKGK ATLT VDK S S S T A YMELL SLT SED S A V YF C ARMGLGNAMD YW GQGTS VT V S S
(f) QVQLKESGPGLVAPSQSLSITCTISGFSLTSYGIHWVRQPPGKGLEWL VVIWSDGRTTYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCARHG RYDP Y AMD YW GQGTS VTV S S
(g) EVQLQQSGPELVKPGASMKISCKASGYSFTGYNMNWVKQTHGK NLEWIGLINP YN GGTRYN QKFKGK ATLT VDK S S ST A YMELL SLT SED S A V Y FCAR MGLGNAMDY WGQGTSVTVSS
(h) EVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN
WVRQMPGKGLEWMGLINPYNGGTRYNQKFKGQVTISADKSISTAYLQWSS LKASDTAMYFCAR MGLGNAMDY WGQGTTVTVSS
(i) EVQLVQSGAEVKKPGESLKISCKGSGYSFT GYNMN
WVRQMPGKNLEWIG LINPYNGGTRYNQKFKG QVTISADKSISTAYLQWSSLKASDTAMYFCAR MGLGNAMDY WGQGTTVTVSS
the LC variable region comprises a polypeptide selected from:
(a) DIVMTQSP S SL AMS VGQK VTMSCKS SQNLLNS SNQKNYL AW YQQKP GQSPKLLVYFASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQQHY STPLTF GAGTKLELK
(b) DIVLTQSPASLAVSLGQRATISCRASESVDNYGFSFLHWYQQKPGQPP KLLIYRASNLASGIPARFSGSGSRTDFTLTINPVETDDVATYYCQQSNQGPLT F GAGTKLELK
(c) DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQ SPKLLI YK V SNRF S GVPDRF S GSE S GTDF TLKISRVE AEDLGI YF C S QNTHVPR TF GGGTKLEIR
(d) DIVLTQSPASLAVSLGQRATISCRASESVDNYGFSFMHWYQQKPGQP PKLLIYRASNLESGIPARFSGSWSRTDFTLTINPVETDDVATYYCQQSNKVPL TF GAGTKLELK
(e) DIVMTQSPSSLTVTAGEKVTMSC KSSQNLLNSGNQKNYLT
WYQQKPGQPPKLLIYWASTMESGVPDRFTGSGSGTDFTLTISSVQAEDLAV YYC QNDYIYPLP F GAGTKLELK
(f) DI VMT Q SPD SLAV SLGERATIN C KSSQNLLNSGNQKNYLT
WYQQKPGQPPKLLIYWASTMESGVPDRFSGSGSGTDFTLTISSLQAEDVAV YYC QNDYIYPLP FGQGTKLEIK
(g) DIVMTQSPSSLTVTAGEKVTMSC KSSQNLLNSGNQKNYLT
WYQQKPGQPPKLLIYWASTMESGVPDRFTGSGSGTDFTLTISSVQAEDLAV YYC QNDYIYPLP F GAGTKLELK
(h) DI VMT Q SPD SLAV SLGERATIN C KSSQNLLNSGNQKNYLT
WYQQKPGQPPKLLIYWASTMESGVPDRFSGSGSGTDFTLTISSLQAEDVAV YYC QNDYIYPLP FGQGTKLEIK
(i) DI VMT Q SPD SLAV SLGERATIN C KSSQNLLNSGNQKNYLT
WYQQKPGQPPKLLIYWASTMESGVPDRFSGSGSGTDFTLTISSLQAEDVAV YYC QNDYIYPLP FGQGTKLEIK, or an equivalent thereof.
18. The CAR of claim 16 or 17, wherein an equivalent comprises an polypeptide having at least 80% amino acid identity to polypeptide or a polypeptide that is encoded by a polynucleotide that hybridizes under conditions of high stringency to the complement of a polynucleotide encoding the polypeptide.
19. The CAR of any one of claims 13 to 18, further comprising a detectable marker or a purification marker.
20. An isolated nucleic acid sequence encoding the antibody of any one of claims 1 to 12, or the CAR of any one of claims 13 to 18.
21. The isolated nucleic acid of claim 20, further comprising a Kozak consensus sequence located upstream of the antigen binding domain of the anti-CLDN 18.2 antibody, or an enhancer.
22. The isolated nucleic sequence of any one of claims 20 or 21, further comprising an antibiotic resistance polynucleotide.
23. A vector comprising the isolated nucleic acid sequence of any one of claims 20 to 22.
24. The vector of claim 23, wherein the vector is a plasmid.
25. The vector of claim 23, wherein the vector is selected from a group consisting of a retroviral vector, a lentiviral vector, an adenoviral vector, and an adeno-associated viral vector.
26. An isolated cell comprising the CAR of any one of claims 13 to 19; and/or the isolated nucleic acid of any one of claims 20 to 22; and/or the vector of any one of claims 23 to 25.
27. The isolated cell of claim 26, wherein the cell is a T-cell.
28. The isolated cell of claim 26, which is a natural killer (NK) cell.
29. A composition comprising a carrier and one or more of: the antibody of any one of claims 1 to 12; and/or the CAR of any one of claims 13 to 19; and/or the isolated nucleic acid of any one of claims 20 to 22; and/or the vector of any one of claims 23 to 25; and/or an isolated cell of any one of claims 26 to 28.
30. The composition of claim 29, further comprising an antigen binding fragment capable of binding a peptide comprising a CLDN 18.2 fragment or an equivalent thereof.
31. The composition of claim 30, wherein the peptide is a full-length CLDN 18.2 protein.
32. The composition of claim 30 or 31, wherein the peptide is associated with a cell.
33. The composition of claim 30 or 31, wherein the peptide is bound to a solid support.
34. The composition of claim 30 or 31, wherein the peptide is disposed in a solution.
35. The composition of claim 30 or 31, wherein the peptide is associated with a matrix.
36. A method of producing anti-CLDN 18.2 CAR T-cells comprising:
(i) introducing a population of T-cells with a nucleic acid sequence encoding the CAR of any one of claims 13 to 19; and
(ii) selecting a subpopulation of T-cells that have been successfully transduced with said nucleic acid sequence of step (i) thereby producing anti-CLDN 18.2 CAR T-cells.
37. A method of producing anti-CLDN 18.2 CAR NK-cells comprising:
(i) introducing a population of NK-cells with a nucleic acid sequence encoding the CAR of any one of claims 13 to 19; and
(ii) selecting a subpopulation of NK-cells that have been successfully transduced with said nucleic acid sequence of step (i) thereby producing anti-CLDN 18.2 CAR NK- cells.
38. A method of inhibiting the growth of a tumor in a subject in need thereof, comprising administering to the subject an effective amount of the antibody of any one of claims 1 to 12 and/or the isolated cells of any one of claims 26 to 28 and/or the composition of claim 29.
39. The method of claim 38, wherein the isolated cells are autologous to the subject being treated.
40. The method of claim 38 or 39, wherein the tumor expresses or overexpresses CLDN 18.2.
41. The method of claim 38 or 39, wherein the tumor is a gastric, pancreatic, esophageal, ovarian, or lung tumor.
42. A method of treating a cancer patient in need thereof, comprising administering to the subject an effective amount of the isolated cell of the antibody of any one of claims 1 to 12 and/or the isolated cells of any one of claims 27 to 29 and/or the composition of claim 29.
43. The method of claim 42, wherein the isolated cells are autologous to the subject being treated.
44. The method of claim 42 or 43, wherein the tumor is cancer is gastric, pancreatic, esophageal, ovarian, or lung cancer.
45. The method of any one of claims 38 to 44, wherein the subject is a human, an animal, a non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
46. A method for determining if a patient is likely to respond or is not likely to anti- CLDN 18.2 CAR therapy, comprising contacting a tumor sample isolated from the patient with an effective amount of the antibody of any one of claims 1 to 12, and detecting the presence of any antibody bound to the tumor sample, wherein the presence of antibody bound to the tumor sample indicates that the patient is likely to respond to the anti-CLDN 18.2 CAR therapy and the absence of antibody bound to the tumor sample indicates that the patient is not likely to respond to the anti-CAR therapy.
47. The method of claim 46, further comprising administering an effective amount of the anti-CLDN 18.2 CAR of claims 13 to 19 to the patient that is determined likely to respond to the anti-CLDN 18.2 CAR therapy.
48. The method of claim 46 or 47, wherein the patient is suffering from gastric, pancreatic, esophageal, ovarian, or lung cancer.
49. A kit for detecting CLDN 18.2 comprising an antibody of any of claims 1 to 12, and instructions for use.
50. The kit of claim 49, further, wherein the antibody is capable of binding a CLDN 18.2 polypeptide in a biological sample.
51. The kit of claim 49 or 50, further, further comprising means for determining the amount of the CLDN 18.2 polypeptide in the biological sample, and means for comparing the amount of the CLDN 18.2 polypeptide in the sample with a standard.
52. A method of detecting CLDN 18.2 in a biological sample comprising contacting the sample with the antibody of any of claims 1 to 12 or an equivalent thereof, and detecting a complex formed by the binding of the antibody or antigen binding fragment to CLDN 18.2.
53. The method of claim 52, wherein the sample comprises a cell sample or a tissue sample.
54. The method of claim 53, wherein the sample is obtained from a subject that is diagnosed as having, suspected as having, or at risk of having cancer.
55. The method of claim 54, wherein the cancer is gastric, pancreatic, esophageal, ovarian, or lung cancer.
56. The method of any one of claims 52 to 55, wherein the detection comprises one or more of immunohistochemistry (IHC), Western blotting, Flow cytometry or ELISA.
57. A method of detecting a pathological cell in a sample isolated from a subject, comprising
(a) detecting the level of CLDN 18.2 in a biological sample from the subject by detecting a complex formed by the antibody of any of claims 1 to 12 or an equivalent thereof; and
(b) comparing the levels of CLDN 18.2 observed in step (a) with the levels of CLDN 18.2 observed in a control biological sample;
wherein the pathological cell is detected when the level of CLDN 18.2 is elevated compared to that observed in the control biological sample.
58. The method of claim 57, wherein the biological sample of the subject comprises one or more of a sample isolated from gastric, pancreatic, esophageal, ovarian, or lung tissue.
59. The method of claim 57 or 58, wherein the detection comprises one or more of immunohistochemistry (IHC), Western Blotting, Flow cytometry or ELISA.
60. The method of any of claims 57 to 59, further comprising isolating the biological sample from the subject.
61. The method of claim 60, wherein the subject is a mammal.
62. The method of claim 61, wherein the mammal is selected from the group of: a human, an animal, a non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
Priority Applications (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/262,351 US12054543B2 (en) | 2018-07-25 | 2019-07-24 | CLDN 18.2-specific monoclonal antibodies and methods of use thereof |
CN201980060754.7A CN112770723B (en) | 2018-07-25 | 2019-07-24 | CLDN 18.2-specific monoclonal antibodies and methods of use thereof |
EP19842207.3A EP3826612A4 (en) | 2018-07-25 | 2019-07-24 | Novel cldn 18.2-specific monoclonal antibodies and methods of use thereof |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201862703036P | 2018-07-25 | 2018-07-25 | |
US62/703,036 | 2018-07-25 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2020023679A1 true WO2020023679A1 (en) | 2020-01-30 |
Family
ID=69181937
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2019/043316 WO2020023679A1 (en) | 2018-07-25 | 2019-07-24 | Novel cldn 18.2-specific monoclonal antibodies and methods of use thereof |
Country Status (4)
Country | Link |
---|---|
US (1) | US12054543B2 (en) |
EP (1) | EP3826612A4 (en) |
CN (1) | CN112770723B (en) |
WO (1) | WO2020023679A1 (en) |
Cited By (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN113416260A (en) * | 2021-04-14 | 2021-09-21 | 南京凯地医疗技术有限公司 | Claudin18.2-targeted specific chimeric antigen receptor cell and preparation method and application thereof |
WO2021218874A1 (en) * | 2020-04-27 | 2021-11-04 | 启愈生物技术(上海)有限公司 | Bispecific antibody targeting human claudin and human pdl1 proteins, and application thereof |
WO2021228141A1 (en) * | 2020-05-15 | 2021-11-18 | 四川科伦博泰生物医药股份有限公司 | Antibody drug conjugate, preparation method therefor and use thereof |
WO2021254481A1 (en) * | 2020-06-19 | 2021-12-23 | 信达生物制药(苏州)有限公司 | Anti-claudin18.2 antibody and use thereof |
WO2021236724A3 (en) * | 2020-05-20 | 2021-12-30 | Remd Biotherapeutics, Inc. | Human endothelin receptor a (etar) antagonist antibodies |
WO2022032004A3 (en) * | 2020-08-06 | 2022-03-17 | Abpro Corporation | Anti-claudin 18.2 multi-specific antibodies and uses thereof |
WO2022063272A1 (en) * | 2020-09-28 | 2022-03-31 | Elpiscience (Suzhou) Biopharma, Ltd. | Novel anti-claudin18 antibodies |
WO2022111405A1 (en) * | 2020-11-27 | 2022-06-02 | 南京北恒生物科技有限公司 | Antibody targeting claudin18.2 and use thereof |
WO2022122709A1 (en) | 2020-12-07 | 2022-06-16 | Sotio Biotech A.S. | Antibody-drug conjugates based on humanized cldn18.2 antibodies |
WO2022136642A1 (en) | 2020-12-23 | 2022-06-30 | Sotio Biotech A.S. | Tumor-specific claudin 18.2 antibody-drug conjugates |
WO2022206976A1 (en) * | 2021-04-02 | 2022-10-06 | 原启生物科技(上海)有限责任公司 | Antigen-binding protein targeting cldn18.2, and use thereof |
RU2814164C2 (en) * | 2021-05-08 | 2024-02-27 | Ремеджен Ко., Лтд. | Anti-claudin 18.2 antibody and its antibody-drug conjugate |
Families Citing this family (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022011531A1 (en) * | 2020-07-14 | 2022-01-20 | 浙江道尔生物科技有限公司 | Anti-cld18a2 single-domain antibody |
CN113687085A (en) * | 2021-08-27 | 2021-11-23 | 复旦大学附属中山医院 | Method for evaluating expression of Claudin18.2 protein of solid tumor and application |
CN116102649A (en) * | 2021-11-11 | 2023-05-12 | 上海生物制品研究所有限责任公司 | anti-CLDN 18.2 monoclonal antibody and application thereof |
CN114539410B (en) * | 2022-03-15 | 2023-09-05 | 苏州量化细胞生物科技有限公司 | CLDN18.2 binding antibodies, probes and use in single cell sequencing of CLDN18.2 expressing cells |
WO2023226836A1 (en) * | 2022-05-27 | 2023-11-30 | 苏州易慕峰生物科技有限公司 | Chimeric antigen receptor containing cldn18.2 single domain antibody and application thereof |
US20240228610A9 (en) * | 2022-10-10 | 2024-07-11 | Medimmune, Llc | Compositions and methods of treating cancer with chimeric antigen receptors targeting claudin 18.2 |
CN115947851B (en) * | 2022-12-19 | 2024-02-13 | 华润生物医药有限公司 | Antibodies that bind CLDN18.2 and uses thereof |
KR20240101987A (en) * | 2022-12-23 | 2024-07-03 | 주식회사 와이바이오로직스 | Monoclonal antibody specifically binding to claudin-18.2 and uses thereof |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100061988A1 (en) * | 2008-09-04 | 2010-03-11 | Hansen Genevieve | Monoclonal antibodies |
US20130324432A1 (en) * | 2010-11-09 | 2013-12-05 | Sarcotein Diagnostics Llc | Bin1 expression as a marker of skeletal muscle mass and neurological conditions |
US20140127223A1 (en) * | 2011-04-28 | 2014-05-08 | Sbi Biotech Co., Ltd. | Anti-human receptor-type protein tyrosine phosphatase sigma antibody |
WO2016077720A1 (en) * | 2014-11-14 | 2016-05-19 | Protein One, Llc | Binding agents and uses thereof |
CA3030257A1 (en) * | 2016-07-08 | 2018-01-11 | Carsgen Therapeutics Co., Ltd. | Antibody for anti-claudin 18a2 and use thereof |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2016180468A1 (en) | 2015-05-11 | 2016-11-17 | Biontech Cell & Gene Therapies Gmbh | Claudin-18.2-specific immunoreceptors and t cell epitopes |
-
2019
- 2019-07-24 EP EP19842207.3A patent/EP3826612A4/en active Pending
- 2019-07-24 US US17/262,351 patent/US12054543B2/en active Active
- 2019-07-24 WO PCT/US2019/043316 patent/WO2020023679A1/en active Application Filing
- 2019-07-24 CN CN201980060754.7A patent/CN112770723B/en active Active
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100061988A1 (en) * | 2008-09-04 | 2010-03-11 | Hansen Genevieve | Monoclonal antibodies |
US20130324432A1 (en) * | 2010-11-09 | 2013-12-05 | Sarcotein Diagnostics Llc | Bin1 expression as a marker of skeletal muscle mass and neurological conditions |
US20140127223A1 (en) * | 2011-04-28 | 2014-05-08 | Sbi Biotech Co., Ltd. | Anti-human receptor-type protein tyrosine phosphatase sigma antibody |
WO2016077720A1 (en) * | 2014-11-14 | 2016-05-19 | Protein One, Llc | Binding agents and uses thereof |
CA3030257A1 (en) * | 2016-07-08 | 2018-01-11 | Carsgen Therapeutics Co., Ltd. | Antibody for anti-claudin 18a2 and use thereof |
Non-Patent Citations (1)
Title |
---|
See also references of EP3826612A4 * |
Cited By (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2023522492A (en) * | 2020-04-27 | 2023-05-30 | 啓愈生物技術(上海)有限公司 | Bispecific antibody targeting human claudin and human PDL1 protein and use thereof |
WO2021218874A1 (en) * | 2020-04-27 | 2021-11-04 | 启愈生物技术(上海)有限公司 | Bispecific antibody targeting human claudin and human pdl1 proteins, and application thereof |
JP7463000B2 (en) | 2020-04-27 | 2024-04-08 | 啓愈生物技術(上海)有限公司 | Bispecific antibodies targeting human claudin and human pdl1 proteins and uses thereof |
WO2021228141A1 (en) * | 2020-05-15 | 2021-11-18 | 四川科伦博泰生物医药股份有限公司 | Antibody drug conjugate, preparation method therefor and use thereof |
WO2021236724A3 (en) * | 2020-05-20 | 2021-12-30 | Remd Biotherapeutics, Inc. | Human endothelin receptor a (etar) antagonist antibodies |
WO2021254481A1 (en) * | 2020-06-19 | 2021-12-23 | 信达生物制药(苏州)有限公司 | Anti-claudin18.2 antibody and use thereof |
WO2022032004A3 (en) * | 2020-08-06 | 2022-03-17 | Abpro Corporation | Anti-claudin 18.2 multi-specific antibodies and uses thereof |
WO2022063272A1 (en) * | 2020-09-28 | 2022-03-31 | Elpiscience (Suzhou) Biopharma, Ltd. | Novel anti-claudin18 antibodies |
WO2022111405A1 (en) * | 2020-11-27 | 2022-06-02 | 南京北恒生物科技有限公司 | Antibody targeting claudin18.2 and use thereof |
WO2022122709A1 (en) | 2020-12-07 | 2022-06-16 | Sotio Biotech A.S. | Antibody-drug conjugates based on humanized cldn18.2 antibodies |
WO2022136642A1 (en) | 2020-12-23 | 2022-06-30 | Sotio Biotech A.S. | Tumor-specific claudin 18.2 antibody-drug conjugates |
WO2022206976A1 (en) * | 2021-04-02 | 2022-10-06 | 原启生物科技(上海)有限责任公司 | Antigen-binding protein targeting cldn18.2, and use thereof |
CN113416260A (en) * | 2021-04-14 | 2021-09-21 | 南京凯地医疗技术有限公司 | Claudin18.2-targeted specific chimeric antigen receptor cell and preparation method and application thereof |
RU2814164C2 (en) * | 2021-05-08 | 2024-02-27 | Ремеджен Ко., Лтд. | Anti-claudin 18.2 antibody and its antibody-drug conjugate |
Also Published As
Publication number | Publication date |
---|---|
US12054543B2 (en) | 2024-08-06 |
US20210214433A1 (en) | 2021-07-15 |
EP3826612A4 (en) | 2022-09-14 |
EP3826612A1 (en) | 2021-06-02 |
CN112770723A (en) | 2021-05-07 |
CN112770723B (en) | 2024-08-02 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US12054543B2 (en) | CLDN 18.2-specific monoclonal antibodies and methods of use thereof | |
US20210070864A1 (en) | Hla-g as a novel target for car t-cell immunotherapy | |
US20210269534A1 (en) | Flt3 directed car cells for immunotherapy | |
US20210403585A1 (en) | Car t-cell therapy directed to lhr for the treatment of solid tumors | |
US20210147551A1 (en) | Lym-1 and lym-2 targeted car cell immunotherapy | |
US20180291089A1 (en) | Secretory tnt car cell immunotherapy | |
US20180118831A1 (en) | Car t-cells for the treatment of b7-h4 expressing solid tumors | |
AU2017330423A1 (en) | Chimeric antigen receptors and compositions and methods of use thereof | |
JP2023165793A (en) | Anti-DCLK1 antibodies and chimeric antigen receptors, and compositions and methods of use thereof | |
US12084514B2 (en) | Anti-DCLK1 antibodies and chimeric antigen receptors, and compositions and methods of use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2019842207 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 2019842207 Country of ref document: EP Effective date: 20210225 |