WO2019023341A1 - Immunogenic composition comprising a fusion peptide derived from superantigen toxoids - Google Patents

Immunogenic composition comprising a fusion peptide derived from superantigen toxoids Download PDF

Info

Publication number
WO2019023341A1
WO2019023341A1 PCT/US2018/043687 US2018043687W WO2019023341A1 WO 2019023341 A1 WO2019023341 A1 WO 2019023341A1 US 2018043687 W US2018043687 W US 2018043687W WO 2019023341 A1 WO2019023341 A1 WO 2019023341A1
Authority
WO
WIPO (PCT)
Prior art keywords
oligopeptide
toxoid
seq
less
sea
Prior art date
Application number
PCT/US2018/043687
Other languages
French (fr)
Inventor
Mohammad Javad Aman
Thomas Kort
Arundhathi VENKATASUBRAMANIAM
Nils WILLISTON
Rajan Prasad ADHIKARI
Frederick W. HOLTSBERG
Original Assignee
Integrated Biotherapeutics, Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Integrated Biotherapeutics, Inc. filed Critical Integrated Biotherapeutics, Inc.
Priority to EP18838475.4A priority Critical patent/EP3658181A4/en
Priority to MX2020001046A priority patent/MX2020001046A/en
Priority to JP2020503935A priority patent/JP7303791B2/en
Priority to US16/633,664 priority patent/US11260120B2/en
Priority to CN201880047111.4A priority patent/CN110996993B/en
Priority to CA3069747A priority patent/CA3069747A1/en
Publication of WO2019023341A1 publication Critical patent/WO2019023341A1/en
Priority to US17/680,897 priority patent/US11826412B2/en

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/02—Bacterial antigens
    • A61K39/085—Staphylococcus
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/305—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F)
    • C07K14/31—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F) from Staphylococcus (G)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70—Vectors or expression systems specially adapted for E. coli
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53—DNA (RNA) vaccination
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55505—Inorganic adjuvants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/70—Multivalent vaccine
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/55—Fusion polypeptide containing a fusion with a toxin, e.g. diphteria toxin
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • Staphylococcus aureus is a gram-positive human pathoge that causes a wide range of infections from skin and soft tissue infections (SSTI) to life threatening sepsis and pneumonia. It is a leading cause of hospital- and commumty-associated infections worldwide (Brown -el al., 2009, Journal-Clio Microbiol Infect, 15(2); 156- 164).
  • the range of pathologies reflects the diverse abilities of SA to escape the immune response using a plethora of virulence factors: the sujteranfi genie and ⁇ pore-forming toxins, c agulase, capsular polysaccharide, adhesios, proteases, complement ⁇ activating exoproteitts, and other innate response modifiers (Powers and Wardenb rg, 2014, Joumal/FLOS Pathogens. I0(2):el003871).
  • Hla Alpha hemolysin (ot-toxin, Hla) is a major virulence factor in SA pneumonia and SSTI (Bubeck Wardenburg and Schnee ind, 2Q0R, J Exp Med, 205 (2):287 ⁇ 294; Kennedy, et al, 2010, J Inject DL% 202 (7): 1050-1058).
  • cytolytic short peptides known as phenol soluble modulins (PSMs) were identified as key virulence factors that lyse neutrophils, the main line of defense against S.
  • SAgs Supera.nti.gem
  • SEs staphylococcal entero toxins
  • TSST-1 toxic shock syndrome toxin ⁇
  • TSS Toxic Shock Syndrome
  • Staphylococcal enterotoxin A ⁇ SEA ⁇
  • antibiotic resistance cassettes like SCC mec Staphylococcal enterotoxin H (SEH) (Oinoe at at., 2002, Joumal J Clin .Microbiol. 4Q(3):857-862).
  • SAgs super antigens
  • this disclosure provides for an attenuated Staphylococcus uure s- dccivcd supcrantigen (SAg) SEA toxoid, or an immunogenic ally or aoiigcmealiy active fragment, variant, or derivative thereof, comprising four mutations relative to wild-type SEA, the four mutations corresponding to the L48R. D70R, Y92A, and H225A mutations in SEQ ID MO: 4.
  • SAg Staphylococcus uure s- dccivcd supcrantigen
  • the toxoid or fragment, variant, or derivatives thereof has decreased superantigenic activity and/or is less virulent than a SEA toxoid comprising SEQ ID NO: 3, while maintaining .mnitmogenieit .
  • the attenuated SEA toxoid or fragment, variant, or derivative ' thereof comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 4.
  • the attenuated SEA toxoid or fragment,, variant, or derivative thereof comprises SEQ ID NO: 4.
  • the attenuated SEA toxoid or fragment, variant, or derivative thereof has less than 50%, less than..40%, leas than 30%, less than 20%, less than 10%, less than 5%, less than 3%, less than 2%, or less- than t % of the superantigemc activity of a SEA toxoid comprising SEQ ID NO: 5.
  • a SEA toxoid comprising SEQ ID NO: 5.
  • the disclosure further provides for a multivalent, oligopeptide comprising a usion of two or more attenuated Staphylococcus aureus-dczWod superantigen (SAg) toxoids at immnnogenieaHy or antigenically active fragments, variants, or derivatives thereof as described elsewhere herein arranged in any order, wherein the SAg toxoids or fragments, variants, or derivatives thereof can be the same or different, and wherein at least one of the SAg toxoids is a SEA toxoid described elsewhere herein, i certain aspects, the oligopeptide comprises a fusion of three or more SAg toxoids or fragments, variants, or derivatives thereof.
  • SAg Staphylococcus aureus-dczWod superantigen
  • the oligopeptide has decreased superantigemc activity anch r is less virulent t an a SAg fusion protein comprising SEQ ID MO: 5. in certain aspects, the oligopeptide maintains the immunogenjeity of the SAg fusion protein comprising SEQ TD NO: 5. hi certain aspects, the oligopeptide has less than 50%, less than 40%, less than 30%, less than 20%, less than 1.0%, less than 5%, less than 3%, less than 2%, or less than 1% of the superanti genie activity of a SAg fusion protein comprising SEQ ID NO: 5. And, in certain aspects, the oligopeptide is completely attenuated.
  • the multivalent oligopeptide comprises one or more of a staphylococcal toxic shock syndrome toxin- 1 .(TSST-1.) attenuated toxoid: a staphylococcal enterotoxin B (SEB) attenuated toxoid; or any combination thereof.
  • TSST ⁇ 1 attenuated toxoid comprises three mutations relative to wild- type TSST-l, the three mutations corresponding to the L30 , D27A.
  • die SEB attenuated toxoid comprises three mutations relative to wild- type SE , the three mutations eorresponding to the L45R, Y89A, and Y94A mutations i SEQ I ' D NO? 2 and an amino acid sequence at least 90% identical to SEQ ID NO: 2, in certain .aspects, t&e SEA attenuated toxoid comprises, four mutations relative to wild-type.
  • the TSST-1 toxoid comprises the amino acid sequence SEQ ID NO; i.
  • the SEB toxoid comprises the amino acid sequence SEQ ID NO: 2.
  • the SEA attenuated toxoid comprises the amin -acid sequence. SEQ ID NO: 4.
  • the multivalent oligopeptide comprises the -amino -acid sequence SEQ ID NO; 6,
  • the linker comprises at least one, but no more than 50 amino acids selected from the gro consistin of glycine, serine, alanine, and a combination thereof.
  • the linker comprises; ⁇ GOGS) s or (GGG ⁇ iS) thread. wherein n is a integer from 1 to 10.
  • the linker comprises (GGGGS) f; . in certain aspects, n is 3.
  • the multivalent oligopeptide can further comprise a heterologous polypeptide.
  • the heterologous polypeptide comprises a His-tag, a ubi uitin. tag, a NttsA tag, a chiiiii binding domain, a B-tag, a MSB-tag, green fluorescent protein (OFF), a calmodulin binding protein (CBP), a gaiaclose-binding protein, a maltose binding protein ⁇ MBP).
  • the heterologous polypeptide comprises an immunogen, a T-eell epitope, a B-cell epitope, a fragment thereof, or a combination thereof.
  • the multivalent oligopeptide can also further comprise an immunogenic carbohydrate.
  • the- immunogenic carbohydrate is a saccharide.
  • the immunogenic carbohydrate is a capsular polysaccharide or a surface polysaccharide, in certain aspects, the immunogenic carbohydrate is selected from the group consisting of capsular polysaccharide (CP) serotype 5 (CP5), C S, poly-N- acctylglucosaminc (PNAG),.
  • CP capsular polysaccharide
  • PNAG poly-N- acctylglucosaminc
  • the immunogenic carbohydrate is conjugated to the oligopeptide, jftOlfi] Further provided for is an isolated polynucleotide comprising a nucleic acid thai encodes an attenuated SEA toxoid polypeptide described elsewhere herein or a multivalent oligopeptide described elsewhere herein.
  • the polynucleotide comprises the nucleotide sequence SEQ ID NO; 8,
  • the polynucleotide can further comprise a heterologous nucleic acid, in certain aspects, the heterologous nucleic acid comprises a promoter operably .associated with the nucleic acid encoding the oligopeptide.
  • a vector comprising the polynucleotide, in certain aspects, the vector is a plasnttd.
  • a host cell compmiag the vector. I» certain aspects, the host, cell is a bacterium, an insect cell, a mammalian cell, or a plant cell. In certain aspects, the bacterium is Escherichia coli.
  • the method comprises culturing a host cell described elsewhere herein and recovering the oli opeptide.
  • compositions such as a therapeutic, immunogenic, and/or antigenic composition, comprising an attenuated SEA toxoid or multivalent oligopeptide described elsewhere herein, or any combination thereof, and a carrier.
  • the composition can further comprise an adjuvant in certain aspects, the adjuvant is alum, aluminum hydroxide, aluminum phosphate, or a giticopyranosyl lipid A-based adjuvant.
  • the composition can also iurther comprise an additional iminunogen.
  • the additional imniunogen is a bacterial antigen.
  • the bacterial antigen is selected from the group consisting of a pore forming toxin, a superantigen. a cell surface protein, a fragment of any of the bacterial antigens, and a combination of two or more of the bacterial antigens.
  • the method comprises administering to a subject in- need of the immune response an effective amount of an immunogenic or antigenic composition described elsewhere herein.
  • the immune response is selected from the group consisting of an Innate response, a humoral response, an antibody response, a cellular response, and a combination of two or more of the immune responses.
  • the immune response is an antibody response.
  • the method comprises administering to a subject in need thereof a composition described elsewhere herein.
  • the infection is a localized or systemic infection of skin, soft tissue, blood, or an organ, or is auto-immune in nature.
  • the disease is a respiratory disease, for example * pneumonia.
  • the disease is sepsis.
  • a subject in any of the methods disclosed herein can be a m mmal
  • the nia runai is a human
  • the mammal is bovine or canine.
  • a composition, for administration in any of the methods disclosed herein can be administered via intramuscular injection, intradennai injection, intraperitoneal -injection, subcutaneous injection, intravenous injection, oral administration, mucosal administration, intranasal administration, or pulmonary administration,
  • compositions for use in inducing a host immune response against Staphylococcus aureus in a subject Further ' rovided or is a composition f r use in preventing or- treating a Staphylococcal disease or. infection in a subject.
  • a method of producing a vaccine against & aureus infection the method comprises isolating an attenuated SEA toxoid described elsewhere herein, a -multivalent oligopeptide described elsewhere herein, or any combination thereof; and combining the toxoid, oligopeptide, or any combination thereof with an adjuvant.
  • Figure 1 is a schematic of rTBA and rTBA225 constructs. Additional -potential configurations of the fusion peptide are also shown, Linker; three repeats of the linker GGGGS (4GS).
  • Figure 2A-B illustrates purification of rTBA.
  • Fig. 2A Process for purification of rTBA and rTBA 225.
  • Fig. 2B SDS-PAGE analysis of rTBA.
  • FIG. 3 shows the comparative immunogenicity of rTBA versus a cocktail of the three individual toxoids in mice
  • Figure 4 shows- rTBA and rTBA225 safety profiles. Response of human PBMC from three donors to SEA, rTBA, SEAH225A, rSEA225, mid iTBA2 5.
  • FIG. 5 shows the comparativ immunogenicity of rTBA225 versus rTBA versus a cocktail of the three individual toxoids in. mice.
  • ELISA and toxin neutralization. assay (TNA) were performed o « individual sera from 10 immunized mice per group for SEA, SEB ant! TSST-T
  • Data shown are ELISA ECJO (A) and TNA NTso values (B)> ⁇ to test for Gross-neutraUzation against other super ' antigens were also performed on pooled sera from the immunized mice.
  • Data shown is percentage neutralization at 1:40 serum dilution (C). Error bars represent standard errors of mean and the asterisks show statistical difference " between rTBA225 and SAg cocktail immunized mice sera as determined by the Mann-Whitney non-parametric test.
  • Figure 6 shows adsorption ofrTSST-l (A) and jrTBA225 (B) by Alhydrogel.
  • the proteins were incubated alone ( " left lanes) or with Alhydrogel at the indicated ratios (protein: Alhydrogel) for 30 minutes at room temperature. Following the incubation the samples were eentrifuged to precipitate (he adsorbed protein. The supernatant was then subjected to SDS-PAG E analysis and visualized by Coomassie staining. Lack of detectable protein band indicates binding to Alhydrogel.
  • a or “an” entity refers to one or more of that entity; for example, "a polynucleotide * is understood to represent one or more polynucleotides.
  • she terms “ “ (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
  • nucleic acid or “nucleic acid .fragment” refers to any one or more nucleic acid segments, e r g character DMA or RJSlA fragments, . present in a polynucleotide or construct.
  • Two or more nucleic acids of the disclosure can he present in a single polynucleotide construct, e.g., on a single- plasm id, or in separate (non- identical) polynucleotide constructs, e.g., on separate plasmids.
  • Furthentiofe. any nucleic acid or nucleic acid fragment can encode a single polypeptide, e.g..
  • nucleic acid can encode two or more polypeptides.
  • a nucleic acid can encode a regulatory clement such as a promoter or a transcription terminator, or can encode a specialized, element or motif of a polypeptide or protein, such as a secretory signal peptide or a functional domain.
  • polynucleotide is intended to encompass a singular nucleic acid or nucleic acid fragment as well as plural nucleic acids or nucleic acid. fragments, and refers to. an isolated molecule or construct, a virus genome (e.g., a non-infectious viral genome), messenger RNA (nsKNA), plasmid DNA pDNA), or derivatives of pDNA (e.g., minieireles as described in (Darquet, A-M et al , Gene Therapy 4: 1341 -1349, 1 997) comprising a polynucleotide.
  • virus genome e.g., a non-infectious viral genome
  • nsKNA messenger RNA
  • plasmid DNA pDNA plasmid DNA pDNA
  • derivatives of pDNA e.g., minieireles as described in (Darquet, A-M et al , Gene Therapy 4: 1341 -1349, 1 997) comprising a polynu
  • a polynucleotide can be provided in linear (e.g., RNA), circular (e.g., plasmiti), or branched form as well as double-stranded or single-stranded forms.
  • a polynucleotide can comprise a conventional phosphodiester bond or a non- coiiventionai bond (e.g. , an amide bond, such as found in peptide nucleic acids (P AJ).
  • polypeptide ig intended to encompass a singular "polypeptide'' as well as phrrai. "polypeptides,” and comprises any chain or chains of two or more -amino- acids.
  • a "peptide,” an ⁇ oligope tide;” a “dipeptlde.” a 'tripeptide,” a “protein “ ' an “amino acid chain,” an “amino acid sequence,' * “a peptide subunit,” or any other term used to refer to a chain or chains of two or more amino acids, are included in the definition of a "polypeptide,” (even though each of these terms can have a more specific meaning) and the term “polypeptide” can be used instead of, or interchangeably with any of these terms.
  • the terra former includes polypeptides which have undergone post-translatiotial modifications, for example, g!yeosyjation, acetylation, phosphorylation* amtdation,- derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturall occurring amino acids.
  • multivalent oligopeptide'' a used herein refers to a fusion protein comprising two or. more attenuated staphylococcal proteins, e.g.,. supeianugea (SAg) toxoids or an fragments, variants, or derivatives thereof tused together .as a single polypeptide in any order.
  • An oligopeptide can include other heterologous -peptides as described elsewhere herein.
  • Other peptides for inclusion in a multivalent oligopeptide provided herein include various other, staphylococcal, toxoids or fragments, variants, or derivatives thereof, described elsewhere herein or in PCT Publication NETS.
  • WO 2012/1.09167A 1 and WO 201 3/082558 A S which are both incorporated by reference herein in their entireties.
  • toxoids and oligopeptides of fusions of toxoids are- collectively referred to herein as a "multivalent oligopeptide and/or SAg toxoid," or a “multivalent oligopeptide, SAg toxoid, or .any combination thereof. " These collective references are meant to include, without limitation, any one toxoid or oligopeptide as provided herein, or two, three, four, or more toxoids or oligopeptides as provided herein,
  • fragment when referring to a multivalent oligopeptide and/or SAg toxoid of the present disclosure include any polypeptide which retains at leas some of the immunogenicity or antigenicity of the source protein or - I ! - proteins.
  • Fragments of multivalent oligopeptides and/or SAgs as described herein include proteolytic fragments, deletion Ixagmettts or fragments ihat exhibit increased solubility during expression, purification, and/or administration to aa animal.
  • Fragments of multivalent oligopeptides and/or SAgs as described herein further include proteolytic fragments or deletion fragments which exhibit reduced pathogenicity or toxicity w en delivered to a subject
  • fragments tlirtlier include any portion of the polypeptide -which comprises an antigenic or immunogenic epitope of the source polypeptide, including linear as well as three-dimensional epitopes.
  • An- "epitopte fragment” of a polypeptide is a portion of the polypeptide mat contains an epitope.
  • An. “epitopic fragment” can, but need not, contain amino acid sequence in addition to one or more epitopes,
  • variants refers to a polypeptide that differs from the recited polypeptide due to amino acid substitutions, deletions, insertions, and/or modifications. Non-natu rally occurring variants can be produced using art-known mutagenesis techniques. In some aspects, variaat polypeptides differ from an identified sequence by substitution, deletion or addition of three amino acids or fewer. Such variants can generally be identified by modifying a polypeptide sequence, and. evaluating the antigenic or pathogenic properties of the modified polypeptide using, for -example, the representative procedures described herein. In some aspects, variants of a multivalent oligopeptide and or SAg toxoid form a protein complex which is less toxic than the wild- type complex.
  • Polypeptide variants disclosed herein exhibit at least about 85%, 90%,.94%, 95%, 96%. 97%, 98%, 99% or 99.9% sequence identity with Identified polypeptide,.
  • Variant, polypeptides can comprise conservative or non-conservative amino acid substitutions, deletions or insertions * Variants can comprise multivalent oligopeptides and/or SAgs identical to the various wild-type staphylococcal proteins except for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10. 15, 20, or more amino acid substitutions, including specific mutations described elsewhere herein, where the substitutions render comple less toxic than a corresponding wild-type protein complex.
  • Derivatives of multivalent oligopeptides and/or SAgs as described herein are polypeptides which have been altered so as to exhibit additional features not found on the native polypeptide. Examples include fusion proteins.
  • An analog is another form of a multivalent oligopeptide .and/or SAg toxoid described herein.
  • An example is a proprotein which can be activated by cleavage of the proprotein to produce an active mature polypeptide.
  • Variants can aiso ⁇ or alternatively, contain other modifications.
  • a polypeptide can e conjugated or coupled, e.g., fused to a heterologous amino acid sequence, e.g., a signal (or leader) sequence at the N-terniinal end of the protein which c -transiationaUy or post-trans1 ⁇ 4tiona 1y directs transfer of the protein.
  • the polypeptide can also be conjugated or produced coupled to a linker or other sequence for ease of synthesis, purification or identification of the polypeptide 6-His), or to enhance binding of the polypeptide to a solid support.
  • the polypeptide can be conjugated or coupled to an immunoglobulin Fc region.
  • the polypeptide can also be conjugated or coupled to a. sequence that imparts or modulates the immune response t the polypeptide ( .g., a T-cell epitope, B-cel! epitope, cytokine, chemokine, etc.) and/or enhances uptake and/or processing of the polypeptide by antigen presenting cells or other immune system cells.
  • the polypeptide can also be conjugated or coupled to other polypeptides epitopes from Staphylococcus sp.
  • the polypeptide can also be conjugated or coupled to moieties which confer greater stability or improve half life such as, but. not limited to albumin, an immunoglobulin Fc region, polyethylene glycol (PEG), and the like.
  • the polypeptide can also be conjugated or coupled to moieties (e.g., immunogenic carbohydrates, ,g. , a capsular polysaccharide or a surface polysaccharide) from Staphylococcus sp.
  • the polypeptide described herein further .comprises an immunogenic carbohydrate.
  • the immunogenic carbohydrate is a saccharide . .
  • saccharide'' throughout this specification can indicate polysaccharide or oligosaccharide and includes both.
  • Polysaccharides of the disclosure can be isolated from bacteria and can be si ed by known ' methods. r example, full length polysaccharides can be "sized" ( «?,#,, their size can be reduced by various methods such as acid hydrolysis treatment, hydrogen peroxide treatment, sizin by E ULSIFLEX® followed by a hydrogen peroxide treatment to generate oligosaccharide fragments or mieroflui dilation), Polysaccharides can be sized in order to reduce viscosity in polysaccharide samples and/or to improve filterability tor conjugated products. Oligosaccharides have a low number of repeat units (e.g., 5-30 repeat units) and are typically hydralyzed polysaccharides. Polysaccharides of the disclosure can be produced recombinantly,
  • JOCMSI S. aureus capsular antigens are surface associated, limited in. antigenic specificity * and highly conserved among clinical isolates.
  • the immunogenic carbohydrate of the disclosure is a capsular polysaccharide (CP) of SI aureus.
  • CP capsular polysaccharide
  • a capsular saccharide can be a full length -polysaccharide, however in other aspects it can be one oligosaccharide unit, or a shorter than native length saccharide chain of repeating oligosaccharide units.
  • Type 5 has the structure ( ⁇ )-3-0-Ac-S ⁇ -ManNAcA-(l. ⁇ >- «-L- FUCNAC 1 ⁇ *3)-B-D-FUC:N Ac- ⁇ 1 -*) « (Foamier, J. M.. ? et 1987.
  • Type 5 and t polysaccharides differ only the linkages between the sugars and in the sites of 0- acetyf ion of the inannosaminuronic acid, residues, yet they are serologically distinct.
  • Type 5 and 8 CP conjugated to detoxified recombinant Psemhmonas aeruginosa exotox n A currier were shown to be highly immunogenic and protective in a mouse model (A. Fattom et at., Infect Imniiu . 1993 March; 61 (3); 1023-1032; A Fattom et aL, Infect Ininiun. 1996 May; 64(5): 1659-1665 ) and passive transfer of the CP5- specific antibodies from the ' immunized, animals induced protection against systemic infection in mice (Lee et aL, Infect Iramnn.
  • PNSG was identified as the- chemical form of the S, epidermidis capsular pol saccharide/acfcesm (PS/A) which mediates adherence of coagaiase-negative staphylococci (CoNS) to biOmaterials, serves as the capsule for strains of CoNS that express PS/A, and is a target for protective antibodies.
  • PS/A epidermidis capsular pol saccharide/acfcesm
  • CoNS coagaiase-negative staphylococci
  • PNSG is also made by S. aureus, where it is an environmentally regulated, in wVo-exprcssed surf ce polysaccharide and similarly serves as a target, for protective immunity (McK ' enney D. et l, J. Biotecbnol.
  • the immunogenic carbohydrate is a surface polysaccharide, g,, polv-N-acetyiglucosarniiie (PNAG), poly-N-succinyl glucosamine (PNSG), a. surface polysaccharide fragment or a combination thereof.
  • PNAG polv-N-acetyiglucosarniiie
  • PNSG poly-N-succinyl glucosamine
  • Wall TeichoiC Acid (WTA) is a prominent polysaccharide widely expressed o S.
  • WTA is linked to peptidog!ycans and protrudes through the cell wall becoming prominently exposed on non-encapsulated strains such as US A300 responsible for most cases of community acquired MRSA (C RSA) in the US (Hidron, A,i, et al, Lancet Infect Dis s 2009. 9(6): 384-92).
  • C RSA community acquired MRSA
  • Lipoteichotc acid is a constituent of the cell wall of Gfam-positive bacteria, e.g.. Staphylococcus aureus. LTA can bind to target cells non-speeifically through membrane phospholipids, or specifically to CD14 and to Toll-like receptors. Target-bound LTA can interact with circulating antibodies and activate the complement cascade to induce a passive immune kill phenomenon. It also triggers the release front neutrophils and macrophages of reactive oxygen and nitrogen species, acid hydrolases, highly cationic proteinases, bactericidal cationic peptides, growth factors, and cytotoxic cytokines, which can act in synergy to amplify cell damage,
  • a surface polysaccharide is combined with or conjugated to a polypeptide of the disclosure, to certain aspects the surface polysaccharide- is, e.g. , poly- .N-acety.lglueo>samme (P AG), poly-N-succinvi glucosamine- (PNSG), Wall Teichoic Acid (WTA), Lipoteichoic acid (LP A), a fragment of any of said surface polysaccharides, or a combination of two or more of said surface polysaccharides.
  • P AG poly- .N-acety.lglueo>samme
  • PNSG poly-N-succinvi glucosamine-
  • WTA Wall Teichoic Acid
  • LP A Lipoteichoic acid
  • sequence identity refers to a .relationship betwee two •or more -polynucleotide sequences or between two or more polypeptide sequences. When a position in one sequence is occupied by the same nucleic acid base or amino acid in the corresponding position of Che comparator sequence, the sequences are said io b "identical” at that position.
  • the percentage “sequence identity” is calculated by determining the number, of positions at which the identical nucleic acid base or -amino acid occurs in both sequences to yield the number of "identical” positions. The -number of "identical' ' ' positions is then divided by the total number of positions in.
  • Percentage of "sequence identity” is determined by comparing two optimally aligned sequences over a comparison window and a homologous polypeptide from another isolate.
  • the portion of a polynucleotide or polypeptide sequence in the comparison window can comprise additions or -deletions termed gaps while the reference sequence is kept, constant An optimal alignment s that alignment which, even with gaps, produces the greatest possible number of "Identical" positions between the reference and comparator sequences.
  • sequence identity between two sequences can be determined using the version o the program ''BLAST 2 Sequences* which is available from the National Center for Biotechnology information as of September 1, 2004, which program incorporates the programs BLAST (for nucleotide sequence comparison) and BLASTP (for polypeptide sequence comparison), which programs arc based on the algorithm of Karlm and Altschui (Proc. NaiL Acad. Set. USA 90(12 ⁇ :5873-5&77, 1993).
  • BLAST .2 Sequences parameters that were default parameters as of September 1 , 2004, can be used for word size (3), open gap penalt (1 1). extension gap penalty ⁇ ! ).
  • epitope refers to portions of a polypeptide having antigenic or immunogenic activity in an animal for example a mammal, for example, a. human.
  • An 'Immunogenic epitope is defined as a portion of a protein that elicits an immune response m an animal, as determined by any method knows in fee art.
  • antigenic epitope aa used herein, is defined as. a portion of a protein to which an antibody or T-celi receptor can immunospceirically bind its antigen as determined by any method well known in the ait. Immunospecific binding excludes non- specific binding but does not necessarily exclude cross-reactivity with oilier antigens. Whereas all immunogenic epitopes are antigenic, antigenic epitopes need not he immunogenic.
  • a "coding region” is a portion of nucleic acid which consists of codons translated into ammo acids. Although a "stop codon ' (TAG. TGA, or ' f AA) is not translated into an amino acid, it can be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding: sites, transcriptional terminators, and the like, arc outside the coding region.
  • codon optimization is defined herein as modifying a nucleic acid sequence for enhanced expression itt the cells of the host of interest by replacing at least one, more than one * or a significant number, of codons of the native sequence with codons that are more frequently or most frequently used in the genes of that host.
  • Various species exhibit particular bias tor certain codons of a particular amino acid.
  • compositions that are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity or other complications commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically acceptable refers to compositions that are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity or other complications commensurate with a reasonable benefit/risk ratio.
  • the polypeptides, polynucleotides, compositions, and vaccines described herein are pharmaceutically acceptable.
  • an "effective amount” is that amount the administration of which to an individual, either in a single dose or as part of a series, is .effective for treatment or prevention.
  • An amount is effective, for example, when its administration results in a reduced incidence of S. wreus infection relative to an untreated individual, as determined, e.g., after infection or challenge with infectious S. aureus > including, hut is not limited to reduced bacteremia * reduced toxemia, reduced sepsis, reduced symptoms, increased immune response, modulated immune response, or reduced time required for recovery. This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of individual to be treated (e.g.
  • a single dose is from about 10 3 ⁇ 4 to .10 nig/kg body weigh of purified polypeptide or an amount, of a modified carrier organism or v irus * or a fragment or remnant thereof, sufficient to provide a comparable quantity of recombinantly expressed multivalent oligopeptide and/or SAg toxoid as described herein.
  • peptide vaccine or "suhunit vaccine” refers to a composition comprising one or more polypeptides described herein, which when administered to an a imal are useful in stimulating an immune response against staphylococcal (e.g., S, aur us) infection.
  • staphylococcal e.g., S, aur us
  • subject is meant any subject:, particularly a mammalian subject, for whom diagnosis, prognosis, immunization, or therapy is desired.
  • Mammalian subjects include, but are not limited to, humans, domestic animals, farm animals, zoo animals such as bears, sport animate, pet animals such as dogs, eats, guinea pigs, rabbits, rats, mice, horses, cattle, bears, cows; primates such as apes, monkeys, orangutans, and chimpanzees.; can ids such as dogs and.
  • the .subject is a human subject
  • '"subject in need thereof refers to an individual for whom it is desirable to treat, i.e.. to prevent, cure, retard, or reduce the .severity of staphylococcal (e.g., S. aureus) disease ' symptoms, or result in no ' worsening of disease cause by S. aureus over a specified per iod of time, or both.
  • staphylococcal e.g., S. aureus
  • the terms "priming” ' o '"primary” and “boost” or '"boosting” as used herein refer to the initial and subsequent: immunizations, respectively, i.e., in accordance with the definitions these terras normally have in immunology. However, in certain aspects, e.g., where the priming component and boosting component are in a single formulation, .initial and subsequent immunizations are not be necessary as both the "prime” and the "boost" compositions are administered simultaneously *
  • supenmtigenic activity is a measure of a multivalent oligopeptide 's or SAg toxoid's residual toxicity and can be measured in comparison t that of a wild-type SAg toxin or to another reference SAg toxoid or SAg toxoid containing , multivalent oligopeptide.
  • aft increase or decrease in "superant geftic- activity" in comparison to a reference polypeptide can be determined by measuring the activity of a SAg toxin, toxoid, or oligopeptide against isolated peripheral blood mononuclear cells (PBJvlCs) in an in vitro stimulation assay as described elsewhere herein.
  • PBJvlCs peripheral blood mononuclear cells
  • This disclosure provides tor- recombinant oligopeptide fusion proteins comprised of attenuated polypeptide subunits, referred to herein as "toxoids," derived from Staphylococcal superat tigens.
  • the SAg toxoid is attenuated by one or more mutations to decrease its superatiiigenic activity, toxicity, -and/or virulence, while maintaining its itnmvmogeni ity.
  • this disclosure provides for an attenuated Staphylococcus aureus-d&dv&i superaniigen (SAg) Staphylococcal enlerotoxin A (SEA) toxoid or fragment, variant, or derivative thereof, comprising four mutations relative to wild-type SEA corresponding to L48R, D7 , Y.92A, and H225A mutations i SEQ ID NO: 4.
  • SAg Staphylococcus aureus-d&dv&i superaniigen
  • SEA Staphylococcal enlerotoxin A
  • the attenuated SEA toxoid or fragment, variant, or derivative thereof, having the four specified mutations comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 4-
  • the attenuated SEA toxoid or fragment, variant, or deri vative thereof comprises and/or consists of SEQ ID ' MO: 4.
  • toxoid or fragment, variant, or derivatives thereof, having the four specified mutations has decreased -superantigenic activity, decreased toxicity, and or is less virulent than a SEA toxoid consisting of SEQ ID HO: 3.
  • the attenuated SEA toxoid or fragment, variant, or derivative thereof, having the four specified mutations has less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less, than 5%, less than 3%, less than 2%, or less than 1% of the ssuperantigenic activity of a wild- type SEA toxin.
  • the attenuated SEA toxoid or fragment, variant, or derivative thereof having the four specified mutations has less than 50%, less than 40%, less than.
  • the attenuated SEA toxoid or fragment, variant, or derivative thereof, having the four specified mutations has less than 50%, less than 40%, less than 30%, less than 20%, less than. 10%, less than 5%. less than 3%, less tha 2%, or less than 1% of the- superantigenic activity of a SEA toxoid .consisting, of SEQ ID NO: 3.
  • any of the attenuated SEA toxoids or fragments, variants, or derivatives thereof comprising four mutations relative to wild-type SEA corresponding to the L48R, D70R, Y92A, and B2.25A .
  • immuiiogemci y is maintained as compared to a wild-type SEA toxin., a SEA toxoid comprising SEQ ID NO: 3, and/or a SEA toxoid consisting of SEQ ID NO: 3,
  • immunization with the SEA toxoid or fragment, variant, or derivative thereof, comprising the four specified mutations, elicits neutralizing antibodies against a wild- type SEA toxin
  • this disclosure provides a. multivalent oligopeptide comprising a fusion of two or more, e.g. t two, three, four, five, six, seven, eight, nine, ten or more Stiiph !oc-occ aurem- ' derivs toxoids or fragments, variants, or derivatives thereof arranged in any order,
  • the multivalent oligopeptide- comprises a fusion protei of tw or more SAg toxoids having reduced superantigenie activity, toxicity, and/or virulence relative to a SAg fusion protein comprising and/or consisting of SEQ ID NO: 5.
  • the multivalent oligopeptide has less than 50%, less than 40%, less than 30%, less than 20%. less than 10%, less than 5%, l ss than 3%, less than 2%, or less than !
  • the multivalent oligopeptide maintains t e mimunogenicity of the SAg fusion protein comprising and/or consisting of SEQ ID NO: 5.
  • immunization with the -multivalent oligopeptide elicits neutralizing antibodies against a SAg TSST-1 toxin, a SAg SEB toxin, a SAg SEA toxin, or any combmation thereof.
  • immunization with the multivalent oligopeptide elicits neutralizing antibodies to SAg toxins other than TSST-1 , SEB; or SEA.
  • the multivalent oligopeptide exhibits greater and/or broader immunog nicity tha -an .equimolar cocktail of ike individual SAg toxoids from which it is com oses! ( Figure 5),
  • immunization of a subject with the multivalent oligopeptide provides protection against at least one or more of wild-type SAg TSST-1 toxin, wild-type SAg SEB toxin, and wild-type SAg SEA toxin ( Figure 7).
  • the multivalent oligopeptide or a composition comprising the oligopeptide can be used to treat. or prevent a Staphylococcal disease or infection,
  • a multivalent oiigopepiide includes staphylococcal SA toxoid or fragment, variant or derivative thereof including, without limitation, a toxoid derivative of staphylococcal .enterotoxin A (SEA), staphylococcal, enterotoxin B (SEB), staphylococcal enteroiox-his CI-3- (SBC 1-3), staphylococcal enterotoxin £ (SEE), staphylococcal enterotoxin H (SHE), staphylococcal enterotoxin I SEI), staphylococcal enterotoxin K (SE ), staphylococcal toxic shock syndrome toxin- 1 (TSST-1 ).
  • SEA staphylococcal SA toxoid or fragment, variant or derivative thereof including, without limitation, a toxoid derivative of staphylococcal .enterotoxin A (SEA), staphylococcal, enterotoxin B (SEB), staphylococcal enteroiox
  • streptococcal pyrogenie exotoxin .. ' (SpeC), staphylococcal enterotoxin D (SED), streptococcal pyrogenie exotoxin A (SpcA), or any combination thereof in any order.
  • the multivalent oligopeptide includes staphylococcal toxic shock syndrome toxin- 1 (TSST-1) toxoid or fragment, variant, or derivative thereof.
  • TSST-1 toxoid is the attenuated toxoid TSST- lu iWAtmA (SEQ ID NO: 1), or a TSST- 1 toxoid comprising the three attenuating mutations relative io wild- type TSST-1 corresponding to the L30R, D27A, and I46A -mutations in SEQ ID NO: 1
  • multivalent oligopeptide as provided herein comprises at least one Staphylococcal enterotoxin A (SEA) attenuated toxoid comprising four mutations relative to wild-type SEA correspondin to the L48R, D70R, Y92A, and. H225A. mutations in SEA. «R/E>?oR,'y ⁇ 2A, «?.SA. (SEQ ID NO: 4) as described elsewhere herein.
  • the multivalent oligopeptide comprises two or more or three or more SAg toxoids or fragments, variants, or derivatives thereof.
  • the oligopeptide further comprises a staphylococcal enterotoxin 8 (SEB) attenuated toxoid as described elsewhere herein, a staphylococcal toxic shock syndrome toxin- 1 (TSST- 1 ) attenuated toxoid as described elsewhere herein, and any combination thereof.
  • SEB staphylococcal enterotoxin 8
  • TSST- 1 staphylococcal toxic shock syndrome toxin- 1
  • the TSST- 1 toxoid comprises three mutations relative to -wild-type TSST-I corresponding to the L30 , D27A, and 146A mutations in SEQ ID NO: 1 and a amino acid sequence at least 90% identical to SEQ ID NO: !
  • the SEB toxoid comprises three mutations, relative to wild-type SEB corresponding to the 1,451 , Y89A, and Y94A mutations in SEQ ID NO: 2 and a amino acid sequence at. least 90% identical to SEQ ID NO: 2: and.
  • the SEA attenuated toxoid comprises four mutations relative to wild-type SEA corresponding to the L48R, D7QR, Y92A, and H225A mutations in the SEA toxoid of SEQ ID NO; 4- and- an amino acid sequence at least 90% identical to SEQ ID NO: 4, in certain aspects, the- TSST-I toxoid comprises the amino acid sequence SEQ ID NO: 1 ; the SEB toxoid comprises the amino acid sequence of SEQ ID NO: 2; and the SEA attenuated toxoid comprises the amino acid sequence SEQ ID NO: 4,
  • the SAg toxoids included in the multivalent oligopeptide can be directly fused to each other, In other aspects, the SAg toxoids included in the multivalent oligopeptide can be associated via a linker.
  • Suitable linkers can be chosen based on their ability to adopt a flexible, extended confonnatiun, or a secondary structure that can interact with joined epitopes, or based on their ability to increase overall solubility of the fusion polypeptide, or based on their lack of electrostatic or water-interaction effects that influence joined peptide regions.
  • the linker is a peptide linker.
  • a peptide linker for use in a multivalent oligopeptide as provided herein can include at least one, but no more than 50 amino acids, e.g. * small amino acids that provide a flexible chain, e.g. ? glycine, serine, alanine, or a combination thereof.
  • a linker for use in a multivalent oligopeptide as provided herein can include (GOGS, ! or (GGGGS) n * wherein n is a integer from 1 to 10, In certain aspects, socli as in the fusion peptide rTBA225 ⁇ SEQ ID NO: 6), the linker is a (GGGGS),; linker in which w ::: 3.
  • the multivalent oligopeptide comprises, consists of, or consists essentially of the amino acid sequence SEQ ID NO: 6.
  • the multivalent oligopeptide and/or SAg toxoid as provided herein can be attached to a heterologous polypeptide.
  • Various heterologous polypeptides can be used, including, but not limited to an N ⁇ or Oterminal peptide imparting stabilization, secretion, or ' simplified purification, such as a hexa-lBslidme-tag, a ubiquitin lag, a NiisA tag, a ckilin binding domain, ompT, ompA, pelB, DsbA, DsbC, c- myc, KSi, polyaspartic acid, (Ala-Trp-Trp-Prqjn, polypbenyalanine, polycysteine, pofyarg ine, a B-iag, a HSB-lag, green fluorescent protein (GFP), influenza virus hemagglutinin (HAI), a cal
  • T7gene10 an avidin/stre tavidiri Strop-tag complex, trpE, chlorarup enicol aeetyltransferase !: iacZ ( -Galactosidase), His-patch thioredoxia, thioredoxin, a FLAGTM peptide (Sigtna-Aklrich), an S ⁇ tag s .
  • Heterologous polypeptides can also include any pre- and/or pro- sequences thai facilitate the transport, translocations, processing and/or purification of a multivalent oligopeptide and/or SAg toxoid as described herein, from a host cell or any useful immunogenic sequence, including but not limited to sequences that encode a T-celi epitope of microbial pathogen, or other immunogenic proteins and ot' epitopes. (0080!
  • the multivalent oligopeptide and/or SAg toxoid attached to a heterologous polypeptide, as described herein can include a peptide linker sequence joining sequences that comprise two or more peptide regions, Suitable peptide linker sequences can be chosen based on their ability to adopt a flexible, extended conformation, or a secondary structure that could interact with joined epitopes, or based on their ability to increase overall solubility of the fusion polypeptide, or based on thei lack of electrostatic, or water-interaction effects that influence joined peptide regions.
  • the .multivalent oligopeptide and/or SAg toxoid -as described, herein is is lated.
  • An "isolated" polypeptide one that has been removed from its natural milieu.
  • the term “isolated” does hot connote any particular level of purification.
  • Recombinants produced multivalent oligopeptides and/or - SAgs as described herein, expressed in non-native host cells is considered isolated for purposes of the disclosure, as is the polypeptide which have been separated, fractionated, or partially -or substantially purified by an suitable technique, including by filtration, chromatography, centrifugation, and the like.
  • the production of multivalent oligopeptides and/or SAgs as described herein can be achieved, by cralturihg a host cell comprising a polynucleotide that operably encodes a polypeptide of the disclosure, and recovering the polypeptide. Determining conditions for cu I taring such a host cell and expressing the polynucleotide are generally specific to the host cell and the expression system and are within the knowledge of one of skill in the art. Likewise, appropriate methods for recovering die polypeptide o the disclosure are known to those in the art, and include, but are not limited to, chromatography, filtration, precipitation, or centrifugation.
  • an isolated polynucleotide comprising a .nucleic acid encoding a multivalent oligopeptide and/or SAg toxoid as described elsewhere herein.
  • an isolated polynucleotide as provided herein further comprises, non-coding regions such as promoters, operators, -or transcription terminators as- described elsewhere herein..
  • the disclosure is directed to the polynucleotide 3 ⁇ 43 ⁇ 4 described herein, and further comprising a heterologous nucleic acid.
  • the heterologous nucleic acid can. in some aspects, encode a heterologous polypeptide fused to the polypeptide as described herein.
  • the isolated polynucleotide as described herein can comprise additional coding regions encoding, e.g., a heterologous polypeptide fused to the polypeptide as described herein, or coding regions encoding heterologous, polypeptides separate from the polypeptide as described herein such as-, but not limited to, selectable makers, additional immunogens, immune enhancers, and. the like.
  • an isolated polynucleotide is a recombinant polynucleotide contained in a vector.
  • the vector is an expression vector.
  • an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host ceils or purified (partially or substantially) polynucleotides in solution.
  • a polynucleotide is 'Recombinant " Isolated pol nucleotides or nucleic acids according to the disclosure further inciude such molecules produced synthetically, The relative degree of purity of a polynucleotide or polypeptide described herein is easily determined by well-known methods.
  • nucleic acids encoding the multivalent oligopeptides and/or SAgs as described herein can readily be accomplished by those skilled in the art, for example, by oligonucleoiide-directed site-specific mutagenesis or de -novo nucleic acid synthesis, j0086
  • Some aspects disclose an isolated polynucleotide comprising a nucleic acid that encodes a multivalent oligopeptide and/or SA toxoid as described elsewhere herein, where the coding region encoding the polypeptide has been eodon-optimJzed.
  • nucleic acid coding regions will encode the same polypeptide due to the redundancy of the genetic code. Deviations in the nucleotide sequence that comprise the eodons encoding the amin acids of any polypeptide chain allow for variations in the sequence of the coding region. Since each eodo consists of three nucleotides, and the nucleotides comprising DNA are restricted to four specific ba es, there are 64 possible combinations of nucleotides, 61 of which encode amino acids (the remaining three codecs encode signals ending translation). The "genetic code" which shows which eodons encode which amino acids is- reproduced herein as Table 2.
  • amino acids are de ignated by more than one eodon.
  • amino acids alanine and proline are coded for by four triplets, serine and argtnine by six, whereas tryptophan and methionine are coded by just one triplet
  • This degeneracy allows; for DNA base composition to vary over a wide range without altering die amino acid sequence of the polypeptides encoded by the DMA, TABLE 2 : The Standard Genetic Code
  • codon usage preference includes translational selection.
  • GC composition strand-specific mutational bias, amino acid conservation, protein hydropathy, trans ri tional selection and even RNA stability.
  • codon usage 3 ⁇ 4 mutational bias One factor that determines codon usage 3 ⁇ 4 mutational bias that shapes genome GC composition. This factor is most significant in genomes with extreme base composition: species with high GC content ( .g., gram positive bacteria). .Mutational bias is responsible not only for Intergenetie difference in codon. usage but also for codon usage bias within the same genome (Ermolaeva M, C rr. Issues Mol Biol 3(4 ⁇ :9 -97, 2001).
  • J0090I Codon bias often correlates with the efficienc of translation of ' messenger RNA (mRNA), which is in turn believed to be dependent on, inter aii . the properties of the codons being translated and the availability of particular transfer NA (tRNA) molecules.
  • mRNA messenger RNA
  • tRNA transfer NA
  • the predominance of selected tRNAs in a cell is generally a reflection of the. codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codo optimization.
  • the present disclosure provides a polynucleotide comprising a codon-optimized coding region which e codes a multivalen oligopeptide and/or S Ag toxoid as described herein.
  • the codon usage is adapted for optimized expression in a given profcaryotic or eukaryoik host cell.
  • the codon usage is adapted for optimized expression in E, coU,
  • SEQ ID NO: 7 is a nuc leotide sequence codon optimized ⁇ £ ⁇ expression encoding the rTBA fusion protein:
  • iacagcecggcatl eaccaaaggcgaa3 ⁇ 4aa tggatctgaataccai!aegcacgaaaa atcacagcaSacctcag aaggtaectacatccactttcagateagcggcgtgaccaacaecgaaaactgccgaceccgattgaactgcegctg .aaagtgaaagtteatggeaaagattcgccg
  • SEQ E) NO: 8 is a nucleotide ' sequence codon optimized for E.coli expression encoding the rTBA225 fusion protein: atgtcgacgaa!gacaaeatcaa ⁇
  • Codon-optimized polynucleoti es are prepared by incorporating codons preferred for use in the genes of a given species into the DMA sequence. Also provided are polynucleotide expression constructs, vectors, host ceils comprising polynucleotides comprising eodoii-optimized coding regions which encode a multivalent oligopeptide and/or SAg toxoid as described erein.
  • Co don usage tables are readily available, for example, at the "Codon Usage Database” available at http://wmv.kaziisa.or.jp/eodon/ (visited October 12, 20] ]). and these tables can be adapted in a number of ways, ( akamura, Y,, el at, "Codon usage tabulated from the international DNA sequence databases: status for the year 2000' * Nitcl. Acids Res. 28:292, 2000).
  • a vector comprising a polynucleotide as provided herein.
  • the terra "vector,” as used herein, refers to e.g., any of a number of nucleic acids into which a desired sequence can be inserted, e.g., by restriction and ligation, for transport between different genetic environments or for expression in a host cell.
  • Nucleic acid vectors can be DNA or NA.
  • Vectors include, but are not limited to. plasmids, phage, phagemids, bacterial genomes, and virus genomes..
  • a cloning vector is one which is able to replicate in a host cell, and which is further characterized by one or more endonucicase restriction sites at which the vector can be cut in a determinable .fashion and int which a desired DNA sequence can be li ated such that the new recombinant vector retains its ability to replicate in the host cell, hi on case of plasraids, replication of the desired sequence can occur many times as the piasmid increases in copy number within the host bacterium or just a single time per host before the host reproduces by mitosis. In the case of phage, replication; can occur activel during a lytic phase or passively during a l sogenic phase. Certain vectors are capable of autonomous replication in a host cell into which they are introduced- Other vectors at e integrated into the genome of a host cell upon introduction into the hast cell, and thereby are replieated along with the host genome.
  • sui table cloning vectors are known in the art and commercially available which can be used with appropriate .hosts.
  • the term "piasmid” refers to a circular, double-stranded construct made up of genetic material ⁇ Le. f nucleic acids), in which the genetic material is extrachrofflosomal and in some instances, replicates autonomously.
  • a polynucleotide described herein can be in a circular or li earized piasmid or in any other sort of vector.
  • Procedures for inserting a nucleotide sequence into a vector e.g., an expression, vector, and transforming or transiecting into an appropriate host cell and cultivating under conditions suitable for expression are generally known hi the art (0099]
  • the disclosure further provides a vector comprising a nucleic acid sequence encoding a raoltivalejil oligopeptide and/or SAg. toxoid as described elsewhere herein, hi certain aspects the vector is an expression vector capable of expressing the mititivalent oligopeptide and or SAg toxoid as described herein in a suitable .host cell.
  • the terra "expression vector” ' refers to a vector that is capable of expressing the polypeptide described herein, / admir ⁇ ?, the vector sequence contains the .regulatory sequences regulating transcription and translation of a polypeptide, Including, but not limited to promoters, operators, transcription termination sites, ribosome binding sites, and the like.
  • expression refers to the biological production of -a product encoded hy a. coding sequence. In roost cases a DNA sequence, including the coding sequence, is transcribed to. form- a messenger- NA (niRNA). The. messenger-RNA is then translated to form a polypeptide product which has a relevant biological, activity. Also, the process of expression can involve further processing steps to the R A product of transcription, such as splicing to remove introns, and/or post-translarional processing of a polypeptide product.
  • Vector-host systems include, but are not limited to, systems such as bacterial, mammalian, yeast, insect or plant cell systems, either in vivo., e.g., in an animal or in vitro, e.g. , in bacteria or in cell cultures.
  • the selection of an appropriate host is deemed to be within the scope of those skilled in the art from the teachings herein.
  • the host ceil is a bacterium, and insect cell, a .mammalian, cell, or a plant cell.
  • the bacterium is £. coii.
  • Host celts are genetically engineered (infected, transduced, transformed, or- transfected.) w ith vectors of the disclosure.
  • a host cell comprising a vector which contains the polynucleotide- as describe herein.
  • the engineered host cell can be cultured in conventional nutrient media modified as appropri te for activating promoters, selecting iransform.an.ts or amplifying the polynucleotides.
  • the culture conditions such as temperature, pM and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
  • trans ect refers to any procedure whereby .eukaryotic celts are induced to accept and incorporate into their genome isolated DNA, including but not limited to DNA in the form of a plas.ra.id.
  • transform refers to any procedure whereby bacterial cells are induced to. accept and incorporate into their genome isolated DNA, includmg but not limited to DNA in the form of a plasmid.
  • Bacterial host-expression vector systems include, , but are not limited to, a pr karyote ( g., coli), transformed with recombinant bacteriophage DMA, plasmid DMA or cosmid D A.
  • the plasmids used with E, coil use the T7 promoter-driven system regulated by the Lad protein via 1PTG induction.
  • suitable vectors are blown to those of skill in the art, and are commercially available.
  • the following bacterial vectors are provided by way of example: pET ( ovagen). pBT28, p ' BAD, pTrcHIS, pBR322, pQE7D, pQE60, pQE-9 (Qiagen),- phagescript.
  • pNH46A (Stratagene), ptre99» f pKK223-3, pKK243-3, pDR540, pBR322, pPS lO, RSF101 O, pRTI'5 (Pharmacia); pCR (Invitrogen); pLex (mvitrogen), aiid UC plasmid derivatives.
  • a suitable expression vector contains regulatory sequences mat can b operabLy joined to an inserted nucleotide sequence encoding the multivalent oligopeptide and/or SAg toxoid as described herein.
  • regulatory sequences means nucleotide sequences which are necessary for or conducive to the transcription of an inserted sequence encoding a multivalent oligopeptide and/or S Ag toxoid as described herein by a host cell and/or which are necessary for or conducive to the translation by a host cell of the resulting transcript into the desired multivalent oligopeptide and/or SAg toxoid.
  • Regulatory sequences include, but are not limited to, 5' sequences such as operators, promoters and ribosome binding sequences, and 3' sequences such as poiyadenylation signals or transcription terminators. Regulatory sequences can also include, enhancer sequences or upstream activator sequences.
  • bacterial vectors will include origins of replication and selectable markers, e.g., the ampieillin, tetracycl ine, kanainycin, resistance genes of E. col t, permitting transformation of the host cell and a promoter derived from a highly- expressed gene to direct, transcription of a downstream structural sequence.
  • selectable markers e.g., the ampieillin, tetracycl ine, kanainycin, resistance genes of E. col t, permitting transformation of the host cell and a promoter derived from a highly- expressed gene to direct, transcription of a downstream structural sequence.
  • Suitable promoters include, but are not limited to, the 17 promoter* lambda ( ⁇ ) promoter, T5 promoter, and lac promoter, or promoters derived from operons encoding glycolytic enzymes such s 3 -phosplioglycerate kinase (PG ), acid phosphatase, or heat shock, proteins, or inducible promoters like cadmium (pead). and beta-Iactamase (pbla).
  • PG 3 -phosplioglycerate kinase
  • pead acid phosphatase
  • pbla beta-Iactamase
  • the polynucleotide as described herein can be cloned downstream of the promoter, for example, in a poly! inker region.
  • the vector ' is transformed into . an. appropriate bacteria! strain, and DNA is prepared using standard techniques.
  • the orientation and UNA sequence of the polynucleotide as well as all other elements included in the vector, are confirmed using restriction mapping, DNA sequence analysis, and/or PCR analysis.
  • Bacterial cells harboring the correct piasmid can be stored s cell banks.
  • compositions as described herein cart further comprise, additional immunogenic components, e.g., as a multivalent vaccine, as well as carriers, excipients or adjuvants.
  • jftlQSJ Compositions as provided herein can be formulated according to known methods.
  • compositions can be in. a variety of forms, including, but not limited to an aqueous solution, an emulsion, a gel, a suspension, lyophilized form, or any other form known in the art.
  • the composition can contain pharmaceutically acceptable additives including, for example, diluents, binder's, stabilizers, and preservatives.
  • compositions of the disclosure can be admimstered directly to. the subject.
  • the subjects to be treated can be animals; in particular* human subjects can be treated,
  • Carriers that can be used with ⁇ compositions of the disclosure are well known in the .art, and include, without limitation. th.yroglobu1.in, albumins such as human serum albumin, tetanus toxoid, and polyamino acids such as poly W sme. poly L- glutamic acid, influenza, hepatitis B virus core protein, and the like.
  • aqueous carriers can. be used, e.g. water, buffered water, 0.8% saline, 0.3% glycine, hyaluronic acid and the like.
  • compositions- can be sterilized by conventional, well known sterilization techniques, or can be sterile filtered, A resultin composition can be packaged for use as is, or lyophilized, the iyopMlii-ed preparation being combined with, a sterile solution prior to administration.
  • Compositions can contain pharmaceutically acceptable auxiliary substances as to approximate physiological conditions, such as pH adjusting and buffering agents, -tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbttan (nonolaurate, triefhanolamineoleate , etc.
  • compositions as provided herein further include one or more adjuvants, a.
  • immunogenic composition to, for example, enhance, sustain, localize, or modulate an immune response to an immunogen.
  • adjuvant*' refers to any material having the ability to (1) alter or increase the imniune response to a particular antigen or (2) increase or aid an effect of a phannacological agent. Any compound which can increase the expression, antigenicity or iraraunogemcity of the polypeptide is a potential adjuvant.
  • immunogenic carrier refers to a first -moiety., e.g., a polypeptide or fragment, variant, or derivative thereof which enhances the immunogefiieity o * a second polypeptide or fragment, ' variant, or derivative thereof.
  • a great variety of mate-rials have been shown to have adjuvant activity through a variety of mechanisms. For example, an increase in humoral immunity is typically manifested y a significant increase in the titer of antibodies raised to the antigen * and an increase in T-celi -activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion.
  • An adjuvant can -also. lter or modulate an immune response, for example, by changing a primarily humoral or Th2 response into a primarily cellular, or Thj response. Immune responses to a given antigen can be tested b various immunoassays well known to those, of ordinary skill is the art, and/or described elsewhere herein.
  • Adjuvants which can be. used in compositions described herein include, hut arc not limited to: inert carriers, such as alum, bentonite, latex, and acrylic particles; incomplete Freund's adjuvant, complete Freimd's adjuvant; aluminum-based salts such as aluminum ' hydroxide: Alhydrogel (A1(03 ⁇ 4)) . ; aluminum phosphate (AIPO4); calcium-based salts; silica; any T ' LR biological ligancl(s); IDC- 1001 (also known as GLA-SB; .
  • the adjuvant comprises Alhydrogel. The amount of adjuvant, how it is formulated, and how it is administered all parameters which are well within the purview of a person of ordinary skil l in the art.
  • composition of the disclosure further comprises a liposome or other particulate carrier, which can serve, .g., to stabilize a formulation, to target the formulation to a particular tissue, such as lymphoid tissue, or to increase the half- life of the polypeptide composition.
  • particulate carriers include emulsions, foams, miceiles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers, iscorns, and the like.
  • the polypeptid described herein can be incoiporat «d as part of a liposome or other particle, or can be delivered in conjunction with a liposome- Liposomes for use in accordance with, the disclosure can be formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol.
  • a composition comprising a liposome or other particulate suspension as well as the polypeptide as described herein can be administered intravenously, locally, topically* etc. in a dose which varies according to, inter alia, the manner of administration, the polypeptide bein delivered, and the stage of the diseas being treated.
  • nontoxic solid carriers can be used which include, for -example, pharmaceutical grades of mannitoL lactose, starch, magnesium stearate, sodium sacchaiin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like.
  • a pharmaceutically acceptable nontoxic composition- is formed by incorporatin any of the normally employed excipients, such as those carriers previously listed, and generally 10-95% of active ingredient, that, is, the polypeptide as described herein, often at a concentration of 25%-75 .
  • the polypeptide as described herein can be supplied in finely divided form . , optionally along with a surfactant and, propeilant and/or a mucoadliesjve, e.g,, cMtosart.
  • a surfactant and, propeilant and/or a mucoadliesjve e.g,, cMtosart.
  • the -surfactant is pharmaceutically acceptable, and in some aspects soluble in the propeilant.
  • esters or partial esters of fatty acids containing from 6 to 22 carbon atoms such as caproic, octanoie, laufi.c, palmitic, stearic, Imoleie, linoleaic, olesteric and oleic acids with an .aliphatic polyhydrie alcohol or its cyclic anhydride.
  • Mixed esters, such as mixed or natural glycerides can be employed.
  • the surfactant can constitute 0J 3 ⁇ 4-2Q% by weight of the composition* in so e aspects 0,25-5% by weight.
  • the balance of the composition is ordinarily propeilant, although, on atomizer can be used in which no propeilant is necessary and oilier percentages are adjusted accordingly, in some aspects, the immunogenic polypeptides can be incorporated within an aerodynamically light particle, such as those particles described in U.S-, Pat. No. 6,942,868 or U.S. Pat. Pub. No, 2005/0008633.
  • a carrier can also be included, e.g. t lecithin for intranasal delivery.
  • the disclosure is also directed to. a method of producing the composition according to the disclosure.
  • the method of producing the composition comprises (a) isolating a . polypeptide according to the disclosure: and (b) adding an adjuvan carrier and/or exeipient to the isolated polypeptide.
  • Sortie aspects disclose further combining the polypeptide with other staphylococcal antigens,
  • a multivalent vaccine of the present disclosure caa include a multivalent oligopeptide and/or SAg toxoid as described herein, or a polynucleotide encoding a multivalent oligopeptide and/or SAg toxoid, and one or more additional immunogenic components.
  • additional immunogenic components can be additional immunogens of the sgme infectious agent, e.g... S. aureus, or from other staphylococci, or can be immnhogens derived from other infectious agents which can be effectively, conveniently, or economically administered together.
  • the multivalent oligopeptid and/or SAg toxoid as described herein can be combined wit other toxins or other virulent component-based vaccines to make a broad toxin-based multivalent vaccine capable of targeting multiple bacterial virulence det rminate.
  • the multivalent ⁇ oligopeptide and/or SAg toxoid as described herein can he fused to other immunoge ic; biologically significant, or protective epitope containing polypeptides to generate a multivalent vaccine in a sinele chain and induce an immune response against multiple antigens.
  • the multivalent oligopeptide and/or SAg toxoid, as described herein can be fused to one or more T cell epitopes to induce T cell immunity,
  • the subject is an animal, eg>, 3 ⁇ 4 vertebrate, e.g., a mammal. e.g, > a human.
  • Some aspects include a method of inducing m immune response against a S, aureus steam, comprising dministerin to a subject h need of said immune " response an effective amount of a composition comprising a multivalent oligopeptide and/or SAg toxoid as described herein, or polynucleotides- vectors, or host cells encoding same.
  • a subject is administered a composition comprising a multivalent oligopeptide and/or SAg toxoid as described herein, or polynucleotides, vectors, or host cells encoding same prophylacticaliy, e.g,, as a prophylactic vaccine, to establish or enhance immunity tu Staphylococcus ⁇ e.g., 5. aureus, in. a healthy aniina! prior to potential or actual exposure to Staphyloi K-cm, e.g., S.
  • aureus or contraction of a Staphyhmc-c s-re ⁇ &ted symptom thus preventing disease, alleviating symptoms, reducing symptoms, or reducing the severity of disease symptoms, fn one aspect die disease is a respiratory disease, e.g. , pneumonia.
  • Other diseases or conditions to be treated or prevented include, but are not limited to, bacteremia, sepsis, skin infections, wound infections, endocarditis, bone and joint infections, osteomyelitis., arid/or meningitis.
  • One or more compositions, polypeptides, polynucleotides, vectors, or host cells as described herein can also be used to treat a subject already exposed to Staphylococcus, e.g., S.
  • treatment of an animal refers to the use of one or more compositions, polypeptides, polynucleotides, vectors, or host ceils of the disclosure to prevent, cure, retard, or reduce the severity of S, aureus symptoms in an animal and/or result in no worsening of S. aureus symptoms over specified period of time.
  • Ft is not required that any composition, polypeptide, polynucleotide a vector, or a host cell as described herein provides total protection against a staphylococcal infection or totally cute or eliminate all Staphylococcus related symptoms
  • a subject in. need of therapeutic aad/or preventative immunity refers, to a subject in which it is desirable to treat, i.e., to prevent, cure, retard, or reduce the severity of Staphylococcus related symptoms, or result in no worsening of Staphylococcus related symptoms over a ' s ecified period of time.
  • a subject .in -need of the immune .response refers to a subject for which .an immune resportse(s) against a S Staphylococcus, related disease is desired.
  • Treatment with phannaceutical compositions comprising an immunogenic composition, polypeptide or polynucleotide as described herein can occur separately or conjunction with other treatments, as appropriate.
  • compositions, polypeptide or polynucleotide of die disclosure is administered to a patient in an amount sufficient to elicit an effective innate, humoral and/or cellular response to the multivalent oligopeptide and/or SA toxoid to cure or at least partially arrest symptoms or complications.
  • An. amount adequate to accomplish this is defined as 'therapeutically effective dose” or "unit dose.” Amounts effective for this use will depend on, e.g., the polypeptide or polynucleotide composition, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, -and- the judgment of the prescribing physician, In some aspects, a priming dose is followed by a boosting dose over a period of lime.
  • an initial inumrakation (that is for therapeutic or prophylactic administration) is administered followed by boosting dosages in the same dose range pursuant to a boosting-regimen over weeks to months depending upon the patient's response and condition by measuring the antibody or T lymphocyte response in the patient's blood.
  • Polypeptides and compositions as described herein can generally be employed in serious disease states, mat is, life-threatening or potentially life " threatening situations. In such cases, in view of the minimi ation of extraneous substances and the relative nontoxic nature of the polypeptides, it is possible and can be felt desirable by the treating, physician to administer substantial excesses of these polypeptide compositions.
  • administration can begin at the first sign of S. aureus infection or risk factors, in certain aspects, the initial dose is followed by boosting doses until, e.g., symptoms are substantially abated and for a period thereafter. In frequent infection loadi ng doses followed by boosting doses can be indicated,
  • the composition as described herein is delivered to a subject by methods described herein, thereby -achieving an effective immune response, and/or an effective therapeutic or preventative immune response.
  • Any mode of administration can be used s long as the mode results in the delivery and Or expression of the desired polypeptide in the desired tissue, in an amount sufficient to generate an Immune response to Staphylococcus, e.g., S. aureus, and/or to generate a prophylactically or therapeutically -effective: immune response to Staphyloco cus * eg., to S. aureus, in an animal in need of such response.
  • a composition described herein can be administered b mucosal delivery, transdermal delivery, subcutaneous injection, intravenous injection, oral administration, pulmonary administration, intramuscular (fm.) administration, or via intraperitoneal injection.
  • Other suitable routes of administration include, but not limited to intratracheal, transdermal, intraocular, intranasal, inhalation, inrracavity, intraductal (e.g., into the pancreas) and intraparenchymal (i.e., into any tissue) administration.
  • Transdermal delivery includes, but not limited, to intradermal (e.g., into the dermis or epidermis), transdermal ( ⁇ ?,#; > percutaneous) and trans mucosal administration (i.e., into or through skin or mucosal tissue), hitracavity administration includes, but not limited to ad minis (rati n into oral, vaginal, rectal, nasal, peritoneal, or intestinal cavities as well as. intrathecal ( v. t into spinal canal), intraventricular (i.e., into the brain ventricles or the heart ventricles), intraarterial (i.e., into the heart allium) and sub arachnoidal (Le. * into the sub arachnoid spaces of the brain) administration.
  • intradermal e.g., into the dermis or epidermis
  • transdermal ⁇ ?,#; > percutaneous
  • trans mucosal administration i.e., into or through skin or mucosal tissue
  • Any mode of administration can be used so long as the mode results in the del ivery and/or expressio of the desired polypeptide ill an amount sufficient to generate an immune response to Staphylococcus, e.g., 5. aureus, and/or to generate a prophylactically or therapeutically effective immune response to Stap ylococc , e.g., S. aureus, in an animal in. need of such response.
  • Admini stration as described herein can be by e.g.. needle injection, or other delivery or devices known in the art
  • composition comprising a multivalent oligopeptide and/or SAg toxoid s described herein, or polynucleotides, vectors, or host cells encoding same, stimulate an .antibody response or a cell-mediated immune response sufficient for protection of an animal against Staphylococcus, e.g., S. aureus infection.
  • a composition comprisin a multivalent oligopeptide and/or SAg toxoid as described herein, or polynucleotides, vectors, or host cells encoding same, stimulate both a humoral and a cell-mediated response, the combination, of which is sufficient for protection of an animal against Staphylococcus * e.g., S.
  • compositions comprising a multivalent oligopeptide and/or SAg toxoid as described herein, or polynucleotides, ve tors, or host ceils encoding same, further stimulates an innate, an antibody, and/or a cellula mmune response.
  • compositions comprising a multivalent oligopeptide and/or SAg toxoid as described herein, or polynucleotides, vectors, -or host cells encoding same, can induce antibody responses to S, aureus, ⁇ certain aspects, components that induce T cell responses (e.g., T cell epitopes) are combined with components such as the polypeptides as described herein that primarily induce -an antibody response.
  • compositions as described herein ears be administered to an animal at any time during the lifecycle of the animal to which it is being admi istered. Jo humans, administration of the composition as described herein can, and often advantageously occurs while other vaccines are being administered, e.g., as a multivalent vaccine as described elsewhere herein. jftIM] Furthermore, the composition as described herein can be used in any desired immunization or administration regimen; e.g. * . in a single administration or alternatively as part of periodic vaccination regimes such as annua!
  • Prime-boost protocol is often a suitable method -of administering vaccines.
  • a prime-boost protocol one or more compositions as described herein can be utilized in a "prime boost” regimen.
  • An example of a "prime- boost” regimen ca be found in Yang, Z. et at J. Virol. 77:799-803, 2002, which is incorporated herein by reference in its entirety.
  • Infections to be treated include.de» but are not limited to a localized or systemic infection of skin, soft tissue, blood, or an organ or an auto-immune disease.
  • Specific diseases or conditions to be treated or prevented include, bat are not limited to, respiratory diseases, e.g., pneumonia, sepsis, skin infections, wound, infections, endocarditis, bone and joint infections, osteomyelitis, and or meningitis.
  • aureus-m ' cuted pneumonia in .adult, immunocompetent C57BL/6J mice is described, which closely mimics the clinical and pathological features of pneumonia in human patients. (Bitbeck-Wardenburg J. et ml., infect Immun. 75: 1040-4 ⁇ 2007 ⁇ ). Additionally., virulence has been tested in a rat model of S aureus- pneumonia as described in McElray et al (McBlroy MC. el . , infect Immut 67:554.1-4 (1999)), Finally, is standardized and reproducible model of MRSA-induced septic pneumonia to. evaluate new therapies was established in sheep, (Lnkhbaatar P. et al.. Shock, 29 ⁇ 5);642- 9 (2008)).
  • P ' BM were incubated in culture .medium in individual wells of 96 well plates with various concentration of wild type TSST-1 or toxoids such as rTBA at 37 °C and 5% CO2 .in a humidified ' incubator. After 48 hours of culture, the plates were eentrifuged for 5 minutes and supematants removed. The IFNy concentration in each well was measured using an ELISA kit from R&D Systems according to manufacturer's instructions. The conceu ' trat ' ion of induced IFNy was plotted against the concentration of the toxin or toxoid to determine EC» ' (50 percent effective concentration) for each agent,
  • a mutation was introduced at position H225A into WT SEA, rSEAI.48R/D70R/Y92A as well as rTBA.
  • the new mutants are referred lo herein as SEAH225A (S.BQ ID NO: 1 1 ), rSEAVax225 (also as SEAI48R/D70R/Y92A H225A) (SEQ ID NO: 4), and rTBA225 (SEQ ID NO: 6), respectively, and were tested in the PBMC stimulation assay.
  • Introduction of the single 11225 A mutation into wild-type SEA (SEAM225A) attenuated the toxin but left significant levels of residua! toxicity ( Figure 4).
  • the bacterial cell were harvested,, weighed, and resuspended in cell lysis buffer (20 mM ' Iris pH 8.0. 50 mM .NaCl, 1 mM EDTA, 0.1% Triton X-i00). Lyso2yme was added ( 1 mg/mLJ, and the cells were incubated at 37 C C for 30 minutes. The partially lysed cells were sonicated. Bacterial cell lysis was confirmed, spectrophotometrieal ly . The cell lysate was adjusted to 0.5 M NaCl, and the nucleic acid was precipitated b the addition of polyctlrylencmiinc ( ⁇ ) under constant mixing.
  • the ⁇ pellet was removed by eentrifugation, and the supernatant containing the toxoid was subjected to ammonium, sulfate (( HihSC ) precipitation.
  • the ( H ⁇ SGu pellet w s recovered by eentrifugation and stored at -80°C.
  • mice were immunised, 3 times with 4 day interval, with either rTBA or a cocktail of the three toxoids along with Sigma ' Adjuvant System (SAS) adjuvant Day 35 sera from these mice were tested for total antibody EL1SA and toxin neutralization (TNA). titers.
  • SAS Sigma ' Adjuvant System
  • PB G Peripheral blood mononuclear eel!s(PB G) were isolated from heparinized blood of healihy munan donors by Ficoll gradient c nirifugaiioa, isolated PSMCs were re-suspended in EPMl 640 with 5% fetal bovine serum (FBS), cells were washed, enumerated by Trypan blue exclusion and adjusted to 2x10* cells/ml.
  • FBS fetal bovine serum
  • mice were immunized three times with 20 ,g either of SAg cocktail (equiniolar amounts of each individual toxoid), rTBA, or rTBA225 along with Alhydrogel. After the third immunization, mouse sera were tested for binding and neutralization titers by EL!SAs and toxin neutralization assay (TNA) for the antigens SEA, SEB and TSST-i.
  • SAg cocktail equiniolar amounts of each individual toxoid
  • rTBA rTBA225
  • Alhydrogel Alhydrogel
  • mice vaccinated with the fusion constructs had a strong total antibody (Figure 5 A) and neutralizing antibody response (Figure 5B) to all three superantigens.
  • Figure 5 A mice vaccinated with the fusion constructs had a strong total antibody (Figure 5 A) and neutralizing antibody response (Figure 5B) to all three superantigens.
  • Figure 5B neutralizing antibody response
  • EXAMPLE 5 Protective efficacy of rTBA225 vaccine against toxin challenge with SEA, SEB, and TSST-1
  • rTBA225 The protective efficacy of rTBA225 against SAg toxin challenge was evaluated by immunizing Baib'e rake with 20 ⁇ ig of rIBA225 thrice along with Alhydrogel as the adjuvant followed by challenge with an intraperitoneal lethal dose of SEA (10 ⁇ ig/reouse ⁇ ., SEB (3.315 ug niouse) or TSST-1. (10 ⁇ tg mouse) potentiated by 40 & ⁇ ⁇ $ ⁇ TPS. Weights and health scores of the mice were monitored tor fiv days after the challenge. As shown in Figure 7, immunization with iTBA225 provided 100% protection to SEB and TSST-1 challenge and 90% protection to SEA challenge. These data demonstrate the protective efficacy of rTBA225 against challenge with the respective toxins.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

The present disclosure provides immunogenic compositions useful in prevention and treatment of Staphylococcus aureus infection. In particular, the disclosure provides multivalent oligopeptides, fusion proteins comprising two or more staphylococcal superantigen (SAg) proteins, or any fragments, variants, or derivatives thereof fused together as a single polypeptide in any order.

Description

IMMUNOGENIC COMPOSITION COMPRISING A FUSION PEPTIDE DERIVED FROM SUPERA TiGEN TOXOIDS
Inventors: Mohammad Javad Aman,
Thomas ort,
Arcndhami Venkaiasubramaniam,
Nils Wiliiston,
Rajaii Prasad Adhikari,
Frederick W Hollsberg
CROSS-REFERENCE TO RELATED APPLICATIONS
(0001] This application claims the 'benefit of VS. Provisional Patent Application No, '62/537,706. fded July 27, 2017, which is incorporated herein by reference in its entirely.
J00ft2] This application is related to U.S. Patent Application No. 14/899,993, filed December 18, 2015, now VS. Patent No. 9,81 : 5,872, which is incorporated by reference herein in its entirety.
INCORPORATION OF SEQUENCE LISTING
(0003] A sequence listing containing the file named "1BT J76965_PCTjSeqLisiing.Jl,25.ixt,, s which is 34,503 bytes (measured in MS- Windows®), contains 12 sequences, and was created on Jul 19, 2018, is provided herewith and is incorporated herein by reference in its entirety.
GOVERNMENT RIGHTS
This invention was made with Government support tinder All 1 1205 awarded by National institutes of Health. The Government has certain rights in the invention.
BACKGROUND
(0005] Staphylococcus aureus (SA). is a gram-positive human pathoge that causes a wide range of infections from skin and soft tissue infections (SSTI) to life threatening sepsis and pneumonia. It is a leading cause of hospital- and commumty-associated infections worldwide (Brown -el al., 2009, Journal-Clio Microbiol Infect, 15(2); 156- 164). The range of pathologies reflects the diverse abilities of SA to escape the immune response using a plethora of virulence factors: the sujteranfi genie and · pore-forming toxins, c agulase, capsular polysaccharide, adhesios, proteases, complement ^activating exoproteitts, and other innate response modifiers (Powers and Wardenb rg, 2014, Joumal/FLOS Pathogens. I0(2):el003871).
J 006| Since its .first emergence in the 1960s methiciilin-resislant SA (MRSA) has become endemic in healthcare settings worldwide (Diep. et al„ 2006, J Infect DM, 193 (1 1 ): 1495-1 03). Since the 1990a, community associated MRSA strains (CA-MRSA) emerged, and are- osing a major global challenge ( Bassetti, et al} 2009, Int J Antimicrob Agents, 34 Suppi. 1 ;S 1.5-1 ; Bradley, 2005, Semin Respir Crit Cure Med, 26 (6):643-649; Chambers, 2005, K Engl J Med, 352 (i4): 14S5-I4S7.), There have hence been increasing efforts directed towards the development of vaccines and therapeutics for 5. aureus infections,
|0007| Alpha hemolysin (ot-toxin, Hla) is a major virulence factor in SA pneumonia and SSTI (Bubeck Wardenburg and Schnee ind, 2Q0R, J Exp Med, 205 (2):287~294; Kennedy, et al, 2010, J Inject DL% 202 (7): 1050-1058). Recently, cytolytic short peptides known as phenol soluble modulins (PSMs were identified as key virulence factors that lyse neutrophils, the main line of defense against S. aureus (Wang, et a/., 2007, .Nat ed, 13 (12): 1510- 1514), Another related cytolytic short peptide of staphylococci is known as delta hemolysin or delta toxin (6toxin) the key marker of S. aureus quorum sensing system (agr) (Novkk, et al., 1993, EMBO J, 12 (10}:3 67-3975). A reee epidemiological study "in a cohort of patients with S A bacteremia shows inverse correlation between probability of sepsis and pi-e-existing antibodies to Hla* PSM-o.3, as well as o-toxm (Adhikari, et at., 2012, J Infect Di$, 206 (6);915-923).
}0008 Supera.nti.gem (SAgs) constitute a large family of pyrogenic toxins composed of staphylococcal entero toxins (SEs) and toxic shock syndrome toxin } (TSST-1). In contrast to conventional, antigens that undergo proteolytic processing by antigen presenting cells and are presented as HC peptide. complex to I cells, SAgs cross link T cell receptor (ICR) with MHC Class II and activate up to 30% of T cells (Sehlievert, 1993, Journal The Journal of Infectious Diseases, 167(5): 97-1002} leading to massive release of cytokines and chemokines, enhanced expression as well as activation of eel S- adhesion molecules, increased T-ccll proliferation., and eventually T-ccH apoptosis anergy. This sequence of events can culminate in Toxic Shock Syndrome (TSS),. a life-threatening condition characterized by rash, hypotension, fever, and multisystem dysfunction (Bohach et ai, 1990, Joumal/Crit Rev Microbiol, 17(4):251- 272). Antibodies play an important role in protection against TSS* thus individuals that do not seroconverl towards the offending toxin due to hypo responsive -cells (Mahlkneeht el a!., 1996, JouraaL Hu . frnmunol, 45(l):42-45) and/or T-cel! dependent B-celJ apoptosis (Hofer et n 1996, Journal Prut Natl Acad S i U S A, 93(11 ):5425- 5430) are more likely to experience recurring bouts. Furthermore, at lower non-TSS inducing conecntratioris SAgs impact the virulence of 5. aureus strains through induction of a local excessive inflammatory response.
}0009j A. major challenge in development of multivalent S aureus vaccines "including superantigens is that there are more Ulan 20 different 'SAgs and there is a wide range of variability in SAg presence in. clinical .isolates, because must SAgs are on mobile genetic elements, such as plasmids or pathogenicity islands (Staphylococcal enterotoxin (SEK), Staphylococcal ertterotoxra. Q (SEQ)). lysogenic phages (Staphylococcal enterotoxin A {SEA}), or antibiotic resistance cassettes, like SCC mec Staphylococcal enterotoxin H (SEH) (Oinoe at at., 2002, Joumal J Clin .Microbiol. 4Q(3):857-862). Based on an extensive literature review encompassing over 6000 clinical isolates, the most widely represented super antigens (SAgs) appear to be toxic shock syndrome toxi 1 (TSST-l} and Staphylococcal, enterotoxin C (SEC), followed by SEA, Staphylococcal enterotoxin D (SED), and Staphylococcal enterotoxin B (SBB). More recent studies show the emergence of SEK and SEQ, primarily due to circulation of the USA3Q0 clone (Proft and Eraser, 2003, iouniai/Ciinical and Experimental Immunology, 133(3):299- 3(16). Monoclonal antibodies and vaccination against multiple SAgs have been found to partially protect against SA sepsis in mice. Significant protection has been reported against, pneumonia in rabbits using multivalent immunization with various combinations of detoxified SAgs and cytolysins (Spaulding el aL 2012, Vaccine 3O(34):3O99~109; Sa!gadn-Pabon et al., 2014, J Mec Dis, 210 (S):784~792).
SUMMARY
{0010| In one aspect, this disclosure provides for an attenuated Staphylococcus uure s- dccivcd supcrantigen (SAg) SEA toxoid, or an immunogenic ally or aoiigcmealiy active fragment, variant, or derivative thereof, comprising four mutations relative to wild-type SEA, the four mutations corresponding to the L48R. D70R, Y92A, and H225A mutations in SEQ ID MO: 4. In certain -aspects, the toxoid or fragment, variant, or derivatives thereof, has decreased superantigenic activity and/or is less virulent than a SEA toxoid comprising SEQ ID NO: 3, while maintaining .mnitmogenieit . In certain aspects, the attenuated SEA toxoid or fragment, variant, or derivative 'thereof comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 4. In certain aspects,, the attenuated SEA toxoid or fragment,, variant, or derivative thereof comprises SEQ ID NO: 4. And, in certai aspects, the attenuated SEA toxoid or fragment, variant, or derivative thereof has less than 50%, less than..40%, leas than 30%, less than 20%, less than 10%, less than 5%, less than 3%, less than 2%, or less- than t % of the superantigemc activity of a SEA toxoid comprising SEQ ID NO: 5. It will be understood that ilie nomenclature used herein to describe poi nt mutations (e.g. "I .4S ") are in comparison to wild-type SAg proteins which do not contain, the 'N-tenninal Methionine that was required for heterologous expression.
11 In another aspect, the disclosure further provides for a multivalent, oligopeptide comprising a usion of two or more attenuated Staphylococcus aureus-dczWod superantigen (SAg) toxoids at immnnogenieaHy or antigenically active fragments, variants, or derivatives thereof as described elsewhere herein arranged in any order, wherein the SAg toxoids or fragments, variants, or derivatives thereof can be the same or different, and wherein at least one of the SAg toxoids is a SEA toxoid described elsewhere herein, i certain aspects, the oligopeptide comprises a fusion of three or more SAg toxoids or fragments, variants, or derivatives thereof. In certain aspects, the oligopeptide has decreased superantigemc activity anch r is less virulent t an a SAg fusion protein comprising SEQ ID MO: 5. in certain aspects, the oligopeptide maintains the immunogenjeity of the SAg fusion protein comprising SEQ TD NO: 5. hi certain aspects, the oligopeptide has less than 50%, less than 40%, less than 30%, less than 20%, less than 1.0%, less than 5%, less than 3%, less than 2%, or less than 1% of the superanti genie activity of a SAg fusion protein comprising SEQ ID NO: 5. And, in certain aspects, the oligopeptide is completely attenuated.
21 in certain aspects, the multivalent oligopeptide comprises one or more of a staphylococcal toxic shock syndrome toxin- 1 .(TSST-1.) attenuated toxoid: a staphylococcal enterotoxin B (SEB) attenuated toxoid; or any combination thereof. In certain aspects, the TSST~1 attenuated toxoid comprises three mutations relative to wild- type TSST-l, the three mutations corresponding to the L30 , D27A. and I46A mutations so SEQ ID NO; 1 and an amino acid, sequence at least 90% identical to SEQ ID NO: 1 , In certain aspects, die SEB attenuated toxoid comprises three mutations relative to wild- type SE , the three mutations eorresponding to the L45R, Y89A, and Y94A mutations i SEQ I'D NO? 2 and an amino acid sequence at least 90% identical to SEQ ID NO: 2, in certain .aspects, t&e SEA attenuated toxoid comprises, four mutations relative to wild-type. SEA, the four mutations corresponding to the L48 , O7QR» Ύ92Α, and H225A mutations in SEQ ID NO; 4 and an amino acid sequence at least 90% identical to SEQ ID NO: 4. In certain aspects, the TSST-1 toxoid comprises the amino acid sequence SEQ ID NO; i. In certaia aspects, the SEB toxoid comprises the amino acid sequence SEQ ID NO: 2. In certain, aspects, the SEA attenuated toxoid comprises the amin -acid sequence. SEQ ID NO: 4. In certain aspects, the multivalent oligopeptide comprises the -amino -acid sequence SEQ ID NO; 6,
(00I3J in certain aspects, at- least two SAg toxoids or fragments, variants, or derivatives thereof described elsewhere herein are each associated via a linker. In certain aspects, the linker comprises at least one, but no more than 50 amino acids selected from the gro consistin of glycine, serine, alanine, and a combination thereof. In. certain aspects, the linker comprises; {GOGS)s or (GGG<iS)„. wherein n is a integer from 1 to 10. In -certain aspects, the linker comprises (GGGGS)f;. in certain aspects, n is 3.
{0014! The multivalent oligopeptide can further comprise a heterologous polypeptide. In certain aspects, the heterologous polypeptide comprises a His-tag, a ubi uitin. tag, a NttsA tag, a chiiiii binding domain, a B-tag, a MSB-tag, green fluorescent protein (OFF), a calmodulin binding protein (CBP), a gaiaclose-binding protein, a maltose binding protein {MBP). cellulose -binding, domains (CBD's), -an avidin sta^tavidi /Strep-tag, trpE. chloramphenicol acetyliransferase, laeZ (p-Galactosidase), a FLAG™ peptide, an S-tag, a T7-tag, a fragment of any of the heterologous polypeptides, or a combination of two or more of the heterologous polypeptides. In certain aspects, the heterologous polypeptide comprises an immunogen, a T-eell epitope, a B-cell epitope, a fragment thereof, or a combination thereof.
(00151 The multivalent oligopeptide can also further comprise an immunogenic carbohydrate. In certain aspects, the- immunogenic carbohydrate is a saccharide. In certain aspects, the immunogenic carbohydrate is a capsular polysaccharide or a surface polysaccharide, in certain aspects, the immunogenic carbohydrate is selected from the group consisting of capsular polysaccharide (CP) serotype 5 (CP5), C S, poly-N- acctylglucosaminc (PNAG),. poly-N-succinyl glucosamine (PNSG), Wall Tcichoic Acid {WTA}, Upoteieboic acid (LTA), a fragment of any of the immunogenic carbohydrates, and a combination of tw or more of the immunogenic carbohydrates, hi certain aspects, the immunogenic carbohydrate is conjugated to the oligopeptide, jftOlfi] Further provided for is an isolated polynucleotide comprising a nucleic acid thai encodes an attenuated SEA toxoid polypeptide described elsewhere herein or a multivalent oligopeptide described elsewhere herein. In certain aspects, the polynucleotide comprises the nucleotide sequence SEQ ID NO; 8, The polynucleotide can further comprise a heterologous nucleic acid, in certain aspects, the heterologous nucleic acid comprises a promoter operably .associated with the nucleic acid encoding the oligopeptide. Also provided for is a vector comprising the polynucleotide, in certain aspects, the vector is a plasnttd. Also provided for is a host cell compmiag the vector. I» certain aspects, the host, cell is a bacterium, an insect cell, a mammalian cell, or a plant cell. In certain aspects, the bacterium is Escherichia coli.
[0017] Further provided is a method of producing a multivalent oligopeptide. In certain aspects, the method comprises culturing a host cell described elsewhere herein and recovering the oli opeptide.
fOO!A! Further provided is a composition, such as a therapeutic, immunogenic, and/or antigenic composition, comprising an attenuated SEA toxoid or multivalent oligopeptide described elsewhere herein, or any combination thereof, and a carrier. The composition can further comprise an adjuvant in certain aspects, the adjuvant is alum, aluminum hydroxide, aluminum phosphate, or a giticopyranosyl lipid A-based adjuvant. The composition can also iurther comprise an additional iminunogen. In certain aspects, the additional imniunogen is a bacterial antigen. In certain aspects, the bacterial antigen is selected from the group consisting of a pore forming toxin, a superantigen. a cell surface protein, a fragment of any of the bacterial antigens, and a combination of two or more of the bacterial antigens.
[ΟΟΙθΊ Further provided is a method of inducing a 'host immune response against Staphylococcus aur us. In certain aspects, the method comprises administering to a subject in- need of the immune response an effective amount of an immunogenic or antigenic composition described elsewhere herein. In .certain, aspects, the immune response is selected from the group consisting of an Innate response, a humoral response, an antibody response, a cellular response, and a combination of two or more of the immune responses. In certain aspects, the immune response is an antibody response.
[0020] Further provided is a method, of preventing or treating a. Staphylococcal disease or mfeetion in a subject In certain aspects, the method comprises administering to a subject in need thereof a composition described elsewhere herein. In certain aspects, the infection is a localized or systemic infection of skin, soft tissue, blood, or an organ, or is auto-immune in nature. In certain aspects, the disease is a respiratory disease, for example* pneumonia. In certain aspects, the disease is sepsis.
0021 f A subject In any of the methods disclosed herein can be a m mmal In certain aspects, the nia runai is a human, hi certain aspects, the mammal is bovine or canine.
(00221 A composition, for administration in any of the methods disclosed herein can be administered via intramuscular injection, intradennai injection, intraperitoneal -injection, subcutaneous injection, intravenous injection, oral administration, mucosal administration, intranasal administration, or pulmonary administration,
100231 Further provided tor is' a composition for use in inducing a host immune response against Staphylococcus aureus in a subject. Further' rovided or is a composition f r use in preventing or- treating a Staphylococcal disease or. infection in a subject. Further provided for is a method of producing a vaccine against & aureus infection, m certain aspects, the method comprises isolating an attenuated SEA toxoid described elsewhere herein, a -multivalent oligopeptide described elsewhere herein, or any combination thereof; and combining the toxoid, oligopeptide, or any combination thereof with an adjuvant.
BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES
J002 | Figure 1 is a schematic of rTBA and rTBA225 constructs. Additional -potential configurations of the fusion peptide are also shown, Linker; three repeats of the linker GGGGS (4GS).
10025] Figure 2A-B illustrates purification of rTBA. Fig. 2A) Process for purification of rTBA and rTBA 225. Fig. 2B) SDS-PAGE analysis of rTBA.
{0026} Figure 3 shows the comparative immunogenicity of rTBA versus a cocktail of the three individual toxoids in mice, A) ELISA and toxin neutralization assay (TNA) were performed on pooled sera from 5 immunized mice per group for the three SAgs. B) Groups of 10 mice were immunized 3 times with rTBA formulated either in CpG or Alhydrogel and imiiiunogenicity was determined in ELISA and: TNA assays. Data shown are ELISA O, ; and TNA N su values.
(0027] Figure 4 shows- rTBA and rTBA225 safety profiles. Response of human PBMC from three donors to SEA, rTBA, SEAH225A, rSEA225, mid iTBA2 5.
{0028} Figure 5 shows the comparativ immunogenicity of rTBA225 versus rTBA versus a cocktail of the three individual toxoids in. mice. ELISA and toxin neutralization. assay (TNA) were performed o« individual sera from 10 immunized mice per group for SEA, SEB ant! TSST-T Data shown are ELISA ECJO (A) and TNA NTso values (B)> ΎΝΑ to test for Gross-neutraUzation against other super 'antigens were also performed on pooled sera from the immunized mice. Data shown is percentage neutralization at 1:40 serum dilution (C). Error bars represent standard errors of mean and the asterisks show statistical difference "between rTBA225 and SAg cocktail immunized mice sera as determined by the Mann-Whitney non-parametric test.
[0029] Figure 6 shows adsorption ofrTSST-l (A) and jrTBA225 (B) by Alhydrogel. The proteins were incubated alone ("left lanes) or with Alhydrogel at the indicated ratios (protein: Alhydrogel) for 30 minutes at room temperature. Following the incubation the samples were eentrifuged to precipitate (he adsorbed protein. The supernatant was then subjected to SDS-PAG E analysis and visualized by Coomassie staining. Lack of detectable protein band indicates binding to Alhydrogel.
| 03O| Figure 7 shows protection provided by rTBA225 against toxin challenge. Groups of 10 mice were vaccinated tliree times with BSA as a control or rTBA225 formulated in Alhydrogel and challenged with the indicated doses of wild-type TSST-i , SEA, or SEA. Animals were monitored for 5 da s for mortality and morbidity.
DETAILED DESCRIPTION
1. Definitions
[0031] It is to be rioted that the term "a" or "an" entity refers to one or more of that entity; for example, "a polynucleotide * is understood to represent one or more polynucleotides. As such, she terms " " (or "an"), "one or more," and "at least one" can be used interchangeably herein.
[0032] Furthermore, "and/or" where' used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term and/or" as used in a phrase such as "A and/or B" herein is intended to include "A and Bs" WA or B." "A" (alone), and "B" (alone). Likewise, the term "and/or" as used in a phrase such as "A, B, and/or C is intended to encompass each of the following: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
{ 033J Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one -of ordinary skill in the art to which this disclosure is related. For example* the Concise 'Dictionary of Biomedkine and Molecular Biology* Juo, Pel-Show, 2nd edt,. 2002, CRC Press; The Dictionary of Cell and Molecular Biology. 3rd ed,, 1999, Academic Press; and the Oxford Dictionary Of Biochemistry And Molecular Biology, Revised, 2t)0(), Oxford University Press, provide one of skill with a general dictionary of many of the terms used in this disclosure.
10034] Units, prefixes, and symbols are denoted in their Systems- International de Unites (SI) accepted form. Numeric ranges are inclusive of the numbers defining the range. Uiiless otherwise indicated, amino acid sequences are written left to right in amino to carboxy orientation. The headings provided herein are not limitations of the various aspects or embodiments of the disclosure, which can be had by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification in its entirety.
{0035} Wherever aspects or embodiments are described with the language "comprising," otherwise analogous aspects or embodiments described in terms ofconsisting of" and/or "consisting essentially of are also provided.
{ 0361 Amino acids are referred to herein by their commonly known three letter symbols- or by the one-letter symbols recommended by the lUPAC-LUB Biochemical Nomenclature Commissioa Nucleotides, likewise, are referred to by thei commonly accepted single-letter codes.
{0037] The terms "nucleic acid" or "nucleic acid .fragment" refers to any one or more nucleic acid segments, erg„ DMA or RJSlA fragments, . present in a polynucleotide or construct. Two or more nucleic acids of the disclosure can he present in a single polynucleotide construct, e.g., on a single- plasm id, or in separate (non- identical) polynucleotide constructs, e.g., on separate plasmids. Furthentiofe. any nucleic acid or nucleic acid fragment can encode a single polypeptide, e.g.. a single antigen, cytokine, or regulatory polypeptide, or can encode more than one polypeptide, ,, a nucleic acid can encode two or more polypeptides. In addition, a nucleic acid can encode a regulatory clement such as a promoter or a transcription terminator, or can encode a specialized, element or motif of a polypeptide or protein, such as a secretory signal peptide or a functional domain.
{0038] The term "polynucleotide" is intended to encompass a singular nucleic acid or nucleic acid fragment as well as plural nucleic acids or nucleic acid. fragments, and refers to. an isolated molecule or construct, a virus genome (e.g., a non-infectious viral genome), messenger RNA (nsKNA), plasmid DNA pDNA), or derivatives of pDNA (e.g., minieireles as described in (Darquet, A-M et al , Gene Therapy 4: 1341 -1349, 1 997) comprising a polynucleotide. A polynucleotide can be provided in linear (e.g., RNA), circular (e.g., plasmiti), or branched form as well as double-stranded or single-stranded forms. A polynucleotide, can comprise a conventional phosphodiester bond or a non- coiiventionai bond (e.g. , an amide bond, such as found in peptide nucleic acids (P AJ).
10039] As used herein, the term "polypeptide" ig intended to encompass a singular "polypeptide'' as well as phrrai. "polypeptides," and comprises any chain or chains of two or more -amino- acids. Thus, as used herein, a "peptide," an ^oligope tide;" a "dipeptlde." a 'tripeptide," a "protein "'an "amino acid chain," an "amino acid sequence,'* "a peptide subunit," or any other term used to refer to a chain or chains of two or more amino acids, are included in the definition of a "polypeptide," (even though each of these terms can have a more specific meaning) and the term "polypeptide" can be used instead of, or interchangeably with any of these terms. The terra former includes polypeptides which have undergone post-translatiotial modifications, for example, g!yeosyjation, acetylation, phosphorylation* amtdation,- derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturall occurring amino acids.
.| Q 0| The term "multivalent oligopeptide'' a used herein refers to a fusion protein comprising two or. more attenuated staphylococcal proteins, e.g.,. supeianugea (SAg) toxoids or an fragments, variants, or derivatives thereof tused together .as a single polypeptide in any order. An oligopeptide can include other heterologous -peptides as described elsewhere herein. Other peptides for inclusion in a multivalent oligopeptide provided herein include various other, staphylococcal, toxoids or fragments, variants, or derivatives thereof, described elsewhere herein or in PCT Publication NETS. WO 2012/1.09167A 1 and WO 201 3/082558 A S , which are both incorporated by reference herein in their entireties.
(00411 The collection of toxoids and oligopeptides of fusions of toxoids provided by the disclosure are- collectively referred to herein as a "multivalent oligopeptide and/or SAg toxoid," or a "multivalent oligopeptide, SAg toxoid, or .any combination thereof. " These collective references are meant to include, without limitation, any one toxoid or oligopeptide as provided herein, or two, three, four, or more toxoids or oligopeptides as provided herein,
{0042] The terms 'fragment," "derivative," or "variant" when referring to a multivalent oligopeptide and/or SAg toxoid of the present disclosure include any polypeptide which retains at leas some of the immunogenicity or antigenicity of the source protein or - I ! - proteins. Fragments of multivalent oligopeptides and/or SAgs as described herein include proteolytic fragments, deletion Ixagmettts or fragments ihat exhibit increased solubility during expression, purification, and/or administration to aa animal. Fragments of multivalent oligopeptides and/or SAgs as described herein further include proteolytic fragments or deletion fragments which exhibit reduced pathogenicity or toxicity w en delivered to a subject Polypeptide, fragments tlirtlier include any portion of the polypeptide -which comprises an antigenic or immunogenic epitope of the source polypeptide, including linear as well as three-dimensional epitopes.
Jft043| An- "epitopte fragment" of a polypeptide is a portion of the polypeptide mat contains an epitope. An. "epitopic fragment" can, but need not, contain amino acid sequence in addition to one or more epitopes,
(0O 4J The term "variant," as used herein, refers to a polypeptide that differs from the recited polypeptide due to amino acid substitutions, deletions, insertions, and/or modifications. Non-natu rally occurring variants can be produced using art-known mutagenesis techniques. In some aspects, variaat polypeptides differ from an identified sequence by substitution, deletion or addition of three amino acids or fewer. Such variants can generally be identified by modifying a polypeptide sequence, and. evaluating the antigenic or pathogenic properties of the modified polypeptide using, for -example, the representative procedures described herein. In some aspects, variants of a multivalent oligopeptide and or SAg toxoid form a protein complex which is less toxic than the wild- type complex.
|00 5) Polypeptide variants disclosed herein exhibit at least about 85%, 90%,.94%, 95%, 96%. 97%, 98%, 99% or 99.9% sequence identity with Identified polypeptide,. Variant, polypeptides can comprise conservative or non-conservative amino acid substitutions, deletions or insertions* Variants can comprise multivalent oligopeptides and/or SAgs identical to the various wild-type staphylococcal proteins except for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10. 15, 20, or more amino acid substitutions, including specific mutations described elsewhere herein, where the substitutions render comple less toxic than a corresponding wild-type protein complex. Derivatives of multivalent oligopeptides and/or SAgs as described herein are polypeptides which have been altered so as to exhibit additional features not found on the native polypeptide. Examples include fusion proteins. An analog is another form of a multivalent oligopeptide .and/or SAg toxoid described herein. An example is a proprotein which can be activated by cleavage of the proprotein to produce an active mature polypeptide. jftlMfi] Variants can aiso} or alternatively, contain other modifications., whereby, for example* a polypeptide can e conjugated or coupled, e.g., fused to a heterologous amino acid sequence, e.g., a signal (or leader) sequence at the N-terniinal end of the protein which c -transiationaUy or post-trans¼tiona 1y directs transfer of the protein. The polypeptide can also be conjugated or produced coupled to a linker or other sequence for ease of synthesis, purification or identification of the polypeptide 6-His), or to enhance binding of the polypeptide to a solid support. For example, the polypeptide can be conjugated or coupled to an immunoglobulin Fc region. The polypeptide can also be conjugated or coupled to a. sequence that imparts or modulates the immune response t the polypeptide ( .g., a T-cell epitope, B-cel! epitope, cytokine, chemokine, etc.) and/or enhances uptake and/or processing of the polypeptide by antigen presenting cells or other immune system cells. The polypeptide can also be conjugated or coupled to other polypeptides epitopes from Staphylococcus sp. and/or from other bacteria and/or other viruses to generate a hybrid immunogenic protein that alone or in combination with various adjuvants can elicit protective immunity to other pathogenic organisms. The polypeptide can also be conjugated or coupled to moieties which confer greater stability or improve half life such as, but. not limited to albumin, an immunoglobulin Fc region, polyethylene glycol (PEG), and the like. The polypeptide can also be conjugated or coupled to moieties (e.g., immunogenic carbohydrates, ,g. , a capsular polysaccharide or a surface polysaccharide) from Staphylococcus sp. and/or from other bacteria and/or other viruses to generate a modified immunogenic protei that alone or in combination with one or more adjuvants cm enhance and/or synergize protective immunity. In certain aspects, the polypeptide described herein further .comprises an immunogenic carbohydrate. In one aspect, the immunogenic carbohydrate is a saccharide..
160 7] The term "saccharide'' throughout this specification can indicate polysaccharide or oligosaccharide and includes both. Polysaccharides of the disclosure can be isolated from bacteria and can be si ed by known' methods. r example, full length polysaccharides can be "sized" («?,#,, their size can be reduced by various methods such as acid hydrolysis treatment, hydrogen peroxide treatment, sizin by E ULSIFLEX® followed by a hydrogen peroxide treatment to generate oligosaccharide fragments or mieroflui dilation), Polysaccharides can be sized in order to reduce viscosity in polysaccharide samples and/or to improve filterability tor conjugated products. Oligosaccharides have a low number of repeat units (e.g., 5-30 repeat units) and are typically hydralyzed polysaccharides. Polysaccharides of the disclosure can be produced recombinantly,
JOCMSI S. aureus capsular antigens are surface associated, limited in. antigenic specificity* and highly conserved among clinical isolates. In one aspect, the immunogenic carbohydrate of the disclosure is a capsular polysaccharide (CP) of SI aureus. In one aspect, a capsular saccharide can be a full length -polysaccharide, however in other aspects it can be one oligosaccharide unit, or a shorter than native length saccharide chain of repeating oligosaccharide units. Serotyping studies of staphylococcal isolates have revealed several putative a sula serotypes, with types 5 and 8 (CPS and CPS) being the most prevalent among isolates from clinical infections, accounting for about 25% and 50% of isolates recovered from humans respectively (O'Riordan and Lee, Clinical Microbiology Reviews, January 2004, p. 218-234, Vol. 17, No. 1 ; Poutrel and Sutra, J Clin Microbiol 1993 Feb;31{2):467-9).. The same isolates were also recovered from poultry, cows, horses and pigs (Toltersrud et a/.. .1 Clin Microbiol. 2000 Aug;38(.8):29 8-3G03; Cunnion. KM et at, Infect tamuii. 2001 Νον·69(1 Ι.):6796-803). Type 5 and 8 capwlar polysaccharides purified from the prototype strains Reynolds and. Becker, respectively, are. structurally very- similar to each other and to die capsule made by strain I, described previously by Wu and Park (Wu and Park. 1971, J, Bacieri i ] :Q8;8?4~88 ). Type 5 has the structure (^)-3-0-Ac-S~ -ManNAcA-(l.~ >-«-L- FUCNAC 1~*3)-B-D-FUC:N Ac-{ 1 -*)« (Foamier, J. M..? et 1987. Aim. lost. Pasteur Microbiol. 08:561-567; M reau, M.s ® at, 1990. Carbohydtr. Res. 201 :28.5-297), and type 8 has the structure ( 3H"OAc-fi-D- SrtN eA-{l *3)-** ..-FucNAc~(1 «3)-fi-D- FucNAc-(!-*)„ (Fouraier, J. .} et al, 1 984. infect. Immprs. 45:87-93). Type 5 and t polysaccharides differ only the linkages between the sugars and in the sites of 0- acetyf ion of the inannosaminuronic acid, residues, yet they are serologically distinct.
J0049] Type 5 and 8 CP conjugated to detoxified recombinant Psemhmonas aeruginosa exotox n A currier were shown to be highly immunogenic and protective in a mouse model (A. Fattom et at., Infect Imniiu . 1993 March; 61 (3); 1023-1032; A Fattom et aL, Infect Ininiun. 1996 May; 64(5): 1659-1665 ) and passive transfer of the CP5- specific antibodies from the 'immunized, animals induced protection against systemic infection in mice (Lee et aL, Infect Iramnn. 1997 October; 65(10): 4146-415 1 ) and against, endocarditis in rats challenged with a serotype 5.5. aureus. (Shinefield II et aL> N Engl J Med. 2002 Feb 14;346 73:49l -6). A bivalent CPS and CPS conjugate vaccine (SlaphVAX^, Nabi Biophaimace tical) was developed that provided 75% protection in mice against S. aureus challenge, The vaccine has been tested on humans. (Pattern AI at at.. Vaccine. 2004 Feb 17;22(7>; 880-7; Maira-Li!ran T et al, Mm lmraun. 2005 Oct;73(10):6752~62). In certain- aspects, the recombinant peptide or multivalent oligopeptide of the disclosure is combined with or conjugated to an immunogenic carbohydrate {e.g., CPS, CPS, a CP fragment or a combination thereof),
1 O50] Immunizaiioii with po]y-N-acerA'Igiucosai¾ke (PNAG) (McKenney D. et al,, Science. 1999 May 28:284(5419): 1523-7} or po!y-N-sttccmyl glucosamine (PNSG) (Tuchsdierr IP. ei al, Meet Immua. 2008 Dee;76(12):573S-44. Epub 2008 Sep 22)? both S, aureus surface carbohydrates, has been shown to generate at least partial protection against 5 aureus challenge in experimental, animal models. PNSG was identified as the- chemical form of the S, epidermidis capsular pol saccharide/acfcesm (PS/A) which mediates adherence of coagaiase-negative staphylococci (CoNS) to biOmaterials, serves as the capsule for strains of CoNS that express PS/A, and is a target for protective antibodies. PNSG is also made by S. aureus, where it is an environmentally regulated, in wVo-exprcssed surf ce polysaccharide and similarly serves as a target, for protective immunity (McK'enney D. et l, J. Biotecbnol. 2000 Sept 29;83(l-2); 37-44), hi certain aspects of the disclosure, the immunogenic carbohydrate is a surface polysaccharide, g,, polv-N-acetyiglucosarniiie (PNAG), poly-N-succinyl glucosamine (PNSG), a. surface polysaccharide fragment or a combination thereof.
(0051] Wall TeichoiC Acid: (WTA) is a prominent polysaccharide widely expressed o S.
aureus strains (Neuhaiis, F.C. and J. Baddiley, Microbiol Mol Biol Rev, 2003. 67(4):686-723 and amisera to WTA have been sh w to induce opsonophagocytic killing alone and i n presence of complement ((Thakker, M., et al, Infect Tmmurt, 1998, 66( 1 i}:5 83-9), and Fattam t l US Patent 7,754,225). WTA is linked to peptidog!ycans and protrudes through the cell wall becoming prominently exposed on non-encapsulated strains such as US A300 responsible for most cases of community acquired MRSA (C RSA) in the US (Hidron, A,i, et al, Lancet Infect Diss 2009. 9(6): 384-92).
| 052| Lipoteichotc acid (LTA) is a constituent of the cell wall of Gfam-positive bacteria, e.g.. Staphylococcus aureus. LTA can bind to target cells non-speeifically through membrane phospholipids, or specifically to CD14 and to Toll-like receptors. Target-bound LTA can interact with circulating antibodies and activate the complement cascade to induce a passive immune kill phenomenon. It also triggers the release front neutrophils and macrophages of reactive oxygen and nitrogen species, acid hydrolases, highly cationic proteinases, bactericidal cationic peptides, growth factors, and cytotoxic cytokines, which can act in synergy to amplify cell damage,
10053| In certain aspects, a surface polysaccharide is combined with or conjugated to a polypeptide of the disclosure, to certain aspects the surface polysaccharide- is, e.g. , poly- .N-acety.lglueo>samme (P AG), poly-N-succinvi glucosamine- (PNSG), Wall Teichoic Acid (WTA), Lipoteichoic acid (LP A), a fragment of any of said surface polysaccharides, or a combination of two or more of said surface polysaccharides.
J00S ) The term sequence identity" as used herein refers to a .relationship betwee two •or more -polynucleotide sequences or between two or more polypeptide sequences. When a position in one sequence is occupied by the same nucleic acid base or amino acid in the corresponding position of Che comparator sequence, the sequences are said io b "identical" at that position. The percentage "sequence identity" is calculated by determining the number, of positions at which the identical nucleic acid base or -amino acid occurs in both sequences to yield the number of "identical" positions. The -number of "identical''' positions is then divided by the total number of positions in. the comparison window and multiplied by 100 to yield the percentage of "sequence identity-." Percentage of "sequence identity" is determined by comparing two optimally aligned sequences over a comparison window and a homologous polypeptide from another isolate. In order to optimally align sequences for comparison, the portion of a polynucleotide or polypeptide sequence in the comparison window can comprise additions or -deletions termed gaps while the reference sequence is kept, constant An optimal alignment s that alignment which, even with gaps, produces the greatest possible number of "Identical" positions between the reference and comparator sequences. Percentage "sequence identity" between two sequences can be determined using the version o the program ''BLAST 2 Sequences* which is available from the National Center for Biotechnology information as of September 1, 2004, which program incorporates the programs BLAST (for nucleotide sequence comparison) and BLASTP (for polypeptide sequence comparison), which programs arc based on the algorithm of Karlm and Altschui (Proc. NaiL Acad. Set. USA 90(12}:5873-5&77, 1993). When utilizing "BLAST .2 Sequences," parameters that were default parameters as of September 1 , 2004, can be used for word size (3), open gap penalt (1 1). extension gap penalty { ! ). gap drop-off (50), expect value (10) and any other required parameter including but not limited to matrix, option. |0 5S| The term "epitope " as used herein, refers to portions of a polypeptide having antigenic or immunogenic activity in an animal for example a mammal, for example, a. human. An 'Immunogenic epitope," as used herein, is defined as a portion of a protein that elicits an immune response m an animal, as determined by any method knows in fee art. The term "antigenic epitope." aa used herein, is defined as. a portion of a protein to which an antibody or T-celi receptor can immunospceirically bind its antigen as determined by any method well known in the ait. Immunospecific binding excludes non- specific binding but does not necessarily exclude cross-reactivity with oilier antigens. Whereas all immunogenic epitopes are antigenic, antigenic epitopes need not he immunogenic.
[0056] As -used herein, a "coding region" is a portion of nucleic acid which consists of codons translated into ammo acids. Although a "stop codon ' (TAG. TGA, or 'f AA) is not translated into an amino acid, it can be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding: sites, transcriptional terminators, and the like, arc outside the coding region.
{0057J The term "codon optimization" is defined herein as modifying a nucleic acid sequence for enhanced expression itt the cells of the host of interest by replacing at least one, more than one* or a significant number, of codons of the native sequence with codons that are more frequently or most frequently used in the genes of that host. Various species exhibit particular bias tor certain codons of a particular amino acid.
[0058 J The terms "composition" or ^pharmaceutical .composition'* can include compositions containing immunogenic polypeptides of the disclosure -along with g,, adjuvants or pharmaceutically' acceptable carriers, excipients, or diluents, which are administered to an individual already suffering from S. aureus infection or an individual in need of immunization against 5. aureus infection.
J00S9] The term "pharmaceutically acceptable" refers to compositions that are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity or other complications commensurate with a reasonable benefit/risk ratio. In some aspects, the polypeptides, polynucleotides, compositions, and vaccines described herein are pharmaceutically acceptable.
|0Q60] An "effective amount" is that amount the administration of which to an individual, either in a single dose or as part of a series, is .effective for treatment or prevention. An amount is effective, for example, when its administration results in a reduced incidence of S. wreus infection relative to an untreated individual, as determined, e.g., after infection or challenge with infectious S. aureus > including, hut is not limited to reduced bacteremia* reduced toxemia, reduced sepsis, reduced symptoms, increased immune response, modulated immune response, or reduced time required for recovery. This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of individual to be treated (e.g. y human, nonhuman primate, primate, etc.), the responsive capacity of the. individual's immune system, the extent of treatment or protection desired, the formulation of the vaccine, a profession al assessment of the medical situation, arid other rel evant factors. It is expected, that the effective amount will fall in a relatively broad range that can he determined through routine trials, Typically a single dose is from about 10 ¾ to .10 nig/kg body weigh of purified polypeptide or an amount, of a modified carrier organism or v irus* or a fragment or remnant thereof, sufficient to provide a comparable quantity of recombinantly expressed multivalent oligopeptide and/or SAg toxoid as described herein. The term "peptide vaccine" or "suhunit vaccine" refers to a composition comprising one or more polypeptides described herein, which when administered to an a imal are useful in stimulating an immune response against staphylococcal (e.g., S, aur us) infection..
{0061] The term "subject" is meant any subject:, particularly a mammalian subject, for whom diagnosis, prognosis, immunization, or therapy is desired. Mammalian subjects include, but are not limited to, humans, domestic animals, farm animals, zoo animals such as bears, sport animate, pet animals such as dogs, eats, guinea pigs, rabbits, rats, mice, horses, cattle, bears, cows; primates such as apes, monkeys, orangutans, and chimpanzees.; can ids such as dogs and. wolves; fel.ids such .as .cats, lions, and tigers; equids such as horses, donkeys, and zebras; food animals such as cows, pigs, and sheep; •ungulates such as deer and giraffes; rodents such as mice, rats, hamsters and guinea pigs; and so on. In one aspect, the .subject is a human subject,
{0062] As used herein, '"subject in need thereof refers to an individual for whom it is desirable to treat, i.e.. to prevent, cure, retard, or reduce the .severity of staphylococcal (e.g., S. aureus) disease' symptoms, or result in no 'worsening of disease cause by S. aureus over a specified per iod of time, or both.
{0063] The terms "priming"' o '"primary" and "boost" or '"boosting" as used herein refer to the initial and subsequent: immunizations, respectively, i.e., in accordance with the definitions these terras normally have in immunology. However, in certain aspects, e.g., where the priming component and boosting component are in a single formulation, .initial and subsequent immunizations are not be necessary as both the "prime" and the "boost" compositions are administered simultaneously*
{00641 As used 'herein, "supenmtigenic activity" is a measure of a multivalent oligopeptide 's or SAg toxoid's residual toxicity and can be measured in comparison t that of a wild-type SAg toxin or to another reference SAg toxoid or SAg toxoid containing, multivalent oligopeptide. For purposes of this disclosure, aft increase or decrease in "superant geftic- activity" in comparison to a reference polypeptide can be determined by measuring the activity of a SAg toxin, toxoid, or oligopeptide against isolated peripheral blood mononuclear cells (PBJvlCs) in an in vitro stimulation assay as described elsewhere herein.
II . Superatitigen (SAg) Toxoids and Multivalent Oligopeptides
{0065} This disclosure provides tor- recombinant oligopeptide fusion proteins comprised of attenuated polypeptide subunits, referred to herein as "toxoids," derived from Staphylococcal superat tigens. In certain aspects, the SAg toxoid is attenuated by one or more mutations to decrease its superatiiigenic activity, toxicity, -and/or virulence, while maintaining its itnmvmogeni ity. Accordingly, this disclosure provides for an attenuated Staphylococcus aureus-d&dv&i superaniigen (SAg) Staphylococcal enlerotoxin A (SEA) toxoid or fragment, variant, or derivative thereof, comprising four mutations relative to wild-type SEA corresponding to L48R, D7 , Y.92A, and H225A mutations i SEQ ID NO: 4. In certain aspects, the attenuated SEA toxoid or fragment, variant, or derivative thereof, having the four specified mutations, comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 4- In certain aspects, the attenuated SEA toxoid or fragment, variant, or deri vative thereof comprises and/or consists of SEQ ID 'MO: 4. it will be understood that the nomenclature used herein to describe point mutations (e.g.
Figure imgf000020_0001
toxoid or fragment, variant, or derivatives thereof, having the four specified mutations, has decreased -superantigenic activity, decreased toxicity, and or is less virulent than a SEA toxoid consisting of SEQ ID HO: 3.
| 067| In certain aspects, the attenuated SEA toxoid or fragment, variant, or derivative thereof, having the four specified mutations, has less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less, than 5%, less than 3%, less than 2%, or less than 1% of the ssuperantigenic activity of a wild- type SEA toxin. In certai aspects, the attenuated SEA toxoid or fragment, variant, or derivative thereof having the four specified mutations, has less than 50%, less than 40%, less than. 30%, less than 20 * less than 1.0%, less than 5%, less than 3%, less than 2%, or less than l'% of the su erantigenic activity of a SEA toxoid comprising SEQ ID NO: 3. In certain aspects., the attenuated SEA toxoid or fragment, variant, or derivative thereof, having the four specified mutations, has less than 50%, less than 40%, less than 30%, less than 20%, less than. 10%, less than 5%. less than 3%, less tha 2%, or less than 1% of the- superantigenic activity of a SEA toxoid .consisting, of SEQ ID NO: 3.
[0068] In certain aspects of any of the attenuated SEA toxoids or fragments, variants, or derivatives thereof, comprising four mutations relative to wild-type SEA corresponding to the L48R, D70R, Y92A, and B2.25A . mutations in SEQ ID NO: 4 as disclosed herein, immuiiogemci y is maintained as compared to a wild-type SEA toxin., a SEA toxoid comprising SEQ ID NO: 3, and/or a SEA toxoid consisting of SEQ ID NO: 3, In certain aspects, immunization with the SEA toxoid or fragment, variant, or derivative thereof,, comprising the four specified mutations, elicits neutralizing antibodies against a wild- type SEA toxin,
1 069] Further, in certain aspects, this disclosure provides a. multivalent oligopeptide comprising a fusion of two or more, e.g.t two, three, four, five, six, seven, eight, nine, ten or more Stiiph !oc-occ aurem-' derivs toxoids or fragments, variants, or derivatives thereof arranged in any order, The two or more Staphylococcus a« ews-derived toxoids or fragments, variants, or derivatives thereof of the multivalent oligopeptide -can be the same or different.
J0070] U.S. Publication No. 2016/01.85829' A3 (incorporated herein by reference) describes a simplified Siiperantigen SAg) toxoid vaccine comprising a fusion oligopeptide of mutants of Supcrantigcns, namely recombinant 'TSST-l LWR/»3?.A/«&A (SEQ ID NO: I), SEB 5R/ys¾ Y* (SEQ ID O: 2), and SEAL4¾E I 7ORV¾A (SEQ ID NO: 3), This mu'iliva'lent oligopeptide is referred to 'herein, as rTBA (Figure 1) and has the amino acid sequence SEQ 3D NO: 5, Th rTBA construct was capable of inducing broad netitralisdng antibodies. This fusion protein induced a better total antibody and neutralizing response compared to a simple mixture of the three individual toxoid s, but it retained some residual, superantf genie activity.
|0071 { Provided herein is a multivalent oligopeptide that improves upon rT A, In certain aspects, the multivalent oligopeptide- comprises a fusion protei of tw or more SAg toxoids having reduced superantigenie activity, toxicity, and/or virulence relative to a SAg fusion protein comprising and/or consisting of SEQ ID NO: 5. In certain aspects, the multivalent oligopeptide has less than 50%, less than 40%, less than 30%, less than 20%. less than 10%, less than 5%, l ss than 3%, less than 2%, or less than ! % of the superantigienic activity, toxicity, and/or virulence, of a wild-type SEA toxin and/or a SAg fusion protein cornpriising SEQ ID NO: 5 (Figure 4). In certain aspects, the multivalent oligopeptide maintains t e mimunogenicity of the SAg fusion protein comprising and/or consisting of SEQ ID NO: 5. m certain .aspects, immunization with the -multivalent oligopeptide elicits neutralizing antibodies against a SAg TSST-1 toxin, a SAg SEB toxin, a SAg SEA toxin, or any combmation thereof. In certain aspects, immunization with the multivalent oligopeptide elicits neutralizing antibodies to SAg toxins other than TSST-1 , SEB; or SEA. In certain aspects, the multivalent oligopeptide exhibits greater and/or broader immunog nicity tha -an .equimolar cocktail of ike individual SAg toxoids from which it is com oses! (Figure 5), In certain aspects, immunization of a subject with the multivalent oligopeptide provides protection against at least one or more of wild-type SAg TSST-1 toxin, wild-type SAg SEB toxin, and wild-type SAg SEA toxin (Figure 7). In certain aspects, the multivalent oligopeptide or a composition comprising the oligopeptide can be used to treat. or prevent a Staphylococcal disease or infection,
10072 hi certain aspects of ibis disclosure, a multivalent oiigopepiide includes staphylococcal SA toxoid or fragment, variant or derivative thereof including, without limitation, a toxoid derivative of staphylococcal .enterotoxin A (SEA), staphylococcal, enterotoxin B (SEB), staphylococcal enteroiox-his CI-3- (SBC 1-3), staphylococcal enterotoxin £ (SEE), staphylococcal enterotoxin H (SHE), staphylococcal enterotoxin I SEI), staphylococcal enterotoxin K (SE ), staphylococcal toxic shock syndrome toxin- 1 (TSST-1 ). streptococcal pyrogenie exotoxin (..' (SpeC), staphylococcal enterotoxin D (SED), streptococcal pyrogenie exotoxin A (SpcA), or any combination thereof in any order.
J0073] In certain aspects, the multivalent oligopeptide includes staphylococcal toxic shock syndrome toxin- 1 (TSST-1) toxoid or fragment, variant, or derivative thereof. In certain aspects, the TSST-1 toxoid is the attenuated toxoid TSST- lu iWAtmA (SEQ ID NO: 1), or a TSST- 1 toxoid comprising the three attenuating mutations relative io wild- type TSST-1 corresponding to the L30R, D27A, and I46A -mutations in SEQ ID NO: 1
Figure imgf000023_0001
4] In certain aspects, multivalent oligopeptide as provided herein comprises at least one Staphylococcal enterotoxin A ( SEA) attenuated toxoid comprising four mutations relative to wild-type SEA correspondin to the L48R, D70R, Y92A, and. H225A. mutations in SEA. «R/E>?oR,'y§2A, «?.SA. (SEQ ID NO: 4) as described elsewhere herein. In certain aspects, the multivalent oligopeptide comprises two or more or three or more SAg toxoids or fragments, variants, or derivatives thereof. In certain aspects, the oligopeptide further comprises a staphylococcal enterotoxin 8 (SEB) attenuated toxoid as described elsewhere herein, a staphylococcal toxic shock syndrome toxin- 1 (TSST- 1 ) attenuated toxoid as described elsewhere herein, and any combination thereof. In certain aspects, the TSST- 1 toxoid comprises three mutations relative to -wild-type TSST-I corresponding to the L30 , D27A, and 146A mutations in SEQ ID NO: 1 and a amino acid sequence at least 90% identical to SEQ ID NO: ! ; the SEB toxoid comprises three mutations, relative to wild-type SEB corresponding to the 1,451 , Y89A, and Y94A mutations in SEQ ID NO: 2 and a amino acid sequence at. least 90% identical to SEQ ID NO: 2: and. the SEA attenuated toxoid comprises four mutations relative to wild-type SEA corresponding to the L48R, D7QR, Y92A, and H225A mutations in the SEA toxoid of SEQ ID NO; 4- and- an amino acid sequence at least 90% identical to SEQ ID NO: 4, in certain aspects, the- TSST-I toxoid comprises the amino acid sequence SEQ ID NO: 1 ; the SEB toxoid comprises the amino acid sequence of SEQ ID NO: 2; and the SEA attenuated toxoid comprises the amino acid sequence SEQ ID NO: 4,
Figure imgf000024_0001
Sinkers, and can be the same or different, In some aspects, the SAg toxoids included in the multivalent oligopeptide can be directly fused to each other, In other aspects, the SAg toxoids included in the multivalent oligopeptide can be associated via a linker. Suitable linkers can be chosen based on their ability to adopt a flexible, extended confonnatiun, or a secondary structure that can interact with joined epitopes, or based on their ability to increase overall solubility of the fusion polypeptide, or based on their lack of electrostatic or water-interaction effects that influence joined peptide regions. In certain aspects, the linker is a peptide linker. In certain aspects, a peptide linker for use in a multivalent oligopeptide as provided herein can include at least one, but no more than 50 amino acids, e.g.* small amino acids that provide a flexible chain, e.g. ? glycine, serine, alanine, or a combination thereof. In certain aspects, a linker for use in a multivalent oligopeptide as provided herein can include (GOGS,! or (GGGGS)n* wherein n is a integer from 1 to 10, In certain aspects, socli as in the fusion peptide rTBA225 {SEQ ID NO: 6), the linker is a (GGGGS),; linker in which w:::3.
1<MI78| In certain aspects the multivalent oligopeptide comprises, consists of, or consists essentially of the amino acid sequence SEQ ID NO: 6.
TABLE 1; SAgs and Multivalent Oligopeptide Protein Sequences
SEQ 1 ID
NO 1
TSST-l o«r)27A,l4fiA MSTNDN3KDLLDWYSSGSDTFTNSEVLANS GSMR ί
(Mutations relative to iKNTDGSiSLSAFPSPYYSPAFI' GEKVDLN'r Rl' K
mid-t e SQHTSEGTYJIll'QiSGVTOTE LFTPiELPEKVKVllG
bold/ underlined) DSPLKYWPKFDK QLAiSTLDFRIRHQLTQiHOLY
RSSDKTGGYWKlTMlSiDG'STYQSDLSKKFEY TEiP
ΡΓΝΙΟΕΤΚΤΪΕΑΕΪΝ
Wild-type TSST-1 SI^DNI DLLDWYSSGSDTFTNSEVLDNSLGSM I 9
K TDGSiSLllFPSPYYSPAFT GE VDLNT RJ S
QHTSEG^TYIHFQISCJVT TE LPTPIELPEKV VHGIC
DSPLKYWP FDK QLAISTLDFE'IRHQLTQIHGLYR
SSDKTGGYWKFrMNDGSTYQSDLSKKFEYNTEKPPi
N JDEI 'TIE AEI.N
MESQPDP PDELH SKFTGLMENMKVEYDDNBV 2
(Mutations SAINV SIDQFRYFDLr SlKDTKLG YDNVRVEF
bold^underfined) NKDLADKYKPKYYPVFGANAYYQCAFS KTOD!I
Si -IQTDKR TCM Y( ! VTEi ! N( 7 QEDK YRS ITVR V 1: ii
DGKM FDVQTNKK VTAQELDYLTRHYLVKN
KLYEFNNSPYETGYl FI'E ENSFWYDM PAPG'DK
FDQSKYLMMYHDNKMVDSKDVKIEVYLTTKKK
Wild-type SEB ESQP DP PDELHKS S lrfGLMENMKVEYDDM H V 10
S AIM V S 1DQFL YFDL1 YS i JDTKLG N YDM V VEF&
NKDLAD Y DKYVDVFGANYYYQCYFSKKI'NDI
SHQTD KRKTCM YGG VTEHNGNQ LD YR.S1T VR VFE
DG NLLSFDVQTNKKKVTAQELDYLTRHYLVKN KLY EFN S P Y-ETGY HCFIEN EN S FWY DM M PAPGD
FDQS YLM fiTO K DSKDV IEVYLTTK
SBAK225A EK5EE1NEKDLR SEEQGTAEGNEKQIYYYNEKA T I
(Mutation TE ESHDQFLQHIILFKGFFTDHSWYNDLLVDF
bold'underlincd) DSKDiVD Y G XVDLYCiAYYGYQCACiGTP KTA
CMYCIGVTLHDNNRLTEEK VPINLWLD JKQNTVP
LETVKTNK NVTVQELDLQARRYLQEKYNLY SD
VF1X5KVQRGLTVFHTSTEPSV YDLFGA0G0YSNT
LLRIYRDN TE^SENMAI rYLYTS S E A i_ fj R' 7SR ,·Ύ¾Λ e SEEINEKDD OiSELQGTALGNL QlYYYNE A 3
(Mutations KTENKES.HDQFRQH.T1LF QFFTDHSWYNDLLVRF boi diffi derlined) DSKDJVDKY GK .VDLY'GA AGYQCAGi.3TP. KTA
CMYGGVTLHD N LTEE V ilS!LWLDG .Q TVF
L ET VKTN KKN VTVQ E LD LQ A RR YLQEK Y NL YNSD
VFDG VQRGLiVFHTSTEPSWYDLFGAQGQYSNT
LL I YRDNKTINSENMHfDIYLYTS
S E f,4 ϊί 70S V % AA T225 EKSEE1 E .DLRK SELQGTALGNLKQIY YYNE A 4 A . TE ESHDQFRQHTiLF GFFTDHSWYNDLLVRP
(Mutations D KJ^lVD YK !KVDLYGAYACiYQCAGGTP TA. boldmTsderlined) C YGGWl.HDNl^ETEE T LWT^DG QNTVP
LETVKTN KNVTVOELDLQARRYLQEKY LYNSD
VFDGKVQRGLJVFHTSTEPSV.NYDLFGAQ(iQYSNT
LLRIYRDNKTIN'SENIMAJDIYLYTS
Wild-type SEA E SEEi E DLR SELQGTALG L QlY Y YN EK A 12·
KTE ESH QFLQHTILF GFFTDHSWY DLLVDF
DSKDl V DKYKGKK VOL YGAY YG YQC AGGTPN A
CMYGG TLHDNNRLTEEKKVPi LWLDGKQNTVP
LETV TNKKNVTVQELDLOARRYLOEKYNLY SD
VFDGKVORGLWFirTSTEPSWYDLFGAQGQYS T
IXRiYRDNKTINSENMHIMYLYTS
rTBA Fusion Protein: MST D I J3LEDWYSSGSDTFT SEVLANSRGSMRI 5
KIM TDGSI SL LAF.PSPYYS'PAFTKGEKV DLNTKRTK S
L-SEBi.45ftY S θ Α,'Ύ ¾ 4 A - QHTSECTTYIHFQTSGVTNTE LPTPTEEPLKVKVHGK
L-SEAuafcrtiTORWJA DSPLKYWPKFDKKQLAISTLDFElRHQLTQiHGLYR (Linkers underlined) SSDKTGGY W ίΓΜ N DGSTYQSD LS KK FEY ΝΊΈΚΡΡ1
NFDETKTTEAEmGGGGSGGGGSGGGGSESOPDPKPD
ELHKSS' FTGL EN .VLYt>DNHVSAINV SIDQF
RYFDL1YSDCI)TKLGNYDNVR\¾FK DLADKYKD
YVDVEGANAYYQCAFSKKWDINSHQTDKRKTC
MYGGVTEHNGNOLD YRSITVRVFEDGK LLSFDV
QTNKXKVTAQELDYLTRIIYL NKKLYEFN SPY
ETC YI F ENE SF W YDMMP AFGDKF QSK YLMM
Y D KjViVDSKDVKiEVYLTTK KGGGGSGGGGSG
GGGSEKSBElNEKDLRKKSELQGTALGNLKQrYYYN
EKAKTENRESHDQFRQHTiLFKCjFFTDHSWYNDLL
V RFDS DIVD K Y KGKKVD LYGA YAGYQCAGGTPN TACMYGGVTLHDNNRLTEEKKVPF LWLiXi Q
TVP L ET V T K N VT VQKLD I X) AR RYLQ EK YNLY
SDVF >GKVORGLrVFHTSTF SV YDLFGAQGQY
SNTLLRIYRDNKTINSENKIHIDIYLYTS rTBA225 Fusion MSTODNIKDLLDWYSSGSDTFTNSEVLANS GSMRI
Protein: KNTDGSiSLlAFPSPYYSPAFTKGE VDLNT RT S
TS ST- 1 ΐ..ίΟΛ ΪΚ7Α.·Ί46Α- QBTSEGTYIHFQISGVTNTEKLPTPIELPLKV VHGI
DSPL YWP FDKKQLAISTLDFEIRHQLTQIHGLYR
i - SSDKTGGYW n¾i DGSTYQSDLSKKFEYNTEKPPI
NIDEi TIEAElNGGGGSGGGGSGGG SESOPDP PD
A FXHKSSKFTGLMEN KVI..Yl)DNHVSAI VKSrDQF
(Linkers underlined) RYFDLTYSIKI)TKXGNY'DN\'RVEF N DLADKYr .D
YVDVFGANAYYQCAFSKK NDINSHOTD RKTC YGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDV
QTNTO V'fAQELDYLTilllYLV NKKLYEF'N SPY
ETC Y IKFIEN EN SF W Y DMMPAPGD&FDQSK. YEMM
Y^DHmVDSKDV lEVYLTT GGGGSGGGGSG
GGGSE SEEilslEKiJLRK SELOG iALG L OjYYYN
E AKTENKESHDQFRQ TILFKGFFTD SWYNDLL
V FDS DIVDKYKGKKVDLYGAYAGYQCAGGTPN TACMYGGVTLHDNN LTEEK VPINLWLDCiKQN
TVPLETVKTN NVTVQELDLQARRYLQEKYNLY
KSDVFDGKVQRGLIVFHtSTEPSV YDLFGAQGQY
SNTLLRIYRDNKTWSENMAIDIYLYTS
|¾M)79| In another aspect, the multivalent oligopeptide and/or SAg toxoid as provided herein can be attached to a heterologous polypeptide. Various heterologous polypeptides can be used, including, but not limited to an N~ or Oterminal peptide imparting stabilization, secretion, or 'simplified purification, such as a hexa-lBslidme-tag, a ubiquitin lag, a NiisA tag, a ckilin binding domain, ompT, ompA, pelB, DsbA, DsbC, c- myc, KSi, polyaspartic acid, (Ala-Trp-Trp-Prqjn, polypbenyalanine, polycysteine, pofyarg ine, a B-iag, a HSB-lag, green fluorescent protein (GFP), influenza virus hemagglutinin (HAI), a calmodulin binding protein (CBP), a gaJaetose-binding protein, a maltose binding protein (MBP), a cellulose binding domains (CBD's), dihydfo folate reductase (DHFR), giutethione-S-ifansferase (GST), streptococcal protein G, staphylococcal protein A. T7gene10, an avidin/stre tavidiri Strop-tag complex, trpE, chlorarup enicol aeetyltransferase!: iacZ ( -Galactosidase), His-patch thioredoxia, thioredoxin, a FLAG™ peptide (Sigtna-Aklrich), an S~tags. or a T7-tag, See, e,g y Stevens, R.C., Structure, R177-R185 (2000), Heterologous polypeptides can also include any pre- and/or pro- sequences thai facilitate the transport, translocations, processing and/or purification of a multivalent oligopeptide and/or SAg toxoid as described herein, from a host cell or any useful immunogenic sequence, including but not limited to sequences that encode a T-celi epitope of microbial pathogen, or other immunogenic proteins and ot' epitopes. (0080! 'ϊη some aspects, the multivalent oligopeptide and/or SAg toxoid attached to a heterologous polypeptide, as described herein, can include a peptide linker sequence joining sequences that comprise two or more peptide regions, Suitable peptide linker sequences can be chosen based on their ability to adopt a flexible, extended conformation, or a secondary structure that could interact with joined epitopes, or based on their ability to increase overall solubility of the fusion polypeptide, or based on thei lack of electrostatic, or water-interaction effects that influence joined peptide regions.
(0081 i In some aspects, the .multivalent oligopeptide and/or SAg toxoid -as described, herein, is is lated. An "isolated" polypeptide one that has been removed from its natural milieu. The term "isolated" does hot connote any particular level of purification. Recombinants produced multivalent oligopeptides and/or - SAgs as described herein, expressed in non-native host cells is considered isolated for purposes of the disclosure, as is the polypeptide which have been separated, fractionated, or partially -or substantially purified by an suitable technique, including by filtration, chromatography, centrifugation, and the like.
'{00 2] As provided for herein, the production of multivalent oligopeptides and/or SAgs as described herein, can be achieved, by cralturihg a host cell comprising a polynucleotide that operably encodes a polypeptide of the disclosure, and recovering the polypeptide. Determining conditions for cu I taring such a host cell and expressing the polynucleotide are generally specific to the host cell and the expression system and are within the knowledge of one of skill in the art. Likewise, appropriate methods for recovering die polypeptide o the disclosure are known to those in the art, and include, but are not limited to, chromatography, filtration, precipitation, or centrifugation.
111. Polynucleotides
{0083] Also provided by this disclosure is an isolated polynucleotide comprising a .nucleic acid encoding a multivalent oligopeptide and/or SAg toxoid as described elsewhere herein. In certain aspects, an isolated polynucleotide as provided herein further comprises, non-coding regions such as promoters, operators, -or transcription terminators as- described elsewhere herein.. In some aspects, the disclosure is directed to the polynucleotide ¾¾ described herein, and further comprising a heterologous nucleic acid. The heterologous nucleic acid can. in some aspects, encode a heterologous polypeptide fused to the polypeptide as described herein. For example,, the isolated polynucleotide as described herein can comprise additional coding regions encoding, e.g., a heterologous polypeptide fused to the polypeptide as described herein, or coding regions encoding heterologous, polypeptides separate from the polypeptide as described herein such as-, but not limited to, selectable makers, additional immunogens, immune enhancers, and. the like.
(00iM| Also provided are expression, constructs, vectors, and/or host cells comprising the polynucleotides described herein. An example of an isolated polynucleotide is a recombinant polynucleotide contained in a vector. In certain aspects, the vector is an expression vector. Farther examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host ceils or purified (partially or substantially) polynucleotides in solution. In certain aspects of the disclosure a polynucleotide is 'Recombinant " Isolated pol nucleotides or nucleic acids according to the disclosure further inciude such molecules produced synthetically, The relative degree of purity of a polynucleotide or polypeptide described herein is easily determined by well-known methods.
100851 Also included within the scope of the disclosure are genetically engineered polynucleotides encoding the multivalent oligopeptides and/or SAgs as described herein. Modifications of nucleic acids encoding the multivalent oligopeptides and/or SAgs as described herein can readily be accomplished by those skilled in the art, for example, by oligonucleoiide-directed site-specific mutagenesis or de -novo nucleic acid synthesis, j0086| Some aspects disclose an isolated polynucleotide comprising a nucleic acid that encodes a multivalent oligopeptide and/or SA toxoid as described elsewhere herein, where the coding region encoding the polypeptide has been eodon-optimJzed. As appreciated by one of ordinary - skill in the art, various nucleic acid coding regions will encode the same polypeptide due to the redundancy of the genetic code. Deviations in the nucleotide sequence that comprise the eodons encoding the amin acids of any polypeptide chain allow for variations in the sequence of the coding region. Since each eodo consists of three nucleotides, and the nucleotides comprising DNA are restricted to four specific ba es, there are 64 possible combinations of nucleotides, 61 of which encode amino acids (the remaining three codecs encode signals ending translation). The "genetic code" which shows which eodons encode which amino acids is- reproduced herein as Table 2. As a result, many amino acids are de ignated by more than one eodon. For example, the amino acids alanine and proline are coded for by four triplets, serine and argtnine by six, whereas tryptophan and methionine are coded by just one triplet This degeneracy allows; for DNA base composition to vary over a wide range without altering die amino acid sequence of the polypeptides encoded by the DMA, TABLE 2 : The Standard Genetic Code
Figure imgf000030_0001
10087} It is to be appreciated that any polynucleotide that encodes a polypeptide in accordance with the disclosure fails within the scope of this disclosure, regardless of the codons used.
[0088} Many organisms display a bias for use of particular codons to code for insertion of a particular amino acid in a grooving polypeptide chain, Codon preference or codon bias, differences m codon usage between organisms, is afforded by degeneracy of the gen tic code, and is well documented among many organisms.
10089] Different factors have been proposed to contribute, to codon usage preference, including translational selection. GC composition, strand-specific mutational bias, amino acid conservation, protein hydropathy, trans ri tional selection and even RNA stability. One factor that determines codon usage ¾ mutational bias that shapes genome GC composition. This factor is most significant in genomes with extreme base composition: species with high GC content ( .g., gram positive bacteria). .Mutational bias is responsible not only for Intergenetie difference in codon. usage but also for codon usage bias within the same genome (Ermolaeva M, C rr. Issues Mol Biol 3(4}:9 -97, 2001).
J0090I Codon bias often correlates with the efficienc of translation of 'messenger RNA (mRNA), which is in turn believed to be dependent on, inter aii . the properties of the codons being translated and the availability of particular transfer NA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the. codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codo optimization.
| 09Ij The present disclosure provides a polynucleotide comprising a codon-optimized coding region which e codes a multivalen oligopeptide and/or S Ag toxoid as described herein. The codon usage is adapted for optimized expression in a given profcaryotic or eukaryoik host cell. In certain aspects the codon usage is adapted for optimized expression in E, coU,
(0092] For example, SEQ ID NO: 7 is a nuc leotide sequence codon optimized ΐοτ £χοΙΐ expression encoding the rTBA fusion protein:
atgtcgacgaafgacaacatcaaagacctgctggactggte^
gctggeaaaeteacgcggtageatgcgtaLcaaaaatac^
iacagcecggcatl:eaccaaaggcgaa¾aa tggatctgaataccai!aegcacgaaaa atcacagcaSacctcag aaggtaectacatccactttcagateagcggcgtgaccaacaecgaaaaactgccgaceccgattgaactgcegctg .aaagtgaaagtteatggeaaagattcgccg
ctggatttcgaaattcgccaecagctgacccagatccatggtctgtaccgttcaagcgacaaaaccggcggtiattgg aaaateaecatgaatgatggitegacgtaccagagcgaietgtegaaaaaatfcgaataeaaeacggafiaaaccgec ^taatAtcgatgaaatc^aaccatc^agcggaaaicai-tggcggtggcggctcgggtggtggcggtagcggt ggeggcggtagtgaatcgcaaceggatcegaaiiccggacgaactgeacaaatcgtccaaatttaecggteigatgg aaaalaigaaagtgetgtalgatgacaaecaigtgtcggcaatt^
etgaictatageat saagaiaegaaaetgggtaato
aeaaatataaagacaaatacgtgga cgttttc
tatcaaetcccati gacegacaaaegiaaaa
aeaaatategtagcateaeggtccgtgigttiga
gaaagttacggcteaagaaetggatiaectgae^^^
ageccgt&cgaaaccggctaeatcaaattcattgaaaa¾^
gacaaatttgaccaaagcaaatacetgatgatgtaeaacgataacaaaatggtcgattcaaaagacgtgaaaaicgaa gtctatctgacgaccaaaaagaaaggtggcggtggticiggtggiggtggctcgggcggcggtggcfcggaaaaai eegaagaaaitaaegaaaaagaeetgcgiaaaa^
t attectaeaacgMaaagecaaaaecgaaaacaaagaaagccatgaieagttccgccagcatacgaieetgttcaa aggettttteaecgateaitcgt^
eaaaaaagtggalctgtatggegcat^
atggiggtgtgacgctgcatgacaaiaaccgcctgaccgaagaaaagaaaglgccg
aaae& 3aeacc$gcc etggaaac.ggl^^
agcacgeGgttatctgcaggaaaaatataacctgtataacagcgac^
cgtcttecaiaecagcaccgaaccgagcgttaactatgacctgtttggcgcacaaggccagtacteeaaiaceetgct gcgeatttatogcgata&oaaaaccattaaotceg^^
caccatcattgataataa
(SEQ ID NO: 7)
(0093] For example, SEQ E) NO: 8 is a nucleotide 'sequence codon optimized for E.coli expression encoding the rTBA225 fusion protein: atgtcgacgaa!gacaaeatcaa^^
gciggeaaadeacgcggiagea^
iaeagcecggcatleaOT
aaggiacciacatecacttteagatca^
aaiigtgaaagttotggcaaag& egcegctgaaa
ctggatttcgaaattcgccace^
auaatcaccatgaatgatggttcgacgtaccagagcga&^
g^ttaatatcgatgaaateaaaaecategaagcggaa^^
ggcggeggiagtgaatcgcaaccggatccgaaac ggacgaactgcacaaatcgtccaaatttaccggtctgatgg aaaatetgaiiagtgctgtatgatgacaaj^^
ctgaictatagcatiaaagaacgaaaetgggtaattaegata^
acaaatataaagacaaatacgtg&a^
tatcaacteccatca aecgacaaac;g-aaa^^
acaaatatcgtagcatcacggtccglgigtt gaagacggcaaaaacctgctgicatttgatgllcagacgaacaa gaaag tacggctcaagaactggaftacctgaccc
agcc giacgaaaccggciaaitcaaaltcaligaaaatgaaaatagct
gaeaaattfgaecaaagcaaatacctgatgatg^
gtctatctgacgac aaaaagaaaggtggcggtggttciggtggtggtggct gggcggcg
c ga aaailaae aaaaa aect e taimaaatce^^
ttat actacaaGgaaaaagccaaaaccgaaaacaaagaaagccaigatGagticcgccagcaiacgatccigiteaa aggcttttteaccgatearteg^
caaaaaagtggatetgiatggegcataegetg ^
atggiggigtgacgctg aigacaataaccgcctgaccgaagaaaagaaagtgccgattaatctgtggctggac^ aaaeagaacacGgtgeGgctggaaaeggtgaaa
agcacgccgttatctgcaggaaaaata^
egtctteeataceagcaccgaaccg^
gegea!iiaicgcgalaacaaaaeeate
accatca tgataataa iSEQ ID NO: 8}
{4)09 j Codon-optimized polynucleoti es are prepared by incorporating codons preferred for use in the genes of a given species into the DMA sequence. Also provided are polynucleotide expression constructs, vectors, host ceils comprising polynucleotides comprising eodoii-optimized coding regions which encode a multivalent oligopeptide and/or SAg toxoid as described erein.
100 5J Given the large number of gene sequences available for a wide variety of animal, plant and microbial species, it is possible to calculate the relative frequencies, of codon us ge. Co don usage tables are readily available, for example, at the "Codon Usage Database" available at http://wmv.kaziisa.or.jp/eodon/ (visited October 12, 20] ]). and these tables can be adapted in a number of ways, ( akamura, Y,, el at, "Codon usage tabulated from the international DNA sequence databases: status for the year 2000'* Nitcl. Acids Res. 28:292, 2000). jftOffi] By utilizing available tables, one of ordinary skill in the art can apply the frequencies to any given polypeptide sequence, and produce a nucleic acid fragment of a codon-optimized coding region which encodes a desired polypeptide, but which uses codons optimal for a given s ec es, A number of options are available for synthesizing codon optimized coding regions designed by any of the methods described above, using standard and routine molecular biological manipulations well known to those of ordinary skill in the. art. In addition, gene synthesis is readily available commercially.
IV. Vectors and Expression Systems
f©0 7| Further provided is a vector comprising a polynucleotide as provided herein. The terra "vector," as used herein, refers to e.g., any of a number of nucleic acids into which a desired sequence can be inserted, e.g., by restriction and ligation, for transport between different genetic environments or for expression in a host cell. Nucleic acid vectors can be DNA or NA. Vectors include, but are not limited to. plasmids, phage, phagemids, bacterial genomes, and virus genomes.. A cloning vector is one which is able to replicate in a host cell, and which is further characterized by one or more endonucicase restriction sites at which the vector can be cut in a determinable .fashion and int which a desired DNA sequence can be li ated such that the new recombinant vector retains its ability to replicate in the host cell, hi lire case of plasraids, replication of the desired sequence can occur many times as the piasmid increases in copy number within the host bacterium or just a single time per host before the host reproduces by mitosis. In the case of phage, replication; can occur activel during a lytic phase or passively during a l sogenic phase. Certain vectors are capable of autonomous replication in a host cell into which they are introduced- Other vectors at e integrated into the genome of a host cell upon introduction into the hast cell, and thereby are replieated along with the host genome.
(0098] An of a wide variety of sui table cloning vectors are known in the art and commercially available which can be used with appropriate .hosts. As used herein, the term "piasmid" refers to a circular, double-stranded construct made up of genetic material {Le.f nucleic acids), in which the genetic material is extrachrofflosomal and in some instances, replicates autonomously. A polynucleotide described herein can be in a circular or li earized piasmid or in any other sort of vector. Procedures for inserting a nucleotide sequence into a vector, e.g., an expression, vector, and transforming or transiecting into an appropriate host cell and cultivating under conditions suitable for expression are generally known hi the art (0099] The disclosure further provides a vector comprising a nucleic acid sequence encoding a raoltivalejil oligopeptide and/or SAg. toxoid as described elsewhere herein, hi certain aspects the vector is an expression vector capable of expressing the mititivalent oligopeptide and or SAg toxoid as described herein in a suitable .host cell. The terra "expression vector"' refers to a vector that is capable of expressing the polypeptide described herein, /„<?,, the vector sequence contains the .regulatory sequences regulating transcription and translation of a polypeptide, Including, but not limited to promoters, operators, transcription termination sites, ribosome binding sites, and the like. The term "expression" refers to the biological production of -a product encoded hy a. coding sequence. In roost cases a DNA sequence, including the coding sequence, is transcribed to. form- a messenger- NA (niRNA). The. messenger-RNA is then translated to form a polypeptide product which has a relevant biological, activity. Also, the process of expression can involve further processing steps to the R A product of transcription, such as splicing to remove introns, and/or post-translarional processing of a polypeptide product.
'{00100} Vector-host systems include, but are not limited to, systems such as bacterial, mammalian, yeast, insect or plant cell systems, either in vivo., e.g., in an animal or in vitro, e.g. , in bacteria or in cell cultures. The selection of an appropriate host is deemed to be within the scope of those skilled in the art from the teachings herein. In certain aspects, the host ceil is a bacterium, and insect cell, a .mammalian, cell, or a plant cell. In certain aspects, the bacterium is £. coii.
{00101 ] Host celts are genetically engineered (infected, transduced, transformed, or- transfected.) w ith vectors of the disclosure. Thus, one aspect, of the disclosure is di rected to a host cell comprising a vector which contains the polynucleotide- as describe herein. The engineered host cell can be cultured in conventional nutrient media modified as appropri te for activating promoters, selecting iransform.an.ts or amplifying the polynucleotides. The culture conditions, such as temperature, pM and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan. The term "trans ect," as used herein, refers to any procedure whereby .eukaryotic celts are induced to accept and incorporate into their genome isolated DNA, including but not limited to DNA in the form of a plas.ra.id. The term "transform," as used herein, refers to any procedure whereby bacterial cells are induced to. accept and incorporate into their genome isolated DNA, includmg but not limited to DNA in the form of a plasmid. |ft100] Bacterial host-expression vector systems include,, but are not limited to, a pr karyote ( g., coli), transformed with recombinant bacteriophage DMA, plasmid DMA or cosmid D A. In some aspects, the plasmids used with E, coil use the T7 promoter-driven system regulated by the Lad protein via 1PTG induction. A large number of suitable vectors are blown to those of skill in the art, and are commercially available. The following bacterial vectors are provided by way of example: pET ( ovagen). pBT28, p'BAD, pTrcHIS, pBR322, pQE7D, pQE60, pQE-9 (Qiagen),- phagescript. psi I74, pBluescript SK, pbsks, pNBSA, pNH1 6a; pNHiSA. pNH46A (Stratagene), ptre99»f pKK223-3, pKK243-3, pDR540, pBR322, pPS lO, RSF101 O, pRTI'5 (Pharmacia); pCR (Invitrogen); pLex (mvitrogen), aiid UC plasmid derivatives.
[0101] A suitable expression vector contains regulatory sequences mat can b operabLy joined to an inserted nucleotide sequence encoding the multivalent oligopeptide and/or SAg toxoid as described herein. As used herein, the term, "regulatory sequences" means nucleotide sequences which are necessary for or conducive to the transcription of an inserted sequence encoding a multivalent oligopeptide and/or S Ag toxoid as described herein by a host cell and/or which are necessary for or conducive to the translation by a host cell of the resulting transcript into the desired multivalent oligopeptide and/or SAg toxoid. Regulatory sequences include, but are not limited to, 5' sequences such as operators, promoters and ribosome binding sequences, and 3' sequences such as poiyadenylation signals or transcription terminators. Regulatory sequences can also include, enhancer sequences or upstream activator sequences.
.{01 2 Generally, bacterial vectors will include origins of replication and selectable markers, e.g., the ampieillin, tetracycl ine, kanainycin, resistance genes of E. col t, permitting transformation of the host cell and a promoter derived from a highly- expressed gene to direct, transcription of a downstream structural sequence. Suitable promoters include, but are not limited to, the 17 promoter* lambda (λ) promoter, T5 promoter, and lac promoter, or promoters derived from operons encoding glycolytic enzymes such s 3 -phosplioglycerate kinase (PG ), acid phosphatase, or heat shock, proteins, or inducible promoters like cadmium (pead). and beta-Iactamase (pbla).
(011)3} Once an expression vector is selected, the polynucleotide as described herein can be cloned downstream of the promoter, for example, in a poly! inker region. The vector 'is transformed into. an. appropriate bacteria! strain, and DNA is prepared using standard techniques. The orientation and UNA sequence of the polynucleotide as well as all other elements included in the vector, are confirmed using restriction mapping, DNA sequence analysis, and/or PCR analysis. Bacterial cells harboring the correct piasmid can be stored s cell banks.
V, Immunogenic and Pharmaceutical Compositions
{01041 Further disclosed are cotaptssttions, e.g., immunogeni or pharmaceutical compositions that contai an effective amount of the multivalent oligopeptide and/or SAg toxoid as described herein, or a polynucleotide encodin the polypeptide of the discl sure. Compositions as described herein cart further comprise, additional immunogenic components, e.g., as a multivalent vaccine, as well as carriers, excipients or adjuvants.
jftlQSJ Compositions as provided herein can be formulated according to known methods.
Suitable preparation methods are described, for example* in Remington ',Υ Pharmaceutical Sciences, 19th Edition, A.R. Gennaro, ed., Mack Publishing -Co., Baston, PA (1995), which is incorporated herein by reference in its entirety. Composition can be in. a variety of forms, including, but not limited to an aqueous solution, an emulsion, a gel, a suspension, lyophilized form, or any other form known in the art. In addition, the composition can contain pharmaceutically acceptable additives including, for example, diluents, binder's, stabilizers, and preservatives. Once formulated, compositions of the disclosure can be admimstered directly to. the subject. The subjects to be treated can be animals; in particular* human subjects can be treated,
{0166] Carriers that can be used with■compositions of the disclosure are well known in the .art, and include, without limitation. th.yroglobu1.in, albumins such as human serum albumin, tetanus toxoid, and polyamino acids such as poly W sme. poly L- glutamic acid, influenza, hepatitis B virus core protein, and the like. A variety of aqueous carriers can. be used, e.g. water, buffered water, 0.8% saline, 0.3% glycine, hyaluronic acid and the like. Compositions- can be sterilized by conventional, well known sterilization techniques, or can be sterile filtered, A resultin composition can be packaged for use as is, or lyophilized, the iyopMlii-ed preparation being combined with, a sterile solution prior to administration. Compositions can contain pharmaceutically acceptable auxiliary substances as to approximate physiological conditions, such as pH adjusting and buffering agents, -tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbttan (nonolaurate, triefhanolamineoleate , etc.
[0107] Certain compositions as provided herein further include one or more adjuvants, a.
substance added to an immunogenic composition to, for example, enhance, sustain, localize, or modulate an immune response to an immunogen. The term "adjuvant*' refers to any material having the ability to (1) alter or increase the imniune response to a particular antigen or (2) increase or aid an effect of a phannacological agent. Any compound which can increase the expression, antigenicity or iraraunogemcity of the polypeptide is a potential adjuvant. The term '"immunogenic carrier" as used herein refers to a first -moiety., e.g., a polypeptide or fragment, variant, or derivative thereof which enhances the immunogefiieity o * a second polypeptide or fragment,' variant, or derivative thereof.
("01081 A great variety of mate-rials have been shown to have adjuvant activity through a variety of mechanisms. For example, an increase in humoral immunity is typically manifested y a significant increase in the titer of antibodies raised to the antigen* and an increase in T-celi -activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion. An adjuvant can -also. lter or modulate an immune response, for example, by changing a primarily humoral or Th2 response into a primarily cellular, or Thj response. Immune responses to a given antigen can be tested b various immunoassays well known to those, of ordinary skill is the art, and/or described elsewhere herein.
(0109| A. wide number of adjuvants are familiar to persons of ordinary skill in the art, and are described in numerous references. Adjuvants which can be. used in compositions described herein include, hut arc not limited to: inert carriers, such as alum, bentonite, latex, and acrylic particles; incomplete Freund's adjuvant, complete Freimd's adjuvant; aluminum-based salts such as aluminum' hydroxide: Alhydrogel (A1(0¾)).; aluminum phosphate (AIPO4); calcium-based salts; silica; any T'LR biological ligancl(s); IDC- 1001 (also known as GLA-SB; . luoopyranosyl lipid .adjuvant stable emulsion) (Coler et t, PLoS One, 2010, 5(10): p. el 3677; Coler et PLoS One, 201 1. 6(1): p. e 16333); CpG (Mullen, et a!., PLoS One, 2008. 3(8): p. e294G), or my combination thereof. In. certain' aspects, the adjuvant comprises Alhydrogel. The amount of adjuvant, how it is formulated, and how it is administered all parameters which are well within the purview of a person of ordinary skil l in the art.
JOt l GJ In some aspects, a. composition of the disclosure further comprises a liposome or other particulate carrier, which can serve, .g., to stabilize a formulation, to target the formulation to a particular tissue, such as lymphoid tissue, or to increase the half- life of the polypeptide composition. Such particulate carriers include emulsions, foams, miceiles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers, iscorns, and the like. In these preparations, .the polypeptid described herein can be incoiporat«d as part of a liposome or other particle, or can be delivered in conjunction with a liposome- Liposomes for use in accordance with, the disclosure can be formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. A composition comprising a liposome or other particulate suspension as well as the polypeptide as described herein can be administered intravenously, locally, topically* etc. in a dose which varies according to, inter alia, the manner of administration, the polypeptide bein delivered, and the stage of the diseas being treated.
(01111 For solid compositions, conventional nontoxic solid carriers can be used which include, for -example, pharmaceutical grades of mannitoL lactose, starch, magnesium stearate, sodium sacchaiin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like. For oral administration., a pharmaceutically acceptable nontoxic composition- is formed by incorporatin any of the normally employed excipients, such as those carriers previously listed, and generally 10-95% of active ingredient, that, is, the polypeptide as described herein, often at a concentration of 25%-75 .
(0112J For aerosol or- mucosal administration, the polypeptide as described herein can be supplied in finely divided form., optionally along with a surfactant and, propeilant and/or a mucoadliesjve, e.g,, cMtosart. In .certain aspects, the -surfactant is pharmaceutically acceptable, and in some aspects soluble in the propeilant. Representative of such agents are the esters or partial esters of fatty acids containing from 6 to 22 carbon atoms, such as caproic, octanoie, laufi.c, palmitic, stearic, Imoleie, linoleaic, olesteric and oleic acids with an .aliphatic polyhydrie alcohol or its cyclic anhydride. Mixed esters, such as mixed or natural glycerides can be employed. The surfactant can constitute 0J ¾-2Q% by weight of the composition* in so e aspects 0,25-5% by weight. The balance of the composition is ordinarily propeilant, although, on atomizer can be used in which no propeilant is necessary and oilier percentages are adjusted accordingly, in some aspects, the immunogenic polypeptides can be incorporated within an aerodynamically light particle, such as those particles described in U.S-, Pat. No. 6,942,868 or U.S. Pat. Pub. No, 2005/0008633. A carrier can also be included, e.g.t lecithin for intranasal delivery.
|0U3] The disclosure is also directed to. a method of producing the composition according to the disclosure. In some aspects, the method of producing the composition comprises (a) isolating a .polypeptide according to the disclosure: and (b) adding an adjuvan carrier and/or exeipient to the isolated polypeptide. Sortie aspects disclose further combining the polypeptide with other staphylococcal antigens,
{01141 Some aspects include a multivalent vaccine. A multivalent vaccine of the present disclosure caa include a multivalent oligopeptide and/or SAg toxoid as described herein, or a polynucleotide encoding a multivalent oligopeptide and/or SAg toxoid, and one or more additional immunogenic components. Such components can be additional immunogens of the sgme infectious agent, e.g... S. aureus, or from other staphylococci, or can be immnhogens derived from other infectious agents which can be effectively, conveniently, or economically administered together. In certain aspects, the multivalent oligopeptid and/or SAg toxoid as described herein, can be combined wit other toxins or other virulent component-based vaccines to make a broad toxin-based multivalent vaccine capable of targeting multiple bacterial virulence det rminate. In other aspects, the multivalent · oligopeptide and/or SAg toxoid as described herein can he fused to other immunoge ic; biologically significant, or protective epitope containing polypeptides to generate a multivalent vaccine in a sinele chain and induce an immune response against multiple antigens. In yet another aspect, the multivalent oligopeptide and/or SAg toxoid, as described herein, can be fused to one or more T cell epitopes to induce T cell immunity,
VI. Methods of Treatment Prevention and Regimens
(01151 Also provided is a method of treatin or preventing Staphylococcus infection,.
e.g., S. aureus infection or treating or preventing a disease caused by Staphylococcus, e.g , S. aureus in a subject,, comprising administering to a subject in need thereof a composition as described herein comprising a multivalent oligopeptide and/nr SAg toxoid as described herein, or polynucleotides, vectors, or host cells encoding same. In. certain aspects, the subject is an animal, eg>, ¾ vertebrate, e.g., a mammal. e.g,> a human. Some aspects include a method of inducing m immune response against a S, aureus steam, comprising dministerin to a subject h need of said immune" response an effective amount of a composition comprising a multivalent oligopeptide and/or SAg toxoid as described herein, or polynucleotides- vectors, or host cells encoding same.
(0116} In some aspects, a subject is administered a composition comprising a multivalent oligopeptide and/or SAg toxoid as described herein, or polynucleotides, vectors, or host cells encoding same prophylacticaliy, e.g,, as a prophylactic vaccine, to establish or enhance immunity tu Staphylococcus ^ e.g., 5. aureus, in. a healthy aniina! prior to potential or actual exposure to Staphyloi K-cm, e.g., S. aureus or contraction of a Staphyhmc-c s-re\&ted symptom, thus preventing disease, alleviating symptoms, reducing symptoms, or reducing the severity of disease symptoms, fn one aspect die disease is a respiratory disease, e.g. , pneumonia. Other diseases or conditions to be treated or prevented include, but are not limited to, bacteremia, sepsis, skin infections, wound infections, endocarditis, bone and joint infections, osteomyelitis., arid/or meningitis. One or more compositions, polypeptides, polynucleotides, vectors, or host cells as described herein can also be used to treat a subject already exposed to Staphylococcus, e.g., S. aureus^ or already suffering from a Staphylococcus related symptom to further stimulate the immune system of the -animal, thus reducing or eliminating the symptoms associated with that exposure. As defined herein, "treatment of an animal" refers to the use of one or more compositions, polypeptides, polynucleotides, vectors, or host ceils of the disclosure to prevent, cure, retard, or reduce the severity of S, aureus symptoms in an animal and/or result in no worsening of S. aureus symptoms over specified period of time. Ft is not required that any composition, polypeptide, polynucleotide a vector, or a host cell as described herein provides total protection against a staphylococcal infection or totally cute or eliminate all Staphylococcus related symptoms,
|0117J As used herein, '*a subject in. need of therapeutic aad/or preventative immunity" refers, to a subject in which it is desirable to treat, i.e., to prevent, cure, retard, or reduce the severity of Staphylococcus related symptoms, or result in no worsening of Staphylococcus related symptoms over a 's ecified period of time. As used herein, "a subject .in -need of the immune .response" refers to a subject for which .an immune resportse(s) against a S Staphylococcus, related disease is desired.
j0118| Treatment with phannaceutical compositions comprising an immunogenic composition, polypeptide or polynucleotide as described herein can occur separately or conjunction with other treatments, as appropriate.
{#11 1 in. therapeutic applications, a composition, polypeptide or polynucleotide of die disclosure is administered to a patient in an amount sufficient to elicit an effective innate, humoral and/or cellular response to the multivalent oligopeptide and/or SA toxoid to cure or at least partially arrest symptoms or complications.
J0120] An. amount adequate to accomplish this is defined as 'therapeutically effective dose" or "unit dose." Amounts effective for this use will depend on, e.g., the polypeptide or polynucleotide composition, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, -and- the judgment of the prescribing physician, In some aspects, a priming dose is followed by a boosting dose over a period of lime.
{01211 In some aspects, generally for humans, an initial inumrakation (that is for therapeutic or prophylactic administration) is administered followed by boosting dosages in the same dose range pursuant to a boosting-regimen over weeks to months depending upon the patient's response and condition by measuring the antibody or T lymphocyte response in the patient's blood.
|0f 22] Polypeptides and compositions as described herein can generally be employed in serious disease states, mat is, life-threatening or potentially life" threatening situations. In such cases, in view of the minimi ation of extraneous substances and the relative nontoxic nature of the polypeptides, it is possible and can be felt desirable by the treating, physician to administer substantial excesses of these polypeptide compositions.
{0123} For therapeutic use, administration can begin at the first sign of S. aureus infection or risk factors, in certain aspects, the initial dose is followed by boosting doses until, e.g., symptoms are substantially abated and for a period thereafter. In frequent infection loadi ng doses followed by boosting doses can be indicated,
]0124j In certain aspects, the composition as described herein is delivered to a subject by methods described herein, thereby -achieving an effective immune response, and/or an effective therapeutic or preventative immune response. Any mode of administration, can be used s long as the mode results in the delivery and Or expression of the desired polypeptide in the desired tissue, in an amount sufficient to generate an Immune response to Staphylococcus, e.g., S. aureus, and/or to generate a prophylactically or therapeutically -effective: immune response to Staphyloco cus* eg., to S. aureus, in an animal in need of such response. According to the disclosed methods, a composition described herein can be administered b mucosal delivery, transdermal delivery, subcutaneous injection, intravenous injection, oral administration, pulmonary administration, intramuscular (fm.) administration, or via intraperitoneal injection. Other suitable routes of administration include, but not limited to intratracheal, transdermal, intraocular, intranasal, inhalation, inrracavity, intraductal (e.g., into the pancreas) and intraparenchymal (i.e., into any tissue) administration. Transdermal delivery includes, but not limited, to intradermal (e.g., into the dermis or epidermis), transdermal (<?,#;> percutaneous) and trans mucosal administration (i.e., into or through skin or mucosal tissue), hitracavity administration includes, but not limited to ad minis (rati n into oral, vaginal, rectal, nasal, peritoneal, or intestinal cavities as well as. intrathecal ( v.t into spinal canal), intraventricular (i.e., into the brain ventricles or the heart ventricles), intraarterial (i.e., into the heart allium) and sub arachnoidal (Le.* into the sub arachnoid spaces of the brain) administration.
(0125| Any mode of administration can be used so long as the mode results in the del ivery and/or expressio of the desired polypeptide ill an amount sufficient to generate an immune response to Staphylococcus, e.g., 5. aureus, and/or to generate a prophylactically or therapeutically effective immune response to Stap ylococc , e.g., S. aureus, in an animal in. need of such response. Admini stration as described herein can be by e.g.. needle injection, or other delivery or devices known in the art
(0126] In some aspects, composition comprising a multivalent oligopeptide and/or SAg toxoid s described herein, or polynucleotides, vectors, or host cells encoding same, stimulate an .antibody response or a cell-mediated immune response sufficient for protection of an animal against Staphylococcus, e.g., S. aureus infection. In other aspects, a composition comprisin a multivalent oligopeptide and/or SAg toxoid as described herein, or polynucleotides, vectors, or host cells encoding same, stimulate both a humoral and a cell-mediated response, the combination, of which is sufficient for protection of an animal against Staphylococcus* e.g., S. aureus infection. In some aspects, a composition, comprising a multivalent oligopeptide and/or SAg toxoid as described herein, or polynucleotides, ve tors, or host ceils encoding same, further stimulates an innate, an antibody, and/or a cellula mmune response.
10.1271 In some aspects, a composition comprising a multivalent oligopeptide and/or SAg toxoid as described herein, or polynucleotides, vectors, -or host cells encoding same, can induce antibody responses to S, aureus, ΐη certain aspects, components that induce T cell responses (e.g., T cell epitopes) are combined with components such as the polypeptides as described herein that primarily induce -an antibody response.
(01281 Further disclosed is a method for generating, enhancing, or modulating a protective and/or therapeutic immune response to 5'.' aur s infection in a subject, comprising administering to a subject in need of therapeutic and/or preventative immunity one or more of the compositions s described herein .
(012°i The compositions as described herein ears be administered to an animal at any time during the lifecycle of the animal to which it is being admi istered. Jo humans, administration of the composition as described herein can, and often advantageously occurs while other vaccines are being administered, e.g., as a multivalent vaccine as described elsewhere herein. jftIM] Furthermore,, the composition as described herein can be used in any desired immunization or administration regimen; e.g.*. in a single administration or alternatively as part of periodic vaccination regimes such as annua! vaccinations, or as i» a prime- boost regime in which composition or polypeptide or polynucleotide of the isciosure s administered either before or after the administration of the same or of a different polypeptide or polynucleotide. Recent studies have indicated that a prime-boost protocol is often a suitable method -of administering vaccines. In a prime-boost protocol, one or more compositions as described herein can be utilized in a "prime boost" regimen. An example of a "prime- boost" regimen ca be found in Yang, Z. et at J. Virol. 77:799-803, 2002, which is incorporated herein by reference in its entirety.
{0131] Infections to be treated inclu.de» but are not limited to a localized or systemic infection of skin, soft tissue, blood, or an organ or an auto-immune disease. Specific diseases or conditions to be treated or prevented include, bat are not limited to, respiratory diseases, e.g., pneumonia, sepsis, skin infections, wound, infections, endocarditis, bone and joint infections, osteomyelitis, and or meningitis.
10132] A number of animal models for $. aureus infection are known: in the art, and can be used with the methods disclosed herein without undue experimentation. For example, a hamster model of inethicillin-resistant Staphylococcus aureus (MRSA) pneumonia has been described for the testing- of antimicrobials, (Verghese A, et alf, Chemotherapy. 34:407-503 (1988), Kephart PA. et ai. I Antimicrob Chemother. 21 :33-9, ( 1988)), Further, a mode! of S. aureus-m' duced pneumonia in .adult, immunocompetent C57BL/6J mice is described, which closely mimics the clinical and pathological features of pneumonia in human patients. (Bitbeck-Wardenburg J. et ml., infect Immun. 75: 1040-4 {2007}). Additionally., virulence has been tested in a rat model of S aureus- pneumonia as described in McElray et al (McBlroy MC. el . , infect Immut 67:554.1-4 (1999)), Finally, is standardized and reproducible model of MRSA-induced septic pneumonia to. evaluate new therapies was established in sheep, (Lnkhbaatar P. et al.. Shock, 29{5);642- 9 (2008)).
101331 The practice o the .disclosure- will employ, unless otherwise- indicated, conventional techniques of ceil biology, ceil culture, molecular biology, transgenic biology, -microbiology, .recombinant DNA, and immunology, which arc witliin the skill of the art. Such techniques are explained folly in. the literature. See, or example, Molecular Cloning A Laboratory Manual, 2nd Ed.( Sambrook et a!,, -ed., Cold Spring Harbor Laboratory Press: (1989); Molecular Cloning; A Laboratory Manual, Sambrook et al, ecL Cold Springs Harbor Laboratory, New York (S 992), DNA Cloning, D. KL Glover ed„ Volumes I and II (1985); Oligonucleotide Synthesis,. M, J, Gait ed,, (1984); Miillis ei at. U.S. Pat. No: 4.683,195; Nucleic Acid H>"bridizaUon, , D. H raes & S. J. Higgins eds, ( 1984); Transcription Aiid'Tramlatk n, . D. Haraes. & S. J. Higgins eds, (198.4); Culture Of Animal Cells, . I . Fres ney, Alan R. Liss, inc., (1987); Immobilized Cells And Enzymes. [RL Press, ( 1986); B. Perbal, A Practical Guide To Molecular Cloning (1984); trie treatise, Methods In Eftzymology. Academic Press. Inc., N.Y.; Ctene Transfer Vectors For Mammalian Cells, J. H. Miller and M. P. Calos eds.. Cold Spring Harbor Laboratory (1987); Methods In Enzymology, Vols. 154 and 155 (Wu et aL eds,); Immunochemical Methods In Cell And Molecular Biology. Mayer and Walker, eds., Academic Press, London (1987); Handbook Of Experimental Immunology, Volumes- 1- IV, D. M. Weir and C, C, BlackwelK eds., (1986); Manipulating the Mouse Embryo, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, .Y.. (1.986); aed in Ausubc! et al., Cnrrent Protocols i Molecular Biology, John Wiley and Sons, Baltimore, Maryland (1989),
1 13 1 Standard, reference works setting forth general principles of immunology include Current Protocols in. Immunology, John Wiley & Sons, New York; Klein, J., immunology: The Science of Seif-Nonself Discrimination, John Wiley & Sons, New York (1982); Roitl I, BiO toff, J, and Male P,, Immunology, 6 ! ed, London: Mosby (2001); Abbas A., Abul, A. and . Lichtraan, A., Cellular and Molecular immunology, Ed. 5, Elsevier Health Sciences Division (2005); and Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1 988).
Examples
{0135 The breadth and scope of the present disclosure should not be limited by any of the above-described exemplary aspects or embodiments, but should be. defined only in accordance with the following claims and their equivalents,
EXAMPLE 1 : τΤΒΑ225 Triple Fusion of Staphylococcal Superantigen toxoids
10136] While the safety of rSEB has been extensively evaluated including a phase I clinical trial,, the safety of rSEA and rTSST-1 have not been extensively studied. In addition, to evaluate whether the fusion of the- three superantigen toxoids exacerbate residual superantigeme activity, the response of PDMC from healthy human donors Lo rTBA using IFNy release as readout for superantigenic activity was evaluated' ("PBMC stimulation assay").
10137} For the P'BM'C stimulation assay, P'BM were incubated in culture .medium in individual wells of 96 well plates with various concentration of wild type TSST-1 or toxoids such as rTBA at 37 °C and 5% CO2 .in a humidified' incubator. After 48 hours of culture, the plates were eentrifuged for 5 minutes and supematants removed. The IFNy concentration in each well was measured using an ELISA kit from R&D Systems according to manufacturer's instructions. The conceu'trat'ion of induced IFNy was plotted against the concentration of the toxin or toxoid to determine EC» '(50 percent effective concentration) for each agent,
[0138] Three donors characterized as l . medium, and high respoaders were used. As shown in Figure 4. at high concentrations, rTBA exhibited low level of IFN-γ induction m the low responder, medium level, in medium responder and high levels in high respftoders, although these responses were much lower than the responses of the same donor to wild-type superantigens.
{01391 These experiments suggested that rTBA retains some residual superantigenic activity. Further analysis indicated that this activity is due to residual activity of rSEAL48R/D70R/Y92A, while rTSSTU0R D27A/146A was completely inactive. Therefore, an additional mutation was introduced into the rSEA portion of rTBA. A previous report suggested that mutation of H225 (SEA-H225A) binding site for MH'C class 11 reduced the ability of SEA to . stimulate T cells .Hudson et ah, 1995, Journaj J Exp Med, 182(3):71 1-720; Kozono et at, 1995, Jonrnal/Tmmumty, 3(2): 187- 196). A mutation was introduced at position H225A into WT SEA, rSEAI.48R/D70R/Y92A as well as rTBA. The new mutants are referred lo herein as SEAH225A (S.BQ ID NO: 1 1 ), rSEAVax225 (also as SEAI48R/D70R/Y92A H225A) (SEQ ID NO: 4), and rTBA225 (SEQ ID NO: 6), respectively, and were tested in the PBMC stimulation assay. Introduction of the single 11225 A mutation into wild-type SEA (SEAM225A) attenuated the toxin but left significant levels of residua! toxicity (Figure 4). The combination o H225A and the L48R D70.R Y92A mutations (rSEAVax 25), however. Was completely inactive on low and medium responder cells and only marginally active on high responder cells at very high concentration (Figure 4). Similarly, rTBA showed residual toxicity while rTBA225 was completel attenuated, even more so than rSEAVax225. These data indicate that a combination of these four mutations was required for full attenuation of rTBA and rSEAVax (Figure 4), EXAMPLE 2: Method for production and tag-free purification of fusion protein of superantigen mutants
|0i4()| The genes encoding the fusion of toxoids rTBA (SEQ ID NO: 5) and rTBA225 (SEQ iD NO: 6) were codon optimized, -synthesized, cloned into the pET24a (·*-) expression vector, and transformed into RL21 (DF,3) E. coll cells, Overnight cultures were expanded in Luria Broth containing kanamydn .until a mid-log phase culture (- 0.5 OD at 600 nm)* at which, point the ceils were chilled to ~-25°C and induced with 0,3 mM WT.G, followed by overnight culture at 25°C. The next day, the bacterial cell were harvested,, weighed, and resuspended in cell lysis buffer (20 mM 'Iris pH 8.0. 50 mM .NaCl, 1 mM EDTA, 0.1% Triton X-i00). Lyso2yme was added ( 1 mg/mLJ, and the cells were incubated at 37CC for 30 minutes. The partially lysed cells were sonicated. Bacterial cell lysis was confirmed, spectrophotometrieal ly . The cell lysate was adjusted to 0.5 M NaCl, and the nucleic acid was precipitated b the addition of polyctlrylencmiinc (ΡΕΓ) under constant mixing. The ΡΕΪ pellet was removed by eentrifugation, and the supernatant containing the toxoid was subjected to ammonium, sulfate (( HihSC ) precipitation. The ( H^SGu pellet w s recovered by eentrifugation and stored at -80°C.
[0141 J As shown in Figure 2.4, the following chromatography steps were performed.
The (NH4J2SO pellets; were resuspended and desalted into the capture column equilibration buffer, clarified, and subjected to chromatography over a Poms 50 MS column. The column was equilibrated, loaded, washed and cluted using a 40-coluntn volume (CV) gradient from 25 to 1 ,000 mM NaCl in phosphate buffer at pfl 6.5. The column fractions were analyzed by SDS-PAGE to determine the -toxoid containing •fractions. The pooled material was dialyzed into the next column .equilibration buffer and subjected to chromatography oyer a Bio ad Ceramic Hydroxyapatfte. (HTP) Type. I column. The column was equilibrated, loaded, washed and elated- using a 40 CV gradient of 50-1 ,000 mM NaCl in a phosphate buffer at pH 6.8. The fractions were analyzed by SDS-PAGE to detect the- toxoid (Figure 2B). The- pooled HTP fractions were dia!yzed into the appropriate storage buffer, filter sterilized, aliquoted and frozen at. -St)yC,
EXAMPLE 3: Immunogenicity of the fusion construct rTBA
[0142] Groups of 5 BALB/c mice were immunised, 3 times with 4 day interval, with either rTBA or a cocktail of the three toxoids along with Sigma' Adjuvant System (SAS) adjuvant Day 35 sera from these mice were tested for total antibody EL1SA and toxin neutralization (TNA). titers. (At 3] Peripheral blood mononuclear eel!s(PB G) were isolated from heparinized blood of healihy munan donors by Ficoll gradient c nirifugaiioa, isolated PSMCs were re-suspended in EPMl 640 with 5% fetal bovine serum (FBS), cells were washed, enumerated by Trypan blue exclusion and adjusted to 2x10* cells/ml. 75 μΐ of this cell suspension (1.5 10s cells) with a viability of >95% was added to duplicate wells of 96- well flat-bottom plates containing 37.5 μΐ of semi- log diluted sera from vaccinated animals -mixed wit a fixed concentration of the supemnti en. Wells containing medium with toxin onlv were used as controls. The cultures were incubated at 37 aC in an atmosphere of 5% CO - 5% air for 48 hours. Cells were .centrifuged at 1600 x g for 10 .minutes, culture supernatant^ were harvested and I y production was assessed by EOSA (R&D Systems, Minneapolis, M ) following the manufacturers- protocol. Plates were read at 450 am using the VersaMax plate reader and data was transferred and analyzed in Microsoft Office Excel 2007. Cells stimulated with toxin in the absence of a neutralizing antibodies served as positive control and was considered as 0% IFNy inhibition. Accordingly, inhibition of IFNy production in the presence of immune sera was calculated as the difference between positive control and sample. T¾o values for the neutralizing agents {human monoclonal antibodies} were determined using a 4-pararneter logistic model (equation 205, XLFii v5.2),
(0144] rTHA induced much higher titers of total I G binding to SBB and TSST-l as well as higher toxin neutralization (TNA) titers as compared to the cocktail of the three toxoids (Figure 3A). Thus, the fusion of the three toxoids into one molecule not only simplifies the vaccine, but also enhances the im mufiogenicity.
{01 51 The .rnmunogen icily of rTBA formulated in Alhydrogel or CpG was also compared; As shown in Figure 3B, both adjuvants induced very high and balanced titers against all three toxins and the magnitude of aotibod response was higher than those achieved with SAS adjuvant. The two adjuvants were equivalent with respect to induction of neut lizing antibodies against SEB and TSST-l while Alhydrogel induced stronger neutralizing response against SEA.
EXAMPLE 4: Inimunogenicit of fusion construct rTBA225
(01461 The immunogcMcity o rTBA225 was tested in Balb/c mice in comparison to rTBA to determine whether the additional imitation impacted the imrounogenicity. Mice were immunized three times with 20 ,g either of SAg cocktail (equiniolar amounts of each individual toxoid), rTBA, or rTBA225 along with Alhydrogel. After the third immunization, mouse sera were tested for binding and neutralization titers by EL!SAs and toxin neutralization assay (TNA) for the antigens SEA, SEB and TSST-i. As shown in Figure 5, mice vaccinated with the fusion constructs had a strong total antibody (Figure 5 A) and neutralizing antibody response (Figure 5B) to all three superantigens. These data show that addition of the mutation did not reduce the .immunogenicity of the fusion vaccine. Furthermore, 'the fusion protein rTBA225 is able to induce neutralizing activity towards superafttigeiis that are not included In the antigen as shown In Figure SC.
10147] It was observed that the SAg toxoid cocktail formulated in Alhydrogel was unable, to induce any antibody response to TSST-1 » while in sharp contrast, the fusion proteins rTBA and rTBA225 induced strong TSST-1 response (Figure 5A left panel). These data show that fusion of TSST-1 was necessary tor inducing strong immune response when formulated with AlhydrogeL T e binding data indicated that this is due to inability, of TSST-1 alone to adsorb Athydrogel, while, as a fusion protein the. antigen adsorbs the Alhydrogel and therefore can induce strong antibody response (Figure 6).
EXAMPLE 5: Protective efficacy of rTBA225 vaccine against toxin challenge with SEA, SEB, and TSST-1
(0148] The protective efficacy of rTBA225 against SAg toxin challenge was evaluated by immunizing Baib'e rake with 20 ^ig of rIBA225 thrice along with Alhydrogel as the adjuvant followed by challenge with an intraperitoneal lethal dose of SEA (10 ^ig/reouse}., SEB (3.315 ug niouse) or TSST-1. (10 ^tg mouse) potentiated by 40 &Ύη η$ε TPS. Weights and health scores of the mice were monitored tor fiv days after the challenge. As shown in Figure 7, immunization with iTBA225 provided 100% protection to SEB and TSST-1 challenge and 90% protection to SEA challenge. These data demonstrate the protective efficacy of rTBA225 against challenge with the respective toxins.

Claims

CLAIMS What is claimed is:
1 . An attenuated Staphyhcoccm ureus-deftved superantigen (SAg) SEA toxoid or fragment, variant, or derivative thereof, comprising four mutations relative to wild-type SEA corresponding to the L48R, D7QR, Y92A, and H225A mutations in SEQ ID NO: 4; wherein the toxoid or fragment, variant, or derivatives thereof, has decreased sruperantigenic activity and/or is less virulent than a SEA toxoid comprising SEQ ID NO; X while maintaining immimogenicity.
2. The attenuated SEA toxoid or fragment, variant, or derivative thereof of claim 1 comprising an amino acid sequence at least 90% identical to SEQ ID NO: 4,
3. The attenuated SEA toxoid or fragment, variant, or derivative thereof of claim 1 comprising SEQ ID NO: 4.
4. The attenuated SEA tox id or fragment, variant, or derivative thereof of any One of claims 1 to which has less than 50%, less than 40%, less than .30%. less than 20%, less than 10%. less than 5%. less than 3%, less than ,2%, or less than 1% of the supe.rantigenic activity of a SEA toxoid comprising SEQ ID NO: 3.
5. A multivalent oligopeptide comprising a fusion of two or more attenuated Staphylococcus aureus-ti&ived superantigen. (SAg) toxoids or fragments, variants, or derivatives thereof arranged in any order, wherein the SAg toxoids or fragments, variants, or derivatives thereof can be the same or different, and wherein at least one of the SAg toxoids is the SEA toxoid of any one of claims I to 4.
6. The oligopeptide of claim 5, xvhereiii the oligopeptide has decreased stiperaiitigenie activity and/or is less virulent than a SAg fusion protein comprising SEQ ID NO: 5,
7. The oli gopeptide of claim 5 or claim 6. wherein the oligopeptide maintains the immunogenicity of the SAg fusion, protein comprising SEQ ID NO: 5.
8. The oligopeptide of any one of claims 5 to 7, wherein the oligopeptide has less than 50%. jess than 40%, less than 30%, less than 20%, less than 1 %, less than 5%,. less than 3%, less than 2%, or less than i.% of the. supcrantigcnic activity of a SAg fusion protein comprising SEQ ID NO: 5.
9. The oligopeptide of any one of claims 5 to 8, wherein the oligopeptide is completely attenuated.
10. The oligopeptide of any one of claims 5 to , comprising three or snore SAg toxoids or fragments, variants, or derivatives thereof.
1 1. The oligopeptide of any one of claims 5 to 10, comprising one or more of a staphylococcal toxic shock syndrome toxin- 1 (TSST-1 ) attenuated toxoid; a staphylococcal cntcrotoxin. B (SEB) attenuated toxoid; or any combination thereof.
12. The oligopeptide of claim 1 1, wherein the TSST-1 attenuated toxoid comprises ihree mutaiicms relative to wild-type TSST-i eoiTes-ponding to the L30R, D27A, and 146 A mutations in SEQ ID O: 1 and. an amino acid sequence at least, 90% identical to SEQ ID NO: 1 ; the SEB attenuated toxoid comprises three mutations relative to wild-type SEB corresponding to the L45R* Y89A, and Y 4A mutations in SEQ ID NO: 2 and -an amino acid sequence at. least 90% identical to SEQ ID NO: 2; and the SEA attenuated toxoid, comprises four mutations relative to wild-type SEA corresponding to the L4HR, D7 R, Y92A, and H225A. mutations in SEQ ID NO: 4 ami an amino acid sequence at least 90% identical to SEQ ID NO: 4.
13. The oligopeptide of claim I I or claim 12, wherein the TSST-1 toxoid comprises the amino acid sequence SEQ ID NO: 1 ; the SEB toxoid comprises the amino acid sequence SEQ ID NO: 2; and the SEA attenuated toxoid comprises the amino acid sequence
SEQ ID NO: 4.
14. The oligopeptide of any one of claims 5 to 13, wherein the two or more SAg toxoids or fragments, variants, or derivatives thereof are each associated via a linker,
15. The oligopeptide of claim 14, wherein the linker comprises at least one, but no more than 50 amino acids selected from the group consisting of glycine, serine, alanine,, -and a combination thereof.
16. The oligopeptide of claim 15, wherein th linker comprises {GGGS)n or (GGGGS),¾ wherein n is a integer from 1 to 10. - SO -
17. The oligopeptide of claim 16, wherein the linker comprises (GGGGS)a.
18. The oligopeptide of claim 17, wherein n is 3 ,
19. The oligopeptide of any one of claims 5 to 18 comprising the amino acid sequence SEQ ID NO: 6,
20. The -oligopeptide of -any one of claims 5 to 19, furthef comprising a heterologous polypeptide.
21 . The oligopeptide of claim 20, wherein the heterologous polypeptide comprises a His-tag, a ubiquitin tag, a NusA tag, a chitm binding domain, a B-tag., a H SB-tag,, green fhiorcsccnt protein (GFP), a calmodulin binding protein (CBP), a galactose-binding protein, a maltose binding protein (MBP). cellulose binding domains (CBD's), an avidin ¾lreptavidin Strep ag, t pE, chloramphenicol, aeetyltransferase., lacZ (β- Gaiactosidase), a FLAG1*1 peptide, an S-tag, a T7-tag, a f agment of any of the heterologous polypeptides, or a combination of two or more of the heterologous polypeptides.
22. The oligopeptide of claim 20 or claim 21 , wherein the heterologous polypeptide comprises an immunogen, a T-eefl epitope, a B-cell epitope, fragment thereof, or a combination thereof.
23. The oligopeptide of any one. of claims 5 to 22 further comprising an immiifiogcnic carbohydrate.
24. The oligopeptide of claim 23, wherein the immunogenic carbohydrate is a saccharide.
25. The oligopeptide of claim 24, wherein, the immunogenic carbohydrate is a capsular polysaccharide or a surface polysaccharide.
26. The oligopeptide of claim 25. wherein the immunogenic carbohydrate is selected from, the group consisting of capsular polysaccharide (CP) serotype 5 (CPS), CPS, poly- -acetylgiucosamine (PNAG), poIy-N-succinyl glucosamine (PNSG), Wall Teichoic Acid (WTA), Lipoi ichoic acid (LTA), a fragment of any of the immunogenic carbohydrates, and a combination of two or more of the immunogenic carbohydrates.
27. The oligopcptid.e of an one of claims 23 to 26, wherein the immunogenic carbohydrate is conjugated to the oligopeptide.
28. An. isolated polynucleotide comprising a nucleic acid that encodes the attenuated SEA toxoid polypeptide of any one of claims 1 to 4 or the multivalent oligopeptide of any one of claims 5 to 27,
29. The polynucleotide of claim 28 comprising the nucleotide sequence SEQ ID
NO; 8.
30. The polynucleotide of claim 28 or claim 29. further comprising a heterologous nucleic acid.
31. The polynucleotide of claim 30, wherein the heterologous nucleic acid comprises a.-pr«raoler -operab!y associated- with the nucleic add encoding the oligopeptide,
32. A vector comprising the polynucleotide of any on e of claims 28 to 31.
33. The sector of claim 32, which is a plasmid.
34. A host cell comprising the vector of claim 32 or claim 33.
35. The host cell of claim 34, which is a bacterium, an insect cell, -a■mammalian cell, or a plant cell.
36. The host cell of claim 35, wherein the bacterium is Escherichi coli.
37. A method of producing a multivalent oligopepiide, comprising euJturing the host ceil of any one of claims 34 to 36, and recovering die oligopeptide.
38. A composition comprising the attenuated SEA toxoid, of any one of claims I to 4, the oligopeptide of an one of claims 5 to 27. or an com ination thereof, and a carrier.
39. The composition of claim 3S5 further comprising an adjuvant.
40. The composition of claim 39, wherein the adjuvant is alum, aluminum hydroxide, aluminum phosphate, or a glacopyran syl lipid A-bascd adjuvant.
41. The composition of any one of claims 38 to 40, further comprising an additional krmiunogen.
42. The composition of claim 41, wherein the additional immuriogen is a bacterial antigen.
43. The composition of claim 42, wherein the bacterial antigen is selected from the group consisting of a pore forming toxin, a superaiitigen, a cell surface protein, a fragment of any of the bacterial antigens, and a combination of two or more of the■' bacterial antigens,
44. A method of inducing a hast immune response against Staphylococcus aure . comprising administering to a subject in need of the immune response an effective amount of die composition of any one of claims 38 to 43.
45. The method of claim 44» wherein the immune response is selected from the group consisting of an innate response, a humoral response, an antibody response, a cellular response, and a combination of two or more of the immune responses.
46. The method of claim 45, wherein the immune response is an antibody response,
47. A method of preventing or treating a Staphylococcal disease or infection in a subject comprising administering to a subject in need thereof the composition of any one of claims 38 to 43,
48. The method: of claim 47, wherein the infection is a localized or systemic infection of skin, soft tissue, blood, or a organ, or is auto-immune in nature.
49. The method of claim 48, wherein the disease is a respiratory disease.
50. The method of claim 49, wherein the respiratory disease is pneumonia.
51. The method of claim 48, wherein the disease i s sepsis.
52. The method of any one of claims 44 to 51 , wherein the subject is a mammal.
53. The method of claim .52, wherein the mammal is a hitman.
54. The method of claim 52, wherein the mammal is bovine or canine.
55. The metliod of any one of claims 44 to 54, wherein the composition is administered via intramuscular injection, intradermal injection, intraperitoneal injection, subcutaneous injection, intravenous injection, oral admin jstratiorij mucosal administration., intranasal administration, or pulmonary administration.
56. The composition of any one of claims 38 to 43, for use in inducing a host immune response against Staphylococcus aureus in a subject.
57. The composition of any one of claims 38 to 43. for use in preventing or treating a Staphylococcal disease or infection in a subject.
5.8. A method of producin a vaccine against S. aureus infection comprising: isolating the attenuated SEA toxoid of any one of claims I to , the multivalent oligopeptide of any one of claims 5 to 27, or any combination thereof: and combining the toxoid, oligopeptide, or any combination thereof, with an adjuvant.
PCT/US2018/043687 2017-07-27 2018-07-25 Immunogenic composition comprising a fusion peptide derived from superantigen toxoids WO2019023341A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
EP18838475.4A EP3658181A4 (en) 2017-07-27 2018-07-25 Immunogenic composition comprising a fusion peptide derived from superantigen toxoids
MX2020001046A MX2020001046A (en) 2017-07-27 2018-07-25 Immunogenic composition comprising a fusion peptide derived from superantigen toxoids.
JP2020503935A JP7303791B2 (en) 2017-07-27 2018-07-25 Immunogenic compositions containing fusion peptides derived from superantigen toxoids
US16/633,664 US11260120B2 (en) 2017-07-27 2018-07-25 Immunogenic composition comprising a fusion peptide derived from superantigen toxoids
CN201880047111.4A CN110996993B (en) 2017-07-27 2018-07-25 Immunogenic compositions comprising fusion peptides derived from superantigen toxoids
CA3069747A CA3069747A1 (en) 2017-07-27 2018-07-25 Immunogenic composition comprising a fusion peptide derived from superantigen toxoids
US17/680,897 US11826412B2 (en) 2017-07-27 2022-02-25 Immunogenic composition comprising a fusion peptide derived from superantigen toxoids

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762537706P 2017-07-27 2017-07-27
US62/537,706 2017-07-27

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/633,664 A-371-Of-International US11260120B2 (en) 2017-07-27 2018-07-25 Immunogenic composition comprising a fusion peptide derived from superantigen toxoids
US17/680,897 Division US11826412B2 (en) 2017-07-27 2022-02-25 Immunogenic composition comprising a fusion peptide derived from superantigen toxoids

Publications (1)

Publication Number Publication Date
WO2019023341A1 true WO2019023341A1 (en) 2019-01-31

Family

ID=65041106

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/043687 WO2019023341A1 (en) 2017-07-27 2018-07-25 Immunogenic composition comprising a fusion peptide derived from superantigen toxoids

Country Status (6)

Country Link
US (2) US11260120B2 (en)
EP (1) EP3658181A4 (en)
JP (1) JP7303791B2 (en)
CA (1) CA3069747A1 (en)
MX (1) MX2020001046A (en)
WO (1) WO2019023341A1 (en)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030009015A1 (en) * 1997-06-25 2003-01-09 Robert G. Ulrich Bacterial superantigen vaccines
US20100111978A1 (en) * 2001-06-28 2010-05-06 Active Biotech Ab Conjugates between a variant staphylococcal enterotoxin e superantigen and a targeting antibody that binds to a cancer-associated cell surface structure
US20160185829A1 (en) * 2013-06-19 2016-06-30 Integrated Biotherapeutics, Inc. Toxoid Peptides Derived from Phenol Soluble Modulin, Delta Toxin, Superantigens, and Fusions Thereof

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6593114B1 (en) 1996-01-05 2003-07-15 Human Genome Sciences, Inc. Staphylococcus aureus polynucleotides and sequences
TW517061B (en) 1996-03-29 2003-01-11 Pharmacia & Amp Upjohn Ab Modified/chimeric superantigens and their use
US7087235B2 (en) 1997-06-25 2006-08-08 The United States Of America As Represented By The Secretary Of The Army Fusion protein of streptococcal pyrogenic exotoxins
WO2000002522A2 (en) 1998-07-10 2000-01-20 U.S. Medical Research Institute Of Infectious Diseases Anthrax vaccine
GB0118155D0 (en) 2001-07-25 2001-09-19 Lorantis Ltd Superantigen
EP1461433A1 (en) 2001-11-26 2004-09-29 U.S. Medical Research Institute of Infectious Diseases Bacterial superantigen vaccines
NZ561879A (en) 2003-03-07 2009-05-31 Wyeth Corp Polysaccharide - staphylococcal surface adhesin carrier protein conjugates for immunization against nosocomial infections
US7754225B2 (en) 2006-07-20 2010-07-13 Glaxosmithkline Biologicals S.A. Method of protecting against staphylococcal infection
WO2008154101A1 (en) 2007-06-06 2008-12-18 The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Psm peptides as vaccine targets against methicillin-resistant staphylococcus aureus
AU2008292897B2 (en) 2007-08-31 2015-01-22 University Of Chicago Methods and compositions related to immunizing against staphylococcal lung diseases and conditions
AU2012214677B2 (en) 2011-02-08 2016-11-10 Abvacc, Inc. Immunogenic composition comprising alpha-hemolysin oligopeptides
CN103561762A (en) 2011-03-16 2014-02-05 明尼苏达大学董事会 Compositions and methods for inducing immune responses against bacteria in the genus staphylococcus
SI2785368T1 (en) 2011-12-02 2019-08-30 Integrated Biotherapeutics, Inc. Immunogenic composition comprising panton-valentine leukocidin (pvl) derived polypeptides

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030009015A1 (en) * 1997-06-25 2003-01-09 Robert G. Ulrich Bacterial superantigen vaccines
US20100111978A1 (en) * 2001-06-28 2010-05-06 Active Biotech Ab Conjugates between a variant staphylococcal enterotoxin e superantigen and a targeting antibody that binds to a cancer-associated cell surface structure
US20160185829A1 (en) * 2013-06-19 2016-06-30 Integrated Biotherapeutics, Inc. Toxoid Peptides Derived from Phenol Soluble Modulin, Delta Toxin, Superantigens, and Fusions Thereof

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
ABRAHMSEN ET AL.: "Characterization of two distinct MHC class II binding sites in the superantigen staphylococcal enterotoxin A", THE EMBO JOURNAL, vol. 14, no. 13, 3 July 1995 (1995-07-03), pages 2978 - 2986, XP055572015 *
HUDSON ET AL.: "Staphylococcal enterotoxin A has two cooperative binding sites on major histocompatibility complex class II", JOURNAL OF EXPERIMENTAL MEDICINE, vol. 182, no. 3, 1 September 1995 (1995-09-01), pages 711 - 720, XP055572007 *
KRUPKA ET AL.: "Structural basis for abrogated binding between staphylococcal enterotoxin A superantigen vaccine and MHC-IIa", PROTEIN SCIENCE, vol. 11, no. 3, 31 March 2002 (2002-03-31), pages 642 - 651, XP055572012 *
See also references of EP3658181A4 *

Also Published As

Publication number Publication date
US20200206335A1 (en) 2020-07-02
JP2020537488A (en) 2020-12-24
CA3069747A1 (en) 2019-01-31
MX2020001046A (en) 2020-08-06
JP7303791B2 (en) 2023-07-05
US20220257744A1 (en) 2022-08-18
CN110996993A (en) 2020-04-10
US11260120B2 (en) 2022-03-01
EP3658181A1 (en) 2020-06-03
EP3658181A4 (en) 2021-06-16
US11826412B2 (en) 2023-11-28

Similar Documents

Publication Publication Date Title
US10174085B2 (en) Toxoid peptides derived from phenol soluble modulin, delta toxin, superantigens, and fusions thereof
AU2012214677B2 (en) Immunogenic composition comprising alpha-hemolysin oligopeptides
CA2857666C (en) Immunogenic composition comprising panton-valentine leukocidin (pvl) derived polypeptides
AU2018285857B2 (en) Immunogenic compositions comprising Staphylococcus aureus leukocidin lukA and lukB derived polypeptides
US11826412B2 (en) Immunogenic composition comprising a fusion peptide derived from superantigen toxoids
CN110996993B (en) Immunogenic compositions comprising fusion peptides derived from superantigen toxoids
US20180141981A1 (en) Immunogenic composition comprising engineered alpha-hemolysin oligopeptides
GR1010289B (en) Toxoid peptides originating from phenol-soluble modulin, toxin delta , superantigen and fusion thereof
NZ626762B2 (en) Immunogenic composition comprising panton-valentine leukocidin (pvl) derived polypeptides

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18838475

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3069747

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020503935

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2018838475

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2018838475

Country of ref document: EP

Effective date: 20200227