WO2019155002A1 - Anti-prevotella bacteriocin methods and compositions - Google Patents
Anti-prevotella bacteriocin methods and compositions Download PDFInfo
- Publication number
- WO2019155002A1 WO2019155002A1 PCT/EP2019/053170 EP2019053170W WO2019155002A1 WO 2019155002 A1 WO2019155002 A1 WO 2019155002A1 EP 2019053170 W EP2019053170 W EP 2019053170W WO 2019155002 A1 WO2019155002 A1 WO 2019155002A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- prevotella
- bacteriocin
- seq
- lmo2776
- infection
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/164—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
Definitions
- Prevotella is classically considered as a bacterial commensal due to its presence in several locations of the healthy human body including the oral cavity, gastrointestinal tract, urogenital tract and skin (1).
- the Prevotella genus encompasses more than 40 different culturable species of which three, P. copri, P salivae and P. stercorea, can be isolated from the gut. Only a few strains have been reported to be associated with opportunistic infections, e.g. periodontitis or bacterial vaginosis (1).
- Prevotella has been described as the major genus of one of the three reported human enterotypes (2).
- the microbiota plays a central role in protecting the host from pathogens (9).
- pathogens for example, in the case of Listeria monocytogenes, the foodborne pathogen responsible for listeriosis, the intestinal microbiota provides protection, as germfree mice are more susceptible to bacterial infection than conventional mice (10, 11). Unravelling the interactions between the host, the microbiota and pathogenic bacteria is critical for the design of new therapeutic strategies via manipulation of the microbiota.
- identifying the specific molecules and the mechanisms used by the commensals to elicit their beneficial action is challenging due to the high complexity of the microbiomes, together with technical issues such as unculturability of many commensal species.
- enteric pathogens have developed various strategies to outcompete other species in the intestine and access nutritional and spatial niches, leading to successful infection (20, 21).
- enteric pathogens have developed various strategies to outcompete other species in the intestine and access nutritional and spatial niches, leading to successful infection (20, 21).
- the contribution of bacteriocins and type VI secretion systems effectors during pathogen colonisation of the gut is an emerging field of investigation.
- Lmo2776 targets Prevotella and reduces its abundance in the microbiota of both the mouse and human. This effect is direct and specific as (i) Prevotella are killed by Listeria culture supernatant (containing Lmo2776) in vitro and (ii) despite the complexity of the microbiota and its well-controlled equilibrium, no other genus of the intestinal microbiota was found to decrease in the presence of Lmo2776.
- the examples further demonstrate that the Lmo2776 bacteriocin targets B. subtilis, a Gram-positive bacterium found in the soil, suggesting that Lmo2776 could give an advantage to Listeria in the environment. B. subtilis, a Gram-positive bacterium found in the soil, suggesting that Lmo2776 could give an advantage to Listeria in the environment.
- subtilis is also found in the human gastrointestinal tract (60) and could also be targeted by Lmo2776 in the intestine.
- the antibacterial effect of the Lmo2776 bacteriocin against Prevotella was confirmed using a synthetic Lmo2776 peptide.
- Lmo2776 peptide inhibits Prevotella copri growth in vitro and in vivo in conventional mouse microbiota.
- Lmo2776 peptide is capable of inhibiting the growth of P. copri isolates from Rheumatoid arthritis patients.
- this invention provides methods of treating or preventing inflammation in a subject, comprising administering an anti -Prevotella bacteriocin to the subject.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1.
- the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3.
- the subject has or is at risk of developing an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, and HIV infection.
- the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80%.
- this invention provides methods of treating or preventing an enteropathogenic bacterial infection in a subject, comprising administering an anti -Prevotella bacteriocin to the subject.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1.
- the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3.
- the subject has or is at risk of developing an Listeria infection.
- the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80%.
- this invention provides methods of reducing the Prevotella load of a subject by at least 80%, comprising administering an anti -Prevotella bacteriocin to the subject.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1.
- the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3.
- the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80%. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 90%. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 99%. In some embodiments the Prevotella load is reduced in the gut microbiota of the subject.
- this invention provides pharmaceutical compositions comprising an anti -Prevotella bacteriocin and a pharmaceutically acceptable carrier.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1.
- the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3.
- this invention provides pharmaceutical compositions comprising an anti -Prevotella bacteriocin and a pharmaceutically acceptable carrier for use in treating or preventing inflammation in a subject.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1.
- the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3.
- the subject has or is at risk of developing an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, and HIV infection.
- the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80%.
- this invention provides pharmaceutical compositions comprising an anti -Prevotella bacteriocin and a pharmaceutically acceptable carrier for use in treating or preventing an enteropathogenic bacterial infection in a subject.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1.
- the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3.
- the subject has or is at risk of developing an Listeria infection.
- the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80%.
- this invention provides pharmaceutical compositions comprising an anti -Prevotella bacteriocin and a pharmaceutically acceptable carrier for use in reducing the Prevotella load of a subject.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1.
- the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1 SEQ ID NO: 2 or SEQ ID NO: 3.
- the anti -Prevotella bacteriocin reduces the Prevotella load by at least 80%.
- the anti -Prevotella bacteriocin reduces the Prevotella load by at least 90%.
- the anti -Prevotella bacteriocin reduces the Prevotella load by at least 99%.
- said anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3.
- said Prevotella is Prevotella copri.
- Figures 1A to IF Lmo2776 limits Listeria virulence in a microbiota- dependent manner.
- A-C BALB/c mice were inoculated orally with 5xl0 9 Listeria WT, D lmo2776 or Lmo2776 complemented ( p2776 ) bacteria.
- CFUs in the intestinal luminal content (A), the spleen (B) and the liver (C) were assessed at 72h post-infection.
- D-F Germ-free C57BL/6J were infected with 5x10 9 Listeria WT or D lmo2776 for 72h and CFUs in the intestinal luminal content (D), the spleen (E) and the liver (F) were assessed. Each dot represents the value for one mouse. Statistically significant differences were evaluated by the Mann- Whitney test. (*p ⁇ 0.05).
- FIGS 2A to 2D Lmo2776 targets Prevotella in mouse microbiota.
- FIGS 3A to 3J Lmo2776 targets P. copri in human microbiota and in vitro.
- E-F Numbers of P. copri (E), B. subtilis or E. coli (F) after incubation with supernatant of WT ( Lm ) or Almo2776 strains. Results are expressed as mean ⁇ SEM of a least 3 independent experiments and P-values were obtained using two-tailed unpaired Student’s t-test (*p ⁇ 0.05, ***p ⁇ 0.005).
- A Assessment of listerial CFUs in the intestinal luminal content of germ-free (GF) C57BL/6J mice colonized or not with P. copri, B. thetaiotamicron or P. salivae for 2 weeks and then infected with L. monocytogenes WT or D lmo2776 for 72h.
- B Numbers of P. copri CFUs in the intestinal luminal content of GF C57BL/6J mice colonized with P. copri and then infected with Listeria WT or Almo2776 for 72h.
- each dot represents one mouse.
- Statistically significant differences were evaluated by the Mann- Whitney test (A), one way-ANOVA test (C and D) or two-tailed unpaired Student’s t-test (B and E) (*p ⁇ 0.05, ***p ⁇ 0.005).
- Figures 5A to 5C Presence of lmo2776 in L. monocytogenes strains and homologies with members of the Lactococcin 972 family.
- A Schematic representation of Listeria monocytogenes (WT) genome showing a locus comprising Imo 2776. Absence of Imo 2776 locus in the non-pathogenic L. innocua strain CLIP 111262. Deletion of Imo 2776 in the Almo2776 mutant.
- B Cluster analysis based on core genome multilocus sequence typing (cgMLST) profiles of 1,096 genomes (61) and pattern of Imo2774-lmo2775-lmo2776 genes presence (dark) or absence (white). The ten most frequent sublineages (SL) are highlighted. The last column corresponds to the sample source, represented by colour codes (upper left key).
- Figures 6A to 6F Effect of lmo2776 on Listeria infection.
- mice were inoculated orally with 5xl0 9 Listeria WT or A lmo2776 strains. CFUs in the intestinal luminal were assessed at 24h, 48h and 72h post-infection.
- mice were inoculated intraveinously with 5xl0 9 Listeria WT or A lmo2776 strains. CFUs in the the spleen were assessed at 72h post-infection.
- FIGS 8A to 8D OTUs targeted by Lmo2776 are closely related to Prevotella genus.
- FIG. 9A to 9D Quantification of Prevotella (pg/mg) in the feces of conventional mice at day 0 and orally inoculated with 5xl0 9 Listeria WT or A lmo2776 strains at day 1.
- Figures 9A to 9D Production of butyrate, isobutyrate, acetate and iso valerate is not modified by Lmo2776. Levels of butyrate (A), isobutyrate (B), acetate (C) and isovalerate (D) in SHIME® vessels infected with WT (dashed line) or A lmo2776 (grey) strains or non-infected (black) overtime. Results are expressed as mean ⁇ SEM for 2 to 3 individual vessels. [0024] Figures 10A to 10B: Lm secretes a bona fide bacteriocin targeting B. subtilis.
- FIG. 11 Lmo2776 targets Prevotella in mouse microbiota. Relative abundance of OTU 355746, OTU 216524, OTU 421792, OTU 258849, OTU 331772, OTU 346870, OTU 430197, OTU 447141, OTU 465433, OTU 208409, OTU 353012, OTU 364179 in gut microbiota of mice infected with WT or Almo2776 strains at day 0, day 1 and day 2. Each dot represents the value for one mouse.
- Figures 12A to 12C P. copri controls Listeria infection. Assessment of listerial CFUs in the intestinal luminal content (A), spleen (B) and liver (C) of germ-free (GF) C57BL/6J mice colonized or not with a mixture of 12 bacteria including V errucom i crobi a (A. muciniphila YL44), Bacteroidetes (B. caecimuris 148, M. intestinale YL27), Proteobacteria CL. muris YL45), Actinobacteria (B. longum YL2), Fimicutes (E. faecalis KB1 ; A. muris KB18; C.
- V errucom i crobi a A. muciniphila YL44
- Bacteroidetes B. caecimuris 148, M. intestinale YL27
- Proteobacteria CL. muris YL45 Proteobacteria
- treatment refers to any process, action, application, therapy, or the like, wherein a subject, including a human being, is subjected to medical aid with the object of curing a disorder, or eradicating a pathogen, or improving the subject's condition, directly or indirectly. Treatment also refers to reducing incidence, or alleviating symptoms, eliminating recurrence, preventing recurrence, preventing incidence, improving symptoms, improving prognosis or combinations thereof. [0029] The term“preventing” includes the reducing the incidence, recurrence, spread, onset or establishment of a disorder such as a bacterial infection. It is not intended that the present disclosure be limited to complete prevention or to prevention of establishment of an infection. In some embodiments, the onset is delayed, or the severity of a subsequently contracted disease is reduced, and such constitute examples of prevention.
- percent amino acid sequence identity with respect to the anti- Prevotella bacteriocin polypeptide sequences is defined herein as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific anti -Prevotella bacteriocin polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for example, using publicly available software such as BTAST or Megalign (DNASTAR) software.
- subject refers to a subject to be treated and includes inter alia mammals, e.g., humans, dogs, cows, horses, pigs, sheep, goats, cats, mice, rabbits, rats, and transgenic non-human animals.
- the subject is a human.
- the phrase “inhibiting growth” in reference to Prevotella refers to any mechanism that reduces the accumulation of Prevotella cells in an area over time.
- any mechanism that causes Prevotella cells in a culture to accumulate at a slower rate than Prevotella cells in a control culture or any mechanism that that causes Prevotella cells in an in vivo context (e.g., gut microbiota, lung microbiota) to accumulate at a slower rate than Prevotella cells in a control.
- inhibitting includes without limitation mechanisms reducing the rate of cell division and induction of cell death such as by cell lysis.
- Prevotella load refers to a measurable quantity of bacteria in an object, organism, or organism compartment. In some embodiments the Prevotella load is determined at least in part by measuring the proportion of total bacteria present that are viable Prevotella.
- Bacteriocins are proteinaceous or peptidic toxins produced by bacteria to inhibit the growth of similar or closely related bacterial strain(s). They are similar to yeast and paramecium killing factors, and are structurally, functionally, and ecologically diverse.
- an“anti -Prevotella bacteriocin” is a bacteriocin that inibits the growth of P. copri in an in vitro culture.
- An exemplary assay is demonstrated in Example 3.
- assay bacteriocin is obtained by culturing L. monocytogenes Lmo2776 and collecting the supernatant of the culture that comprises bacteriocin.
- P. copri is then grown at 37°C in anaerobic conditions in the presence of the supernatant.
- the assay may be adapted to use bacteriocin from any suitable source at a defined concentration in the culture media.
- a candidate bacteriocin is added to culture media at a concentration of from 10 nM to 80 mM and the effect of the candidate bacteriocin on growth of P. copri colonies is measured.
- a candidate bacteriocin that inhibits the growth of P. copri colonies when present in culture media at a concentration within this concentration range is identified as a anti -Prevotella bacteriocin.
- a candidate bacteriocin that inhibits the growth of P. copri colonies when present in culture media at a concentration of from 10 nM to 100 nM is identified as a anti -Prevotella bacteriocin.
- a candidate bacteriocin that inhibits the growth of P. copri colonies when present in culture media at a concentration of from 100 nM to ImM is identified as a anti- Prevotella bacteriocin.
- a candidate bacteriocin that inhibits the growth of P. copri colonies when present in culture media at a concentration of from ImM to 10 pM is identified as a anti -Prevotella bacteriocin.
- a candidate bacteriocin that inhibits the growth of P. copri colonies when present in culture media at a concentration of from 10 pM to 80 pM is identified as a anti -Prevotella bacteriocin.
- the anti -Prevotella bacteriocin is an L. monocytogenes bacteriocin. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes EGD-e Lmo2776, which has the following sequence:
- the anti -Prevotella bacteriocin is a fragment of L. monocytogenes EGD-e Lmo2776.
- the anti -Prevotella bacteriocin is a fragment of L. monocytogenes EGD-e Lmo2776 from which the signal peptide has been cleaved.
- Bacteriocin of the lactococcin 972 family are cleaved following a GG motif (positions 67-68 of SEQ ID NO: 1; underlined) to the mature form.
- the fragment comprises or consists of the following sequence:
- the fragment comprises or consists of the following sequence:
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 70% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 75% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 85% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 90% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 91% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 92% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 93% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 94% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 95% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 96% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 97% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 98% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 98% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1. In some embodiments the anti -Prevotella bacteriocin consists of the amino acid sequence of SEQ ID NO: 1.
- the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 2. In some embodiments the anti -Prevotella bacteriocin consists of the amino acid sequence of SEQ ID NO: 2. In some embodiments the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin consists of the amino acid sequence of SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3. In some more preferred embodiments, the anti- Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3.
- the invention encompasses variants of L. monocytogenes Lmo2776 including natural and synthetic variants thereof. Natural variants are found in the various serotypes, strains and isolates of L. monocytogenes. Synthetic variants can be made from any one of SEQ ID NO: 1, 2, and 3 by routine techniques in the art and screened for activity (i.e. anti-Prevotella bacteriocin activity) using the assays described herein such as the exemplary assay disclosed in Example 3 or other similar assays.
- Bacteriocins may be produced using any suitable reagents and methods known in the art.
- a bacteriocin-producing strain of bacteria is cultured and the bacteriocin is recovered from the culture.
- the bacteriocin is recovered by collecting culture media from the culture and then optionally purifying the bacteriocin from the culture media.
- the bacteriocin-producing strain is a Listeria strain.
- the bacteriocin-producing strain is an E coli strain.
- lmo2776 was cloned in pGEX4Tl plasmid and the recombinant plasmid transformed into E. coli BL2l(DE3) Gold competent cells (Novagen). The bacteria were grown at 37°C up to an OD of 0.7-0.8 and expression of GST-Lmo2776 was induced with 0.6 mM IPTG at l6°C for l6h prior to collection of cell pellets by centrifugation. Cells were resuspended in 20 mM Tris pH 8.5, 150 mM NaCl, 1 mM DTT and lysed by sonication or by passage through a French press.
- Lmo2776 peptide as defined above is synthesized using standard peptide synthesis methods that are well-known in the art such as for example solid-phase synthesis methods.
- compositions comprising an anti -Prevotella bacteriocin and a pharmaceutically acceptable carrier.
- the pharmaceutical composition is a solution, a suspension, an emulsion, an inhalable powder, an aerosol, or a spray.
- the pharmaceutical composition further comprises one or more antibiotics suitable for the treatment of bacterial infection.
- the pharmaceutical composition further comprises one or more antibiotics suitable for the treatment of Gram-negative and/or Gram-positive bacterial infection.
- the pharmaceutical composition further comprises one or more antibiotics suitable for the treatment of Gram-negative bacterial infection.
- the pharmaceutical composition further comprises one or more anti-inflammatory agents for the treatment of inflammation.
- the term“pharmaceutically acceptable carrier” includes any and all solvents, additives, excipients, dispersion media, solubilizing agents, coatings, preservatives, isotonic and absorption delaying agents, surfactants, propellants and the like that are physiologically compatible.
- the carrier(s) must be“acceptable” in the sense of not being deleterious to the subject to be treated in amounts typically used in medicaments.
- Pharmaceutically acceptable carriers are compatible with the other ingredients of the composition without rendering the composition unsuitable for its intended purpose.
- pharmaceutically acceptable carriers are suitable for use with subjects as provided herein without undue adverse side effects (such as toxicity, irritation, and allergic response). Side effects are“undue” when their risk outweighs the benefit provided by the composition.
- Non-limiting examples of pharmaceutically acceptable carriers or excipients include any of the standard pharmaceutical carriers such as phosphate buffered saline solutions, water, and emulsions such as oil/water emulsions and microemulsions.
- excipients such as urea or mesna can be included to improve stability.
- Other excipients include bulking agents, buffering agents, tonicity modifiers, surfactants, preservatives and co-solvents.
- suitable pharmaceutically acceptable excipients include, but are not limited to, starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like.
- suitable pharmaceutically acceptable excipients include, but are not limited to, water, glycols, oils, alcohols, flavoring agents, preservatives, and the like.
- suitable excipients include, but are not limited to a cream, a cellulosic or oily base, emulsifying agents, stiffening agents, rheology modifiers or thickeners, surfactants, emollients, preservatives, humectants, alkalizing or buffering agents, and solvents.
- Suitable excipients for the formulation of the foam base include, but are not limited to, propylene glycol, emulsifying wax, cetyl alcohol, and glyceryl stearate.
- Potential preservatives include methylparaben and propylparaben.
- compositions of the present disclosure can take the form of solutions, suspensions, emulsion, tablets, pills, pellets, capsules, capsules containing liquids, powders, sustained-release formulations, suppositories, tampon applications emulsions, aerosols, sprays, suspensions, lozenges, troches, candies, injectants, chewing gums, ointments, smears, a time- release patches, a liquid absorbed wipes, and combinations thereof.
- compositions of the present disclosure or pharmaceutically acceptable forms thereof may be topical, i.e., the pharmaceutical composition is applied directly where its action is desired, or systemic.
- systemic administration can be enteral or oral, i.e., substance is given via the digestive tract, parenteral, i.e., substance is given by other routes than the digestive tract such as by injection or inhalation.
- the bacteriocin polypeptides of the present disclosure can be administered to a subject orally, parenterally, by inhalation, topically, rectally, nasally, buccally or via an implanted reservoir or by any other known method.
- the bacteriocin polypeptides of the present disclosure can also be administered by means of sustained release dosage forms.
- the bacteriocin polypeptides of the present disclosure can be formulated into solid or liquid preparations, for example tablets, capsules, powders, solutions, suspensions and dispersions.
- the compound can be formulated with excipients such as, e.g., lactose, sucrose, corn starch, gelatin, potato starch, alginic acid and/or magnesium stearate.
- a bacteriocin polypeptide of the present disclosure is mixed with a pharmaceutical excipient to form a solid preformulation composition.
- tablets may be sugar coated or enteric coated by standard techniques.
- the tablets or pills may be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action.
- the tablet or pill can include an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former.
- the two components can be separated by enteric layer, which serves to resist disintegration in the stomach and permit the inner component to pass intact into the duodenum or to be delayed in release.
- enteric layers or coatings such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol, and cellulose acetate.
- the bacteriocin of the present disclosure may also be administered by injection of a therapeutic agent comprising the appropriate amount of bacteriocin polypeptide and a carrier.
- a therapeutic agent comprising the appropriate amount of bacteriocin polypeptide and a carrier.
- the bacteriocin polypeptides can be administered intramuscularly, intrathecally, subdermally, subcutaneously, or intravenously.
- the carrier may be comprised of distilled water, a saline solution, albumin, a serum, or any combinations thereof.
- compositions of parenteral injections can comprise pharmaceutically acceptable aqueous or nonaqueous solutions of bacteriocin polypeptides in addition to one or more of the following: pH buffered solutions, adjuvants (e.g., preservatives, wetting agents, emulsifying agents, and dispersing agents), liposomal formulations, nanoparticles, dispersions, suspensions or emulsions, as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use.
- adjuvants e.g., preservatives, wetting agents, emulsifying agents, and dispersing agents
- liposomal formulations e.g., nanoparticles, dispersions, suspensions or emulsions, as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use.
- an isotonic formulation is preferably used.
- additives for isotonicity can include sodium chloride, dextrose, mannitol, sorbitol, and lactose.
- isotonic solutions such as phosphate buffered saline are preferred.
- Stabilizers can include gelatin and albumin.
- a vasoconstriction agent can be added to the formulation.
- the pharmaceutical preparations according to this type of application are provided sterile and pyrogen free.
- the diluent may further comprise one or more other excipient such as, e.g., ethanol, propylene glycol, an oil or a pharmaceutically acceptable emulsifier or surfactant.
- excipient such as, e.g., ethanol, propylene glycol, an oil or a pharmaceutically acceptable emulsifier or surfactant.
- compositions of the present disclosure are inhalable compositions.
- the inhalable compositions of the present disclosure can further comprise a pharmaceutically acceptable carrier.
- bacteriocin polypeptide(s) of the present disclosure are advantageously formulated as a dry, inhalable powder.
- bacteriocin polypeptides inhalation solution may further be formulated with a propellant for aerosol delivery.
- solutions may be nebulized.
- a surfactant can be added to an inhalable pharmaceutical composition of the present disclosure in order to lower the surface and interfacial tension between the medicaments and the propellant.
- a surfactant may or may not be required.
- a surfactant may or may not be necessary, depending in part, on the solubility of the particular medicament and excipient.
- the surfactant may be any suitable, non-toxic compound which is non-reactive with the medicament and which substantially reduces the surface tension between the medicament, the excipient and the propellant and/or acts as a valve lubricant.
- Suitable surfactants include, but are not limited to: oleic acid; sorbitan trioleate; cetyl pyridinium chloride; soya lecithin; polyoxyethylene(20) sorbitan monolaurate; polyoxy ethylene (10) stearyl ether; poly oxy ethylene (2) oleyl ether; poly oxypropylene-polyoxy ethylene ethylene diamine block copolymers; polyox yethylene(20) sorbitan monostearate; polyoxyethylene(20) sorbitan monooleate; polyoxypropylene- polyoxyethylene block copolymers; castor oil ethoxylate; and combinations thereof.
- Suitable propellants include, but are not limited to: dichlorodifluoromethane, trichlorofluoromethane, dichloro-tetrafluoroethane and carbon dioxide.
- excipients for use in inhalable compositions include, but are not limited to: lactose, starch, propylene glycol diesters of medium chain fatty acids; triglyceride esters of medium chain fatty acids, short chains, or long chains, or any combination thereof; perfluorodimethylcyclobutane; perfluorocyclobutane; polyethylene glycol; menthol; lauro glycol; diethylene glycol monoethylether; polyglycolized glycerides of medium chain fatty acids; alcohols; eucalyptus oil; short chain fatty acids; and combinations thereof.
- compositions of the present disclosure comprise nasal applications.
- Nasal applications include for instance nasal sprays, nasal drops, nasal ointments, nasal washes, nasal injections, nasal packings, bronchial sprays and inhalers, or indirectly through use of throat lozenges, mouthwashes or gargles, or through the use of ointments applied to the nasal nares, or the face or any combination of these and similar methods of application.
- compositions of the present disclosure contain a complementary agent, including one or more antimicrobial agents, one or more conventional antibiotics, and/or one or more anti-inflammatory agents.
- the therapeutic agent containing one or more bacteriocin polypeptides of the present disclosure may further include at least one complementary agent which can also potentiate the bactericidal activity of the bacteriocin polypeptide.
- the complementary agent may be one or more antibiotics.
- the pharmaceutical compositions of the present disclosure comprise an anti -Prevotella bacteriocin comprising an amino acid sequence that is at least 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably an anti -Prevotella bacteriocin comprising or consisting of the amino acid sequence of SEQ ID NO: 3.
- Examples 1 and 2 demonstrate that Lmo2776 reduces the amount of Prevotella in the human gut microbiota.
- Example 3 demonstrates that Lmo2776 is a bona fide bacteriocin that targets directly P. copri in an in vitro assay. Accordingly, this disclosure provides methods of inhibiting growth of Prevotella and/or methods of reducing Prevotella load.
- this invention also provides methods of inhibiting growth of Prevotella, comprising contacting Prevotella with an anti -Prevotella bacteriocin.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti- Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3.
- the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 80%.
- the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 90%.
- the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 95%. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 99%.
- This invention also provides methods of inhibiting growth of Prevotella in a subject, comprising administering an anti -Prevotella bacteriocin to the subject.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti- Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3.
- the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 80%.
- the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 90%.
- the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 95%. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 99%.
- This invention also provides methods of reducing the Prevotella load in a subject, comprising administering an anti -Prevotella bacteriocin to the subject.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti- Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3.
- the anti -Prevotella bacteriocin is in an amount sufficient to reduce the Prevotella load by at least 80%.
- the anti -Prevotella bacteriocin is in an amount sufficient to reduce the Prevotella load by at least 90%.
- the anti- Prevotella bacteriocin is in an amount sufficient to reduce the Prevotella load by at least 95%. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the Prevotella load by at least 99%. In some embodiments the Prevotella load in the gut microbiota of a subject is reduced. In some embodiments the Prevotella load in the lung microbiota of a subject is reduced. In some embodiments the Prevotella load in an organ or another compartment of a subject is reduced. In some embodiments the Prevotella load in at least one first compartment of a subject is reduced while the Prevotella load in at least one first compartment of a subject is not reduced.
- said Prevotella is Prevotella copri.
- Prevotella bacteria are associated with inflammation. As shown in Example 5, the presence of Prevotella in the intestine is associated with a thinner mucus layer and increased levels of faecal Lipocalin-2 (LCN-2). These results indicate that Prevotella is a bacterium promoting a pro-inflammatory phenotype. Thus, the identification in this disclosure of anti- Prevotella bacteriocin provides a new and useful reagent for treating and/or preventing inflammation and diseases having an inflammation component. Thus, this invention provides methods of treating and/or preventing inflammation in a subject.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti- Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3.
- the subject has or is at risk of developing an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, HIV infection and lung disorders, in particular cytic fibrosis.
- administration of the anti- Prevotella bacteriocin to the subject reduces inflammation in the subject.
- the reduction in inflammation results in treatment and/or prevention of an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, HIV infection and lung disorders, in particular cystic fibrosis in the subject.
- an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, HIV infection and lung disorders, in particular cystic fibrosis in the subject.
- the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80% in the subject.
- an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, HIV infection and lung disorders, in particular cystic fibrosis in a subject
- administering an anti -Prevotella bacteriocin comprising administering an anti -Prevotella bacteriocin to the subject.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti- Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3.
- administration of the anti -Prevotella bacteriocin to the subject reduces inflammation in the subject.
- the reduction in inflammation results in treatment and/or prevention of an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, HIV infection and lung disorders, in particular cystic fibrosis in the subject.
- an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, HIV infection and lung disorders, in particular cystic fibrosis in the subject.
- the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80% in the subject.
- said Prevotella is Prevotella copri.
- Example 4 demonstrates that the ability of the D lmo2776 mutant to better grow in the intestine compared to the WT is dependent on the presence of Prevotella in the microbiota of the intestine, as it is observed either in conventional mice or mice colonized with P. copri.
- Example 5 demonstrates that the presence of Prevotella in the intestine is associated with a thinner mucus layer and increased levels of faecal Lipocalin-2 (LCN-2). These results indicate that Prevotella is a bacterium promoting a pro-inflammatory phenotype. These results also strongly indicate that P. copri, by modifying the mucus layer thickness and changing the gut inflammatory condition, promotes infection. This suggests that people with high abundance of intestinal Prevotella are at risk for enteropathogens infection.
- this invention provides methods of treating and/or preventing an enteropatho genic bacterial infection in a subject.
- this invention also provides methods of treating or preventing an enteropathogenic bacterial infection in a subject, comprising administering an anti -Prevotella bacteriocin to the subject.
- the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
- the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3.
- the subject has or is at risk of developing an Listeria infection.
- the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load of the subject by at least 80%.
- said Prevotella is Prevotella copri.
- Bacterial strains and plasmids For standard experiments, Lm EGD-e, E. coli and B. subtilis were grown at 37°C with shaking in Brain Heart Infusion (BHI) medium (Difco) and Luria-Bertani (LB) medium (BD). If needed, Lm were selected on Oxford medium (Oxoid).
- BHI Brain Heart Infusion
- LB Luria-Bertani
- P. copri DSM 18205
- B. thetaiotamicron CIP 104206T, CRB Institut Pasteur
- the Lmo2776 deletion mutant was constructed using the pMAD shuttle plasmid (22) as described previously (23) and confirmed by DNA sequencing.
- pAD-based plasmid fragment obtained by PCR with EGD-e genomic DNA as template, was cloned into the Smal/Sall sites of the pAD vector (24) derived previously from the pPL2 vector (25). Plasmid was verified by sequencing with primers pPL2-Rv and pPL2-Fw and were transformed into A lmo2776 by electroporation. Integration in the chromosome was verified by PCR using primers NC16 and PL95 (24).
- mice 9- to 12-week-old female B ALB/C conventional (Charles River), C57BL6/J conventional (Charles River), C57BL6/J germfree (CDTA or Pasteur) or Oligo- Mouse-Microbiota (Oligo MM12) C57BL6/J (Brugiroux el ah, Nature Microbiology, 2016, 16131) wild-type mice were used for experiments. Germfree mice were housed in plastic gnotobiotic isolators.
- mice infection Lm overnight cultures were diluted in BHI and bacteria were grown to an optical density at 600 nm (OD600) of 1. Bacterial cultures were centrifuged at 3,500 x g for 15 min and washed three times in phosphate-buffered saline (PBS). Mice were infected orally with 5 x 10 9 bacteria diluted in 200 pl of PBS supplemented with 300 m ⁇ of CaC03 (50 mg/ml). Serial dilutions of the inoculum were plated to control the number of bacteria inoculated.
- PBS phosphate-buffered saline
- mice were killed at subsequent time points, and intestines, mesenteric lymph nodes, spleens, and livers were removed.
- the small intestine was opened, and the luminal content was recovered in a l.5-mL tube and weighed.
- the small intestine (duodenum, jejunum, and ileum) tissue was washed four times in DMEM (ThermoFisher), incubated for 2 h in DMEM supplemented with 40 pg/mL gentamycin, and finally washed three four in DMEM.
- DMEM ThermoFisher
- mice were infected with 5 x 10 bacteria diluted in lOOul of PBS. Mice were killed at subsequent time points, and spleens, and livers were removed and processed as described above.
- mice colonisation P. copri, P. salivae and B. thetaiotamicron were grown to log phase under anaerobic conditions in M20 liquid media and 107 CFU were used to inoculate mice. Feces were collected at 2 weeks post-gavage to confirm colonization. Feces were homogenized, serially diluted and plated on M20 agar plates
- Fecal microbiota analysis by 16S rRNA gene sequencing using Illumina technology Before infection, 8 BAFB/c conventional mice were co-housed for 5 weeks in order to stabilize and homogenize their microbiota. After oral infection, animals were single- housed. Feces were collected and frozen at -20°C. 16S rRNA gene amplification and sequencing were done using the Illumina MiSeq technology following the protocol of Earth Microbiome Project with their modifications to the MOBIO PowerSoil DNA Isolation Kit procedure for extracting DNA (www.earthmicrobiome.org/emp-standard-protocols) (27, 28).
- 16S rRNA gene sequence analysis Analysis of the 16S rRNA gene sequence was performed exactly as previously described (29).
- M-SHIME M-SHIME system is a dynamic in vitro model which simulates the lumen-associated and mucus-associated human intestinal microbial ecosystem (ProDigest, Ghent University, Belgium) (30-32). It consists of consecutive pH-controlled, stirred, airtight, double-jacketed glass vessels kept at 37°C and under anaerobic conditions. The system was operated as described earlier (33) with minor modifications The set-up used here consisted of 3 stomach-small intestine vessels and nine proximal colon vessels in parallel. The colon vessels were inoculated at the start with 40 mL fresh human faecal suspension in 500 mL sterile nutritional medium.
- RNA extraction and qRT A total of 25 ml cultures of bacteria (Fm in stationary phase or Fm in exponential phase) was grown in medium (BHI, FB or M20) overnight. Cultures were subsequently pelleted for 20 min at 3000g. Pellets were resuspended in 1 ml TRI Reagent (Sigma), transferred to 2-ml Fysing Matrix tubes (MP Biomedicals) and mechanically lysed by bead beating in a FastPrep apparatus (twice 45s, speed 6.5). Tubes were then centrifuged for 5 min at 8000g at 4°C to separate beads from lysates. The lysates were drawn off and transferred to a 2-ml Eppendorf tube.
- RNA pellets were resuspended in 50 to 100 uF water. For each sample, 10 ug of RNA was treated with Dnase (Turbo DNA-free, Ambion) following manufacturer’s instructions.
- cDNA was synthetiszed from 1 ug of RNA using QuantiTect Reverse Transcription (Qiagen) and reactions were subsenquently diluted with 180 ul of water. qRT-PCR reactions were prepared with SYBR Green master mix. Reaction cycling and quantification was carried out in an Cl 000 touch Thermal cycler (CFX384, Biorad). Expression levels were normalized to the rpoB gene. Samples were evaluated in triplicate and results represent at least three independent experiments.
- Co-culture assays For co-culture assays, 10 bacteria from overnight cultures were inoculated into 5 mF of fresh BHI either in single culture or in coculture with another strain as indicated in the figures and incubated at 37°C for 6 hours. Serial dilutions were plated on selective media for CFU enumeration. [0097] For culture of target in presence of Listeria supernatant, 25 ml of overnight culture of Listeria were centrifuged at l3000g and the supernatants were collected and centrifuged further to remove cells and cells debris. Supernatants were filtered through a
- Lmo2776 (SEQ ID NO : 3) was prepared by solid-phase synthesis (Polypeptide Group) with a purity of more than 95 %. The molecular weight of the peptide was confirmed by mass spectrometry (7402.5 ES+).
- Example 1 Lmo2776 limits Listeria intestinal colonization and virulence in a microbiota-dependent manner
- Lmo2776 is predicted to be a secreted bacteriocin of 107 amino acids (36, 38), belonging to the bacteriocin 972 family, which contains bacteriocins secreted by Lactococcus lactis (39) and also by pathogenic Streptococcus pneumoniae, Staphylococcus aureus and Streptococcus iniae (Figure 5C).
- Bacteriocin of the lactococcin 972 family are cleaved following a GG motif to the mature form, indicating that Lmo2776 mature form is predicted to be a peptide of 63 amino acids (SEQ ID NO: 3).
- Lmo2776 shares between 38 to 47% overall sequence similarity with the other members of the bacteriocin 972 family.
- Lmo2774 and Lmo2775 have sequence similarity with ABC transporters and immunity proteins of the related bacteriocin 972 family members, respectively.
- the Almo2776 strain displayed significantly higher bacterial loads in the small intestinal content compared to the WT strain at 24h, 48h and 72h post-infection (Figure 6B). No difference was observed between the growth curves of the Almo2776 strain and the wild-type in vitro in BHI medium, indicating that lmo2776 deletion does not affect bacterial growth (Figure 6D). Similar differences were observed in C57BL/6J mice (data not shown). Altogether, these data indicate a key role for Lmo2776 in bacterial growth in the intestine and deeper organs. The higher number of Almo2776 strain in the spleen and the liver directly correlate with the high number of bacteria in the intestinal content, crossing the intestinal barrier and consequently reaching deeper organs such as the spleen and the liver.
- Example 2 Lmo2776 specifically targets Prevotella in mouse and human microbiota
- the increased levels in the Firmicutes were mainly due to an increase of the Clostridia class (relative abundance before infection: 27.4% and at day 1 post-infection: 50.7%).
- the relative abundance of Tisteria was around 0.1% and cannot therefore explain by itself the increased levels of Firmicutes observed between day 0 and day 1.
- microbial community compositions of the intestine differed in mice orally infected with the A lmo2776 strain compared to the WT strain ( Figure 2A and 11).
- Prevotella abundance is known to be low in the mouse feces (less than 1%) and can reach up to 50 % in the human feces (41, 42).
- M-SHIME® a mucosal simulator of the human intestinal microbial ecosystem. This ex vivo model allows to stably maintain a human microbiota in vitro, in the absence of host cells (30-33). The microbiota of a healthy human volunteer with high levels of Prevotella was inoculated into the system, which was then infected with WT or D lmo2776 bacteria.
- short-chain fatty acid levels serve as a general read-out for gut microbiota metabolism.
- propionate is produced by many bacteria
- the decrease in propionate production observed during infection of M- SHIME® with WT Listeria is in agreement with the decrease in Prevotella population, as Prevotella are known to produce this short chain fatty acid (43).
- Example 3 Lmo2776 targets P. copri in vitro
- Example 4 Colonization of germ-free mice by P. copri recapitulates the effect of the microbiota on Listeria intestinal growth in conventional mice
- P. copri P. salivae
- B. thetaiotaomicron another commensal bacterium
- a mixture of 12 bacteria including V errucom i crobi a (A. muciniphila YL44), Bacteroidetes (B. caecimuris 148, M. intestinale YL27), Proteobacteria CL. muris YL45), Actinobacteria (B. longum YL2), Fimi cutes (E. faecalis KB1; A. muris KB 18; C.
- Example 5 P. copri modifies the intestinal environment
- Mucus in the intestine of conventional animals forms a physical barrier of about 30pm that is able to keep bacteria at a distance from the epithelium (45).
- Prevotella through production of sulfatases that induce actively mucus degradation (46), might impair the mucosal barrier function and therefore contribute to local inflammation and better accessibility to intestinal epithelial cells for pathogens.
- faecal LCN-2 levels of faecal LCN-2 are used as a marker of intestinal inflammation (47). Faecal LCN-2 levels were thus analysed after colonization of germ-free mice with P. copri compared to non-colonized mice or mice colonized with B. thetaiotaomicron. A significant increase of faecal LCN-2 was observed in germ-free mice monocolonized with P. copri compared to non-colonised animals or to animals monocolonized with B. thetaiotaomicron ( Figure 4E), revealing that P. copri induces intestinal inflammation. Altogether, these results showed that presence of Prevotella in the intestine is associated with a thinner mucus layer and increased levels of faecal LCN-2. They are consistent with previous reports describing Prevotella, as a bacterium promoting a pro-inflammatory phenotype (i, 4, 48).
- mice germ-free C57BT/6J mice were inoculated orally with P. copri, P. salivae or B. thetaiotaomicron, two weeks later mice were orally infected with WT Listeria or D lmo2776 strains and mucus layer thickness was compared 72h post-infection.
- the average distance of bacteria from colonic epithelial cells was significantly smaller in P. copri colonized mice infected with D lmo2776 compared to P. copri colonized mice infected with WT Listeria at 72h ( Figure 4D), non- colonised animals or to animal monocolonized with B. thetaiotaomicron or P. salivae, showing that Prevotella decreases specifically the mucus layer thickness.
- Example 6 Lmo2776 peptide inhibits P. copri growth in vitro and in vivo
- Tmo2776 peptide of SEQ ID NO: 3 was synthesized and tested in vitro and in vivo. In vitro, Tmo2776 peptide inhibits Prevotella copri growth in a dose dependent manner and has no effect on the growth of B. thetaiotaomicron ( Figure 3G). Tmo2776 peptide also inhibits B. subtilis growth but has no effect on the growth of other Prevotella strains, intestinal bacteria or Tactic acid bacteria (IPTA) ( Figure 3H). In addition, conventional mice treated with Tmo2776 peptide displayed significantly lower number of P. copri in the feces compared to untreated mice ( Figure 3J).
- Tmo2776 peptide is also capable of inhibiting the growth of various P. copri isolates from Rheumatoid arthritis (RA) patients ( Figure 31). These results confirm that Tmo2776 is a bona fide bacteriocin that targets directly both P. copri and B. subtilis in vitro and in vivo. These results show the therapeutic potential of Tmo2776 peptide in the treatment of inflammatory diseases and enteropathogenic bacterial infections.
- Listeriolysin S decreases Allobaculum and Alloprevotella genera known to produce butyrate or acetate, two SCFAs reported to inhibit transcription of virulence factors or growth of Listeria (50, 51).
- LLS Listeriolysin S
- a direct or an indirect role on these genera is still under investigation.
- Salmonella enterica serovar Typhimurium infection killing of intestinal Klebsiella oxytoca via the Salmonella T6SS is essential for colonisation of the murine gut (52), but whether K. oxytoca and other members of the gut microbiota are targeted by the Salmonella T6SS in conventional mice is unknown.
- Shigella sonnei uses a T6SS to outcompete E. coli in vivo but the effectors responsible for this effect are unknown (53).
- B. thetaiotaomicron enhances Clostridium rodentium colonization by producing succinate (54, 55) and Akkermansia muciniphila exacerbates S. 1 y phi mu rium - i nduccd intestinal inflammation by disturbing host mucus homeostasis (5b).
- P. copri decreases the mucus layer thickness and increases propionate concentration and levels of fecal LCN-2 ( Figure 4F), in agreement with previous studies reporting that Prevotella exacerbates inflammation (4, 48).
- Prevotella enrichment within the lung microbiome of HIV-infected patients has been observed and is associated with Thl7 inflammation (57).
- Lmo2776 bacteriocin targets B. subtilis, a Gram positive bacterium found in the soil, suggesting that Lmo2776 could give an advantage to Listeria in the environment.
- B. subtilis is also found in the human gastrointestinal tract (60) and could also be targeted by Lmo2776 in the intestine.
- B. subtilis is also targeted by Sil, another member of the bacteriocin 972 family (44).
- the role of the homologs of bacteriocin 972 in other human pathogenic bacteria such as S. pneumoniae and S. aureus remains to be determined.
- the conservation of the bacteriocin in different pathogenic bacteria strongly suggests an important role.
- Lmo2776 bacteriocin against Prevotella was confirmed using a synthetic Lmo2776 peptide.
- Lmo2776 peptide inhibits Prevotella copri growth in vitro and in vivo in conventional mouse microbiota.
- Lmo2776 peptide is capable of inhibiting the growth of P. copri isolates from Rheumatoid arthritis patients.
- Faecalibacterium prausnitzii a commensal bacterium deficient in Crohn's disease. Gut 65, 415- 425 (2016).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Communicable Diseases (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Organic Chemistry (AREA)
- Oncology (AREA)
- Molecular Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Methods of reducing Prevotella load in a subject, treating or preventing inflammation in a subject, and treating or preventing an enteropathogenic bacterial infection in a subject, comprising administering an anti-Prevotella bacteriocin to the subject. Pharmaceutical compositions comprising an anti-Prevotella bacteriocin and a pharmaceutically acceptable carrier.
Description
A i-PREVOTELLA BACTERIOCIN METHODS AND COMPOSITIONS
BACKGROUND
[0001] Prevotella is classically considered as a bacterial commensal due to its presence in several locations of the healthy human body including the oral cavity, gastrointestinal tract, urogenital tract and skin (1). The Prevotella genus encompasses more than 40 different culturable species of which three, P. copri, P salivae and P. stercorea, can be isolated from the gut. Only a few strains have been reported to be associated with opportunistic infections, e.g. periodontitis or bacterial vaginosis (1). Prevotella has been described as the major genus of one of the three reported human enterotypes (2). How Prevotella behaves in different gut ecosystems and how it interacts with other bacteria of the microbiota and/or with its host is still elusive. In addition, high levels of genomic diversity within Prevotella strains of the same species have been observed (3), which adds another layer of complexity for predicting the effects of Prevotella strains. Strikingly, recent studies have linked higher intestinal abundance of P. copri to rheumatoid arthritis (4), metabolic disorders, low-grade systemic inflammation (5) and inflammatory conditions in the context of human immunodeficiency virus (HIV) ( 6 , 7), suggesting that some Prevotella strains may trigger and/or worsen human inflammatory diseases (i, 8).
[0002] The microbiota plays a central role in protecting the host from pathogens (9). For example, in the case of Listeria monocytogenes, the foodborne pathogen responsible for listeriosis, the intestinal microbiota provides protection, as germfree mice are more susceptible to bacterial infection than conventional mice (10, 11). Unravelling the interactions between the host, the microbiota and pathogenic bacteria is critical for the design of new therapeutic strategies via manipulation of the microbiota. However, identifying the specific molecules and the mechanisms used by the commensals to elicit their beneficial action is challenging due to the high complexity of the microbiomes, together with technical issues such as unculturability of many commensal species. In addition, cooperative interactions between commensals species are likely to be central to the functioning of the gut microbiota (12). So far, the mechanism
underlying the impact of commensals on the host has been elucidated only for a few species. Segmented filamentous bacteria (SFB) were shown to coordinate maturation of T cell responses towards Thl7 cell induction (13, 14). Glycosphingolipids produced by the common intestinal symbiont Bacteroides fragilis have been found to regulate homeostasis of host intestinal natural killer T cells (15). A polysaccharide A (PSA) also produced by B. fragilis induces and expands 11-10 producing CD4+ T cells (16-18). Finally, the microbial anti-inflammatory molecule (MAM) secreted by Faecalibacterium prausnitzii impairs the nuclear-factor (NF)-KB pathway (19).
[0003] Conversely, enteric pathogens have developed various strategies to outcompete other species in the intestine and access nutritional and spatial niches, leading to successful infection (20, 21). In this regard, the contribution of bacteriocins and type VI secretion systems effectors during pathogen colonisation of the gut is an emerging field of investigation.
[0004] The recent linkage of Prevotella with inflammatory diseases demonstrates the need in the art for compositions and methods useful to reduce the prevalence of Prevotella in subjects. This invention meets this and other needs.
[0005] The citation of references in this application shall not be construed as an admission that such references are relevant or that they constitute prior art to the present disclosure.
SUMMARY OF THE INVENTION
[0006] The examples presented herein demonstrate the inventor’s discovery that Lmo2776 targets Prevotella and reduces its abundance in the microbiota of both the mouse and human. This effect is direct and specific as (i) Prevotella are killed by Listeria culture supernatant (containing Lmo2776) in vitro and (ii) despite the complexity of the microbiota and its well-controlled equilibrium, no other genus of the intestinal microbiota was found to decrease in the presence of Lmo2776. The examples further demonstrate that the Lmo2776 bacteriocin targets B. subtilis, a Gram-positive bacterium found in the soil, suggesting that Lmo2776 could give an advantage to Listeria in the environment. B. subtilis is also found in the human gastrointestinal tract (60) and could also be targeted by Lmo2776 in the intestine. The
antibacterial effect of the Lmo2776 bacteriocin against Prevotella was confirmed using a synthetic Lmo2776 peptide. Lmo2776 peptide inhibits Prevotella copri growth in vitro and in vivo in conventional mouse microbiota. In particular, Lmo2776 peptide is capable of inhibiting the growth of P. copri isolates from Rheumatoid arthritis patients. These results show the therapeutic potential of Lmo2776 peptide in the treatment of inflammatory diseases and enteropathogenic bacterial infections.
[0007] In a first aspect, this invention provides methods of treating or preventing inflammation in a subject, comprising administering an anti -Prevotella bacteriocin to the subject. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1. In some embodiments the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3. In some embodiments the subject has or is at risk of developing an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, and HIV infection. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80%.
[0008] In another aspect, this invention provides methods of treating or preventing an enteropathogenic bacterial infection in a subject, comprising administering an anti -Prevotella bacteriocin to the subject. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1. In some embodiments the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3. In some embodiments the subject has or is at risk of developing an Listeria infection. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80%.
[0009] In another aspect, this invention provides methods of reducing the Prevotella load of a subject by at least 80%, comprising administering an anti -Prevotella bacteriocin to the subject. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at
least 80% identical to SEQ ID NO: 1. In some embodiments the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80%. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 90%. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 99%. In some embodiments the Prevotella load is reduced in the gut microbiota of the subject.
[0010] In another aspect, this invention provides pharmaceutical compositions comprising an anti -Prevotella bacteriocin and a pharmaceutically acceptable carrier. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1. In some embodiments the the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3.
[0011] In another aspect, this invention provides pharmaceutical compositions comprising an anti -Prevotella bacteriocin and a pharmaceutically acceptable carrier for use in treating or preventing inflammation in a subject. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1. In some embodiments the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3. In some embodiments the subject has or is at risk of developing an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, and HIV infection. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80%.
[0012] In another aspect, this invention provides pharmaceutical compositions comprising an anti -Prevotella bacteriocin and a pharmaceutically acceptable carrier for use in treating or preventing an enteropathogenic bacterial infection in a subject. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some
embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1. In some embodiments the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 3. In some embodiments the subject has or is at risk of developing an Listeria infection. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80%.
[0013] In another aspect, this invention provides pharmaceutical compositions comprising an anti -Prevotella bacteriocin and a pharmaceutically acceptable carrier for use in reducing the Prevotella load of a subject. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to SEQ ID NO: 1. In some embodiments the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1 SEQ ID NO: 2 or SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin reduces the Prevotella load by at least 80%. In some embodiments the anti -Prevotella bacteriocin reduces the Prevotella load by at least 90%. In some embodiments the anti -Prevotella bacteriocin reduces the Prevotella load by at least 99%.
[0014] In some preferred embodiments of the above methods, pharmaceutical composition and uses thereof, said anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3.
[0015] In some embodiments of the above methods, pharmaceutical composition and uses thereof, said Prevotella is Prevotella copri.
BRIEF DESCRIPTION OF THE DRAWINGS
[0016] Figures 1A to IF: Lmo2776 limits Listeria virulence in a microbiota- dependent manner.
(A-C) BALB/c mice were inoculated orally with 5xl09 Listeria WT, D lmo2776 or Lmo2776 complemented ( p2776 ) bacteria. CFUs in the intestinal luminal content (A), the spleen (B) and the liver (C) were assessed at 72h post-infection.
(D-F) Germ-free C57BL/6J were infected with 5x109 Listeria WT or D lmo2776 for 72h and CFUs in the intestinal luminal content (D), the spleen (E) and the liver (F) were assessed. Each dot represents the value for one mouse. Statistically significant differences were evaluated by the Mann- Whitney test. (*p< 0.05).
[0017] Figures 2A to 2D: Lmo2776 targets Prevotella in mouse microbiota.
(A) Principal coordinates analysis of the weighted Unifrac distance matrix of mice infected with WT strain (black) or Almo2776 (grey) at day 0 (top), day 1 (middle) and day 2 (bottom). Permanova: at day 0 P=0.332,at day 1 P=0.063 and at day 2 P= P=0.366.
(B) Relative abundance of 12 OTUs in gut microbiota of mice infected with WT or Almo2776 strains at day 0,day 1 and day 2. Each dot represents the value for one mouse.
(C) Heat-map analysis of the relative abundance of 12 OTUs in gut microbiota of mice infected with WT or Almo2776 strains at day 0 , day 1 and day 2. Each column represents one mouse. The white and black shades indicate low and high abundance.
(D) Phylogenetic tree of 16S rRNA gene alignment of 5 representative bacteria for each phylum of the bacteria domain, together with OTUs showing significantly different relative abundances in gut microbiota of mice infected with WT or Almo2776 strains at day 1. The 12 OTUs with an increased abundance in Almo2776- infected mice compare to Listeria WT- infected mice are shown in grey and Prevotella genus is indicated in dashed line.
[0018] Figures 3A to 3J: Lmo2776 targets P. copri in human microbiota and in vitro.
(A) Principal coordinates analysis of the weighted Unifrac distance matrix of SHIME® vessels infected with WT or Almo2776 strains or non-infected () at day 0 (left) and day 1 (right). Permanova: at day 0 P=0.947 and at day 1 P=0.403.
(B) Relative abundance of genera in SHIME® vessels non-infected or infected with WT or Almo2776 strains at day 0 (left) and day 1 (right). The four more abundant genera are indicated.
(C) Relative abundance of 8 different OTUs in SHIME® vessels infected with WT or Almo2776 strains or non-infected at 24h relative to their abundance at day 0.
(D) Levels of propionate in SHIME® vessels infected with WT (dashed line) or Almo2776 (grey) strains or non-infected (black) overtime. Results are expressed as mean ± SEM for 2 to 3 individual vessels.
(E-F) Numbers of P. copri (E), B. subtilis or E. coli (F) after incubation with supernatant of WT ( Lm ) or Almo2776 strains. Results are expressed as mean ± SEM of a least 3 independent experiments and P-values were obtained using two-tailed unpaired Student’s t-test (*p<0.05, ***p<0.005).
(G) Relative abundance of P. copri (in white) or Bacteroides thetaiotaomicron (in black) after 24h incubation with increasing dose of Lmo2776 peptide (+ =16.5 pg, ++=33 pg and +++ =49.5 pg) relative to their abundance without Lmo2776 peptide. Results are expressed as mean + SEM of a least 3 independent experiments and P-values were obtained using two- tailed unpaired Student’s t-test (**r<0.01, ***p<0.005).
(H) Relative abundance of bacteriocin 972 family targets including B. subtilis ; various intestinal bacteria and various Prevotella strains including P. copri after incubation with the lowest concentration of Lmo2776 peptide (16.5 pg) used in (G) (in gray) or no peptide (in black). Results are expressed as mean + SEM of a least 3 independent experiments and P-values were obtained using two-tailed unpaired Student’s t-test (*p<0.05).
(I) Relative abundance of P. copri isolates from different Rheumatoid arthritis (RA) patients after 24h incubation with Lmo2776 peptide (16.5 pg; in gray) or no peptide (in black). Results are expressed as mean + SEM of a least 3 independent experiments and P-values were obtained using two-tailed unpaired Student’s t-test (*p<0.05).
(J) Relative abundance of P. copri in the feces of mice injected intrarectally with Lmo2776 peptide (1 mg in 100 pL of ¾0) or I E0 (100 pL) at 4 hours post-injection. Each dot represents the value for one mouse.
[0019] Figures 4A to 4F: P. copri controls Listeria infection.
(A) Assessment of listerial CFUs in the intestinal luminal content of germ-free (GF) C57BL/6J mice colonized or not with P. copri, B. thetaiotamicron or P. salivae for 2 weeks and then infected with L. monocytogenes WT or D lmo2776 for 72h. (B) Numbers of P. copri CFUs in the intestinal luminal content of GF C57BL/6J mice colonized with P. copri and then infected with Listeria WT or Almo2776 for 72h.
(C) Distances of closest bacteria to intestinal epithelial cells per condition over 5 high- powered fields per mouse, with each dot representing a measurement.
(D) Germ- free (GF) C57BL/6J mice colonized or not with 108 P. copri, B. thetaiotamicron or P. salivae for 2 weeks were then infected with 5xl09 L. monocytogenes WT or Almo2776 for 72h. Distances of closest bacteria to intestinal epithelial per condition over 5 high-powered fields per mouse Each dot represents one measurement.
(E) Levels of the inflammatory marker Lcn-2 in faeces of mice 2 weeks post-inoculation with P. copri or B. thetaiotamicron. (F) Model depicting the effect of Prevotella on Listeria infection.
In A, B and E, each dot represents one mouse. Statistically significant differences were evaluated by the Mann- Whitney test (A), one way-ANOVA test (C and D) or two-tailed unpaired Student’s t-test (B and E) (*p< 0.05, ***p<0.005).
[0020] Figures 5A to 5C: Presence of lmo2776 in L. monocytogenes strains and homologies with members of the Lactococcin 972 family.
(A) Schematic representation of Listeria monocytogenes (WT) genome showing a locus comprising Imo 2776. Absence of Imo 2776 locus in the non-pathogenic L. innocua strain CLIP 111262. Deletion of Imo 2776 in the Almo2776 mutant.
(B) Cluster analysis based on core genome multilocus sequence typing (cgMLST) profiles of 1,096 genomes (61) and pattern of Imo2774-lmo2775-lmo2776 genes presence (dark) or absence (white). The ten most frequent sublineages (SL) are highlighted. The last column corresponds to the sample source, represented by colour codes (upper left key).
(C) Amino acid alignment of Lmo2776 with members of the Lactococcin 972 family: L82330 from Lactococcus lactis subsp. lactis 111403, SP_0l09 bacteriocin from Streptococcus pneumoniae TIGR4, SAP109 from Staphylococcus aureus subsp. aureus N315, lcn972 bacteriocin 972 from Lactococcus lactis subsp. lactis and Sil from Streptococcus iniae SF. The conserved residues and consensus motif are indicated in Lmo2776 and on the bottom, respectively.
[0021] Figures 6A to 6F. Effect of lmo2776 on Listeria infection.
(A) Relative expression of lmo2774, lmo2775 and lmo2776 in bacteria grown in stationary phase (white bars) compared to bacteria grown in exponential phase (black bars). The transcripts levels were normalised to the levels of rpoB, which were constant under all conditions, and then expressed relative to those of exponential phase. Results are expressed as mean ± SEM of a least 3 independent experiments and P-values were obtained using two-tailed unpaired Student’s t-test (*p<0.05).
(B) BALB/c mice were inoculated orally with 5xl09 Listeria WT or A lmo2776 strains. CFUs in the intestinal luminal were assessed at 24h, 48h and 72h post-infection.
(C) Relative expression of lmo2774, lmo2775 and lmo2777 in Listeria WT (in black) and A lmo2776 (in gray) strains grown in stationary phase.
(D) Growth curve of Listeria WT (in black) and A lmo2776 (in gray) strains.
(E) BALB/c mice were inoculated intraveinously with 5xl09 Listeria WT or A lmo2776 strains. CFUs in the the spleen were assessed at 72h post-infection.
(F) BALB/c mice were inoculated intraveinously with 5xl09 Listeria WT or A lmo2776 strains. CFUs in the liver were assessed at 72h post-infection.
[0022] Figures 7A to 7E: Effect of Listeria infection on mouse microbiota.
(A) Principal coordinates analysis of the weighted Unifrac distance matrix of conventional mice at day 0 (red) and infected with WT strain at day 1 (blue). Permanova P= 0.002. (B) Relative abundance of classes in conventional mice at day 0 (left) and infected with
WT strain at day 1 (right).
(C) LEfSE and (D) histogram of the LDA scores computed for features differentially abundant between microbiota of mice at day 0 (red) and infected with WT strain at day 1 (green). (E) Firmicutes/Bacteroides ratio in microbiota of mice at day 0 and infected with WT strain at day 1. Each dot represents the value for one mouse.
[0023] Figures 8A to 8D: OTUs targeted by Lmo2776 are closely related to Prevotella genus.
(A) Section of phylogenetic tree presented in Figure 2D. OTUs of interest are indicated in red.
(B) LEfSE and (C) histogram of the LDA scores computed for features differentially abundant between microbiota of mice infected with WT (green) or A lmo2776 (red) strains at day 1 post-infection.
(D) Quantification of Prevotella (pg/mg) in the feces of conventional mice at day 0 and orally inoculated with 5xl09 Listeria WT or A lmo2776 strains at day 1. Figures 9A to 9D: Production of butyrate, isobutyrate, acetate and iso valerate is not modified by Lmo2776. Levels of butyrate (A), isobutyrate (B), acetate (C) and isovalerate (D) in SHIME® vessels infected with WT (dashed line) or A lmo2776 (grey) strains or non-infected (black) overtime. Results are expressed as mean ± SEM for 2 to 3 individual vessels.
[0024] Figures 10A to 10B: Lm secretes a bona fide bacteriocin targeting B. subtilis.
Numbers of B. subtilis (A) and of different Lm strains (B) were quantified after 6h of co-culture. Results are expressed as mean ± SEM of a least 3 independent experiments and P-values were obtained using two-tailed unpaired Student’s t-test (***p<0.005.
[0025] Figures 11: Lmo2776 targets Prevotella in mouse microbiota. Relative abundance of OTU 355746, OTU 216524, OTU 421792, OTU 258849, OTU 331772, OTU 346870, OTU 430197, OTU 447141, OTU 465433, OTU 208409, OTU 353012, OTU 364179 in gut microbiota of mice infected with WT or Almo2776 strains at day 0, day 1 and day 2. Each dot represents the value for one mouse.
[0026] Figures 12A to 12C: P. copri controls Listeria infection. Assessment of listerial CFUs in the intestinal luminal content (A), spleen (B) and liver (C) of germ-free (GF) C57BL/6J mice colonized or not with a mixture of 12 bacteria including V errucom i crobi a (A. muciniphila YL44), Bacteroidetes (B. caecimuris 148, M. intestinale YL27), Proteobacteria CL. muris YL45), Actinobacteria (B. longum YL2), Fimicutes (E. faecalis KB1 ; A. muris KB18; C. clostridioforme YF32) and Firmicutes (F. plautii YF31; B. coccoides YF58; L. reuteri 149 and C. innnocuum 146) for 2 weeks and then infected with L. monocytogenes WT or D lmo2776 for 72h.
DETAILED DESCRIPTION OF THE INVENTION A. Definitions
[0027] Certain terms are defined in this section. Definitions of other terms are provided at locations throughout this disclosure.
[0028] The term“treatment” refers to any process, action, application, therapy, or the like, wherein a subject, including a human being, is subjected to medical aid with the object of curing a disorder, or eradicating a pathogen, or improving the subject's condition, directly or indirectly. Treatment also refers to reducing incidence, or alleviating symptoms, eliminating recurrence, preventing recurrence, preventing incidence, improving symptoms, improving prognosis or combinations thereof.
[0029] The term“preventing” includes the reducing the incidence, recurrence, spread, onset or establishment of a disorder such as a bacterial infection. It is not intended that the present disclosure be limited to complete prevention or to prevention of establishment of an infection. In some embodiments, the onset is delayed, or the severity of a subsequently contracted disease is reduced, and such constitute examples of prevention.
[0030] The term “percent amino acid sequence identity” with respect to the anti- Prevotella bacteriocin polypeptide sequences is defined herein as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific anti -Prevotella bacteriocin polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for example, using publicly available software such as BTAST or Megalign (DNASTAR) software.
[0031] The term“subject” refers to a subject to be treated and includes inter alia mammals, e.g., humans, dogs, cows, horses, pigs, sheep, goats, cats, mice, rabbits, rats, and transgenic non-human animals. In certain embodiments, the subject is a human.
[0032] The phrase “inhibiting growth” in reference to Prevotella refers to any mechanism that reduces the accumulation of Prevotella cells in an area over time. For example, any mechanism that causes Prevotella cells in a culture to accumulate at a slower rate than Prevotella cells in a control culture, or any mechanism that that causes Prevotella cells in an in vivo context (e.g., gut microbiota, lung microbiota) to accumulate at a slower rate than Prevotella cells in a control. In this context “inhibiting” includes without limitation mechanisms reducing the rate of cell division and induction of cell death such as by cell lysis.
[0033] The term“ Prevotella load” refers to a measurable quantity of bacteria in an object, organism, or organism compartment. In some embodiments the Prevotella load is determined at least in part by measuring the proportion of total bacteria present that are viable Prevotella.
B. Anti -Prevotella Bacteriocins
[0034] Bacteriocins are proteinaceous or peptidic toxins produced by bacteria to inhibit the growth of similar or closely related bacterial strain(s). They are similar to yeast and paramecium killing factors, and are structurally, functionally, and ecologically diverse.
[0035] As used herein an“anti -Prevotella bacteriocin” is a bacteriocin that inibits the growth of P. copri in an in vitro culture. An exemplary assay is demonstrated in Example 3. In that assay bacteriocin is obtained by culturing L. monocytogenes Lmo2776 and collecting the supernatant of the culture that comprises bacteriocin. P. copri is then grown at 37°C in anaerobic conditions in the presence of the supernatant. A skilled artisan will appreciate that the assay may be adapted to use bacteriocin from any suitable source at a defined concentration in the culture media.
[0036] In an exemplary assay a candidate bacteriocin is added to culture media at a concentration of from 10 nM to 80 mM and the effect of the candidate bacteriocin on growth of P. copri colonies is measured. In some embodiments a candidate bacteriocin that inhibits the growth of P. copri colonies when present in culture media at a concentration within this concentration range is identified as a anti -Prevotella bacteriocin. In some embodiments a candidate bacteriocin that inhibits the growth of P. copri colonies when present in culture media at a concentration of from 10 nM to 100 nM is identified as a anti -Prevotella bacteriocin. In some embodiments a candidate bacteriocin that inhibits the growth of P. copri colonies when present in culture media at a concentration of from 100 nM to ImM is identified as a anti- Prevotella bacteriocin. In some embodiments a candidate bacteriocin that inhibits the growth of P. copri colonies when present in culture media at a concentration of from ImM to 10 pM is identified as a anti -Prevotella bacteriocin. In some embodiments a candidate bacteriocin that inhibits the growth of P. copri colonies when present in culture media at a concentration of from 10 pM to 80 pM is identified as a anti -Prevotella bacteriocin.
[0037] In some embodiments of this invention the anti -Prevotella bacteriocin is an L. monocytogenes bacteriocin. In some embodiments the anti -Prevotella bacteriocin is L.
monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes EGD-e Lmo2776, which has the following sequence:
MKKKVCVLAIALLTVLSPMGALAAQNLNEGETSLDSLMSANKTGEKVIFS ETTTGKKPLLKAAOSAGGGTFWVTWGODRHYSNYOHTKKTHRSSASNYRA TERSSWKAKNNLATAWIKSSLWGNKANWATK (SEQ ID NO: 1)
[0038] In some embodiments the anti -Prevotella bacteriocin is a fragment of L. monocytogenes EGD-e Lmo2776. For example, in some embodiments the anti -Prevotella bacteriocin is a fragment of L. monocytogenes EGD-e Lmo2776 from which the signal peptide has been cleaved. Bacteriocin of the lactococcin 972 family are cleaved following a GG motif (positions 67-68 of SEQ ID NO: 1; underlined) to the mature form. Thus, in some embodiments the fragment comprises or consists of the following sequence:
ONLNEGETSLDSLMSANKTGEKVIFSETTTGKKPLLKAAOSAGGGTFWVT WGQDRHYSNYQHTKKTHRSSASNYRATERSSWKAKNNLATAWIKSSLWGN KANWATK (SEQ ID NO: 2)
[0039] In some embodiments the fragment comprises or consists of the following sequence:
GTFWVTWGQDRHYSNYQHTKKTHRSSASNYRATERSSWKAKNNLATAWIK SSLWGNKANWATK (SEQ ID NO: 3)
[0040] In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 70% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 75% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 85% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 90% identical to a
sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 91% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 92% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 93% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 94% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 95% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 96% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 97% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 98% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 98% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 1. In some embodiments the anti -Prevotella bacteriocin consists of the amino acid sequence of SEQ ID NO: 1. In some embodiments the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 2. In some embodiments the anti -Prevotella bacteriocin consists of the amino acid sequence of SEQ ID NO: 2. In some embodiments the anti -Prevotella bacteriocin comprises the amino acid sequence of SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin consists of the amino acid sequence of SEQ ID NO: 3.
[0041] In some preferred embodiments, the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97% or 98% identical to SEQ ID NO: 3. In some more preferred embodiments, the anti- Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3.
[0042] The invention encompasses variants of L. monocytogenes Lmo2776 including natural and synthetic variants thereof. Natural variants are found in the various serotypes, strains and isolates of L. monocytogenes. Synthetic variants can be made from any one of SEQ ID NO: 1, 2, and 3 by routine techniques in the art and screened for activity (i.e. anti-Prevotella bacteriocin activity) using the assays described herein such as the exemplary assay disclosed in Example 3 or other similar assays.
[0043] Bacteriocins may be produced using any suitable reagents and methods known in the art. In some embodiments, a bacteriocin-producing strain of bacteria is cultured and the bacteriocin is recovered from the culture. In come embodiments the bacteriocin is recovered by collecting culture media from the culture and then optionally purifying the bacteriocin from the culture media. In some embodiments the bacteriocin-producing strain is a Listeria strain. In some embodiments the bacteriocin-producing strain is an E coli strain.
[0044] In an exemplary embodiment for producing bacteriocins, lmo2776 was cloned in pGEX4Tl plasmid and the recombinant plasmid transformed into E. coli BL2l(DE3) Gold competent cells (Novagen). The bacteria were grown at 37°C up to an OD of 0.7-0.8 and expression of GST-Lmo2776 was induced with 0.6 mM IPTG at l6°C for l6h prior to collection of cell pellets by centrifugation. Cells were resuspended in 20 mM Tris pH 8.5, 150 mM NaCl, 1 mM DTT and lysed by sonication or by passage through a French press. Soluble fractions were recovered from cell debris by ultracentrifugation at 40,000g and subsequently incubated with glutathione-Sepharose beads for 2h at 4°C. Beads were washed with PBS and 40 mM Tris, lOOmM NaCl, pH 8.0. Lmo2776 was then cleaved with thrombin, dialysed in 40 mM Tris, pH7.4 and concentrated using Amicon-lO filter devices (Millipore). Protein was flash frozen in liquid nitrogen and stored at -80°C. Skilled artisans will be aware that variations on this method may also be used.
[0045] In another exemplary embodiment for producing bacteriocins, Lmo2776 peptide as defined above is synthesized using standard peptide synthesis methods that are well-known in the art such as for example solid-phase synthesis methods.
C. Pharmaceutical Compositions
[0046] Also provided are pharmaceutical compositions comprising an anti -Prevotella bacteriocin and a pharmaceutically acceptable carrier. In some embodiments, the pharmaceutical composition is a solution, a suspension, an emulsion, an inhalable powder, an aerosol, or a spray. In some embodiments, the pharmaceutical composition further comprises one or more antibiotics suitable for the treatment of bacterial infection. In some embodiments, the pharmaceutical composition further comprises one or more antibiotics suitable for the treatment of Gram-negative and/or Gram-positive bacterial infection. In some embodiments, the pharmaceutical composition further comprises one or more antibiotics suitable for the treatment of Gram-negative bacterial infection. In some embodiments, the pharmaceutical composition further comprises one or more anti-inflammatory agents for the treatment of inflammation.
[0047] The term“pharmaceutically acceptable carrier” includes any and all solvents, additives, excipients, dispersion media, solubilizing agents, coatings, preservatives, isotonic and absorption delaying agents, surfactants, propellants and the like that are physiologically compatible. The carrier(s) must be“acceptable” in the sense of not being deleterious to the subject to be treated in amounts typically used in medicaments. Pharmaceutically acceptable carriers are compatible with the other ingredients of the composition without rendering the composition unsuitable for its intended purpose. Furthermore, pharmaceutically acceptable carriers are suitable for use with subjects as provided herein without undue adverse side effects (such as toxicity, irritation, and allergic response). Side effects are“undue” when their risk outweighs the benefit provided by the composition. Non-limiting examples of pharmaceutically acceptable carriers or excipients include any of the standard pharmaceutical carriers such as phosphate buffered saline solutions, water, and emulsions such as oil/water emulsions and microemulsions.
[0048] For solid compositions comprising a lyophilized bacteriocin polypeptide, excipients such as urea or mesna can be included to improve stability. Other excipients include bulking agents, buffering agents, tonicity modifiers, surfactants, preservatives and co-solvents.
[0049] For solid oral compositions comprising a bacteriocin, suitable pharmaceutically acceptable excipients include, but are not limited to, starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like.
[0050] For liquid oral compositions, suitable pharmaceutically acceptable excipients include, but are not limited to, water, glycols, oils, alcohols, flavoring agents, preservatives, and the like.
[0051] For topical solid compositions such as creams, gels, foams, ointments, or sprays, suitable excipients include, but are not limited to a cream, a cellulosic or oily base, emulsifying agents, stiffening agents, rheology modifiers or thickeners, surfactants, emollients, preservatives, humectants, alkalizing or buffering agents, and solvents.
[0052] Suitable excipients for the formulation of the foam base include, but are not limited to, propylene glycol, emulsifying wax, cetyl alcohol, and glyceryl stearate. Potential preservatives include methylparaben and propylparaben.
[0053] The compositions of the present disclosure can take the form of solutions, suspensions, emulsion, tablets, pills, pellets, capsules, capsules containing liquids, powders, sustained-release formulations, suppositories, tampon applications emulsions, aerosols, sprays, suspensions, lozenges, troches, candies, injectants, chewing gums, ointments, smears, a time- release patches, a liquid absorbed wipes, and combinations thereof.
[0054] Administration of the compositions of the present disclosure or pharmaceutically acceptable forms thereof may be topical, i.e., the pharmaceutical composition is applied directly where its action is desired, or systemic. In turn, systemic administration can be enteral or oral, i.e., substance is given via the digestive tract, parenteral, i.e., substance is given by other routes than the digestive tract such as by injection or inhalation. Thus, the bacteriocin polypeptides of the present disclosure can be administered to a subject orally, parenterally, by inhalation,
topically, rectally, nasally, buccally or via an implanted reservoir or by any other known method. The bacteriocin polypeptides of the present disclosure can also be administered by means of sustained release dosage forms.
[0055] For oral administration, the bacteriocin polypeptides of the present disclosure can be formulated into solid or liquid preparations, for example tablets, capsules, powders, solutions, suspensions and dispersions. The compound can be formulated with excipients such as, e.g., lactose, sucrose, corn starch, gelatin, potato starch, alginic acid and/or magnesium stearate.
[0056] For preparing solid compositions such as tablets and pills, a bacteriocin polypeptide of the present disclosure is mixed with a pharmaceutical excipient to form a solid preformulation composition. If desired, tablets may be sugar coated or enteric coated by standard techniques. The tablets or pills may be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action. For example, the tablet or pill can include an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former. The two components can be separated by enteric layer, which serves to resist disintegration in the stomach and permit the inner component to pass intact into the duodenum or to be delayed in release. A variety of materials can be used for such enteric layers or coatings, such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol, and cellulose acetate.
[0057] The bacteriocin of the present disclosure may also be administered by injection of a therapeutic agent comprising the appropriate amount of bacteriocin polypeptide and a carrier. For example, the bacteriocin polypeptides can be administered intramuscularly, intrathecally, subdermally, subcutaneously, or intravenously. The carrier may be comprised of distilled water, a saline solution, albumin, a serum, or any combinations thereof. Additionally, pharmaceutical compositions of parenteral injections can comprise pharmaceutically acceptable aqueous or nonaqueous solutions of bacteriocin polypeptides in addition to one or more of the following: pH buffered solutions, adjuvants (e.g., preservatives, wetting agents, emulsifying agents, and dispersing agents), liposomal formulations, nanoparticles, dispersions, suspensions
or emulsions, as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use.
[0058] In cases where parenteral injection is the chosen mode of administration, an isotonic formulation is preferably used. Generally, additives for isotonicity can include sodium chloride, dextrose, mannitol, sorbitol, and lactose. In some cases, isotonic solutions such as phosphate buffered saline are preferred. Stabilizers can include gelatin and albumin. A vasoconstriction agent can be added to the formulation. The pharmaceutical preparations according to this type of application are provided sterile and pyrogen free.
[0059] The diluent may further comprise one or more other excipient such as, e.g., ethanol, propylene glycol, an oil or a pharmaceutically acceptable emulsifier or surfactant.
[0060] In another embodiment, the compositions of the present disclosure are inhalable compositions. The inhalable compositions of the present disclosure can further comprise a pharmaceutically acceptable carrier. In one embodiment, bacteriocin polypeptide(s) of the present disclosure are advantageously formulated as a dry, inhalable powder. In specific embodiments, bacteriocin polypeptides inhalation solution may further be formulated with a propellant for aerosol delivery. In certain embodiments, solutions may be nebulized.
[0061] A surfactant can be added to an inhalable pharmaceutical composition of the present disclosure in order to lower the surface and interfacial tension between the medicaments and the propellant. Where the medicaments, propellant and excipient are to form a suspension, a surfactant may or may not be required. Where the medicaments, propellant and excipient are to form a solution, a surfactant may or may not be necessary, depending in part, on the solubility of the particular medicament and excipient. The surfactant may be any suitable, non-toxic compound which is non-reactive with the medicament and which substantially reduces the surface tension between the medicament, the excipient and the propellant and/or acts as a valve lubricant.
[0062] Examples of suitable surfactants include, but are not limited to: oleic acid; sorbitan trioleate; cetyl pyridinium chloride; soya lecithin; polyoxyethylene(20) sorbitan monolaurate; polyoxy ethylene (10) stearyl ether; poly oxy ethylene (2) oleyl ether; poly
oxypropylene-polyoxy ethylene ethylene diamine block copolymers; polyox yethylene(20) sorbitan monostearate; polyoxyethylene(20) sorbitan monooleate; polyoxypropylene- polyoxyethylene block copolymers; castor oil ethoxylate; and combinations thereof.
[0063] Examples of suitable propellants include, but are not limited to: dichlorodifluoromethane, trichlorofluoromethane, dichloro-tetrafluoroethane and carbon dioxide.
[0064] Examples of suitable excipients for use in inhalable compositions include, but are not limited to: lactose, starch, propylene glycol diesters of medium chain fatty acids; triglyceride esters of medium chain fatty acids, short chains, or long chains, or any combination thereof; perfluorodimethylcyclobutane; perfluorocyclobutane; polyethylene glycol; menthol; lauro glycol; diethylene glycol monoethylether; polyglycolized glycerides of medium chain fatty acids; alcohols; eucalyptus oil; short chain fatty acids; and combinations thereof.
[0065] In some embodiments, the compositions of the present disclosure comprise nasal applications. Nasal applications include for instance nasal sprays, nasal drops, nasal ointments, nasal washes, nasal injections, nasal packings, bronchial sprays and inhalers, or indirectly through use of throat lozenges, mouthwashes or gargles, or through the use of ointments applied to the nasal nares, or the face or any combination of these and similar methods of application.
[0066] In another embodiment, the pharmaceutical compositions of the present disclosure contain a complementary agent, including one or more antimicrobial agents, one or more conventional antibiotics, and/or one or more anti-inflammatory agents.
[0067] .In order to accelerate the treatment of the infection, or augment the antibacterial effect, the therapeutic agent containing one or more bacteriocin polypeptides of the present disclosure may further include at least one complementary agent which can also potentiate the bactericidal activity of the bacteriocin polypeptide. The complementary agent may be one or more antibiotics.
[0068] In some preferred embodiments, the pharmaceutical compositions of the present disclosure comprise an anti -Prevotella bacteriocin comprising an amino acid sequence that is at
least 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably an anti -Prevotella bacteriocin comprising or consisting of the amino acid sequence of SEQ ID NO: 3.
D. Methods of Inhibiting Growth of Prevotella and Reducing Prevotella Load
[0069] Examples 1 and 2 demonstrate that Lmo2776 reduces the amount of Prevotella in the human gut microbiota. Example 3 demonstrates that Lmo2776 is a bona fide bacteriocin that targets directly P. copri in an in vitro assay. Accordingly, this disclosure provides methods of inhibiting growth of Prevotella and/or methods of reducing Prevotella load.
[0070] Accordingly this invention also provides methods of inhibiting growth of Prevotella, comprising contacting Prevotella with an anti -Prevotella bacteriocin. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some preferred the anti- Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 80%. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 90%. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 95%. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 99%.
[0071] This invention also provides methods of inhibiting growth of Prevotella in a subject, comprising administering an anti -Prevotella bacteriocin to the subject. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least
80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some preferred the anti- Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 80%. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 90%. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 95%. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the growth of Prevotella by at least 99%.
[0072] This invention also provides methods of reducing the Prevotella load in a subject, comprising administering an anti -Prevotella bacteriocin to the subject. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some preferred the anti- Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the Prevotella load by at least 80%. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the Prevotella load by at least 90%. In some embodiments the anti- Prevotella bacteriocin is in an amount sufficient to reduce the Prevotella load by at least 95%. In some embodiments the anti -Prevotella bacteriocin is in an amount sufficient to reduce the Prevotella load by at least 99%. In some embodiments the Prevotella load in the gut microbiota of a subject is reduced. In some embodiments the Prevotella load in the lung microbiota of a subject is reduced. In some embodiments the Prevotella load in an organ or another
compartment of a subject is reduced. In some embodiments the Prevotella load in at least one first compartment of a subject is reduced while the Prevotella load in at least one first compartment of a subject is not reduced.
[0073] In some embodiments of the above methods, said Prevotella is Prevotella copri.
E. Methods of Treating or Preventing Inflammation
[0074] Prevotella bacteria are associated with inflammation. As shown in Example 5, the presence of Prevotella in the intestine is associated with a thinner mucus layer and increased levels of faecal Lipocalin-2 (LCN-2). These results indicate that Prevotella is a bacterium promoting a pro-inflammatory phenotype. Thus, the identification in this disclosure of anti- Prevotella bacteriocin provides a new and useful reagent for treating and/or preventing inflammation and diseases having an inflammation component. Thus, this invention provides methods of treating and/or preventing inflammation in a subject.
[0075] Accordingly, also provided are methods of treating or preventing inflammation in a subject, comprising administering an anti -Prevotella bacteriocin to the subject. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some preferred the anti- Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3. In some embodiments the subject has or is at risk of developing an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, HIV infection and lung disorders, in particular cytic fibrosis. In some embodiments administration of the anti- Prevotella bacteriocin to the subject reduces inflammation in the subject. In some embodiments the reduction in inflammation results in treatment and/or prevention of an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, HIV
infection and lung disorders, in particular cystic fibrosis in the subject. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80% in the subject.
[0076] Accordingly, also provided are methods of treating or preventing an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, HIV infection and lung disorders, in particular cystic fibrosis in a subject, comprising administering an anti -Prevotella bacteriocin to the subject. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti- Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some preferred the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3. In some embodiments administration of the anti -Prevotella bacteriocin to the subject reduces inflammation in the subject. In some embodiments the reduction in inflammation results in treatment and/or prevention of an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, HIV infection and lung disorders, in particular cystic fibrosis in the subject. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80% in the subject.
[0077] In some embodiments of the above methods, said Prevotella is Prevotella copri.
F. Methods of Treating or Preventing Enteropathogenic Bacterial Infection
[0078] Example 4 demonstrates that the ability of the D lmo2776 mutant to better grow in the intestine compared to the WT is dependent on the presence of Prevotella in the microbiota of the intestine, as it is observed either in conventional mice or mice colonized with P. copri. Example 5 demonstrates that the presence of Prevotella in the intestine is associated with a thinner mucus layer and increased levels of faecal Lipocalin-2 (LCN-2). These results
indicate that Prevotella is a bacterium promoting a pro-inflammatory phenotype. These results also strongly indicate that P. copri, by modifying the mucus layer thickness and changing the gut inflammatory condition, promotes infection. This suggests that people with high abundance of intestinal Prevotella are at risk for enteropathogens infection. Thus, this invention provides methods of treating and/or preventing an enteropatho genic bacterial infection in a subject.
[0079] Accordingly, this invention also provides methods of treating or preventing an enteropathogenic bacterial infection in a subject, comprising administering an anti -Prevotella bacteriocin to the subject. In some embodiments the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some embodiments the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3. In some preferred the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% or 98% identical to SEQ ID NO: 3; preferably the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3. In some embodiments the subject has or is at risk of developing an Listeria infection. In some embodiments the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load of the subject by at least 80%.
[0080] In some embodiments of the above methods, said Prevotella is Prevotella copri.
EXAMPLES Materials and Methods
[0081] The following materials and methods were used in performing the examples that follow.
[0082] Bacterial strains and plasmids: For standard experiments, Lm EGD-e, E. coli and B. subtilis were grown at 37°C with shaking in Brain Heart Infusion (BHI) medium (Difco) and Luria-Bertani (LB) medium (BD). If needed, Lm were selected on Oxford medium (Oxoid). P. copri (DSM 18205) and B. thetaiotamicron (CIP 104206T, CRB Institut Pasteur) were grown
in M20 medium at 37°C under anaerobic conditions (Genbag Anaer, Biomerieux or AnaeroGen, ThermoScientific). The Lmo2776 deletion mutant was constructed using the pMAD shuttle plasmid (22) as described previously (23) and confirmed by DNA sequencing. For the construction of pAD-based plasmid, fragment obtained by PCR with EGD-e genomic DNA as template, was cloned into the Smal/Sall sites of the pAD vector (24) derived previously from the pPL2 vector (25). Plasmid was verified by sequencing with primers pPL2-Rv and pPL2-Fw and were transformed into A lmo2776 by electroporation. Integration in the chromosome was verified by PCR using primers NC16 and PL95 (24).
[0083] Mice: 9- to 12-week-old female B ALB/C conventional (Charles River), C57BL6/J conventional (Charles River), C57BL6/J germfree (CDTA or Pasteur) or Oligo- Mouse-Microbiota (Oligo MM12) C57BL6/J (Brugiroux el ah, Nature Microbiology, 2016, 16131) wild-type mice were used for experiments. Germfree mice were housed in plastic gnotobiotic isolators.
[0084] All animal experiments were carried out in strict accordance with the French national and European laws and conformed to the Council Directive on the approximation of laws, regulations, and administrative provisions of the Member States regarding the protection of animals used for experimental and other scientific purposes (86/609/Eec). Experiments that relied on laboratory animals were performed in strict accordance with the Institut Pasteur's regulations for animal care and use protocol, which was approved by the Animal Experiment Committee of the Institut Pasteur (approval no. 03-49)
[0085] Mice infection: Lm overnight cultures were diluted in BHI and bacteria were grown to an optical density at 600 nm (OD600) of 1. Bacterial cultures were centrifuged at 3,500 x g for 15 min and washed three times in phosphate-buffered saline (PBS). Mice were infected orally with 5 x 109 bacteria diluted in 200 pl of PBS supplemented with 300 mΐ of CaC03 (50 mg/ml). Serial dilutions of the inoculum were plated to control the number of bacteria inoculated.
[0086] Mice were killed at subsequent time points, and intestines, mesenteric lymph nodes, spleens, and livers were removed. The small intestine was opened, and the luminal
content was recovered in a l.5-mL tube and weighed. The small intestine (duodenum, jejunum, and ileum) tissue was washed four times in DMEM (ThermoFisher), incubated for 2 h in DMEM supplemented with 40 pg/mL gentamycin, and finally washed three four in DMEM. All of the organs and the intestinal luminal content were homogenized, serially diluted, and plated onto BHI plates or Oxford plates and grown overnight at 37 °C for 48-72 h. CFU were enumerated to assess bacterial load. At least three independent experiments were carried out with four or five mice per group in each experiment. Statistically significant differences were evaluated by the Mann- Whitney test, and differences were considered statistically significant when P values were <0.05.
[0087] In case of intra-veinous infection, mice were infected with 5 x 10 bacteria diluted in lOOul of PBS. Mice were killed at subsequent time points, and spleens, and livers were removed and processed as described above.
[0088] For mice colonisation, P. copri, P. salivae and B. thetaiotamicron were grown to log phase under anaerobic conditions in M20 liquid media and 107 CFU were used to inoculate mice. Feces were collected at 2 weeks post-gavage to confirm colonization. Feces were homogenized, serially diluted and plated on M20 agar plates
[0089] Fecal microbiota analysis by 16S rRNA gene sequencing using Illumina technology: Before infection, 8 BAFB/c conventional mice were co-housed for 5 weeks in order to stabilize and homogenize their microbiota. After oral infection, animals were single- housed. Feces were collected and frozen at -20°C. 16S rRNA gene amplification and sequencing were done using the Illumina MiSeq technology following the protocol of Earth Microbiome Project with their modifications to the MOBIO PowerSoil DNA Isolation Kit procedure for extracting DNA (www.earthmicrobiome.org/emp-standard-protocols) (27, 28). Bulk DNA were extracted from frozen extruded feces using a PowerSoil DNA Isolation kit (MoBio Faboratories) with mechanical disruption (bead-beating). The 16S rRNA genes, region V4, were PCR amplified from each sample as described in Chassaing el al., 2015 (29). Four independent PCRs were performed for each sample, combined, purified with Ampure magnetic purification beads (Agencourt), and products were visualized by gel electrophoresis. Products were then quantified (BIOTEK Fluorescence Spectrophotometer) using Quant-iT PicoGreen
dsDNA assay. A master DNA pool was generated from the purified products in equimolar ratios. The pooled products were quantified using Quant-iT PicoGreen dsDNA assay and then sequenced using an Illumina MiSeq sequencer (paired-end reads, 2 x 250 bp) at Cornell University (Ithaca, USA).
[0090] 16S rRNA gene sequence analysis : Analysis of the 16S rRNA gene sequence was performed exactly as previously described (29).
[0091] Qualification of bacteria in feces : after DNA extraction, quantitative PCR were performed using SYBR Green master mix and primers specific to Prevotella. Reaction cycling and quantification was carried out in an Cl 000 touch Thermal cycler (CFX384, Biorad) using known amounts of Prevotella DNA as standard. Expression levels were normalized to the 16S gene. Samples were evaluated in triplicate and results represent at least three independent experiments.
[0092] M-SHIME: M-SHIME system is a dynamic in vitro model which simulates the lumen-associated and mucus-associated human intestinal microbial ecosystem (ProDigest, Ghent University, Belgium) (30-32). It consists of consecutive pH-controlled, stirred, airtight, double-jacketed glass vessels kept at 37°C and under anaerobic conditions. The system was operated as described earlier (33) with minor modifications The set-up used here consisted of 3 stomach-small intestine vessels and nine proximal colon vessels in parallel. The colon vessels were inoculated at the start with 40 mL fresh human faecal suspension in 500 mL sterile nutritional medium. Every 2 days, half of the mucin agar-covered microcosms were replaced by fresh sterile ones under a flow of N2 to prevent disruption of anaerobic conditions. Fourteen days after inoculation, 3 colon vessels were infected with 106 WT bacteria , 3 colon vessels with 106 Almo2776 and 3 were left uninfected. Lumen (10 ml) and mucin agar samples were taken at 6, 24, 48 and 72h. Mucin agar-covered microcosms were washed with sterile PBS to remove lumen bacteria. Mucin agar was removed from microcosms, homogenised and stored immediately at -20°C until further analysis.
[0093] For 16S rRNA Gene Sequencing, DNA was extracted from 1 ml of lumen samples or 250 mg of mucin agar samples using a PowerSoil DNA Isolation kit and 16S rRNA
gene sequencing was analysed as decribed above. Our full 16S rRNA gene sequence data are deposited under Study ID YYYY in the QIIME-DB database (http://www.microbio.me/qiime/).
[0094] For SCFA analysis, lumen samples were diluted 1:2 in demineralized water. Acetate, propionate, butyrate, isobutyrate and isovalerate were extracted and quantified as described (34).
[0095] RNA extraction and qRT: A total of 25 ml cultures of bacteria (Fm in stationary phase or Fm in exponential phase) was grown in medium (BHI, FB or M20) overnight. Cultures were subsequently pelleted for 20 min at 3000g. Pellets were resuspended in 1 ml TRI Reagent (Sigma), transferred to 2-ml Fysing Matrix tubes (MP Biomedicals) and mechanically lysed by bead beating in a FastPrep apparatus (twice 45s, speed 6.5). Tubes were then centrifuged for 5 min at 8000g at 4°C to separate beads from lysates. The lysates were drawn off and transferred to a 2-ml Eppendorf tube. 200 uF chloroform was added to the lysate, shaken and incubated 10 min at room temperature, followed by centrifugation for 15 min at 13 OOOg at 4°C. The aqueous phase was transferred to a new tube and RNA was precipitated by the addition of 500 uF isopropanol and incubation at room temperature for 10 min. RNA was pelleted by centrifuging for 10 min at 13000 g at 4°C, washed twice with 75% ethanol. RNA pellets were resuspended in 50 to 100 uF water. For each sample, 10 ug of RNA was treated with Dnase (Turbo DNA-free, Ambion) following manufacturer’s instructions. cDNA was synthetiszed from 1 ug of RNA using QuantiTect Reverse Transcription (Qiagen) and reactions were subsenquently diluted with 180 ul of water. qRT-PCR reactions were prepared with SYBR Green master mix. Reaction cycling and quantification was carried out in an Cl 000 touch Thermal cycler (CFX384, Biorad). Expression levels were normalized to the rpoB gene. Samples were evaluated in triplicate and results represent at least three independent experiments.
[0096] Co-culture assays: For co-culture assays, 10 bacteria from overnight cultures were inoculated into 5 mF of fresh BHI either in single culture or in coculture with another strain as indicated in the figures and incubated at 37°C for 6 hours. Serial dilutions were plated on selective media for CFU enumeration.
[0097] For culture of target in presence of Listeria supernatant, 25 ml of overnight culture of Listeria were centrifuged at l3000g and the supernatants were collected and centrifuged further to remove cells and cells debris. Supernatants were filtered through a
g
0.20um pore size filter. 10 bacterial targets were inoculated into 2.5 ml of listerial supernatant and 2.5 ml of fresh medium at 37°C. At l6h after inoculation, cultures were serially diluted and plated on selective media.
[0098] Peptide synthesis: Lmo2776 (SEQ ID NO : 3) was prepared by solid-phase synthesis (Polypeptide Group) with a purity of more than 95 %. The molecular weight of the peptide was confirmed by mass spectrometry (7402.5 ES+).
[0099] Effect of the peptide: For in vitro experiments, 107 bacteria from overnight cultures were inoculated into 5 mL of fresh medium either in single culture or in presence of peptide as indicated in the figures and incubated at 37°C for 24 hours. Serial dilutions were plated on selective media for CFU enumeration. For in vivo experiments, conventional BALB/C mice were anaesthetized with an intraperitoneal injection of 65 mg ketamine kg -1 and 13 mg xylazine kg -1. Mice were inoculated intra-rectally with Lmo2776 peptide (1 mg in 100 ul of water) or water (100 ul). Feces were collected between 1 and 4h post-administration. After DNA extraction, levels of total bacteria and P. copri were quantified in feces by quantitative PCR as described above.
[00100] Immunostaining of mucins and localization of bacteria by FISH: Mucus immunostaining was paired with fluorescent in situ hybridization (FISH), as previously described (33, 35). Observations were performed with a Zeiss LSM 700 confocal microscope. The software Zen 2011 version 7.1 was used to measure the distance between bacteria and epithelial cell monolayer.
[00101] Quantification of fecal Lcn-2 by ELISA: Fecal samples were weighted, reconstituted in PBS-0.l% Tween 20 to a final concentration of 100 mg/mL and homogenized. Samples were then centrifuged for 10 min at 14 000 g and 4°C and supernatants were collected and stored at -20°C until analysis. Lcn-2 levels were measured using DuoSet mouse Lipocalin- 2/NGAL ELISA kit (R&D Systems).
[00102] Core genome MLST: cgMLST analysis was performed as previously described (53).
[00103] Statistical analysis: Statistical tests are reported and described in the figure legends. Differences denoted in the text as significant fall below a p-value of 0.05.
Example 1: Lmo2776 limits Listeria intestinal colonization and virulence in a microbiota-dependent manner
[00104] A recent reannotation of the genome of the Listeria strain EGD-e indicated the presence of three genes, lmo2774, lmo2775 and lmo2776, absent in the non-pathogenic L. innocua strain CLIP 11262 and potentially related to bacteriocin production and transport (36), (Figure 5A). This locus is present in Lineage I strains responsible for the majority of Listeria clinical cases (37) and in some Lineage II strains, such as EGD-e (Figure 5B). Conserved domain search indicated that Lmo2776 is predicted to be a secreted bacteriocin of 107 amino acids (36, 38), belonging to the bacteriocin 972 family, which contains bacteriocins secreted by Lactococcus lactis (39) and also by pathogenic Streptococcus pneumoniae, Staphylococcus aureus and Streptococcus iniae (Figure 5C). Bacteriocin of the lactococcin 972 family are cleaved following a GG motif to the mature form, indicating that Lmo2776 mature form is predicted to be a peptide of 63 amino acids (SEQ ID NO: 3). Lmo2776 shares between 38 to 47% overall sequence similarity with the other members of the bacteriocin 972 family. Lmo2774 and Lmo2775 have sequence similarity with ABC transporters and immunity proteins of the related bacteriocin 972 family members, respectively.
[00105] We observed that during EGD-e growth at 37 °C in BHI medium, expression of lmo2774, lmo2775 and lmo2776 genes significantly increases in stationary phase compared to exponential phase (Figure 6A). Expression of lmo2774 (upstream) and lmo2777 (downstream) genes in stationary and exponential phases were not significatively different in A lmo2776 strain compared to the wild type, indicating that lmo2776 deletion does not affect expression of the surrounding genes (Figure 6C). All experiments were thus conducted with Listeria grown up to stationary phase. We then examined lmo2776 expression in mice orally infected with Listeria. Upon inoculation of conventional BALB/c mice with a Listeria strain expressing a
chromosomal copy of the Lux operon under the control of the putative promoter region of lmo2776 (Lm p/mo2776:lux), a bioluminescent signal was detected in the abdomen of animals 3 days post-infection, indicating that Lmo2776 is expressed in vivo.
[00106] To elucidate the effect of Lmo2776 in vivo, we infected mice orally with either the WT, the Almo2776 or the Lmo2776 complemented strains and compared Listeria loads in the intestinal content and target organs 72h post-infection. The Almo2776 strain displayed significantly higher bacterial loads in the small intestinal content compared to the WT or to the Lmo2776 complemented strains (Figure 1A). The bacterial loads of D lmo2776 were also significantly higher in the spleen and liver at 72h post-infection compared to the WT and the Lmo2776 complemented strains (Figure IB and C). The Almo2776 strain displayed significantly higher bacterial loads in the small intestinal content compared to the WT strain at 24h, 48h and 72h post-infection (Figure 6B). No difference was observed between the growth curves of the Almo2776 strain and the wild-type in vitro in BHI medium, indicating that lmo2776 deletion does not affect bacterial growth (Figure 6D). Similar differences were observed in C57BL/6J mice (data not shown). Altogether, these data indicate a key role for Lmo2776 in bacterial growth in the intestine and deeper organs. The higher number of Almo2776 strain in the spleen and the liver directly correlate with the high number of bacteria in the intestinal content, crossing the intestinal barrier and consequently reaching deeper organs such as the spleen and the liver.
[00107] Upon intravenous infection of BALB/c mice with 5.10 bacteria, the bacterial loads at 72h post-infection of WT and Almo2776 were similar in the spleen (p=0.2854) and liver (p=0.224), indicating that Lmo2776 is only important for the intestinal phase of infection.
[00108] As lmo2776 is predicted to encode a bacteriocin and as we have shown that it plays a role in the intestinal phase of infection, we hypothesized that Lmo2776 could target intestinal bacteria and that this targeting of the intestinal microbiota was critical for Listeria virulence. We thus orally inoculated germ-free mice with WT and Almo2776 strains and compared bacterial burden loads at 72h post-infection. Strikingly, no significant difference was observed between WT and Almo2776 strains in the content of the small intestine (Figure ID),
nor in spleen and liver (Figure IE and F). These results strongly reveal that the Lmo2776 bacteriocin limits the virulence of wild-type Listeria in a microbiota-dependent manner.
Example 2: Lmo2776 specifically targets Prevotella in mouse and human microbiota
[00109] We compared the microbiota compositions of mice orally infected with WT or Almo2776 strains. We verified by 16S rRNA gene sequencing that the fecal microbiota composition of all mice was undistinguishable at day 0 (Figure 2A). As expected, the microbiota composition at day 1 post-infection was dramatically altered by infection with Listeria WT (Figure 7A). These alterations in microbiota composition included reduced levels of Bacteroidetes phylum (relative abundance before infection: 65.4% and at day 1 post infection: 42.4%) and increased levels of Firmicutes (relative abundance before infection: 29.9% and at day 1 post infection: 54.0%) (Figure 7B to E). The increased levels in the Firmicutes were mainly due to an increase of the Clostridia class (relative abundance before infection: 27.4% and at day 1 post-infection: 50.7%). Of note, the relative abundance of Tisteria was around 0.1% and cannot therefore explain by itself the increased levels of Firmicutes observed between day 0 and day 1. At 24h and 48h post-infection, microbial community compositions of the intestine differed in mice orally infected with the A lmo2776 strain compared to the WT strain (Figure 2A and 11). We focussed on operational taxonomic units (OTUs) for which the relative abundance was constant before the infection with Listeria strains (day -3 to day 0) and was at least 2 fold different at day 1 post-infection in mice infected with A/mo2776compared to mice infected with WT strain. We observed that the relative abundance of 12 operational taxonomic units (OTUs) was lower in mice infected with the WT strain compared to the A lmo2776 mutant (Figure 2B and C) (OTU 355746, 216524, 421792, 258849, 331772, , 346870, 430194, 447141, 465433, , 208409, 353012 and 364179). Phylogenetic analyses indicated that all these 12 OTUs belong to the Prevotella cluster (Figure 2D and 8A). The amount of Prevotella in feces was increased at day 1 post-infection in mice orally infected with A lmo2776 compared to mice infected with WT strain (Figure 8D). Tinear discriminant analysis (TDA) effect size (TEfSe) analysis (40) confirmed a positive association between A lmo2776 Listeria strain and Prevotella genus (Figure 8B and C), strongly suggesting that Tmo2776 targets Prevotella.
[00110] Important differences exist between mouse and human gut microbiota composition. Indeed, Prevotella abundance is known to be low in the mouse feces (less than 1%) and can reach up to 50 % in the human feces (41, 42). As Listeria is a human pathogen, we investigated the impact of Lmo2776 on human intestinal microbiota. For this purpose, we used the model M-SHIME®, a mucosal simulator of the human intestinal microbial ecosystem. This ex vivo model allows to stably maintain a human microbiota in vitro, in the absence of host cells (30-33). The microbiota of a healthy human volunteer with high levels of Prevotella was inoculated into the system, which was then infected with WT or D lmo2776 bacteria. Application of 16S sequencing to luminal M-SHIME® samples indicated that the bacterial composition of all vessels was similar before infection (Figure 3A and B). In contrast, at day 1 post-infection, microbial community compositions were different in vessels infected with the WT bacteria compared to non-inf ected vessels or vessels infected with the A lmo2776 strain (Figure 3A and B). The relative abundance of 8 OTUs (313121, 518820, 346938, 588929, New.0.ReferenceOTU20, 181539, 173565 and 89083) was lower with the WT strain compared to the non-infected condition or infection with the A lmo2776 strain (Figure 3C). These 8 OTUs correspond to Prevotella copri, revealing that Lmo2776 targets P. copri in human microbiota, in a host- independent manner.
[00111] Furthermore, short-chain fatty acid levels serve as a general read-out for gut microbiota metabolism. Analysis of luminal M-SHIME® samples indicated a specific decrease in propionate production upon infection with WT bacteria as early as 6h post-infection (Figure 3D) compared to non-infected and Almo2776-infected vessels. This difference was continuously observed up to 3 days post-infection, while no significant difference was observed for butyrate, isobutyrate, acetate and isovalerate (Figure 9). Although propionate is produced by many bacteria, the decrease in propionate production observed during infection of M- SHIME® with WT Listeria is in agreement with the decrease in Prevotella population, as Prevotella are known to produce this short chain fatty acid (43).
Example 3: Lmo2776 targets P. copri in vitro
[00112] We addressed the direct inhibitory activity of Lmo2776 on P. copri by growing P. copri at 37 °C in anaerobic conditions in the presence of culture supernatants of Listeria
strains and counting the viable CFUs on agar plates. Growth of P. copri dramatically decreased (up to 3 Log) in the presence of the WT strain supernatant compared to the Almo2776 strain supernatant (Figure 3E), demonstrating that Lmo2776 targets directly P. copri.
[00113] The effects of Listeria strains or that of their supernatants were also tested on the growth of other bacteria that might be encountered by Listeria in the environment. Growth of Bacillus subtilis was specifically and significantly reduced in the presence of WT Listeria and of p2776 strains compared to the Almo2776 strain (Figure 10). Moreover, addition of the culture supernatant of WT Listeria to B. subtilis significantly decreased the number of B. subtilis compared to the addition of Almo2776 culture supernatant (Figure 3F). Interestingly, B. subtilis is also targeted by the bacteriocin Sil, produced by the fish pathogen Streptococcus iniae, and a member of the bacteriocin 972 family, as Lmo2776 (44). No effect of the WT Listeria culture supernatant was observed on the growth of other tested bacteria, including E. coli (Figure 3F), Bacillus thuringiensis , different Staphylococcus aureus strains, S. epidermidis, Streptococcus carnosus, S. sanguinis, S. pneumoniae, Enterococcus faecalis, different Lactococcus lactis strains and L. monocytogenes 10403S. These results indicate that Lmo2776 is a bona fide bacteriocin that targets directly both P. copri and B. subtilis in vitro.
Example 4: Colonization of germ-free mice by P. copri recapitulates the effect of the microbiota on Listeria intestinal growth in conventional mice
[00114] To decipher the role of P. copri during Listeria infection in vivo, germ-free C57BL/6J mice were inoculated orally with P. copri, P. salivae, B. thetaiotaomicron, another commensal bacterium, or a mixture of 12 bacteria including V errucom i crobi a (A. muciniphila YL44), Bacteroidetes (B. caecimuris 148, M. intestinale YL27), Proteobacteria CL. muris YL45), Actinobacteria (B. longum YL2), Fimi cutes (E. faecalis KB1; A. muris KB 18; C. clostridioforme YL32) and Firmicutes (F. plautii YL31; B. coccoides YL58; L. reuteri 149 and C. innnocuum 146). Analysis of viable bacteria from fecal samples 2 weeks post-inoculation revealed robust intestinal colonization by each bacterium (data not shown). These mice were then orally infected with WT Listeria or A lmo2776 strains and bacterial loads in the intestinal content were compared 72h post-infection. The A lmo2776 strain displayed significantly higher loads in the intestinal content compared to the WT in mice colonized with P. copri (Figure 4A),
while no difference between the two strains was observed in mice monocolonized with B. thetaiotaomicron or P. salivae (Figure4A ), or colonized with the mixture of 12 bacteria
(Figure 12).
[00115] In addition, the number of P. copri significantly decreased in WT-infected animals compared to Almo2776- infected animals (Figure 4B). Altogether, these results indicate that the ability of the Almo2776 mutant to better grow in the intestine compared to the WT dependent on the presence of Prevotella in the microbiota, as it is observed either in conventional mice or mice colonized with P. copri.
Example 5: P. copri modifies the intestinal environment
[00116] Mucus in the intestine of conventional animals forms a physical barrier of about 30pm that is able to keep bacteria at a distance from the epithelium (45). Prevotella, through production of sulfatases that induce actively mucus degradation (46), might impair the mucosal barrier function and therefore contribute to local inflammation and better accessibility to intestinal epithelial cells for pathogens. To test this hypothesis, we compared the mucus layer thickness of conventional mice infected with WT Listeria or Almo2776 by confocal microscopy, using mucus-preserving Carnoy fixation and FISH (35). The average distance of bacteria from colonic epithelial cells was significantly smaller in mice infected with Almo2776 compared to mice infected with WT Listeria at 24 and 48h (Figure 4D), strongly suggesting that Prevotella present in the microbiota of mice infected with Almo2776 decreases the mucus layer thickness. Of note, these distances were also smaller than in uninfected mice, indicating that Listeria can affect the mucus layer thickness in different ways. Disruption of the mucosal barrier function by Prevotella could favour invasion of the host by pathogenic bacteria and contribute to intestinal inflammation. Lipocalin-2 (LCN-2) is a small secreted innate immune protein which is critical for iron homeostasis and which increases during inflammation. Levels of faecal LCN-2 are used as a marker of intestinal inflammation (47). Faecal LCN-2 levels were thus analysed after colonization of germ-free mice with P. copri compared to non-colonized mice or mice colonized with B. thetaiotaomicron. A significant increase of faecal LCN-2 was observed in germ-free mice monocolonized with P. copri compared to non-colonised animals or to animals monocolonized with B. thetaiotaomicron (Figure 4E), revealing that P. copri
induces intestinal inflammation. Altogether, these results showed that presence of Prevotella in the intestine is associated with a thinner mucus layer and increased levels of faecal LCN-2. They are consistent with previous reports describing Prevotella, as a bacterium promoting a pro-inflammatory phenotype (i, 4, 48).
[00117] To demonstate the direct role of P. copri on mucus layer thickness, germ-free C57BT/6J mice were inoculated orally with P. copri, P. salivae or B. thetaiotaomicron, two weeks later mice were orally infected with WT Listeria or D lmo2776 strains and mucus layer thickness was compared 72h post-infection. The average distance of bacteria from colonic epithelial cells was significantly smaller in P. copri colonized mice infected with D lmo2776 compared to P. copri colonized mice infected with WT Listeria at 72h (Figure 4D), non- colonised animals or to animal monocolonized with B. thetaiotaomicron or P. salivae, showing that Prevotella decreases specifically the mucus layer thickness.
Example 6: Lmo2776 peptide inhibits P. copri growth in vitro and in vivo
[00118] Tmo2776 peptide of SEQ ID NO: 3 was synthesized and tested in vitro and in vivo. In vitro, Tmo2776 peptide inhibits Prevotella copri growth in a dose dependent manner and has no effect on the growth of B. thetaiotaomicron (Figure 3G). Tmo2776 peptide also inhibits B. subtilis growth but has no effect on the growth of other Prevotella strains, intestinal bacteria or Tactic acid bacteria (IPTA) (Figure 3H). In addition, conventional mice treated with Tmo2776 peptide displayed significantly lower number of P. copri in the feces compared to untreated mice (Figure 3J). Furthermore, Tmo2776 peptide is also capable of inhibiting the growth of various P. copri isolates from Rheumatoid arthritis (RA) patients (Figure 31). These results confirm that Tmo2776 is a bona fide bacteriocin that targets directly both P. copri and B. subtilis in vitro and in vivo. These results show the therapeutic potential of Tmo2776 peptide in the treatment of inflammatory diseases and enteropathogenic bacterial infections.
Discussion:
[00119] Outcompeting intestinal microbiota is one of the first challenging issues for enteropathogens. These bacteria may secrete diffusible molecules such as bacteriocins or T6SS effectors to target commensals and consequently promote colonization and virulence. However,
in most cases, the molecular mechanisms underlying the interplay between pathogenic and commensal bacteria in the intestine remain elusive. Nevertheless, we previously reported that epidemic Listeria strains, such as F2365 strain, secrete a bacteriocin that promotes intestinal colonisation by Listeria (49). When overexpressed in mice gut, this bacteriocin, named Listeriolysin S (LLS), decreases Allobaculum and Alloprevotella genera known to produce butyrate or acetate, two SCFAs reported to inhibit transcription of virulence factors or growth of Listeria (50, 51). However, whether physiological concentrations of LLS have a direct or an indirect role on these genera is still under investigation. In the case of Salmonella enterica serovar Typhimurium infection, killing of intestinal Klebsiella oxytoca via the Salmonella T6SS is essential for colonisation of the murine gut (52), but whether K. oxytoca and other members of the gut microbiota are targeted by the Salmonella T6SS in conventional mice is unknown. Finally, Shigella sonnei uses a T6SS to outcompete E. coli in vivo but the effectors responsible for this effect are unknown (53).
[00120] Here, we demonstrated that the Lmo2776 Listeria bacteriocin targets Prevotella in mouse and human microbiota. This effect is direct and specific as (i) Prevotella are killed by Listeria culture supernatant in vitro and (ii) despite the complexity of the microbiota and its well-controlled equilibrium, no other genus of the intestinal microbiota was found to decrease in the presence of Lmo2776. By studying Lmo2776, we report for the first time a role for intestinal Prevotella in controlling bacterial infection. The intestinal microbiota, in some cases, has been reported to trigger bacterial virulence by producing metabolites that enhance pathogens virulence gene expression and colonisation in the gut (20, 21). For example, B. thetaiotaomicron enhances Clostridium rodentium colonization by producing succinate (54, 55) and Akkermansia muciniphila exacerbates S. 1 y phi mu rium - i nduccd intestinal inflammation by disturbing host mucus homeostasis (5b). P. copri decreases the mucus layer thickness and increases propionate concentration and levels of fecal LCN-2 (Figure 4F), in agreement with previous studies reporting that Prevotella exacerbates inflammation (4, 48). In addition, Prevotella enrichment within the lung microbiome of HIV-infected patients has been observed and is associated with Thl7 inflammation (57). Prevotella sp. have also been associated with bacterial vaginosis and the role in pathogenicity has been linked to the production of sialidase, an enzyme involved in mucin degradation and increased levels of pro-inflammatory cytokines
(58, 59). Our data strongly indicate that P. copri, by modifying the mucus layer thickness and changing the gut inflammatory condition, promotes infection. We can therefore speculate that people with high abundance of intestinal Prevotella might be more susceptible to enteropathogens infection.
[00121] We also showed that the Lmo2776 bacteriocin targets B. subtilis, a Gram positive bacterium found in the soil, suggesting that Lmo2776 could give an advantage to Listeria in the environment. Importantly, as the natural reservoir for Listeria is at present unknown, it is possible that Lmo2776 is critical for the strain survival and replication in this special niche or animal species, consequently favoring transmission or dissemination, thereby explaining its presence in clinical strains. B. subtilis is also found in the human gastrointestinal tract (60) and could also be targeted by Lmo2776 in the intestine. B. subtilis is also targeted by Sil, another member of the bacteriocin 972 family (44). The role of the homologs of bacteriocin 972 in other human pathogenic bacteria such as S. pneumoniae and S. aureus remains to be determined. The conservation of the bacteriocin in different pathogenic bacteria strongly suggests an important role.
[00122] Taken together, our data indicate that Prevotella may behave as pathobiont that can participate in human disease. Consequently, Lmo2776 might represent an effective therapeutic tool to reduce specifically P. copri abundance in the gut without a profound effect on the commensal population.
[00123] The antibacterial effect of the Lmo2776 bacteriocin against Prevotella was confirmed using a synthetic Lmo2776 peptide. Lmo2776 peptide inhibits Prevotella copri growth in vitro and in vivo in conventional mouse microbiota. In particular, Lmo2776 peptide is capable of inhibiting the growth of P. copri isolates from Rheumatoid arthritis patients. These results show the therapeutic potential of Lmo2776 peptide in the treatment of inflammatory diseases and enteropathogenic bacterial infections.
REFERENCES:
[00124] 1. J. M. Larsen, The immune response to Prevotella bacteria in chronic inflammatory disease. Immunology 151, 363-374 (2017).
[00125] 2. M. Arumugam el al, Enterotypes of the human gut microbiome. Nature 473, 174-180 (2011).
[00126] 3. V. K. Gupta, N. M. Chaudhari, S. Iskepalli, C. Dutta, Divergences in gene repertoire among the reference Prevotella genomes derived from distinct body sites of human. BMC Genomics 16, 153 (2015).
[00127] 4. J. U. Scher et al, Expansion of intestinal Prevotella copri correlates with enhanced susceptibility to arthritis. Elife 2, e0l202 (2013).
[00128] 5. H. K. Pedersen et al, Human gut microbes impact host serum metabolome and insulin sensitivity. Nature 535, 376-381 (2016).
[00129] 6. S. M. Dillon et al, Gut dendritic cell activation links an altered colonic microbiome to mucosal and systemic T-cell activation in untreated HIV-l infection. Mucosal Immunol 9, 24-37 (2016).
[00130] 7. C. A. Lozupone et al, HIV-induced alteration in gut microbiota: driving factors, consequences, and effects of antiretroviral therapy. Gut Microbes 5, 562-570 (2014).
[00131] 8. R. E. Ley, Gut microbiota in 2015: Prevotella in the gut: choose carefully. Nat Rev Gastroenterol Hepatol 13, 69-70 (2016). [00132] 9. C. G. Buffie, E. G. Pamer, Microbiota-mediated colonization resistance against intestinal pathogens. Nat Rev Immunol 13, 790-801 (2013).
[00133] 10. C. Archambaud et al, The intestinal microbiota interferes with the microRNA response upon oral Listeria infection. MBio 4, e00707-007l3 (2013).
[00134] 11. S. Becattini et ah, Commensal microbes provide first line defense against
Listeria monocytogenes infection. J Exp Med 214, 1973-1989 (2017).
[00135] 12. S. Rakoff-Nahoum, K. R. Foster, L. E. Comstock, The evolution of cooperation within the gut microbiota. Nature 533, 255-259 (2016). [00136] 13. V. Gaboriau-Routhiau et al, The key role of segmented filamentous bacteria in the coordinated maturation of gut helper T cell responses. Immunity 31, 677-689 (2009).
[00137] 14. Ivanov, II et al, Induction of intestinal Thl7 cells by segmented filamentous bacteria. Cell 139, 485-498 (2009). [00138] 15. D. An et al, Sphingolipids from a symbiotic microbe regulate homeostasis of host intestinal natural killer T cells. Cell 156, 123-133 (2014).
[00139] 16. S. K. Mazmanian, C. H. Liu, A. O. Tzianabos, D. L. Kasper, An immunomodulatory molecule of symbiotic bacteria directs maturation of the host immune system. Cell 122, 107-118 (2005). [00140] 17. S. K. Mazmanian, J. L. Round, D. L. Kasper, A microbial symbiosis factor prevents intestinal inflammatory disease. Nature 453, 620-625 (2008).
[00141] 18. J. L. Round, S. K. Mazmanian, Inducible Foxp3+ regulatory T-cell development by a commensal bacterium of the intestinal microbiota. Proc Natl Acad Sci U S A 107, 12204-12209 (2010). [00142] 19. E. Quevrain et al, Identification of an anti-inflammatory protein from
Faecalibacterium prausnitzii, a commensal bacterium deficient in Crohn's disease. Gut 65, 415- 425 (2016).
[00143] 20. A. J. Baumler, V. Sperandio, Interactions between the microbiota and pathogenic bacteria in the gut. Nature 535, 85-93 (2016).
[00144] 21. N. Rolhion, B. Chassaing, When pathogenic bacteria meet the intestinal microbiota. Philos Trans R Soc Lond B Biol Sci 371, (2016).
[00145] 22. M. Arnaud, A. Chastanet, M. Debarbouille, New vector for efficient allelic replacement in naturally nontransformable, low-GC-content, gram-positive bacteria. Appl Environ Microbiol 70, 6887-6891 (2004).
[00146] 23. J. R. Mellin et al, A riboswitch-regulated antisense RNA in Listeria monocytogenes. Proc Natl Acad Sci U S A 110, 13132-13137 (2013).
[00147] 24. D. Balestrino et al, Single-cell techniques using chromosomally tagged fluorescent bacteria to study Listeria monocytogenes infection processes. Appl Environ Microbiol 76, 3625-3636 (2010).
[00148] 25. P. Lauer, M. Y. Chow, M. J. Loessner, D. A. Portnoy, R. Calendar,
Construction, characterization, and use of two Listeria monocytogenes site-specific phage integration vectors. J Bacteriol 184, 4177-4186 (2002).
[00149] 26. P. A. Bron, I. R. Monk, S. C. Corr, C. Hill, C. G. Gahan, Novel luciferase reporter system for in vitro and organ-specific monitoring of differential gene expression in Listeria monocytogenes. Appl Environ Microbiol 72, 2876-2884 (2006).
[00150] 27. J. G. Caporaso et al, Ultra-high-throughput microbial community analysis on the Illumina HiSeq and MiSeq platforms. ISME J 6, 1621-1624 (2012).
[00151] 28. J. A. Gilbert et al, The Earth Microbiome Project: Meeting report of the "1 EMP meeting on sample selection and acquisition" at Argonne National Laboratory October
6 2010. Stand Genomic Sci 3, 249-253 (2010).
[00152] 29. B. Chassaing et al, Dietary emulsifiers impact the mouse gut microbiota promoting colitis and metabolic syndrome. Nature 519, 92-96 (2015).
[00153] 30. A. Geirnaert et ah, Interindividual differences in response to treatment with butyrate-producing Butyricicoccus pullicaecorum 25-3T studied in an in vitro gut model. FEMS Microbiol Ecol 91, (2015).
[00154] 31. P. Van den Abbeele et al, Butyrate-producing Clostridium cluster XlVa species specifically colonize mucins in an in vitro gut model. ISME J 7, 949-961 (2013).
[00155] 32. P. Van den Abbeele et al, Incorporating a mucosal environment in a dynamic gut model results in a more representative colonization by lactobacilli. Microb Biotechnol 5, 106-115 (2012).
[00156] 33. B. Chassaing, T. Van de Wiele, J. De Bodt, M. Marzorati, A. T. Gewirtz, Dietary emulsifiers directly alter human microbiota composition and gene expression ex vivo potentiating intestinal inflammation. Gut 66, 1414-1427 (2017).
[00157] 34. R. De Weirdt et al, Human faecal microbiota display variable patterns of glycerol metabolism. FEMS Microbiol Ecol 74, 601-611 (2010).
[00158] 35. M. E. Johansson, G. C. Hansson, Preservation of mucus in histological sections, immunostaining of mucins in fixed tissue, and localization of bacteria with FISH. Methods Mol Biol 842, 229-235 (2012).
[00159] 36. P. Glaser et al, Comparative genomics of Listeria species. Science 294,
849-852 (2001).
[00160] 37. M. M. Maury et al, Uncovering Listeria monocytogenes hypervirulence by harnessing its biodiversity. Nat Genet 48, 308-313 (2016).
[00161] 38. M. Desvaux, E. Dumas, I. Chafsey, C. Chambon, M. Hebraud,
Comprehensive appraisal of the extracellular proteins from a monoderm bacterium: theoretical and empirical exoproteomes of Listeria monocytogenes EGD-e by secretomics. J Proteome Res 9, 5076-5092 (2010).
[00162] 39. B. Martinez, J. E. Suarez, A. Rodriguez, Lactococcin 972 : a homodimeric lactococcal bacteriocin whose primary target is not the plasma membrane. Microbiology 142 ( Pt 9), 2393-2398 (1996).
[00163] 40. N. Segata et al, Metagenomic biomarker discovery and explanation.
Genome Biol 12, R60 (2011).
[00164] 41. F. Hildebrand et al, Inflammation-associated enterotypes, host genotype, cage and inter-individual effects drive gut microbiota variation in common laboratory mice. Genome Biol 14, R4 (2013).
[00165] 42. T. L. Nguyen, S. Vieira-Silva, A. Liston, J. Raes, How informative is the mouse for human gut microbiota research? Dis Model Mech 8, 1-16 (2015).
[00166] 43. D. Flint H.J., S.H. , in Encyclopedia Food Microbiology, C. A. Batt, Ed.
(Elsevier, 2014), pp. 203-208.
[00167] 44. M. F. Li, B. C. Zhang, J. Li, L. Sun, Sil: a Streptococcus iniae bacteriocin with dual role as an antimicrobial and an immunomodulator that inhibits innate immune response and promotes S. iniae infection. PLoS One 9, e96222 (2014).
[00168] 45. M. E. Johansson et al, The inner of the two Muc2 mucin-dependent mucus layers in colon is devoid of bacteria. Proc Natl Acad Sci U S A 105, 15064-15069 (2008).
[00169] 46. D. P. Wright, D. I. Rosendale, A. M. Robertson, Prevotella enzymes involved in mucin oligosaccharide degradation and evidence for a small operon of genes expressed during growth on mucin. FEMS Microbiol Eett 190, 73-79 (2000).
[00170] 47. B. Chassaing et al, Fecal lipocalin 2, a sensitive and broadly dynamic non-invasive biomarker for intestinal inflammation. PEoS One 7, e44328 (2012).
[00171] 48. E. Elinav et al, NLRP6 inflammasome regulates colonic microbial ecology and risk for colitis. Cell 145, 745-757 (2011).
[00172] 49. J. J. Quereda et ai, Bacteriocin from epidemic Listeria strains alters the host intestinal microbiota to favor infection. P roc Natl Acad Sci U SA 113, 5706-5711 (2016).
[00173] 50. C. E. Ostling, S. E. Lindgren, Inhibition of enterobacteria and Listeria growth by lactic, acetic and formic acids. J Appl Bacteriol 75, 18-24 (1993). [00174] 51. Y. Sun, B. J. Wilkinson, T. J. Standiford, H. T. Akinbi, M. X. O'Riordan,
Fatty acids regulate stress resistance and virulence factor production for Listeria monocytogenes. J Bacteriol 194, 5274-5284 (2012).
[00175] 52. T. G. Sana et ai, Salmonella Typhimurium utilizes a T6SS-mediated antibacterial weapon to establish in the host gut. Proc Natl Acad Sci U S A 113, E5044-5051 (2016).
[00176] 53. M. C. Anderson, P. Vonaesch, A. Saffarian, B. S. Marteyn, P. J.
Sansonetti, Shigella sonnei Encodes a Functional T6SS Used for Interbacterial Competition and Niche Occupancy. Cell Host Microbe 21, 769-776 e763 (2017).
[00177] 54. M. M. Curtis et ah, The gut commensal Bacteroides thetaiotaomicron exacerbates enteric infection through modification of the metabolic landscape. Cell Host Microbe 16, 759-769 (2014).
[00178] 55. J. A. Ferreyra et al, Gut microbiota-produced succinate promotes C. difficile infection after antibiotic treatment or motility disturbance. Cell Host Microbe 16, 770- 777 (2014). [00179] 56. B. P. Ganesh, R. Klopfleisch, G. Loh, M. Blaut, Commensal
Akkermansia muciniphila exacerbates gut inflammation in Salmonella Typhimurium-infected gnotobiotic mice. PLoS One 8, e74963 (2013).
[00180] 57. M. K. Shenoy, S. V. Lynch, Role of the lung microbiome in HIV pathogenesis. Curr Opin HIV AIDS, (2017).
[00181] 58. A. M. Briselden, B. J. Moncla, C. E. Stevens, S. L. Hillier, Sialidases
(neuraminidases) in bacterial vaginosis and bacterial vaginosis-associated microflora. J Clin Microbiol 30, 663-666 (1992).
[00182] 59. J. Si, H. J. You, J. Yu, J. Sung, G. Ko, Prevotella as a Hub for Vaginal Microbiota under the Influence of Host Genetics and Their Association with Obesity. Cell Host Microbe 21, 97-105 (2017).
[00183] 60. H. A. Hong et al, Bacillus subtilis isolated from the human gastrointestinal tract. Res Microbiol 160, 134-143 (2009).
[00184] 61. A. Moura et al, Whole genome-based population biology and epidemiological surveillance of Listeria monocytogenes. Nat Microbiol 2, 16185 (2016).
Claims
1. A pharmaceutical composition comprising an anti -Prevotella bacteriocin and a pharmaceutically acceptable carrier.
2. The pharmaceutical composition of claim 1, wherein the anti -Prevotella bacteriocin is L. monocytogenes Lmo2776.
3. The pharmaceutical composition of claim 1 or 2, wherein the anti -Prevotella bacteriocin comprises an amino acid sequence that is at least 80% identical to a sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
4. The pharmaceutical composition of claim 3, wherein the anti -Prevotella bacteriocin comprises an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3.
5. The pharmaceutical composition of claim 4, wherein the anti -Prevotella bacteriocin comprises or consists of the amino acid sequence of SEQ ID NO: 3.
6. The pharmaceutical composition of any one claims 1 to 5, wherein said Prevotella is Prevotella copri.
7. A pharmaceutical composition according to any one of claims 1 to 6 for use in treating or preventing inflammation in a subject.
8. The pharmaceutical composition for use according to claim 7, wherein the subject has or is at risk of developing an inflammatory disease selected from rheumatoid arthritis, metabolic syndrome, inflammatory bowel disease, and HIV infection.
9. A pharmaceutical composition according to any one of claims 1 to 6 for use in treating or preventing an enteropathogenic bacterial infection in a subject.
10. The pharmaceutical composition for use according to claim 9, wherein the subject has or is at risk of developing a Listeria infection.
11. A pharmaceutical composition according to any one of claims 1 to 6 for use in reducing the Prevotella load in a subject.
12. The pharmaceutical composition for use according to claim 11, wherein said Prevotella is Prevotella copri.
13. The pharmaceutical composition for use according to any one of claims 7 to 12, wherein the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 80%.
14. The pharmaceutical composition for use according to any one of claims 7 to 12, wherein the anti -Prevotella bacteriocin is administered in an amount sufficient to reduce the Prevotella load by at least 90%.
15. The pharmaceutical composition for use according to claim 13 or 14, wherein said Prevotella is Prevotella copri.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862628053P | 2018-02-08 | 2018-02-08 | |
| US62/628,053 | 2018-02-08 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019155002A1 true WO2019155002A1 (en) | 2019-08-15 |
Family
ID=65494102
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2019/053170 Ceased WO2019155002A1 (en) | 2018-02-08 | 2019-02-08 | Anti-prevotella bacteriocin methods and compositions |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2019155002A1 (en) |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001077335A2 (en) * | 2000-04-11 | 2001-10-18 | Institut Pasteur | Listeria monocytogenes genome, polypeptides and uses |
| WO2010149792A2 (en) * | 2009-06-26 | 2010-12-29 | Katholieke Universiteit Leuven, K.U. Leuven R&D | Antimicrobial agents |
| EP2682463A1 (en) * | 2011-02-10 | 2014-01-08 | Hiroshima University | Bacteriocin derived from lactobacillus rhamnosus |
-
2019
- 2019-02-08 WO PCT/EP2019/053170 patent/WO2019155002A1/en not_active Ceased
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001077335A2 (en) * | 2000-04-11 | 2001-10-18 | Institut Pasteur | Listeria monocytogenes genome, polypeptides and uses |
| WO2010149792A2 (en) * | 2009-06-26 | 2010-12-29 | Katholieke Universiteit Leuven, K.U. Leuven R&D | Antimicrobial agents |
| EP2682463A1 (en) * | 2011-02-10 | 2014-01-08 | Hiroshima University | Bacteriocin derived from lactobacillus rhamnosus |
Non-Patent Citations (65)
| Title |
|---|
| A. GEIRNAERT: "Interindividual differences in response to treatment with butyrate-producing Butyricicoccus pullicaecorum 25-3T studied in an in vitro gut model", FEMS MICROBIOL ECOL, 2015, pages 91 |
| A. J. BAUMLER; V. SPERANDIO: "Interactions between the microbiota and pathogenic bacteria in the gut", NATURE, vol. 535, 2016, pages 85 - 93 |
| A. M. BRISELDEN; B. J. MONCLA; C. E. STEVENS; S. L. HILLIER: "Sialidases (neuraminidases) in bacterial vaginosis and bacterial vaginosis-associated microflora", J CLIN MICROBIOL, vol. 30, 1992, pages 663 - 666, XP002901154 |
| A. MOURA: "Whole genome-based population biology and epidemiological surveillance of Listeria monocytogenes", NAT MICROBIOL, vol. 2, 2016, pages 16185 |
| AHMAD VARISH ET AL: "Antimicrobial potential of bacteriocins: in therapy, agriculture and food preservation", INTERNATIONAL JOURNAL OF ANTIMICROBIAL AGENTS, ELSEVIER, AMSTERDAM, NL, vol. 49, no. 1, 29 September 2016 (2016-09-29), pages 1 - 11, XP029862502, ISSN: 0924-8579, DOI: 10.1016/J.IJANTIMICAG.2016.08.016 * |
| B. CHASSAING: "Dietary emulsifiers impact the mouse gut microbiota promoting colitis and metabolic syndrome", NATURE, vol. 519, 2015, pages 92 - 96 |
| B. CHASSAING: "Fecal lipocalin 2, a sensitive and broadly dynamic non-invasive biomarker for intestinal inflammation", PLOS ONE, vol. 7, 2012, pages e44328 |
| B. CHASSAING; T. VAN DE WIELE; J. DE BODT; M. MARZORATI; A. T. GEWIRTZ: "Dietary emulsifiers directly alter human microbiota composition and gene expression ex vivo potentiating intestinal inflammation", GUT, vol. 66, 2017, pages 1414 - 1427 |
| B. MARTINEZ; J. E. SUAREZ; A. RODRIGUEZ: "Lactococcin 972 : a homodimeric lactococcal bacteriocin whose primary target is not the plasma membrane", MICROBIOLOGY, vol. 142, no. 9, 1996, pages 2393 - 2398 |
| B. P. GANESH; R. KLOPFLEISCH; G. LOH; M. BLAUT: "Commensal Akkermansia muciniphila exacerbates gut inflammation in Salmonella Typhimurium-infected gnotobiotic mice", PLOS ONE, vol. 8, 2013, pages e74963, XP055326989, DOI: doi:10.1371/journal.pone.0074963 |
| BRUGIROUX, NATURE MICROBIOLOGY, 2016 |
| C. A. LOZUPONE: "HIV-induced alteration in gut microbiota: driving factors, consequences, and effects of antiretroviral therapy", GUT MICROBES, vol. 5, 2014, pages 562 - 570 |
| C. ARCHAMBAUD: "The intestinal microbiota interferes with the microRNA response upon oral Listeria infection", MBIO, vol. 4, 2013, pages e00707 - 00713 |
| C. E. OSTLING; S. E. LINDGREN: "Inhibition of enterobacteria and Listeria growth by lactic, acetic and formic acids", J APPL BACTERIOL, vol. 75, 1993, pages 18 - 24 |
| C. G. BUFFIE; E. G. PAMER: "Microbiota-mediated colonization resistance against intestinal pathogens", NAT REV IMMUNOL, vol. 13, 2013, pages 790 - 801 |
| D. AN: "Sphingolipids from a symbiotic microbe regulate homeostasis of host intestinal natural killer T cells", CELL, vol. 156, 2014, pages 123 - 133, XP028811703, DOI: doi:10.1016/j.cell.2013.11.042 |
| D. BALESTRINO: "Single-cell techniques using chromosomally tagged fluorescent bacteria to study Listeria monocytogenes infection processes", APPL ENVIRON MICROBIOL, vol. 76, 2010, pages 3625 - 3636 |
| D. FLINT H.J.; S.H.: "Encyclopedia Food Microbiology", 2014, ELSEVIER, pages: 203 - 208 |
| D. P. WRIGHT, D. I; ROSENDALE, A. M. ROBERTSON: "Prevotella enzymes involved in mucin oligosaccharide degradation and evidence for a small operon of genes expressed during growth on mucin", FEMS MICROBIOL LETT, vol. 190, 2000, pages 73 - 79 |
| E. ELINAV: "NLRP6 inflammasome regulates colonic microbial ecology and risk for colitis", CELL, vol. 145, 2011, pages 745 - 757, XP028221175, DOI: doi:10.1016/j.cell.2011.04.022 |
| E. QUEVRAIN: "Identification of an anti-inflammatory protein from Faecalibacterium prausnitzii, a commensal bacterium deficient in Crohn's disease", GUT, vol. 65, 2016, pages 415 - 425 |
| F. HILDEBRAND: "Inflammation-associated enterotypes, host genotype, cage and inter-individual effects drive gut microbiota variation in common laboratory mice", GENOME BIOL, vol. 14, 2013, pages R4, XP021151883, DOI: doi:10.1186/gb-2013-14-1-r4 |
| H. A. HONG: "Bacillus subtilis isolated from the human gastrointestinal tract", RES MICROBIOL, vol. 160, 2009, pages 134 - 143, XP026002060, DOI: doi:10.1016/j.resmic.2008.11.002 |
| H. K. PEDERSEN: "Human gut microbes impact host serum metabolome and insulin sensitivity", NATURE, vol. 535, 2016, pages 376 - 381 |
| IVANOV, II: "Induction of intestinal Thl7 cells by segmented filamentous bacteria", CELL, vol. 139, 2009, pages 485 - 498, XP055005112, DOI: doi:10.1016/j.cell.2009.09.033 |
| J. A. FERREYRA: "Gut microbiota-produced succinate promotes C. difficile infection after antibiotic treatment or motility disturbance", CELL HOST MICROBE, vol. 16, 2014, pages 770 - 777 |
| J. A. GILBERT: "The Earth Microbiome Project: Meeting report of the ''1 EMP meeting on sample selection and acquisition'' at Argonne National Laboratory", STAND GENOMIC SCI, vol. 3, 6 October 2010 (2010-10-06), pages 249 - 253 |
| J. G. CAPORASO: "Ultra-high-throughput microbial community analysis on the Illumina HiSeq and MiSeq platforms", ISME J, vol. 6, 2012, pages 1621 - 1624, XP055341618, DOI: doi:10.1038/ismej.2012.8 |
| J. J. QUEREDA: "Bacteriocin from epidemic Listeria strains alters the host intestinal microbiota to favor infection", PROC NATL ACAD SCI U S A, vol. 113, 2016, pages 5706 - 5711, XP055304893, DOI: doi:10.1073/pnas.1523899113 |
| J. L. ROUND; S. K. MAZMANIAN: "Inducible Foxp3+ regulatory T-cell development by a commensal bacterium of the intestinal microbiota", PROC NATL ACAD SCI U S A, vol. 107, 2010, pages 12204 - 12209, XP055088747, DOI: doi:10.1073/pnas.0909122107 |
| J. M. LARSEN: "The immune response to Prevotella bacteria in chronic inflammatory disease", IMMUNOLOGY, vol. 151, 2017, pages 363 - 374 |
| J. R. MELLIN: "A riboswitch-regulated antisense RNA in Listeria monocytogenes", PROC NATL ACAD SCI USA, vol. 110, 2013, pages 13132 - 13137 |
| J. SI; H. J. YOU; J. YU; J. SUNG; G. KO: "Prevotella as a Hub for Vaginal Microbiota under the Influence of Host Genetics and Their Association with Obesity", CELL HOST MICROBE, vol. 21, 2017, pages 97 - 105, XP029881002, DOI: doi:10.1016/j.chom.2016.11.010 |
| J. U. SCHER: "Expansion of intestinal Prevotella copri correlates with enhanced susceptibility to arthritis", ELIFE, vol. 2, 2013, pages e01202 |
| JOSE U SCHER ET AL: "Expansion of intestinal Prevotella copri correlates with enhanced susceptibility to arthritis", ELIFE, vol. 2, 5 November 2013 (2013-11-05), GB, pages 1 - 20, XP055475267, ISSN: 2045-5267, DOI: 10.7554/eLife.01202 * |
| M. ARNAUD; A. CHASTANET; M. DEBARBOUILLE: "New vector for efficient allelic replacement in naturally nontransformable, low-GC-content, gram-positive bacteria", APPL ENVIRON MICROBIOL, vol. 70, 2004, pages 6887 - 6891, XP055069806, DOI: doi:10.1128/AEM.70.11.6887-6891.2004 |
| M. ARUMUGAM: "Enterotypes of the human gut microbiome", NATURE, vol. 473, 2011, pages 174 - 180, XP055018562, DOI: doi:10.1038/nature09944 |
| M. C. ANDERSON; P. VONAESCH; A. SAFFARIAN; B. S. MARTEYN; P. J. SANSONETTI: "Shigella sonnei Encodes a Functional T6SS Used for Interbacterial Competition and Niche Occupancy", CELL HOST MICROBE, vol. 21, 2017, pages 769 - 776 e763 |
| M. DESVAUX; E. DUMAS; I. CHAFSEY; C. CHAMBON; M. HEBRAUD: "Comprehensive appraisal of the extracellular proteins from a monoderm bacterium: theoretical and empirical exoproteomes of Listeria monocytogenes EGD-e by secretomics", J PROTEOME RES, vol. 9, 2010, pages 5076 - 5092 |
| M. E. JOHANSSON: "The inner of the two Muc2 mucin-dependent mucus layers in colon is devoid of bacteria", PROC NATL ACAD SCI U S A, vol. 105, 2008, pages 15064 - 15069 |
| M. E. JOHANSSON; G. C. HANSSON: "Preservation of mucus in histological sections, immunostaining of mucins in fixed tissue, and localization of bacteria with FISH", METHODS MOL BIOL, vol. 842, 2012, pages 229 - 235 |
| M. F. LI; B. C. ZHANG; J. LI; L. SUN; SIL: "Streptococcus iniae bacteriocin with dual role as an antimicrobial and an immunomodulator that inhibits innate immune response and promotes S. iniae infection", PLOS ONE, vol. 9, 2014, pages e96222 |
| M. K. SHENOY; S. V. LYNCH: "Role of the lung microbiome in HIV pathogenesis", CURR OPIN HIV AIDS, 2017 |
| M. M. CURTIS: "The gut commensal Bacteroides thetaiotaomicron exacerbates enteric infection through modification of the metabolic landscape", CELL HOST MICROBE, vol. 16, 2014, pages 759 - 769 |
| M. M. MAURY: "Uncovering Listeria monocytogenes hypervirulence by harnessing its biodiversity", NAT GENET, vol. 48, 2016, pages 308 - 313 |
| N. ROLHION; B. CHASSAING: "When pathogenic bacteria meet the intestinal microbiota", PHILOS TRANS R SOC LOND B BIOL SCI, vol. 371, 2016 |
| N. SEGATA: "Metagenomic biomarker discovery and explanation", GENOME BIOL, vol. 12, 2011, pages R60, XP021106546, DOI: doi:10.1186/gb-2011-12-6-r60 |
| P. A. BRON; I. R. MONK; S. C. CORR; C. HILL; C. G. GAHAN: "Novel luciferase reporter system for in vitro and organ-specific monitoring of differential gene expression in Listeria monocytogenes", APPL ENVIRON MICROBIOL, vol. 72, 2006, pages 2876 - 2884 |
| P. GLASER: "Comparative genomics of Listeria species", SCIENCE, vol. 294, 2001, pages 849 - 852, XP002967927, DOI: doi:10.1126/science.1063447 |
| P. LAUER; M. Y. CHOW; M. J. LOESSNER; D. A. PORTNOY; R. CALENDAR: "Construction, characterization, and use of two Listeria monocytogenes site-specific phage integration vectors", J BACTERIOL, vol. 184, 2002, pages 4177 - 4186, XP002971584, DOI: doi:10.1128/JB.184.15.4177-4186.2002 |
| P. VAN DEN ABBEELE: "Butyrate-producing Clostridium cluster XIVa species specifically colonize mucins in an in vitro gut model", ISME J, vol. 7, 2013, pages 949 - 961 |
| P. VAN DEN ABBEELE: "Incorporating a mucosal environment in a dynamic gut model results in a more representative colonization by lactobacilli", MICROB BIOTECHNOL, vol. 5, 2012, pages 106 - 115, XP002785472 |
| R. DE WEIRDT: "Human faecal microbiota display variable patterns of glycerol metabolism", FEMS MICROBIOL ECOL, vol. 74, 2010, pages 601 - 611 |
| R. E. LEY; GUT MICROBIOTA: "2015: Prevotella in the gut: choose carefully", NAT REV GASTROENTEROL HEPATOL, vol. 13, 2016, pages 69 - 70 |
| RIADH HAMMAMI ET AL: "Anti-infective properties of bacteriocins: an update", CELLULAR AND MOLECULAR LIFE SCIENCES, vol. 70, no. 16, 1 August 2013 (2013-08-01), pages 2947 - 2967, XP055116653, ISSN: 1420-682X, DOI: 10.1007/s00018-012-1202-3 * |
| S. BECATTINI: "Commensal microbes provide first line defense against Listeria monocytogenes infection", J EXP MED, vol. 214, 2017, pages 1973 - 1989, XP055548751, DOI: doi:10.1084/jem.20170495 |
| S. K. MAZMANIAN; C. H. LIU; A. O. TZIANABOS; D. L. KASPER: "An immunomodulatory molecule of symbiotic bacteria directs maturation of the host immune system", CELL, vol. 122, 2005, pages 107 - 118 |
| S. K. MAZMANIAN; J. L. ROUND; D. L. KASPER: "A microbial symbiosis factor prevents intestinal inflammatory disease", NATURE, vol. 453, 2008, pages 620 - 625, XP002560841, DOI: doi:10.1038/nature07008 |
| S. M. DILLON: "Gut dendritic cell activation links an altered colonic microbiome to mucosal and systemic T-cell activation in untreated HIV-1 infection", MUCOSAL IMMUNOL, vol. 9, 2016, pages 24 - 37 |
| S. RAKOFF-NAHOUM; K. R. FOSTER; L. E. COMSTOCK: "The evolution of cooperation within the gut microbiota", NATURE, vol. 533, 2016, pages 255 - 259 |
| T. G. SANA: "Salmonella Typhimurium utilizes a T6SS-mediated antibacterial weapon to establish in the host gut", PROC NATL ACAD SCI U S A, vol. 113, 2016, pages E5044 - 5051 |
| T. L. NGUYEN; S. VIEIRA-SILVA; A. LISTON; J. RAES: "How informative is the mouse for human gut microbiota research", DIS MODEL MECH, vol. 8, 2015, pages 1 - 16 |
| V. GABORIAU-ROUTHIAU: "The key role of segmented filamentous bacteria in the coordinated maturation of gut helper T cell responses", IMMUNITY, vol. 31, 2009, pages 677 - 689, XP055005245, DOI: doi:10.1016/j.immuni.2009.08.020 |
| V. K. GUPTA; N. M. CHAUDHARI; S. ISKEPALLI; C. DUTTA: "Divergences in gene repertoire among the reference Prevotella genomes derived from distinct body sites of human", BMC GENOMICS, vol. 16, 2015, pages 153, XP021217730, DOI: doi:10.1186/s12864-015-1350-6 |
| Y. SUN; B. J. WILKINSON; T. J. STANDIFORD; H. T. AKINBI; M. X. O'RIORDAN: "Fatty acids regulate stress resistance and virulence factor production for Listeria monocytogenes", J BACTERIOL, vol. 194, 2012, pages 5274 - 5284 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Rolhion et al. | A Listeria monocytogenes bacteriocin can target the commensal Prevotella copri and modulate intestinal infection | |
| US20250302733A1 (en) | Dermatological preparations for maintaining and/or restoring healthy skin microbiota | |
| Seksik et al. | The role of bacteria in onset and perpetuation of inflammatory bowel disease | |
| Quereda et al. | Listeriolysin S: A bacteriocin from epidemic Listeria monocytogenes strains that targets the gut microbiota | |
| Carvalho et al. | How Listeria monocytogenes organizes its surface for virulence | |
| Miner et al. | Role of cholesterol in Mycobacterium tuberculosis infection | |
| Johnson et al. | Impact of genomics on the field of probiotic research: historical perspectives to modern paradigms | |
| JP6054371B2 (en) | Regulation of bacterial MAM polypeptides in pathogenic diseases | |
| Chimalapati et al. | Effects of deletion of the Streptococcus pneumoniae lipoprotein diacylglyceryl transferase gene lgt on ABC transporter function and on growth in vivo | |
| Réglier-Poupet et al. | Maturation of lipoproteins by type II signal peptidase is required for phagosomal escape of Listeria monocytogenes | |
| EP4076482B1 (en) | Compositions for modulating gut microflora populations, enhancing drug potency and treating cancer | |
| van Dijk et al. | Campylobacter jejuni is highly susceptible to killing by chicken host defense peptide cathelicidin-2 and suppresses intestinal cathelicidin-2 expression in young broilers | |
| Sá et al. | The virB-encoded type IV secretion system is critical for establishment of infection and persistence of Brucella ovis infection in mice | |
| US10849939B2 (en) | Probiotic formulation | |
| Xu et al. | The role of egg yolk in modulating the virulence of Salmonella enterica serovar Enteritidis | |
| KR20190084097A (en) | Attenuation of bacterial virulence by weakening bacterial folate transport | |
| US20230407241A1 (en) | A novel probiotic streptococcus salivarius strain and its uses | |
| WO2018178072A1 (en) | Lactic acid bacteria, methods and uses thereof | |
| US11666611B2 (en) | Defined therapeutic microbiota and methods of use thereof | |
| WO2019155002A1 (en) | Anti-prevotella bacteriocin methods and compositions | |
| Zhang et al. | The pulmonary commensal Lactobacillus regulated lung γδ T cells to enhance resistance against bacterial infections | |
| Lee et al. | Immunomodulatory Properties and Ameliorative Effects of Pediococcus inopinatus in an Animal Model of Inflammatory Bowel Disease | |
| Rolhion et al. | Specific targeting of intestinal Prevotella copri by a Listeria monocytogenes bacteriocin | |
| Van Zyl | Gastrointestinal persistence of the probiotic bacteria Lactobacillus plantarum 423 and Enterococcus mundtii ST4SA, and their anti-listerial activity | |
| US20200268017A1 (en) | Probiotic compositions and methods |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19705938 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 19705938 Country of ref document: EP Kind code of ref document: A1 |