WO2019018475A1 - Engineered variants of hiv-1 env for presentation of quarternary epitopes - Google Patents
Engineered variants of hiv-1 env for presentation of quarternary epitopes Download PDFInfo
- Publication number
- WO2019018475A1 WO2019018475A1 PCT/US2018/042610 US2018042610W WO2019018475A1 WO 2019018475 A1 WO2019018475 A1 WO 2019018475A1 US 2018042610 W US2018042610 W US 2018042610W WO 2019018475 A1 WO2019018475 A1 WO 2019018475A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- hiv
- env
- protein
- proteins
- mutations
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/21—Retroviridae, e.g. equine infectious anemia virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16111—Human Immunodeficiency Virus, HIV concerning HIV env
- C12N2740/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16111—Human Immunodeficiency Virus, HIV concerning HIV env
- C12N2740/16134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- H IV-1 Env is formed by a homotrimeric complex of gp160 subunits that are cleaved by host proteases during maturation into extracellular gp120 and membrane-tethered gp41 , which remain non-covendingiy associated in a 'closed' conformation ⁇
- the gp120 subunit binds the primary host receptor GD4, inducing a change to an Open' conformation of Env that exposes binding sites for a secondary co-receptor 2 ⁇ 4 .
- This co-receptor is one of either two chemokine receptors, CCR5 or CXCR4, and once bound , further conformational changes release fusogenic regions of gp41 that mediate membrane fusion and viral entry into the host cell.
- Env is the only viral protein on the outside of a HIV-1 virion accessible to the humoral immune system, and therefore has been extensively studied for vaccine development 5 .
- Mature Env has a complex structural organization. At the apex most distal from the membrane is a trimerization domain that mediates contacts between gp120 subunits, and is formed by variable regions V1 , V2, and V3 6"11 .
- V1 , V2, and V3 6"11 In the central region of the Env spike are the gp120 inner and outer domains, which face in towards the trimer axis or out towards bulk solvent, respectively.
- the N- and C-termini of gp120 are encircled and 'grasped' by the extracellular region of gp41 , with the gp41 heptad repeat HR1 forming trimer contacts that resemble a helical-bundle 'spine' at the center of the complex.
- gp41 transmembrane helices 2 followed by gp41 cytoplasmic tails.
- Infection is initiated by GD4 binding to Env in a closed conformation , where there are close interactions between apical tips of the trimerization domains 6 .
- CD4 binding stabilizes large conformational changes that break apical contacts and promote opening of the structure 6 13 .
- the closed and open conformations have distinct antigenic profiles, with many broadly neutralizing antibodies (bNAbs) binding preferentially to closed Env 14 ⁇ 15 , while the open state presents strain-specific, poorly neutralizing epitopes in the V3 region 16,17 .
- bNAbs broadly
- Env sequence diversity exposure of non-neutralizing or strain-specific immunodominant epitopes, and epitope shielding by extensive giycosyiation, ail act to limit potency and breadth of the host response.
- Design and purification of Env immunogens that correctly fold into native-like, pre-fusion closed trimers is also challenging , due to intrinsic conformational flexibility.
- Env for vaccine purposes contains the so-called SOSIP mutations (an introduced disulfide between residues 501 and 605 to prevent gp120-gp41 dissociation 1S , and an I559P mutation that destabilizes the post-fusion trimeric conformation 19 ; ail residue numbers throughout are based on the HXB2 reference strain), which permit the expression and purification of soluble extracellular Env as native trimers 20,21 .
- SOSIP mutations an introduced disulfide between residues 501 and 605 to prevent gp120-gp41 dissociation 1S , and an I559P mutation that destabilizes the post-fusion trimeric conformation 19 ; ail residue numbers throughout are based on the HXB2 reference strain
- SOSIP construct is in the ciade A strain BG5Q5 sequence, but SOSIP mutations have also been introduced into Env from other strains in different clades.
- SOSIP constructs have been engineered with additional mutations and/or disulfide bonds to further stabilize the closed conformation recognized by most bNAbs 22-3 ⁇ 4 , reduce exposure of V3 region epitopes 17 ⁇ 22 - 24 , be expressed as single chain non-proteolyzed native trimers 25-27 , and to bind germline B cells with higher affinity to stimulate lineages that mature into potent bNAb secretors 24,28 .
- Env More reductionist approaches have trimmed down the extracellular regions of Env to produce stable fragments of gp120 9,30 or, at the most extreme, stabilize isolated epitopes for focusing an immune response 3 i-33 , Understanding how Env sequence dictates conformation can therefore assist the design of sophisticated Env immunogens for optimum immunogenicity.
- Env full or close-to-full length Env that contains the transmembrane domain has not been as extensively engineered to stabilize closed trimeric conformations. This is despite full-length Env being well suited for some vaccine formats, such as a DNA vaccine, virus-like particles (VLPs), or purified protein embedded in membrane nanodiscs.
- VLPs virus-like particles
- Deep mutational scanning couples directed evolution of diverse sequence populations with next generation sequencing to track the phenotypic fitness of thousands of mutations simultaneously 34 .
- the method has been used for vaccine design to screen for mutations within SOSIP constructs that, enhance direct interactions with an antibody and its germline precursors, reduce exposure of V3 epitopes, and improve thermostability 24,35 22 .
- Tissue culture propagation of viruses expressing Env variants has also been followed by next generation sequencing, and the mutational tolerance observed in these experiments closely aligns with observed diversity of natural Env sequences 36 .
- this experimental system has proven insightful for characterizing Env mutations that allow Hi V-1 to escape neutralization from a broadly-neutralizing antibody (bNAb) 37 .
- Fig. 1 Sequence-activity landscapes of BaL Ersv interacting with protein ligands.
- the left schematic outlines sequence features of gp120 (dark grey) and gp41 (light grey), with an arrowhead indicating the proteolysis site.
- Fig. 3 Mapping conserved sites for ligand binding to Env structure, (A-C) Conservation scores from selecting Env libraries for binding (A) soluble CD4, (B) VRC01 , or (C) PG16 are mapped to the surface of an Env proiomer, from ⁇ -2 (conserved, black) to > 0 (variable or under selection for change, white). The second and third protomers in the trimeric spike are shown as dark and pale grey ribbons. The binding sites for CD4, VRC01 , and PG16 are shown with dashed circles. The model of BaL Env in the closed state was generated by sequence threading to PDB 5FYK, followed by loop building, and side chain and backbone minimization.
- Fig. 5 Neutralization of the electropositive apical cavity stabilizes Env in a PG16- reeognized conformation. From the mutational scan, substitutions were identified that were both predicted to enhance PG16 binding, and were localized on subunit surfaces not expected to be major sites of direct bNAb interactions. The substitutions validated to enhance PG16 binding signal when expressed on Expi293F ceils clustered to five sites, shown on a structural model of closed E vaaL. PG18 is shown as a black cartoon, interacting glycans are white sticks, two Env protomers are shown as dark and pale grey surfaces, and the third Env protomer is shown as a pale grey ribbon. Mutations are indicated in the magnified insets. In the close-up of site 1 at left, positive electrostatic potential on the surface of two Env protomers is shown in black.
- Fig. 6 Reduced PG16 binding to ceils expressing Env variants that were depleted in the sequence-activity landscape. Twenty representative mutations were chosen that were depleted following FAGS-based selection for PG16 binding in both replicate experiments. All 20 mutants were found to have reduced PG16 (2 nM) binding signal by flow cytometry when transfected in to Expi293F cells. Shown are histograms from one of two replicates. Wildtype is black, mutants are various shades of grey. The percent positive cells from both replicates is tabulated in the legend. Loss of PG16 binding signal may be due to reduced antibody affinity, incorrect folding, or decreased surface expression.
- (D-F) Binding of soluble CD4 to QES mutants of (D) BaL, (E) Q769.d22, and (F) Q842.d12 Env expressed on Expi293F cells, (n 3, mean ⁇ SD).
- Fig. 8 Increased PG18 binding to Env mutated at the subunit interfaces is not mediated by changes in fur n-dependent cleavage.
- A Polyclonal anti-Env blot of iysates from ceils expressing BaL gp160 variants.
- Fig. 9 Mutations at the Env subunit interfaces that stabilize the PG18-recognized closed state do not prevent exposure of V3 region epitopes.
- Env ⁇ QES variants are competent for membrane fusion.
- Ceils expressing the CD4 and CCR5 receptors were co-incubated with ceils expressing wildtype BaL, or BaL- QES.01 Env. The cytoplasm was stained with caicein and nuclei were stained with Hoechst 33342. Fused syncytia were obsea3 ⁇ 4d as enlarged cells.
- Fig. 11 Mutations within the Env core for increased PG16 binding.
- A A combinatorial library of surface-displayed gp14(W was sorted for high PG18 binding. Wiidtype sequence is at top, with core mutations present in the library listed below each residue position. An alignment of 7 enriched clones/sequences with higher PG16 binding is shown, with the consensus in bold.
- Ercv ⁇ GES variants can catalyze membrane fusion.
- the formation of fused syncytia was measured v/hen full-length Env-expressing and CD4/CCR5-expressing ceils were co-incubated.
- QES mutations stabilizing the closed state do not significantly decrease ceil fusion, but mutation V255M that destabilizes the CD4-bound open state does inhibit fusion (compare BaL-QES.i01 .c01 to BaL-QES.i01 , Q769.d22-QES.i03.V255IV1 to Q769.d22 ⁇ QES.i03, and DU422-QES.C03 to DU422 wiidtype).
- Mean ⁇ SEM from n 1 0 replicates.
- Fig. 17 Purified Env sufounits from t e BaL. Q769.d22, and Q842.d12 strains containing QES mutations are not shifted towards higher molecular weight forms.
- BG50S SOSIP trimer recognized by PG18.
- His- tagged wiidtype (grey) and QES.i03.c03 (black) BG505 SQSiP.664 were purified by nickel affinity chromatography and separated by SEC on a Superose 6 10/300 column. The trimer peak at left was identified based on a near identical elution volume to purified soluble gp140 B aL ( Figure 17A) and high affinity binding to PG16.
- B Coomassie-stained SDS electrophoresis gel of purified BG505 SQSIP.664 proteins.
- Fig. 19 Sequence-activity landscapes of g 140 D u 22 for interacting with the host CD4 receptor and bMAb PG16.
- gp140 2 (i.e. depleted, black) to > +3 (i.e. enriched , white).
- the primary structure of gp140 is on the horizontal axis, and amino acid substitutions are on the vertical axis. *, stop codons.
- gp120 and gp41 are dark and pale grey, respectively, the cleavage site is indicated with an arrow head, and notable regions are shaded black.
- B The sequence-activity landscape of gp140 D u422 under FACS-based selection for binding to PG16.
- FIG. 2D Corrections between rep!icate experiments.
- A-C FACS-based selections for sCD4 binding were repeated twice. Agreement between the replicate log2 enrichment ratios for each gp140 DU 422 mutation are plotted for the (A) NT, (B) central, and (C) CT libraries.
- D-F Agreement between the residue conservation scores from replicate selections of the (A) NT, (B) central, and (C) CT libraries for sCD4 binding.
- G-i Log 2 enrichment ratios for every single amino acid substitution of gp140ou422 are plotted for two independent experiments where the (G) NT, (H) central, and (I) CT SS libraries were selected for PG16 binding.
- J-L Agreement between the residue conservation scores from replicate selections of the (A) NT, (B) central, and (C) CT libraries for PG16 binding.
- Fig. 21 Residues at the En D u 22 irimer interface are more conserved for PG18 binding than for CD4 interactions.
- A Cartoon structure of the gp120 (dark grey) and gp41 (pale grey) protomer in the closed conformation (based on PDB 5FYK 85 ). V1 , V2, and V3 (shown as various shades of grey) form the apical trimerization domain.
- B An atomic model of trimeric DU422 gp140 in the closed conformation, with one protomer shown as a surface, and the other protomers shown as grey ribbons.
- the PG16-CD4 conservation difference scores are mapped to the protomer surface in the same orientation as (A), with black indicating residues preferentially conserved for PG16 binding, and white indicating residues more conserved for CD4 binding. On the right is a cutaway through the protomer surface, showing that preferential conservation for PG16 binding extends into the core of the trimerization domain.
- C Cryo-EM structure of gp120 (dark grey) and gp41 (pale grey) from a single protomer in the CD4-bound open conformation (PDB 5VN3 i3 ). Electron density was absent for V1 and V2 regions.
- Fig. 22 increased ydrophobic packing at the gp120 inner-outer domain interface enhances expression of a PG16-recognized conformation.
- B Structures of DU422 Env (gp120, pale grey; gp41 , dark grey) were modeled in closed and CD4-bound open conformations. Mutations are indicated in black.
- An embodiment provides an HIV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations listed in Table 1 , wherein the amino acids are numbered by HXB2 numbering.
- Another embodiment provides an HIV-1 Env protein or fragment thereof comprising one or more of the sets of amino acid mutations iisted in Tabie 2, wherein the amino acids are numbered by HXB2 numbering.
- an HIV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations listed in Tabie 1 or Tabie 2, wherein the protein or fragment thereof has at least one mutation shown in Tables 1 or 2 and otherwise has about 95% or more sequence identity to an HIV-1 Env protein (such as a wild-type HIV-1 Env protein).
- Yet another embodiment provides a trimeric complex or portion thereof comprising H IV- 1 Env proteins or fragments comprising one or more of the mutations iisted in Table and Tabie 2 in a trimeric conformation.
- Still another embodiment provides an immunogen comprising an HIV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations Iisted in Table 1 or Table 2 or an H IV-1 Env trimeric complex or portions thereof comprising one or more of the amino acid mutations iisted in Table 1 or Tabie 2.
- Even another embodiment provides a method of screening a compound for binding to one or more proteins thereof, wherein the one or more proteins comprise an H IV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations iisted in Table 1 or Tabie 2, a trimeric complex or portions thereof comprising one or more of the amino acid mutations listed in Table 1 or Tabie 2, or combinations thereof.
- the method comprises providing the one or more proteins, fragments, complexes or portions thereof; contacting the one or more proteins, fragments, complexes or portions thereof with the compound ; and determining the ability of the compound to bind to the one or more proteins, fragments, complexes or portions.
- the one or more proteins, fragments, trimeric complexes, or portions thereof can comprise 2, 5, 10, 1 5, or more proteins, fragments, trimeric complexes, or portions thereof.
- the compound can inhibit an HiV-mediated activity.
- the compound can be provided in a library.
- An embodiment provides a library comprising two or more (e.g., 2, 5, 10, 20, 30, 50, 100 or more) HIV-1 Env proteins or fragments thereof comprising one or more of the amino acid mutations iisted in Table 1 or Tabie 2 or an HIV-1 Env trimeric complex or portions thereof comprising one or more of the amino acid mutations iisted in Table 1 or Table 2.
- Another embodiment provides a nucleic acid molecule encoding an HIV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations Iisted in Table 1 or Tabie 2 or a trimeric complex or portions thereof comprising one or more of the amino acid mutations iisted in Table 1 or Table 2.
- Still another embodiment provides a vector comprising a nucleic acid molecule described herein.
- Yet another embodiment provides a host ceil comprising a vector described herein. Even another embodiment provides a method of producing an H IV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof comprising cuituring a host cell described herein in a culture medium to produce the protein, fragment, complex, or portion thereof.
- the host ceil can be a mammalian cell having the ability to glycosylate proteins.
- An embodiment provides a composition comprising one or more HIV-1 Env proteins or fragments thereof described herein, one or more HIV-1 Env trimeric complexes or portions thereof described herein, and a pharmaceutically acceptable carrier.
- the composition can comprise one or more HIV-1 Env proteins or fragments thereof or one or more HIV-1 Env trimeric complexes or portions thereof.
- the composition can also comprise one or more HIV-1 Env proteins or fragments thereof and one or more HIV-1 Env trimeric complexes or portions thereof.
- the composition can further comprise an adjuvant.
- HIV-1 infected ceil in a subject comprising administering to the subject an amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof described herein, effective to elicit an immune response in the subject.
- Yet another embodiment provides a method for preventing a subject from becoming infected with HIV-1 comprising administering to the subject a prophylactically effective amount of an amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof described herein, such that the subject is prevented from becoming infected with HIV-1 .
- Still another embodiment provides a method for reducing the likelihood of a subject becoming infected with HIV-1 comprising administering to the subject an amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof described herein, effective to reduce the likelihood of the subject becoming infected with HIV-1 .
- the subject may have been exposed to HIV-1 .
- Another embodiment provides a method for delaying the onset, of, or slowing the rate of progression of, an HIV-1 -related disease or symptom in an HIV-1 -infected subject comprising administering to the subject an amount of an amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof described herein, effective to delay the onset of, or slow the rate of progression of the HIV-1 -related disease or symptom in the subject.
- An embodiment provides a method of isolating antibodies that specifically bind to an HIV- 1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof described herein.
- the method comprises administering an effective amount of an HIV-1 Env trimeric complex or portion thereof, an HIV-1 Env protein or fragment thereof, an HIV-1 Env nucleic acid molecule, a vector, a host cell or a pharmaceutical composition described herein to a subject to generate antibodies that specifically bind to an HIV-1 Env protein or HIV-1 Env trimeric complex; and isolating the antibodies.
- Another embodiment provides a method of identifying antibodies that specifically bind to an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof as described herein.
- the method comprises administering an effective amount of an immunogen selected from: an HIV-1 Env trimeric complex or portion thereof, an HIV-1 Env protein or fragment thereof, an HIV-1 Env nucleic acid moiecule, a vector, a host cell or a pharmaceutical composition described herein to B cells in an in vitro cell culture system to generate antibodies that specifically bind to the HIV-1 Env protein, fragment thereof, HIV-1 En trimeric complex or portion thereof.
- Antibodies specific for the administered complex or composition are then isolated.
- Yet another embodiment provides a method of making an isolated hybridoma that produces a broadly neutralizing antibody that specifically binds to an HIV-1 Env trimeric complex, portion thereof, an HIV-1 Env protein, or fragment thereof.
- the method comprises
- Splenocytes are isolated from the immunized mammal and the isolated splenocytes are fused with an immortalized ceil line to form hybridomas.
- individual hybridomas are screened for production of an antibody that specifically binds with the HIV-1 Env protein or fragment thereof or HIV-1 Env trimeric complex or portion thereof to isolate the hybridoma.
- Still another embodiment provides a method of producing a stable HIV-1 Env trimer in a closed conformation.
- the method comprises making one or more of the amino acid mutations or sets of mutations described herein in an HIV-1 Env protein and expressing the protein such that a stable HIV-1 En trimer in a dosed conformation is produced.
- HIV-1 infection is initiated by viral Env engaging the host receptor CD4, triggering Env to transition from a 'closed' to Open' conformation during the early events leading to virus-cell membrane fusion.
- sequence-activity landscapes were defined for Env interacting with CD4, antibody VRC01 that binds the CD4 site but fails to induce the open state, and antibody PG16 that recognizes closed Env.
- the Env trimer interface was under selection for PG16 recognition, and mutations that enhance presentation of the PG16 quaternary epitope frequently reduce positive charge at the Env apex, suggesting this region is primed for opening by electrostatic repulsion.
- Mutations described herein stabilize a closed Env conformation are broadly applicable to different HIV-1 strains, and can assist in the engineering of Env-based immunogens that better present epitopes recognized by broadly neutralizing antibodies.
- Env sequence preferences are determined independent of infection and virus propagation for interactions with three protein ligands that act as conformational probes: CD4, which induces the open Env conformation and binds monomeric gp120 with highest affinity; bNAb VRC01 , which binds tightly to both monomeric gp120 and mature Env without inducing the open conformation; and bNAb PG16, which exclusively binds closed trimeric Env 8 ⁇ 44 , While soluble SOSIP proteins have been extensively engineered, less focus has been applied to conformational stabilization of full-length Env that may be better suited for virus-like particle or DNA vaccines.
- Mutations are provided herein thai stabilize the PG16 quaternary epitope in full-length Env sequences from representative strains in clades A, B and C, while simultaneously enhancing presentation of epitopes recognized by PGT121 and PGT128 bNAbs, and also revealing an electrostatic repulsion mechanism for inducing the closed-to-open transition, it would be ideal if there were a suite of mutations for applying broadly to any HIV-1 strain, which stabilize Env in a ciosed trimer for improved bNAb elicitation. A HIV-1 vaccine could then be rapidly modified and updated to contain stabilized Env sequences from local prevailing strains.
- the HIV-1 Env mutants described herein address a pressing need in that they can be rapidly used as a focused mutational screen to conformational ⁇ stabilize Env from diverse HIV-1 strains.
- This information provides mechanistic insights, and is leveraged for engineering full-length Env with properties that may prove especially useful for vaccines that incorporate membrane-anchored Env (e.g. virus-like particles or DNA vaccines), and can also be applied to soluble extracellular constructs like SOSIP.
- membrane-anchored Env e.g. virus-like particles or DNA vaccines
- Env-QES.i01 and QESJ02 variants still bind CD4 and expose V3 region epitopes, either because of dynamic or induced conformational fluctuations, or persistent conformational heterogeneity that includes trimeric, monomeric, closed, open and/or misfolded forms.
- V3 region epitopes are hidden only by inclusion of an additional core mutation (V255 ) to destabilize the CD4-bound open state, and some of the mutations identified herein from the mutational scan of DU422 gp14Q (e.g.
- Y484W may similarly act to destabilize the CD4-bound open state.
- trimer-stabilized SOSIP gp140 constructs also have persistent binding to V3 antibodies 17,2 °, and induce undesirable V3 non- neutralizing responses in immunized animals 16 ⁇ 17 . This has necessitated negative selection strategies to explicitly reduce V3 loop exposure 17,24 .
- the findings described herein emphasize that positive stabilization alone appears insufficient to prevent Env opening, and the open state must be explicitly destabilized. HfV-1 Env Protein Mytatiorss
- HIV-1 is completely dependent upon the Env protein to enter cells. HIV-1 Env is formed by a homotrimeric complex of gp160 subunits that are cleaved by host proteases during maturation into extracellular gp120 and membrane-tethered gp41 , which remain non-covalently associated in a 'closed' conformation. Production of Envtrimeric complexes that mimic the native spike, however, is challenging in part because the recombinant trimers either are unstable or aggregate. Therefore, mutants of Env proteins that can form stable trimeric complexes in the closed conformation are desirable.
- Membrane distal and membrane proximal aspects of the HIV- 1 trimer in the closed conformation include several distinct structural elements that are absent from the corresponding regions of the HIV-1 Env trimer in its CD4-bound open conformation.
- the following mutations can be used to generate mutant, stable En trimeric complexes in the closed conformation across many clades of HIV-1 ,
- the amino acid substitutions disclosed herein can be used to alter the Env protein in any clades or subtypes of Group M, O, N, or P HIV- 1 strains.
- HIV-1 Env proteins and nucleic acid sequences encoding Env proteins and methods for the manipulation and insertion of such nucleic acid sequences into vectors are well known (see, e.g., HIV Sequence Compendium, Division of AIDS, National Institute of Allergy and Infectious Diseases (2013); HIV Sequence Database (hiv-web.lanl.gov/conteniihiv-db/mainpage. html); Sambrook et ai. (Molecular Cloning: A Laboratory Manual, 4 t " ed, Cold Spring Harbor, N.Y., 2012); Ausubel et al.
- HIV-1 Env protein sequences are known and are available in the HIV Sequence Database (hiv-web.lanl.gov/content/hiv-db/mainpage.html).
- amino acid substitution is the replacement of one amino acid in a polypeptide with a different amino acid or with no amino acid (i.e., a deletion).
- An embodiment provides an HIV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations) in Table A.
- a fragment can be about 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, or more amino acids as long as it.
- the amino acids are numbered by HXB2 numbering.
- An embodiment provides an HiV-1 Env protein or fragment thereof comprising one or more of the combination of amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more sets of mutations) in Table B.
- the amino acids are numbered by HXB2 numbering.
- An embodiment provides an HIV-1 Env Ba L protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 , 2, 3, 4, 5, or more sets of mutations) in Table C.
- the amino acids are numbered by HXB2 numbering.
- An embodiment provides an HIV-1 Env DU 422 protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 , 2, 3, 4, 5, or more sets of mutations) in Table D.
- the amino acids are numbered by HXB2 numbering.
- An embodiment provides an HIV-1 EnvQ 7 89.d22 protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 , 2, 3, 4, 5, or more sets of mutations) in Table E.
- the amino acids are numbered by HXB2 numbering.
- An embodiment provides an HIV-1 Env Q842.d12 protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 , 2, 3, 4, 5, or more sets of mutations) in Table F.
- the amino acids are numbered by HXB2 numbering.
- An embodiment provides an HIV-1 Env 25711 protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 , 2, 3, 4, 5, or more sets of mutations) in Table G.
- the amino acids are numbered by HXB2 numbering.
- An embodiment provides an HIV-1 BG505 SOSIP.664 protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 ,
- HIV-1 Env mutant protein described herein comprises one or more of the amino acid substitutions described herein (e.g., those shown in Tables A, B, C, D, E, F, G, or H). HIV-1 Env mutant proteins described herein can comprise the disclosed amino acid mutation or set of amino acid mutations and otheavise have 75, 80, 90, 95, 99% or more sequence identity to any HIV-1 Env protein (e.g., an HIV-1 ⁇ ⁇ 3 _ protein, an HIV-1 Env DU 422 protein, an HIV-1 Env Q7 69.d22 protein, an HIV-1 Env Q842.d12 protein, an HIV-1 Env 2571 1 protein or other HIV-1 Env proteins).
- HIV-1 Env protein e.g., an HIV-1 ⁇ ⁇ 3 _ protein, an HIV-1 Env DU 422 protein, an HIV-1 Env Q7 69.d22 protein, an HIV-1 Env Q842.d12 protein, an HIV-1 Env 2571 1 protein or other HIV-1 Env proteins.
- an amino acid in a polypeptide is substituted with an amino acid from a homologous polypeptide, for example, an amino acid in a recombinant Clade A HIV-1 Env polypeptide can be substituted with the corresponding amino acid from a Clade B HIV-1 Env polypeptide.
- HXB2 numbering All amino acid numbering of HIV-1 Env used herein refers to HXB2 number.
- HXB2 numbering is described in detail in, for example, Korber ef a/. Numbering Positions in HIV Relative to HXB2CG, in Korber et a!., eds., Human Retroviruses and AIDS 1998, pp. 111-102- 111-1 1 1 , Los Alamos National Laboratory, Los Alamos, NM, report LA-UR 99-1704, which is incorporated by reference in its entirety.
- HIV HXB2 GenBank accession number K03455.
- HIV HXB2 is also known as: HXBc2, for HXB clone 2; HXB2R, and HXB2CG in GenBank, for HXB2 complete genome.
- HXB2 Env sequence is shown in SEQ ID NO:1 below.
- the HIV-1 Env amino acid mutation "T49D” means that the T at position 49 of the Env sequence is changed to D. in some cases the first amino acid of the mutation abbreviation may not match precisely to the HXB2 numbering.
- HXB2 has a V at position 200, but one mutation described herein is A200E. That means the HIV strain studied has an A at the HXB2 200 position and that the A is mutated to E.
- A200E mutation described herein
- a protein is a polymer of amino acids covendingiy linked by amide bonds.
- a protein can be post-translationally modified.
- a purified protein is a protein preparation that is substantially free of cellular material, other types of proteins, chemical precursors, chemicals used in synthesis of the protein, or combinations thereof.
- a protein preparation that is substantially free of cellular material, culture medium, chemical precursors, chemicals used in synthesis of the protein, etc. has less than about 30%, 20%, 10%, 5%, 1 % or more of other proteins, culture medium, chemical precursors, and/or other chemicals used in synthesis. Therefore, a purified protein is about 70%, 80%, 90%, 95%, 99% or more pure.
- a purified protein does not include unpurified or semi-purified cell extracts or mixtures of protein that are less than 70% pure.
- proteins can refer to one or more of one type of protein (a set of proteins).
- Proteins can also refer to mixtures of two or more different types of proteins (a mixture of proteins).
- proteins or “protein” can each also mean “one or more proteins.”
- proteins refers to both full-length proteins and fragments of proteins.
- the HIV-1 Env proteins comprising one or more mutations described herein are non-naturally occurring.
- HIV-1 Env proteins can be fragments of the proteins described herein.
- an HIV-Env can comprise a fragment of an HIV-1 Env protein, having one or more of the mutations described herein.
- a fragment can be about 20, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 500, 600, 7QQ, 800 or more amino acids in length.
- a fragment can be about 800, 700, 600, 500, 450, 425, 400, 375, 350, 325, 300, 275, 250, 225, 200, 175, 150, 125, 100, 75, 50, 20, or less amino acids in length.
- an HIV-1 Env protein has about 1 , 5, 10, 20, 30, 40, 50 or more amino acids truncated from the C-terminus. Such truncations can advantageously remove motifs for internalization that reduce surface expression.
- HIV-1 Env protein or fragment thereof can be linked to an epitope or affinity tag such as polyhistidine, DYKDDD (SEQ ID NO:2) tag, c-myc tag, Strep tag, TAP tag, and HA tag.
- an epitope or affinity tag such as polyhistidine, DYKDDD (SEQ ID NO:2) tag, c-myc tag, Strep tag, TAP tag, and HA tag.
- a mutated protein comprises at least one deleted, inserted, and/or substituted amino acid, which can be accomplished via mutagenesis of polynucleotides encoding these amino acids.
- Mutagenesis includes well-known methods in the art, and includes, for example, site-directed mutagenesis by means of PCR or via oligonucleotide-mediated mutagenesis as described in Sambrook et a/., Molecular Cloning-A Laboratory Manual, 2nd ed., Vol. 1 -3 (1989).
- a protein can include multiple polypeptide chains.
- mature HIV-1 Env comprises gp120 and gp41 polypeptide chains.
- a single contiguous polypeptide chain of amino acid residues can include multiple polypeptides.
- a single chain HIV-1 Env can comprise a gp120 polypeptide linked to a gp41 polypeptide by a peptide linker.
- Proteins and polynucleotides have about 75, 80, 85, 90, 95, 98, 97, 98, 99% or more sequence identify to proteins and polynucleotides described herein (e.g., proteins have one or more of the mutations show in Table A and Table B) can be used herein. Proteins and polynucleotides that have about 75, 80, 85, 90, 95, 98, 97, 98, 99% or more sequence identity to polypeptides and polynucleotides described herein while retaining one or more of the mutations show in Table A and Table B can also be used herein.
- Sequence identity is the similarity between amino acid sequences and is expressed in terms of similarity between sequences. Sequence identity can be measured in terms of percentage identity (or similarity or homology): the higher the percentage, the more similar the two sequences are. Homologs, orthoiogs, or variants of a protein or nucleic acid molecule will have a relatively high degree of sequence identity when aligned using standard methods.
- the percent sequence identity value is rounded to the nearest tenth. For example, 88.1 1 , 88.12, 88,13, and 88.14 are rounded down to 88.1 , while 88.15, 88,16, 88.17, 88.18, and 88.19 are rounded up to 88.2.
- the length value will always be an integer.
- Homoiogs and variants of a protein and nucleic acid molecule are typically characterized by possession of at least about 75%, for example at least about 75%, 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identify counted over the full length alignment with the amino acid or nucleic acid sequence of interest. Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity.
- homoiogs and variants When less than the entire sequence is being compared for sequence identity, homoiogs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website.
- sequence comparison For sequence comparison of nucleic acid sequences, typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters are used.
- Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482, 1981 , by the homology alignment algorithm of Needleman & Wunsch, J. Moi. Biol. 48:443, 1970, by the search for similarity method of Pearson & Lipman, Proc. Natl.
- PILEUP uses a simplification of the progressive alignment method of Feng & Dooiittle, J. Mol.
- PILEUP Evol. 35:351 -360, 1987. The method used is similar to the method described by Higgins & Sharp, GABIOS 5:151 -153, 1989.
- PILEUP a reference sequence is compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (Q.10), and weighted end gaps.
- PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et a!., Nuci. Acids Res. 12:387-395, 1984).
- thai are suitable for determining percent sequence identity and sequence similarity
- BLAST and the BLAST 2,0 algorithm are described in Aiischu! et at., J. oL Biol. 215:403-410, 1990 and Aifschui et a!., Nucleic Acids Res. 25:3389- 3402, 1977.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (ncbi.nlm.nih.gov).
- the BLASTP program (for amino acid sequences) uses as defaults a word length (W) of 3, and expectation (E) of 10, and the BLOSU 62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915, 1989).
- an HIV-1 Env protein is from strain/clade BaL, DU422, YU-2, 2571 1 , Q769.d22, Q842.d12, BG505, 191084, ADS, B41 , SF162P3, 001428, SHIV327C, Hu_A1 Q, AC10, ZM197 , CH1 10, H031 , CH1 1 1 , 257-31 , PVO, CH1 15, or any other HIV-1 strain or clade and comprises one or more of the mutations or sets of mutations described herein.
- An embodiment provides a library comprising two or more (e.g., 2, 5, 20, 10, 50, 75, 100 or more) of the mutated HIV-1 Env proteins disclosed herein.
- Another embodiment provides a display library of one or more of the mutated HIV-1 Env proteins disclosed herein.
- the mutated HIV-1 Env proteins can comprise a fragment of the mutated HIV-1 Env protein or a full-length mutated HIV-1 Env protein.
- a fragment of the mutated HIV-1 Env protein comprises at least one of the disclosed mutations and is about 10, 20, 50, 100, 200, 300, 400, 500, 600, 700, 800, or more amino acids in length, in an embodiment, a fragment can induce an immune response.
- a mutated HIV-1 Env protein or fragment thereof can be displayed on the surface of a library, by for example the C terminus. This is a display library.
- a mutant HIV-1 Env display library can comprise a phage display library.
- a phage display library can be a collection of phage that has been genetically engineered to express one or more mutant HIV-1 Env proteins or fragments thereof on their outer surface, in an embodiment nucleic acid molecules encoding the mutant HIV-1 Env proteins or fragments thereof are inserted in frame into a gene encoding a phage capsule protein.
- a phage display library is a collection of phage that displays one or more mutant HIV-1 Env proteins or fragments thereof on their outer surface.
- a display library can be, for example, a phage display library, a phagemid display library, a virus display library, a bacterial ceil display library, a mammalian cell display library, yeast display library, a Agt1 1 library, an in vitro library selection system (CIS display), an in vitro compartmentalization library, an antibody-ribosome-mRNA (ARM) ribosome display library, or a ribosome display library.
- a mutant HIV-1 Env library or display library can be screened for biological activity.
- improved percentage of trimeric complex formation e.g., about 10, 20, 30, 40, 50 60, 70% or more improved trimeric complex formation as compared to wild-type HIV-1 Env trimeric complex formation
- improved trimeric complex yield e.g., about 10, 20, 30, 40, 50 60, 70% or more improved trimeric complex yield
- An HIV-1 Env trimeric complex comprises HIV-1 Env proteins comprising at least one mutation described in a mature trimeric conformation. Three HIV-1 Env proteins come together to form one HIV-1 Env trimeric complex. Therefore, each HIV-1 Env trimeric complex has three gp120 subunits and three gp41 subunits.
- a portion of an HIV-1 Env trimeric complex can be about 100, 200, 300, 400, 500, 600, 700 or more amino acids, as long as it contains an amino acid mutation listed in Tables A-H, can induce an immunogenic response in a subject (e.g., a mammal such as a human), and includes at least a portion of three gp120 subunits and at least a portion of three gp41 subunits.
- An HIV-1 Env trimeric complex can be a chimeric HIV-1 Env trimeric complex that comprises amino acid sequences from two or more different HIV-1 c!ades or amino acid sequences from two or more different mutant HIV-1 Env proteins.
- HIV-1 trimeric complex formation can be measured by an antibody binding assay using antibodies that bind specifically to the trimeric form of the HIV-1 Env protein.
- trimeric complex specific antibodies that can be used to defect a trimer form include, but are not limited to, monoclonal antibodies (mAbs) PGT145, PGDM14Q0, PG16, and PGT151 .
- Any antibody binding assay known in the art can be used to measure the percentage of trimer formation of a recombinant HIV-1 Env protein of the invention, such as ELISA, AlphaLISA, etc.
- the amount of HIV-1 Env trimeric complexes formed and the total amount of envelope protein expressed can also be determined using, for example, chromatographic techniques (e.g. , size exclusion chromatography multi-angle light scattering (SEC-MALS) that can separate the trimeric complex form from any other forms of the HIV-1 Env protein , e.g. , the monomer form.
- SEC-MALS size exclusion chromatography multi-angle light
- An HIV-1 En trimeric complex can comprise three gp12Q-gp41 protomers comprising a gp120 polypeptide and a gp41 extracellular domain.
- Mature gp120 includes H IV-1 Env residues from about 31 -51 1 (wherein the amino acids are numbered by HXB2 numbering) , and contains most of the external, surface exposed, domains of the HIV-1 Env trimeric complex.
- the gp120 portion of the trimeric complex can bind to cellular CD4 receptors and can bind to cellular chemokine receptors.
- a mature gp120 poiypeptide is an extracellular poiypeptide that interacts with the gp41 extracellular domain (approximately HIV-1 Env positions 512-644) to form an HIV- 1 Env protomer that trimerizes to form an HIV-1 Env trimeric complex.
- Mature gp41 comprises approximately HIV-1 Env amino acids 512-858, and includes cytosolic, transmembrane, and extracellular-domains.
- the gp41 extracellular domain comprises HIV-1 Env residues from about 512-644.
- an HIV-1 Env protein comprises one or more of the mutations disclosed herein
- an HiV1 -Env protein comprises a fragment of an HIV-1 Env protein, which includes at least one extracellular domain or a portion of an extracellular domain having one or more of the mutations described herein.
- An extracellular fragment can be about 20, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, or more amino acids in length.
- the N-terminal residue of the gp120 polypeptide is one of HIV-1 Env positions 1 -35 (i.e. , one or more of amino acids 1 -34 can be absent).
- the C- terminal residue of the gp120 polypeptide is one of HIV-1 Env positions 503-512 (i.e., one or more of amino acids 504-512 can be truncated or removed), in an embodiment, the N-terminal residue of the gp41 extracellular domain is one of H IV-1 Env positions 512-522 (i.e. , one or more of amino acids 512-521 are absent).
- the C-terminal residue of the gp41 extracellular domain is one of HIV-1 Env positions 640-683 (i.e., one or more of amino acids 640-683 is removed).
- Ail numbering refers to HXB2 numbering.
- Truncations of the C-terminus of HIV-1 Env can be useful to (i) increase expression and/or
- An HIV-1 Env trimeric complex can be stable in a mature closed conformation.
- An HIV-1 Env trimeric complex comprises at least one mutant HIV-1 En protein or fragment described herein and can exhibit increased retention of the mature closed conformation upon CD4 binding compared to a corresponding wild-type or naturally occurring HIV-1 Env trimeric complex.
- a HIV-1 Env trimeric complex stabilized in the mature closed conformation can have at least about 60, 70, 80, 90, 95, 98, 99% or more reduced transition to the CD4-bound open conformation upon CD4 binding compared to a corresponding native HIV-1 Env trimeric complex.
- the stabilization of the mature closed conformation by one or more mutations described herein can be, for example, energetic stabilization (for example, reducing the energy of the mature closed conformation relative to the CD4-bound open conformation) and/or kineiic siabilizatson (for example, reducing the rate of transition from the mature closed conformation to the open conformation) and/or reduced conformational heterogeneity (for example, a greater fraction of the expressed protein is in the dosed conformation).
- stabilization of the HI -1 Env trimeric complex in the mature closed conformation can include an increase in resistance to denaturation compared to a corresponding native HIV-1 Env trimeric complex.
- the inclusion of one or more mutations described herein increases the pool of HIV-1 Env trimeric complexes present in the closed state as compared to wild-type or naturally occurring H IV-1 Env trimeric complexes. That is, use of HIV-1 Env proteins or fragments thereof having one or more mutations described herein can result in about 5, 10, 20, 30, 40, 50, 60, 70, 80, 90% or more HIV-1 Env trimeric complexes present in the closed state as compared to the use of wild-type or naturally occurring HIV-1 proteins or fragments thereof.
- Methods of determining if a H IV-1 Env trimeric complex is in the mature closed conformation include, for example, negative stain electron microscopy and antibody binding assays using a mature closed conformation specific antibody, such as VRG26 or PGT145.
- Methods of determining if a HIV-1 Env trimeric complex is in the CD4-bound open conformation include for example, negative stain electron microscopy and antibody binding assays using a CD4-bound open conformation specific antibody, such as 1 7b, which binds to a CD4-induced epitope.
- an H IV-1 Env trimeric complex can comprise a non-natural disulfide bond between cysteine substitutions at positions 201 and 433, a non-natural disulfide bond between cysteine substitutions at positions 501 and 805, and a proline substitution at position 559.
- an HIV-1 Env trimeric complex does not specifically bind to a CD4- induced antibody when incubated with a molar excess of soluble GD4.
- An embodiment provides an immunogen comprising one or more of the HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof described herein.
- An immunogen can also be a vector, nucleic acid molecule, or host cell as described herein .
- An immunogen can induce an immune response in a mammal, including for example, humans infected with HIV-1 or at risk of HIV-1 infection .
- Administration of an immunogen can lead to protective immunity and/or proactive immunity against HIV-1 .
- An immune response is a response of a cell of the immune system, such as a B cell, T ceil, or monocyte, to a stimulus.
- the response is specific for a particular HI - 1 Env antigen (an "antigen-specific response").
- an immune response is a T ceil response, such as a CD4+ response or a CD8+ response.
- an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof as described herein comprises an epitope or other construct such that the protein or fragment thereof will bind an MHC molecule and induce an immune response, such as a cytotoxic T lymphocyte ("CTL") response, and/or a B cell response (for example, antibody production), and/or a T-helper lymphocyte response against the antigen from which the protein or fragment thereof is derived.
- CTL cytotoxic T lymphocyte
- B cell response for example, antibody production
- Embodiments include nucleic acid molecules encoding the mutant HIV-1 Env protein, fragments thereof, HIV-1 Env trimeric complex or portion thereof disclosed herein.
- Polynucleotides contain less than an entire viral genome and can be single- or double-stranded nucleic acids.
- a polynucleotide can be RNA, DNA, cDNA, genomic DNA, chemically synthesized RNA or DNA or combinations thereof.
- a polynucleotide can comprise, for example, a gene, open reading frame, non-coding region, or regulatory element.
- a gene is any polynucleotide molecule that encodes a protein or fragments thereof, optionally including one or more regulatory elements preceding (5' non-coding sequences) and following (3' non-coding sequences) the coding sequence. In one embodiment, a gene does not include regulatory elements preceding and following the coding sequence.
- a naturally occurring or wild-type gene refers to a gene as found in nature, optionally with its own regulatory elements preceding and following the coding sequence.
- a chimeric or recombinant gene refers to any gene that is not a naturally occurring or wild-type gene, optionally comprising regulatory elements preceding and following the coding sequence, wherein the coding sequences and/or the regulatory elements, in whole or in part, are not found together in nature.
- a chimeric gene or recombinant gene comprise regulatory elements and coding sequences that are derived from different sources or regulatory elements and coding sequences that are derived from the same source, but arranged differently than is found in nature.
- a gene can encompass full-length gene sequences (e.g., as found in nature and/or a gene sequence encoding a full-length polypeptide or protein) and can also encompass partial gene sequences (e.g., a fragment of the gene sequence found in nature and/or a gene sequence encoding a protein or fragment of a polypeptide or protein).
- a gene can include modified gene sequences (e.g., modified as compared to the sequence found in nature).
- a gene is not limited to the natural or full-length gene sequence found in nature.
- Polynucleotides can be purified free of other components, such as proteins, lipids and other polynucleotides.
- the polynucleotide can be 50%, 75%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% purified.
- a polynucleotide existing among hundreds to millions of other polynucleotide molecules within, for example, cDNA or genomic libraries, or gel slices containing a genomic DNA restriction digest are not to be considered a purified polynucleotide.
- Polynucleotides can encode the proteins described herein (e.g., mutant HIV-1 Env proteins and fragments thereof).
- Polynucleotides can comprise additional heterologous nucleotides that do not naturally occur contiguously with the polynucleotides.
- heterologous refers to a combination of elements that are not naturally occurring or that are obtained from different sources.
- Polynucleotides can comprise other nucleotide sequences, such as sequences coding for linkers, signal sequences, T R stop transfer sequences, transmembrane domains, or ligands useful in protein purification such as giutathione-S-transferase, histidine tag, and Staphylococcal protein A.
- Polynucleotides can be isolated.
- An isolated polynucleotide is a naturally-occurring polynucleotide that is not immediately contiguous with one or both of the 5' and 3' flanking genomic sequences that it is naturally associated with.
- An isolated polynucleotide can be, for example, a recombinant DNA molecule of any length, provided that the nucleic acid sequences naturally found immediately flanking the recombinant DNA molecule in a naturally-occurring genome is removed or absent, isolated polynucleotides also include non-naturally occurring nucleic acid molecules.
- Polynucleotides can encode full-length proteins, polypeptide fragments, and variant or fusion polypeptides.
- Degenerate polynucleotide sequences encoding polypeptides described herein, as well as homologous nucleotide sequences that are at least about 80, or about 85, 90, 91 , 92, 93, 94, 95, 96, 97, 98, or 99% identical to polynucleotides described herein and the complements thereof are also polynucleotides.
- Degenerate nucleotide sequences are polynucleotides that encode a protein described herein or fragments thereof but differ in nucleic acid sequence from the wild- type polynucleotide sequence, due to the degeneracy of the genetic code.
- cDNA complementary DNA
- species homologs, and variants of polynucleotides that encode biologically functional polypeptides also are polynucleotides.
- Polynucleotides can be obtained from nucleic acid sequences present in, for example, an HIV virion. Polynucleotides can also be synthesized in the laboratory, for example, using an automatic synthesizer. An amplification method such as PCR can be used to amplify polynucleotides from either genomic DNA or cDNA encoding the polypeptides.
- Polynucleotides can comprise coding sequences for naturally occurring polypeptides or can encode altered sequences that do not occur in nature. Unless otherwise indicated, the term polynucleotide or gene includes reference to the specified sequence as well as the complementary sequence thereof.
- An embodiment includes a vector comprising an HIV-1 Env polynucleotide that encodes a mutant HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof as disclosed herein.
- a vector is used to introduce a nucleic acid molecule into a host ceil, thereby producing a transformed host ceil.
- Recombinant vectors are vectors having recombinant DNA.
- a vector can include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication .
- a vector can also include one or more selectable marker genes and other genetic elements known in the art.
- polynucleotides can be cloned into an expression vector comprising expression control elements, including for example, origins of replication, promoters, enhancers, or other regulatory elements thai drive expression of the polynucleotides in host ceils.
- a vector can be, for example, a virus (e.g. , adenovirus or poxvirus), naked DNA, oligonucleotide, cationic lipid (e.g. , liposome), cationic polymer (e.g ., polysome), virosome, nanoparticle, or dentrimer.
- viral vectors include adeno-associated virus vectors, retrovirus vectors, poxviruses, vaccinia virus, herpesviruses, togaviruses, picornaviruses, and baculoviruses.
- Other vectors include bacteriophages, phagemids, yeast artificial chromosomes, bacterial artificial chromosomes, virus- like particles, cosmids (piasmids into which phage lambda cos sites have been inserted) and repiicons (genetic elements that are capable of replication under their own control in a ceil).
- the nucleic acid molecules of a vector can be encapsulated in a lipid membrane or by structural proteins (e.g. , capsid proteins), that can include one or more viral polypeptides (e.g. , an HIV-1 Env protein or portion thereof).
- structural proteins e.g. , capsid proteins
- a vector can be used to infect ceils of a subject, such that translation of the heterologous gene(s) of the vector occurs, in an embodiment an H IV-1 Env trimeric complex is formed.
- Naked DNA or oligonucleotides encoding one or more of the H IV-1 Env proteins, fragments thereof, HIV-1 trimeric complexes or portions thereof described herein can also be used to express H IV-1 Env proteins in a cell or a subject to promote formation of HIV-1 Env trimeric complexes. See, e.g ., Cohen, Science 259: 1691 -1692 (1993); Fynan et a!. , Proc, Natl. Acad, Sci. USA, 90: 1 1478 (1993); and Wolff et al manipulate BioTechniques 1 1 :474485 (1 991 ),
- a virus-like particle can comprise one or more H IV-1 Env proteins, fragments thereof, or HIV-1 Env trimeric complexes as described herein.
- VLPs lack the viral components that are required for virus replication and thus represent a highly attenuated form of a virus.
- the VLP can display an HIV-1 Env protein, fragment thereof, trimeric complex or portion thereof that is capable of eliciting an immune response to HIV-1 Env when administered to a subject.
- Virus like particles and methods of their production are known to the person of ordinary skill in the art, and viral proteins from several viruses are known to form VLPs, including human papillomavirus, HIV, Semliki-Forest virus, human poiyomavirus, rotavirus, and others.
- the virus like particle can include any of the recombinant HIV-1 Env trimeric complexes or immunogenic fragments thereof thai are disclosed herein .
- An embodiment provides a host ceil comprising one or more vectors or nucleic acid molecules as described above.
- a recombinant host cell, transgenic host cell, or transformed host ceil is a ceil into which one or more foreign or exogenous nucleic acid molecules, synthetic nucleic acid molecules, or piasmids have been introduced or inserted into the cell.
- the one or more foreign nucleic acid molecules, synthetic nucleic acid molecules, or piasmids do not occur in the host cell in nature.
- the cell may be prokaryotic or eukaryotic.
- the term also includes any progeny of the host ceil. It is understood that ail progeny may not be identical to the parental ceil since there may be mutations that occur during replication. However, such progeny are included when the term "host cell" is used .
- An embodiment provides methods of producing HIV-1 Env proteins, fragments thereof, HiV-1 trimeric complexes or portions thereof comprising one or more of the mutations described herein.
- nucleic acid molecules capable of expressing H IV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes or portions thereof are cloned into one or more vectors
- nucleic acid molecules encoding H IV-1 Env gp120 su bun its are cloned into a first vector and nucleic acid molecules encoding HIV-1 Env gp140 are cloned into a second vector. Both vectors can be introduced into host cells, in an embodiment the nucleic acid molecules encoding HIV-1 proteins or fragments thereof are codon optimized for expression in human ceils.
- One or more host cells can be cultured in an appropriate medium to produce HIV-1 Env proteins, fragments thereof, H IV-1 trimeric complexes or portions thereof.
- a host ceil can be a mammalian ceil having the ability to glycosylate proteins.
- An embodiment provides a method of producing a stable H IV-1 Env trimer in a closed conformation.
- the method comprises making one or more of the amino acid mutations or sets of mutations disclosed herein in an HIV-1 Env protein, fragment thereof, H IV-1 Env trimeric complex or portion thereof and expressing the protein in a host cell.
- An embodiment provides methods of screening a compound or test agent for binding to one or more HIV-1 Env proteins, fragments thereof, HIV-1 Env complexes or portions thereof comprising one or more of the mutations described herein.
- the one or more mutant H IV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof are contacted with one or more test agents or compounds.
- the ability of the test agent or compound to bind to the one or more mutant HIV-1 Env proteins, fragments, trimeric complexes or portions thereof is determined.
- the test agent can be any type of compound, molecule, biological molecule, or drug.
- Binding assays such as competitive binding assays and direct binding assays are well known to those of skill in the art.
- a plurality of mutant HIV-1 Env proteins (e.g. , 2, 5, 10, 15, or more mutant HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof disclosed herein) can be screened.
- a compound or test agent can be tested for inhibition of an H IV-1 -mediated activity.
- HIV-1 -mediated activity can be, for example, viral spread, infection, or cell fusion.
- Cell fusion may be, for example, target cell entry or syncytial formation .
- the compound or test agent inhibits an HiV-mediated activity.
- the compound or test agent can be provided in a library or display library.
- a screening step can also serve as the step of recovering a test agent or compound that binds to the mutant HIV-1 Env protein, fragment thereof, or trimeric compound.
- Solid-phase screening methods can involve, for example, immobilizing test agents or compounds onto a solid phase, and contacting mutant HIV-1 Env proteins, fragments, trimeric complexes or portions thereof contained in a liquid phase with the test agents or compounds and removing unbound mutant HIV-1 Env proteins, fragments, trimeric complexes or portions thereof and nonspecifically bound mutant HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof and then seiectiveiy separating mutant HIV-1 Env proteins, fragments, trimeric complexes or portions thereof bound with the test agent or compound to screen for a protein, fragment, trimeric complex or portion thereof having, foi ⁇ example, a desired binding activity.
- a liquid-phase screening method can involve, for example, contacting mutant HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof with test agents in a solution, removing unbound mutant HIV-1 Env proteins, fragments thereof, trimeric complexes and portions thereof and nonspecifically bound HIV-1 Env proteins, fragments thereof, trimeric complexes and portions thereof and then seiectiveiy separating the HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof bound with test agents or compounds.
- an HIV-1 Env protein, fragment thereof, HIV-1 trimeric complex, portion thereof, or combinations thereof can be presented as a membrane protein in nanodiscs. See, e.g., Bayburt et a/., J. Struct. Biol. (1998); 123:37; Civjan et a/,, BioTechniques (2003) 35:556; Hagn et ai, J. Am. Chem. Soc. (2013) 135:1919.
- Nanodiscs have a phospholipid bilayer system held together by membrane scaffold proteins (MSPs), which wrap around a patch of a lipid bilayer to form a disc-like particle or nanodisc.
- MSPs membrane scaffold proteins
- Nanodiscs are therefore highly soluble in aqueous solutions. Once assembled into nanodiscs, membrane proteins can be kept in solution in the absence of detergents.
- MSPs can be, for example, truncated forms of apolipoproiein (apo) A-l, MSP1 D1 , MSP1 E3D1 , MSP2N2, MSP2N3, or MSP1 D1 dH5.
- Nanodiscs can be about 7-17 nm in diameter depending on the type of MSP used.
- MSPs can be derived from for example, mouse, rat or human apo A-1 proteins. Use of mouse or rat apo A-1 proteins can improve antibody specificity when human HIV-1 Env target protein-nanodisc complexes are used for immunization.
- Nanodiscs can be used to reconstitute HIV-1 Env in an artificial environment resembling the native membrane. These nanodisc-stabiiized proteins can be directly purified by standard chromatographic procedures. The resulting purified membrane protein:nanodisc complex can be used in screening applications that require access to both the physiologically intracellular and extracellular surfaces of the protein and thus allows unrestricted access of antagonists, agonists, and other interaction partners. The nanodiscs can also be used as an H IV-1 Env immunogen or HIV-1 Env vaccine.
- Nanodiscs can be made using cell-free expression systems.
- An HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, portions thereof or combinations thereof can be expressed from, for example, a plasmid.
- Pre-assemb!ed nanodiscs are supplied in the mixture that integrate the nascent HIV-1 Env protein.
- Nanodiscs can also be made using a two-step reconstitution of detergent-solubilized proteins. Purified HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof or combinations thereof are combined with a suitable detergent, and membrane scaffold proteins and phospholipids are added .
- Nanodiscs containing the membrane protein form spontaneously, and can be purified by affinity or size exclusion chromatography.
- Nanodiscs can also be made via direct solubilization from membranes expressing HIV-1 Env proteins, fragments thereof, H IV-1 Env trimeric complexes, portions thereof, or combinations thereof. Starting from membranes expressing the HIV-1 Env protein, detergent and membrane scaffold protein are added . Membrane phospholipids, HIV-1 Env protein and MSP assemble to form the nanodisc complex.
- Phospholipids such as dimyristoyl-glycero-phosphocholine (DMPC), paimitoyl-oleoyi- phosphatidylcholine (POPC), and many other phospholipids can be used when making nanodiscs.
- DMPC dimyristoyl-glycero-phosphocholine
- POPC paimitoyl-oleoyi- phosphatidylcholine
- many other phospholipids can be used when making nanodiscs.
- An embodiment provides a nanodisc comprising one or more of HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof, or combinations thereof as described herein, a membrane scaffold protein; and one or more phospholipids.
- the nanodiscs can be used to screen test agents or compounds for binding or biological activity.
- the nanodiscs can be used as an immunogen or vaccine.
- a pharmaceutical composition can comprise a mutant HIV-1 Env protein or fragment thereof (which comprise at least one mutation described herein) , an HIV-1 Env trimeric complex comprising at least on mutant HIV-1 Env protein or portion thereof (which comprises at least one mutation described herein), nucleic acid molecule as described herein , a vector as described herein, a host cell as described herein, or a combination thereof combined with a pharmaceutically acceptable carrier.
- compositions and formulations suitable for pharmaceutical delivery are well known in the art. See e.g., Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co., Easton , Pa., 1 9th Edition , 1995, which describes compositions and formulations suitable for pharmaceutical delivery.
- parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle.
- pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle.
- solid compositions e.g., powder, pill, tablet, or capsule forms
- conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitoi, lactose, starch, or magnesium stearate.
- compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- a carrier may be sterile, and/or suspended or otherwise contained in a unit dosage form containing one or more measured doses of the composition suitable to induce the desired anti-HIV-1 immune response. It may also be accompanied by medications for its use for treatment purposes.
- the unit dosage form may be, for example, in a sealed vial that contains sterile contents or a syringe for injection into a subject, or lyophiiized for subsequent solubilization and administration or in a solid or controlled release dosage.
- a pharmaceutical composition can comprise an adjuvant to enhance antigenicity.
- An adjuvant can comprise, for example, a suspension of minerals (alum, aluminum hydroxide, or phosphate); or water-in-oil emulsion, for example, in which antigen solution is emulsified in mineral oil (Freund incomplete adjuvant), sometimes with the inclusion of killed mycobacteria (Freund's complete adjuvant) to further enhance antigenicity (inhibits degradation of antigen and/or causes influx of macrophages).
- Immunostimulatory oligonucleotides (such as those including a CpG motif) can also be used as adjuvants.
- Adjuvants can include biological molecules, such as costimulatory molecules.
- Exemplary adjuvants include IL-2, RANTES, G -CSF, TNF-a, IFN-Y, G-CSF, LFA-3, CD72, B7-1 , B7-2, OX-40L, SA-4-1 BBL and toll-like receptor (TLR) agonists, such as TLR-9 agonists.
- Adjuvants are well known in the art. See, e.g., Singh (ed.) Vaccine Adjuvants and Delivery Systems. Wiley-lnterscience, 2007).
- a pharmaceutical composition can comprise a detergent, such as a non-ionic detergent (e.g., a polyethylene type detergent).
- a detergent such as a non-ionic detergent (e.g., a polyethylene type detergent).
- An embodiment provides a method for eliciting an immune response against an HiV-1 infected ceil in a subject (e.g., a mammal such as a human) comprising administering to the subject a therapeutically effective amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof comprising one or more mutations described herein such that an immune response is elicited in the subject.
- a pharmaceutical composition as described herein can be used to elicit an immune response against an HIV-1 infected cell in a subject.
- An embodiment provides a method for delaying the onset of, or slowing the rate of progression of, an HIV-1 -related disease or symptom in an HIV-1 -infected subject.
- symptoms of diseases include, for example, fever, muscle aches, coughing, sneezing, runny nose, sore throat, headache, chills, diarrhea, vomiting, rash , weakness, dizziness, bleeding under the skin, in internal organs, or from body orifices like the mouth, eyes, or ears, shock, nervous system malfunction, delirium, seizures, renal failure, personality changes, neck stiffness, dehydration, seizures, lethargy, paralysis of the limbs, confusion, back pain, loss of sensation , impaired bladder and bowel function, and sleepiness that can progress into coma or death.
- diseases e.g., AIDS
- symptoms of diseases include, for example, fever, muscle aches, coughing, sneezing, runny nose, sore throat, headache, chills, diarrhea, vomiting, rash ,
- the method comprises administering to the subject (e.g. , a mammal such as a human) a therapeutically effective amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof comprising one or more mutations described herein such that the onset of an HIV-1 disease or symptom is delayed or the progression of HIV-1 symptoms are slowed in comparison to an HIV-1 positive subject who does not receive the administration .
- a pharmaceutical composition as described herein can be used in the methods.
- a therapeutically effective amount refers to an amount of a composition described herein that, when administered to a subject for treating a disease or disorder or at least one symptom of the disease or disorder, is sufficient to affect such disease, disorder, or symptom.
- a therapeutically effective amount can vary depending , for example, on the composition that is administered, the disease, disorder, and/or symptoms of the disease or disorder, severity of the disease, disorder, and/or symptoms of the disease or disorder, the age, weight, and/or health of the subject to be treated , the capacity of the individual's immune system to synthesize antibodies, the degree of protection desired , the formulation of the composition , the treating doctor's assessment of the medical situation , and other relevant factors.
- the therapeutically effective amount is an amount sufficient to achieve a reduction in the level of HIV (e.g ., as measured by a stabilization or decrease in HIV titer compared to a non-treated control), and/or an increase in the level of neutralizing anti-HIV antisera (e.g ., as measured by an increase in serum neutralizing antibody levels relative to a non-treated control in a luciferase-based virus neutralization assay) as compared to a response obtained without administration of a therapeutic agent described herein, and/or to prevent the propagation of a H IV-1 in a subject (e.g. , a human) having an increased risk of viral infection.
- a subject e.g. , a human
- a therapeutically effective amount provides a therapeutic effect without causing a substantial cytotoxic effect in the subject.
- a therapeutically effective amount of a composition administered to a subject will vary depending upon a number of factors associated with that subject, for example the overall health of the subject, the condition to be treated , or the severity of the condition.
- a therapeutically effective amount of a composition can be determined by varying the dosage of the product and measuring the resulting therapeutic response.
- Administering means giving a dosage of a pharmaceutical composition as described herein to a subject.
- Administration can be done, for example, intramuscularly, intravenously, intradermal ⁇ , percutaneously, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticular ⁇ , intraprostatically, intrapleural ⁇ , intratracheally, intranasally, iniravitreaily, intravaginally, intrarectal ⁇ , topically, intratumorally, peritoneally, subcutaneously, subconjunctival ⁇ , intravesicularlly, mucosally, intrapericardialiy, intraumbiiicaily, intraocularly, orally, topically, locally, by inhalation, by injection, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, by catheter, by lavage, by gavage, in creams, or in lipid compositions.
- an H IV-1 Env protein , fragment thereof, H IV-1 Env trimeric complex, portion thereof, or pharmaceutical composition induces a neutralizing immune response or a broadly neutralizing immune response to H IV-1 Env in the subject
- an administration of the compositions described herein to a subject causes a reduction or decrease of an HIV-mediated activity (e.g ., infection, fusion (e.g. , target ceil entry and/or syncytia formation), viral spread, etc.) and/or a decrease in viral titer).
- HIV- mediated activity and/or HIV titer may be decreased by about 5%, 10%, 20% , 30%, 40% , 50%, 60%, 70% , 80%, 90%, 95%, 98%, 99% or more compared to that of a control subject (e.g. , an untreated subject or a subject treated with a placebo).
- An embodiment provides a vaccine, which is an HIV-1 Env protein , fragment thereof, HIV- 1 Env trimeric complex, portion thereof, or pharmaceutical composition as described herein that can provoke an immune response.
- Administration of a vaccine to a subject can confer at least some protective immunity against HIV-1 infection (e.g. , enhancement of resistance to new infection , complete resistance to new infection, or reduction or elimination of clinical severity of the disease or symptoms).
- An embodiment provides a method for preventing a subject (e.g ., a mammal such as a human) from becoming infected with H IV-1 .
- the method comprises administering to the subject a prophylactically effective amount of an HIV-1 Env protein, fragment thereof, H IV-1 Env trimeric complex, or portion thereof comprising one or more mutations described herein such that a protective immune response is elicited in the subject, in an embodiment a pharmaceutical composition as described herein can be used to elicit a protective immune response.
- the subject can be prevented from becoming infected with at least 1 , 2, 3, 4, 5, 6, or more strains of HIV-1 .
- a prophylactically effective amount is any amount of an agent (e.g. , an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, portion thereof or pharmaceutical composition described herein) which, when administered to a subject prone to suffer from a disease or disorder, inhibits or prevents the onset of the disease or disorder.
- the prophylactically effective amount will vary with the subject being treated, the condition to be treated, the agent delivered, and the route of delivery. A person of ordinary skill in the art can perform routine titration experiments to determine such an amount.
- a prophylactic treatment is a treatment administered to a subject who does not exhibit signs of a disease or exhibits only early signs for the purpose of decreasing the risk of developing pathology.
- a protective immunological response or protective immunity can be demonstrated by either a reduction or lack of clinical signs or symptoms normally displayed by an infected host, a quicker recovery time, and/or a lowered duration of infectivity or lowered pathogen titer in the tissues or body fluids or excretions of the infected host.
- An embodiment provides a method for reducing the likelihood of a subject becoming infected with HIV-1 .
- the method comprises administering to the subject an amount effective to reduce the likelihood of the subject becoming infected with HIV-1 of an HIV-1 Env protein, fragment thereof, HIV-1 Envtrimeric complex or portion thereof comprising one or more mutations described herein such that an immune response is elicited in the subject.
- a pharmaceutical composition as described herein can be used to elicit an immune response.
- the subject has been exposed to HIV-1 .
- An embodiment provides a DNA vaccine comprising one or more of the nucleic acid molecules encoding an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof, wherein then protein, fragment, complex or portion comprises one or more of the mutations described herein together with a pharmaceutically acceptable adjuvant.
- a DNA vaccine comprises genetically engineered DNA that is delivered direcily to ceils to produce an HIV-1 Env antigen (e.g., an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof as described herein), such that an immune response is generated, in an embodiment, the immune response is a protective immune response.
- An embodiment provides a recombinant viral vector vaccine, which comprises a recombinant viral vector comprising one or more of the nucleic acid molecules encoding an HIV- 1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof, wherein then protein, fragment, complex or portion comprises one or more of the mutations described herein and a pharmaceutical acceptable adjuvant.
- the recombinant viral vector can be, for example, vaccinia vector, adenovirus vector, adena-associated virus vector, sendai virus vector, herpes simplex virus vector, human papillomavirus vector, retroviral vector or other viral vector.
- a recombinant viral vector can be a repiicative viral vector.
- An embodiment provides a recombinant bacterial vector vaccine, which comprises a recombinant bacterial vector comprising one or more of the nucleic acid molecules encoding an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof, wherein then protein, fragment, complex or portion comprises one or more of the mutations described herein and a pharmaceutical acceptable adjuvant.
- Ex vivo transfection or transduction of ceils can also be used to deliver the HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes or portions thereof to a subject.
- the cells can be delivered into a subject to allow for the expression of one or more of the HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof described herein.
- cells can be autologous or heterologous to the treated subject.
- Cells can be transfected or transduced ex vivo with, for example, one or more vectors or nucleic acid molecules described herein to allow for the temporal or permanent expression of one or more of the HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes, or portions thereof in the treated subject.
- the one or more vectors or nucleic acid molecules will be expressed, eliciting protective or therapeutic immune responses directed against the HIV-1 Env proteins or HIV-1 Env trimeric complexes.
- Cells that can be isolated and transfected or transduced ex vivo can be, for example, blood ceils, skin cells, fibroblasts, endothelial ceils, skeletal muscle ceils, hepatoc tes, prostate epithelial cells, vascular endothelial cells, and totipotent, pluripotent, multipotent, or unipotent stem cells.
- the HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, portion thereof, or pharmaceutical composition can be administered as part of a prime-boost regimen.
- the immune response triggered by a single administration (prime) of a composition described herein may not be sufficiently potent and/or persistent to provide effective protection. Therefore, repeated administration (boost), such that a prime-boost regimen is established, may significantly enhance humoral and cellular responses to the antigen(s) of the composition.
- the booster is administered to the subject after the primer.
- the primer composition, the booster composition, or both primer composition and the booster composition additionally include an adjuvant, in one embodiment, the primer composition is a DNA-based vaccine (or other vaccine based on gene delivery), and the booster composition is a protein-based vaccine.
- HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof, or pharmaceutical compositions can be administered in a prophy!acticaily effective amount or a therapeutically effective amount that provides an immunogenic response and/or protective effect against HIV-1 .
- a protein composition can be administered at between about 1 pg and about 1 mg of protein, or between about 50 pg and about 300 pg of protein.
- a viral vector capable of expressing HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes or portions thereof can be administered at least about 1 i o 3 viral particles (vp)/dose, between about 1 x10 1 and about 1 x10 ,4 vp/dose, between about. 1 x10 3 and about 1 1 G ,2 vp/dose, or between about 1 x10 s and about 1 x1 Q , ! vp/dose.
- vp viral particles
- compositions can be monitored by, for example, measuring amounts of HIV-1 neutralizing anti-HIV antibodies. The dosages may then be adjusted or repeated as necessary to trigger the desired level of immune response.
- the efficacy of treatment can be determined by monitoring the level of the HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes or portions thereof expressed by or present in a subject following administration.
- the blood or lymph of a subject can be tested for the HIV-1 Env proteins, using for example, standard assays known in the art (see, e.g., Human Interferon-Alpha Multi-Species ELISA kit and Human Interferon-Alpha Serum Sample kit from Pestka Biomedical Laboratories (PBL), Piscataway, N.J,).
- a single dose of one or more of the pharmaceutical compositions described herein can achieve therapy in subjects.
- Multiple doses e.g., 2, 3, 4, 5, or more doses
- HIV-1 proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof oi ⁇ pharmaceutical compositions can be administered, for example, every 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 45, 50, 55, or 60 minutes, 2, 4, 6, 10, 15, or 24 hours, 2, 3, 5, or 7 days, 2, 4, 6 or 8 weeks, or even 3, 4, or 6 months pre-exposure or pre-diagnosis, or may be administered to the subject every 15-30 minutes or 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 20, 24, 48, or 72 hours, 2, 3, 5, or 7 days, 2, 4, 6 or 8 weeks, 3, 4, 6, or 9 months, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 years or longer post-diagnosis or post-exposure or to HIV-1 .
- a subject can be administered one or more doses of the HIV-1 proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof or pharmaceutical compositions once daily, weekly, monthly, or yearly.
- the compositions can be administered to the subject either before the occurrence of symptoms of an HIV infection or disease/syndrome (e.g., acquired immune deficiency syndrome (AIDS)) or a definitive diagnosis, or after diagnosis or symptoms become evident.
- HIV-1 proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof or pharmaceutical compositions can be administered, for example, immediately after diagnosis or the clinical recognition of symptoms or every 2, 4, 6, 10, 15, or 24 hours, 2, 3, 5, or 7 days, 2, 4, 6 or 8 weeks, or even 3, 4, or 6 months after diagnosis or detection of symptoms.
- An embodiment provides antibodies (i.e., an immunoglobulin or an antigen-binding fragment) thai specifically bind and recognize an HIV-1 Env protein, an antigenic fragment thereof, or an HIV-1 Env trimeric complex or antigenic fragment thereof.
- the HIV-1 Env protein, antigenic fragment thereof or HIV-1 Env trimeric complex or antigenic fragment thereof comprise one or more of the mutations described herein.
- antibodies are provided that specificaiiy bind to an HIV-1 En trimeric complex in a closed conformation, wherein the HIV-1 En trimeric complex comprises one or more of the mutations described herein.
- Antibodies include monoclonal antibodies, polyclonal antibodies, muitispecific antibodies (e.g., bispecific antibodies), and antibody fragments, as long as they have antigen-binding activity, in an embodiment, antibodies and fragments thereof can be chimeric antibodies (see, e.g., U.S. Patent No. 5,482,858), humanized antibodies (see, e.g., Jones ei al., Nature 321 :522 (1986); Reichmann et al., Nature 332:323 (1988)); Presta, Curr. Op. Struct. Biol. 2:593 (1992)), or human antibodies.
- Human antibodies can be made by, for example, direct immortalization, phage display, transgenic mice, or a Trimera methodology, see e.g., Reisener et al., Trends Biotechnol. 16:242-248 (1998).
- antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and muitispecific antibodies formed from antibody fragments.
- Antibody fragments include antigen binding fragments either produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA methodologies. See, e.g., Kontermann & Dubel (Ed), Antibody Engineering, Vols. 1 -2, 2 nd Ed., Springer Press, 2010).
- HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof having one or more mutations described herein has a broader and higher neutralization activity to HIV-1 virus when compared to an antibody or fragment produced by induction with a wild-type (i.e., naturally occurring) HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof.
- An embodiment provides methods of identifying antibodies that specifically bind to HIV-1
- An effective amount of an immunogen is administered to B cells in an in vitro cell culture system to generate antibodies that neutralize HIV-1 virus.
- An effective amount is an amount that is sufficient to generate antibodies specific for HIV-1 Env protein, fragment thereof, HIV-1 trimeric complex, or fragment thereof.
- the HIV-1 virus is heterologous to the virus strain or subtype from which the immunogen was derived. That is, use of the immunogen can generate antibodies that specifically bind HIV-1 Env proteins and HIV-1 Env trimeric complexes from more than one clade.
- An immunogen can be an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof described herein.
- An immunogen can also be a nucleic acid molecule, vector, host cell, or pharmaceutical composition described herein.
- antibodies neutralize HIV-1 or broadly neutralize HIV-1 .
- Broadly neutralizing Abs can neutralize infection of a large spectrum of genetically diverse HIV- 1 viruses. BnAbs can reduce the infectious titer of HIV-1 by binding to and inhibiting the function of related HIV-1 Env antigens.
- Related HIV-1 Env antigens share at least about 85%, 90%, 95%, 96%, 97%, 98%, 99% or more sequence identity with an antigenic surface HIV-1 Env.
- broadly neutralizing antibodies to HIV-1 Env are distinct from neutralizing antibodies to HIV-1 Env in that they neutralize with an ID M > 40 a high percentage (e.g., about 50%, 60%, 70%, 80% or more) of the many types of HIV-1 in circulation.
- a BnAb can neutralize the function of HIV-1 Env from more than one clade. Therefore, broadly neutralizing antibodies to HIV-1 Env are distinct from other antibodies to H IV-1 Env in that they neutralize a high percentage of the many types of H IV in circulation.
- Examples of broadly neutralizing antibodies include b12 and VRC01 , which bind to the CD4 binding site of gp120; 2F5 and 4E10, which bind to the membrane-proximal external region (MPER) of gp41 ; and PG9 and PG16, which bind to the V1 V2 domains of the trimer.
- Other examples include PGT122 and 35022.
- Methods to assay for neutralization activity include, but are not limited to, plaque reduction neutralization (PRNT) assays, microneutralization assays, flow cytometry based assays, single-cycle infection assays (see e.g. , Martin et ai. (2003) Nature Biotechnology 21 :71 -76), and pseudovirus neutralization assays (see e.g ., Georgiev et ai (Science, 340, 751 -756, 201 3), Seaman et ai. (J. Virol. , 84, 1439-1452, 2005), Mascola et ai. (J, Virol., 79, 1 0103-10107, 2005).
- PRNT plaque reduction neutralization
- An antibody can be made in vivo in suitable laboratory animals or in vitro using recombinant DNA techniques.
- Means for preparing and characterizing antibodies are well known in the art. See, e.g., Dean, Methods Mol. Bioi. 80:23-37 (1998); Dean, Methods Moi. Bioi. 32:361 - 79 (1994); Baileg, Methods Moi. Bioi. 32:381 -88 (1 994); Guliick, Methods Moi. Bioi. 32:389-99 (1994); Drenckhahn et ai Methods Ceii. Bioi. 37:7-56 (1993); Morrison, Ann. Rev. Immunol. 10:239-65 (1 992); Wright et ai. Crit. Rev. Immunol. 12: 125-68 (1992).
- a first antigen e.g., HIV-1 Env, a portion thereof, a HIV-1 Env trimeric complex or portions thereof recognizes and binds to an antibody or antigen binding fragment thereof with greater affinity than other non-specific molecules.
- a nonspecific molecule is an antigen that shares no common epitope with the first antigen .
- a non-specific molecule is not an HIV-1 Env and is not related to HIV-1 Env. For example, an antibody raised against a first antigen (e.g.
- HIV-1 Env to which it binds more efficiently than to a non-specific antigen
- an antibody or antigen-binding fragment thereof specifically binds to an HIV-1 Env, HIV-1 Env trimeric complex, or portion thereof when it binds with a binding affinity K a of 10 7 i/mol or more.
- An antibody or binding fragment thereof can specifically bind to an HIV-1 Env protein, portion thereof, HIV-1 Env trimeric complex or portion thereof when the interaction has a KD of less than 10 s Molar, such as less than 1 0 s Molar, less than 10 s Molar, less than 10 " 9 , or even less than 1 Q ⁇ 10 Molar.
- an antibody or antigen binding fragment can specifically bind to HIV-1 Env or trimeric complexes of H IV-1 Env from two or more e!ades,
- an antibody or fragment thereof specifically binds to an HIV-1 Env protein, portion thereof, HIV-1 Env trimeric complex or portion thereof in the presence of a heterogeneous population of proteins and other biologies.
- an antibody or fragment thereof specifically binds to a particular target HIV-1 Env protein and does not bind in a significant amount to other proteins or polysaccharides present in the sample or subject.
- An embodiment provides a method of treatment of HIV-1 related disease or symptom thereof comprising administrating one or more of the neutralizing or broadly neutralizing antibodies described above to a subject (e.g., a mammal such as a human).
- An embodiment provides a method of enhancing the binding of an antibody to an HIV-1 Env trimeric complex or portion thereof.
- the method comprises making one or more amino acid mutations described herein to one or more HIV-1 Env proteins such that the HIV-1 Env trimeric complex or portion thereof comprises one or more of the mutations.
- An antibody specific for HIV- 1 Env is contacted with the HIV-1 Env trimeric complex or portion thereof comprising one or more of the mutations. Binding of the antibody is enhanced as compared to binding of the antibody to an HIV-1 Env trimeric complex or portion thereof that does not comprise one or more of the mutations described herein.
- An embodiment provides methods for isolating antibodies that specifically bind to a HIV- 1 Env protein or fragment thereof comprising one or more of the mutations described herein or an HIV-1 trimeric complex or portion thereof comprising one or more of the mutations described herein.
- An effective amount of an immunogen is administered to a subject, such as a mammal and antibodies are isolated.
- An effective amount is an amount sufficient to elicit antibodies to the HIV-1 Env immunogen.
- An embodiment provides a method of identifying antibodies that specifically bind to an HIV-1 Env protein or fragment thereof comprising one or more of the mutations described herein or an HIV-1 Env trimeric complex or fragment thereof comprising one or more of the mutations described herein.
- Methods comprise, for example, administering an effective amount of an immunogen to B ceils in an in vitro ceil culture system to generate antibodies that specifically bind to the HIV-1 Env protein or the HIV-1 Env trimeric complex and isolating antibodies specific for the administered complex or composition.
- An effective amount is an amount sufficient to generate antibodies to the HIV-1 Env immunogen.
- An embodiment provides a method of making or screening for an isolated hybridoma that produces a broadly neutralizing antibody that specifically binds to an HIV-1 Env protein or fragment thereof comprising one or more of the mutations described herein or an HIV-Env trimeric complex or portion thereof comprising one or more of the mutations described herein.
- the method comprises immunizing a mammal with an effective amount of an immunogen as described herein and isolating splenocytes from the immunized mammal.
- An effective amount is an amount sufficient to elicit antibodies to the HIV-1 Env immunogen.
- the isolated splenocytes are fused with an immortalized cell line to form hybridomas. Individual hybridomas are screened for production of an antibody that specifically binds with said trimeric complex or protein thereof to isolate the hybridoma.
- an immunogen can be, for example, an HI -1 Env trimeric complex or portion thereof comprising one or more of the mutations described herein; an HIV-1 Env protein or fragment thereof comprising one or more mutations described herein; a nucleic acid molecule, vector, or host cell encoding or capable of expressing an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof comprising one or more of the mutations described herein.
- compositions and methods are more particularly described below and the Examples set forth herein are intended as illustrative only, as numerous modifications and variations therein will be apparent to those skilled in the art.
- the meaning of "a”, “an”, and “the” includes plural reference unless the context clearly dictates otherwise.
- the term “about” in association with a numerical value means that the value varies up or down by 5% . For example, for a value of about 100, means 95 to 1 05 (or any value between 95 and 105).
- Expi293F cells A derivative of Expi293F cells was used in which CXCR4 expression was knocked out 47 ; these cells do not express CD4, CCR5, or CXCR4 receptors.
- Ceils were cultured in Expi293 Expression Medium (Life Technologies), 8% CO2, 37 °C, at 125 rpm, and transfected with Expifectamine (Life Technologies). Unless otherwise stated, for testing of targeted mutants, 500 ng piasmid DNA was transfected per 2 x 10 6 / mL of ceils, and ExpiFectamine Transfection Enhancers 1 and 2 (Life Technologies) were added 18 h later. Ceils were analyzed 24-30 h post- transfection.
- the pCEP4-ACMV carrier piasmid was generated by digesting pCEP4 with Sail and iigating the vector backbone back together, effectively removing the CMV promoter, multiple cloning site, and SV40 polyadenylation sequence, but maintaining the EBNA1 gene and oriP replication origin.
- a synthetic, codon-optimized Env gene from the BaL HIV-1 isolate (GenBank Accession No. AAA44191 .1 ) was generated from gBiocks (integrated DNA Technologies) and cloned into the Nhel-Xhol sites of pCEP4 (Invitrogen).
- the gene encodes ⁇ ⁇ 3 _ residues E31 -L856 (numbering based on the HXB2 reference strain) fused to an N-terminal CDS leader peptide (sequence MPMGSLQPLATLYLLGMLVASVLA).
- pCEP4-intron a pCEP4 derivative vector containing a strong 5' chimeric intron was used for enhanced expression. This was created by cloning the intron from piasmid pRL-SV40 (Promega) into the Kpnl-Nhel sites of pCEP4. These piasmids are deposited with Addgene.
- SSM Single site-saturation mutagenesis
- the PGR products were cloned by restriction enzyme digestion and ligation into the Nhei-Bgill (Library A), BamHi-Noti (Library B), and Psti-Xhol (Library G) sites of BaLgp160 inserted into the Nhel- Xhol sites of pcDNA3.1 (+) (invitrogen), with the vector Pstl and Bgili sites removed by QisikChange (Agilent) mutagenesis.
- Ligations were transformed into NEB 5-a electrocompetent E, coli (New England Bioiabs), and p!asmid DNA for each library was prepared using GeneJET axiprep Kit (Thermo Scientific).
- the full-length diversified BaLgp160 library inserts was subcioned into the Nhel-Xhol sites of pCEP4- intron. At all cloning steps, the number of transformants was at least an order of magnitude greater than the possible library diversity.
- the three BaL gp160 SSM libraries covered 16,332 out of 16,520 possible single amino acid mutations, based on a minimum frequency of 5.7 x 10 "6 (corresponding to approximately 10 reads) in the deep sequenced piasmid libraries.
- a synthetic, codon-optimized gp16Q gene from the DU422 HIV-1 isolate (GenBank Accession No. ABD83641 .1) was cloned into the Nhel-Xhol sites of pCEP4 (invitrogen). This piasmid is deposited with Addgene (# 1 QQ926).
- the gp140 ectodomain (a. a. N31 -N677, HXB2 reference numbering) was fused to a C-terminai gly/ser-rich linker, 6his tag, and the transmembrane helix of HLA class I a chain for surface display, and inserted into the Nhel-Xhol sites of pCEP4.
- Overlap extension PGR was used to create the SSM libraries 75 .
- Three separate SSM libraries were constructed focused on the gp140 DU 422 N-terminus (a. a. 31 -279; NT library), center (a. a. 280-577; central library), and C-terminus (a. a. 578-677; CT library).
- Mutagenized PCR segments were iigated into the Nhe!-Pf!23li (NT library), Sbfi-Hindiil (central library), or Pfl23ll- Xho1 (CT library) sites of pCEP4-gp140 D u422. Ligations were electroporated into NEB 5- ⁇ E.
- Env variants for high binding signals to soluble CD4 ceils were harvested 24-26 hours following transfection with library DNA as described above. Cells were centrifuged at 500 g for 1 min at 4 °G, the pellets were washed with cold phosphate buffered saline supplemented with 0.2% BSA (PBS-BSA), and incubated on ice for 40 minutes with 200 nM SCD4-183 (domains D1 -D2). Soluble recombinant sCD4-183 was obtained through the NIH AIDS Reagent Program, Division of AIDS, NIAID, from Progenies.
- Sort gates for sCD4- or VRC01 -bound ceils the highest 0.5% (Libraries A and B) and 1 .0% (Library C) of FITC- or APC-positive ceils were collected, respectively.
- the sort gates for PG16-bound cells the highest 0.6% (Libraries A and B) and 0.9% (Library C) of APC-positive cells were collected. These gated cell populations in the respective libraries had similar binding signals. Sort conditions are listed in Table 1 . Sorted ceils were collected by centrifugation (400 g, 3 min, 4 °C) and frozen at -80 °C.
- samples were sorted for a maximum of 4 hours into tubes that, had been coated overnight with fetal bovine serum.
- libraries were prepared again and frozen sorted cell pellets from multiple days' experiments were pooled during RNA extraction. Each replicate typically required 8 hours of sorting per library.
- AIDS Reagent Program Division of AIDS, NIAID.
- ceils were centrifuged at 500 g, 2 min, 4 °C, 24-28 h post-transfection.
- Ceils were washed with cold phosphate buffered saline supplemented with 0.2% BSA (PBS-BSA), incubated on ice for 40 minutes with 10 n sCD4 in PBS-BSA, washed twice, incubated on ice for 30 minutes with fluorescein isothiocyanate (FITC)-conjugated anti-CD4 (clone M-T441 , Lifespan Biosciences, 1 /200 dilution), washed twice, and resuspended in PBS-BSA.
- FITC fluorescein isothiocyanate
- transfected ceils were washed with cold PBS-BSA, incubated on ice for 40 minutes with 3 nM PG16, washed twice, incubated for 30 minutes with aliophycocyanin (APC)-conjugated anti-human IgG Fc antibody (BioLegend, clone HP6017, 1/250 dilution), washed twice more, and resuspended in PBS-BSA.
- APC aliophycocyanin
- the cDNA was PGR amplified in two rounds, in the first round (18 thermocycles), primer overhangs added complementary sequences to the lllumina sequencing primers, in the second round (15 thermocycles), primer overhangs added barcodes and adaptor sequences for annealing to the lllumina flow cell. Thermocycling was kept to a minimum to reduce the introduction of PGR biases and errors.
- Each of the gp160 libraries was amplified as three overlapping fragments to achieve full sequencing coverage. DNA was sequenced at the UiUC Roy J. Carver Biotechnology Center on an lllumina MiSeq v3 (2 x 300nt kit.) or HiSeq 2500 (2 ⁇ 250nt kit).
- first strand cDNA was synthesized with high-fidelity AccuScript (Agilent Technologies) primed with a gene-specific oligonucleotide and the EBV- Reverse sequencing primer (5 '-GTGGTTTGTCC AAACTC ATC-3 ' (SEQ ID NQ:6); anneals to the 3 -UTR).
- cDNA was reverse transcribed with Superscript IV Vilo Master Mix (Thermo Scientific). The cDNA was PGR amplified in two rounds to generate fragments for lllumina sequencing.
- thermocycies In the first round (18 thermocycies), primer overhangs added complementary sequences to the lllumina sequencing primers. In the second round (9 thermocycies for the NT library, and 15 thermocycies for the central and CT libraries), primer overhangs added barcodes and adaptor sequences for annealing to the lllumina flow cell. Thermocycling was minimized to reduce PCR biases and errors.
- the NT and central gp140 libraries were each amplified as two overlapping fragments to achieve full sequencing coverage. DNA was sequenced at the UIUC Roy J. Carver Biotechnology Center on an lllumina HiSeq 2500 (2 x 250nt kit). H. Deep sequencing analysis
- Env Ba L (a. a. E31 - 677) was cloned downstream of a CDS leader peptide and upstream from a gly/ser-rich linker fused to a 6his tag and the T helix of HLA class I chain for surface display.
- a combinatorial library containing core mutations enriched in the sequence-activity landscape for PG16 binding, was synthesized by oiigo assembly and cloned into the Nhei-Xhoi sites of pCEP4-intron.
- Expi293F CXCR4-KO cells (2 ⁇ 10 6 cells/mi) were transfected using Expifectamine with 1 ng/mi library DNA and 1 .5 pCEP4-AC V. Cells were harvested 24-26 h post-transfection, and stained with PG16 as described for the SSM library selection. Cells with the highest APC fluorescence signal (top 0.3%) were collected on a BD FACS Aria II sorter and frozen at -80 °C. Total RNA was extracted from the frozen cell pellet using a GeneJET RNA Purification Kit (Thermo Scientific), and first strand cDNA was synthesized with Superscript IV VILO Master Mix (Thermo Scientific) reverse transcriptase.
- the Env insert was PCR-ampiified from the cDNA using Phusion (Thermo Scientific), and re-cloned into pCEP4- intron for another round of enrichment.
- the numbers of transformants during cloning steps were orders of magnitude greater than the possible library diversity of 9,216 variants, ensuring that all possible mutant combinations in the library were adequately sampled.
- the library selection was repeated three times. To increase stringency, the PG16 concentration was decreased from 2 nM (sort 1 ; 21 ,500 cells collected) to 1 nM (sort 2; 39,100 cells) to Q.5 (sort 3; 31 ,600 cells). After the third round of directed evolution, plasmid DNA from individual clones was purified and tested, J. EnveaL mutants binding to antibodies
- a 1 :3 serial dilution of the antibody was prepared in a 96-weli round-bottomed plate. Cells were incubated with the antibody at 4 °C on a rocker and washed in the 96-weli plate as described above. 39F 73 80 was provided by the NIH AIDS Reagent Program from Dr. James E. Robinson. 268-D IV 81 , 2442 82 and 3074 were provided by Dr. Susan Zolla-Pazner through the NIH AIDS Reagent Program.
- the washed cells were incubated with the !igands at 4 °C on a rocker for 40 minutes, washed twice, incubated for 30 minutes with secondary antibody (1 /200 FITC ⁇ anti-CD4 clone -T441 from Lifespan Biosciences, or 1/300 APC-anti-igG clone HP6017 from BioLegend), washed twice, and analyzed on a BD LSR II flow cytometer.
- Expi293F CXCR4-knockout cells were transfected at a density of 2 x 10 s / ml, with 1 ml of cells perweli of a 12-wei! tissue culture treated plate. Cells were transfected with Expifectamine (Life Technologies) using 1000 ng DNA per weli. Eighteen hours post-transfection ExpiFeciamine Transfection Enhancers 1 and 2 (Life Technologies) were added.
- soluble CD4 For binding assays to soluble CD4, cells were transfected as just described and collected 42 h post-transfection. Ceils were washed with cold PBS-BSA, incubated on ice for 40 minutes with 1 :3 serial dilutions of sCD4-183 prepared in 96-well round-bottomed plates, washed twice, incubated on ice for 30 minutes with FITC-anti-CD4 antibody (clone M-T441 , Lifespan Biosciences, 1/200 dilution), washed twice, and analyzed on a BD LSR II flow cytometer.
- Homology modeling of DU422 Env was based on the crystal structures of JR-FL SOSIP.684 (PDB 5FYK 85 ) and CD4-bound B41 SOSIP.664 (PDB 5VN3 13 ). Glycans were removed, the DU422 sequence was threaded on, and missing loops were rebuilt using Foldlt 86 . Side chain and backbone conformations were then minimized with C3 symmetry imposed around the trimer axis using xml scripting in ROSETTA S7 . Point substitutions were modeled using Foldlt with local side chain minimization. Images were rendered with the Py OL Molecular Graphics System, Schrodinger, LLC.
- Blots were blocked in TBST (Tris-buffered saline, 0.1 % TWEEN® polysorbate 20) containing 3% BSA, washed with TBST, stained with goat polyclonal anti-HIV gp160 (1 /500; Abeam ab1 1 7122) for 30 minutes at room temperature, washed in TBST, stained with donkey ant-goat IgG H&L alkaline phosphatase-conjugate (1 /1 000; Abeam ab971 12) for 30 minutes at room temperature, washed and visualized with Thermo Scientific 1 -Step NBT/BCIP Substrate Solution.
- Expi293F CXCR4-knockout cells (2 x 10 6 cells / ml) were co-transfected using Expifectamine with untagged CD4 (50 ng/ml pCMV3-CD4, Sino Biological HG10400-UT) plus N- terminal myc-tagged CCR5 (450 ng/ml pCEP4 ⁇ myc ⁇ CCR5), Partner ceils for fusion were transfected with 500 ng/ml of pCEP4 plasmid encoding Env. For controls, the plasmid was replaced with empty vector.
- Plasmids were transfected into Expi293F cultures using a protocol adapted from ss . For each milliliter of culture, 1 ⁇ g DNA was mixed with 5 iQ linearized poiyethyieneimine ( W25,000; Polysciences) in 1 Q0 ⁇ of OptiMEM (Gibco). The mixture was incubated for 20 minutes at room temperature, then added to the cell culture at a density of 2 x 1 Q 6 / ml. Expi293 Transfection Enhancers (Life Technologies) were added 18 h post-transfection. Ceils were centrifuged (1200 x g, 15 minutes) 4 days post-transfection, and secreted protein was purified from the culture supernatant.
- Protein was purified at 4 °C. The supernatant was dialyzed against 20 mM Tris pH 8.0 / 225 mM NaCi for 6-8 h, followed by dialysis overnight against 20 mM Tris pH 8.0 / 20 mM imidazole / 300 mM NaCI. Equilibrated NiNTA (50 % slurry, 500 ⁇ per 40 mi culture, Thermo Scientific) was incubated with the sample for 1 h on a rocker, collected in a gravity column, and washed with 20 mi of purification buffer (20mM Tris pH 8.0 / 300 mM NaCI) containing 20 mM imidazole.
- Equilibrated NiNTA 50 % slurry, 500 ⁇ per 40 mi culture, Thermo Scientific
- Protein was eluted using a step gradient of purification buffer containing 50, 100 and 250 mM imidazole (1 mi per fraciion).
- the 100 and 250 mM imidazole fractions were found to contain 8-his-tagged gp120 or gp140 based on SDS-PAGE analysis, and were pooled and concentrated using a 30 kD MWCO centrifugal device (Sartorius). Samples were separated by size exclusion chromatography using a Superose 6 increase 10/300 GL column on an AKTA pure system (GE Healthcare) with PBS as the running buffer.
- a codon-optimized gene fragment of BG505 SGSIP.664 (T332N) was cloned into the Nhei-Xhol sites of pCEP4.
- a CD5 leader peptide was placed at the N-terminus, and the sequence was fused C-terminally via a giy/ser-rich linker to a 6his tag followed by the TM helix of HLA class I chain for tethering to the cell membrane. Mutations were made by overlap extension PGR and screened for PG16 binding in transfected Expi293F CXCR4-KO cells as described above.
- BG505 SOSIP.664 T332N was subcloned into pCEP4 (Nhei-Xhol sites) with the C-terminal TM tether replaced by giy/ser-rich linker and Shis tag.
- the protein was expressed and purified as described above.
- BG5Q5 SOSIP protein 50 ⁇ per well at 2 ⁇ / ⁇ in PBS
- PBS-T1 PBS containing 0.2% TWEEN ⁇ polysorbate 20
- PBS-T2 peroxidase-conjugated donkey anti-human IgG-Fc
- BG505 SOSIP 50 ⁇ per well at 2 ⁇ / ⁇ in TBS: 50 mM Tris-CI pH 7,5, 150 mM NaCI
- TBS 50 mM Tris-CI pH 7,5, 150 mM NaCI
- TBS-T TBS containing 0.05% TWEEN® polysorbate 20
- CD4-igG2 provided by Progenies Pharmaceuticals through the NIH AIDS Reagent Program
- Wells were washed 5 times with TBS-T, incubated for 1 h with peroxidase-conjugated donkey anti-human IgG-Fc (100 ⁇ of a 1 :5000 dilution in TBS-T), and washed another 5 times with TBS- T. All ELISA plates were developed with 1 -Step Ultra T B-ELISA Substrate Solution (Thermo Scientific), and absorbance was measured at 830 nm.
- HIV-1 Env sequences as shown above (SEQ ID NOs:7-1 1) but with the N-terminal signal peptides replaced with a CDS leader sequence (capitalized; P GSLQPLATLYLLG LVASVL (SEQ ID NO:12) for better expression.
- SEQ ID O:13 CD5-BaL gp16G
- NCBI's Gene Expression Omnibus 78 under series accession number GSE102276. This includes commands for running Enrich scripts to replicate data analysis.
- Codon-optimized Env of the BaL isolate (a tier 1 B virus from ciade B) 45 with a GD5 leader sequence for enhanced surface expression 46 bound soluble GD4 (domains D1 -D2), PG16 and VRC01 by flow cytometry when expressed on human Expi293F ceils.
- soluble GD4 domains D1 -D2
- PG16 PG16 and VRC01 by flow cytometry when expressed on human Expi293F ceils.
- SSM single site- saturation mutagenesis
- the Env libraries were transfected into Expi293F ceils under conditions that yielded close to one sequence variant per ceil, achieved by diluting the piasmid-based libraries with a large excess of carrier DNA 47 .
- Env expression was barely detected. it was critical that expression be increased by addition of an artificial intron in the 5' untranslated region, and cotransfection with carrier DNA hypothesized to promote extra-chromosomal replication of the episomal Env piasmids.
- Expi293F cells expressing the Env SSM libraries were bound to soluble CD4, VRCQ1 , or PG16 near the apparent dissociation constants, and were screened by fluorescence-activated ceil sorting (FACS) for highest binding signal (Table 1).
- Library A spans a.a. 31-265; Library B a.a, 266-529; Library C a.a. 530-856.
- Library C had the most positive cells after ligand staining, as there are few deleterious mutations in the cytosolic Env tail. Therefore to sort cells with similar binding signals, a higher percentage of Library C was gated and collected.
- the Env sequence-activity landscapes are similar whether screened for CD4, VRC01 or PG16 binding ( Figure 1); this is because features of the landscapes that impact protein folding and surface expression will be shared.
- the highest conservation is in regions maintaining non- covending association between gp41 and gp120 subunits. This includes gp41 residues both within and upstream of the C-terminal heptad repeat that coil around the similarly consea3 ⁇ 4d gp120 Island C-termini.
- the N-terminal sequence prior to the first variable loop (V1) that forms the gp120 inner domain is also highly consea'ed, and polar substitutions within the hydrophobic transmembrane (TM) helix are depleted.
- V1 to V5 tolerate many substitutions, as do residues on both sides of the furin proteolysis site and within the gp41 fusion peptide.
- Premature stop codons prior to the membrane-spanning helix are depleted, as expected. However, stop codons are tolerated in the cytosolic C-terminus immediately following the membrane anchor; this region contains a GYSPL motif that interacts with the AP-2 complex for clathrin-mediated endocytosis, normally maintaining low levels of surface Env expression 48 ⁇ 49 .
- Premature stop codons are again depleted around the N-terminus of the Kennedy Epitope, but then become highly enriched around residues 731 -759. Env C-terminal deletions have previously been shown to increase surface expression 50 , which has been appropriated for elevated Env levels in virus-like particle vaccines. This indicates that even higher Env SLf rface expression might be achieved in virus-like particles by using alternative premature stop codons (e.g. at position 731 ) to what have already been tested (for example 51 ⁇ 52 ).
- Stop codons are again depleted at a. a. 760-782 and 795-837, approximately corresponding to the lentivirus lytic peptide-2 (LLP-2) and LLP-3 to LLP-1 regions, respectively.
- Premature stop codons are weakly enriched near the very C-terminus, removing another endocytosis signal at the very end of the protein 53 that would otherwise reduce the surface expressed pool.
- Lysine substitutions are depleted around a. a. 832-851 in LLP-1 , in agreement with prior observations that Env expression is decreased when lysine is mutated into the arginine- rich LLP-1 region M , despite arginine and lysine sharing similar physicochemical properties.
- CD4 binds the gp120 outer domain, stabilizing structural elements in the conformational ⁇ flexible subunit 13 ⁇ 56 ⁇ 57 .
- the defined binding site is highly conserved in the selection for CD4 binding ( Figure 3A, 3D-E and 3G), and mutation phenotypes agree with atomic modeling ( Figure 4A-E).
- Env-V430 packs within a hydrophobic pocket formed by CD4-W87 and the aliphatic chain of CD4-R84, and Env-V430 substitutions to small or aliphatic hydrophobic residues are tolerated for CD4 binding ( Figure 4C).
- CD4-F68 is sandwiched between highly conserved Env-W427 and Env-1371 , which is primarily restricted to aliphatic hydrophobic side chains M, L, i and V ( Figure 4D).
- the guanidinium group of CD4-R84 contacts or is in close proximity to Env- D388, P369, and N425; most acidic substitutions of these three Env residues are enriched ( Figure 4A).
- Env-G472 and G473 lie flush against a p-sheei surface of CD4 and are highly conserved, whereas the -carbon of neighboring Env-G471 is directed to a cavity and tolerates most substitutions (Figure 4E).
- VRC01 ⁇ Env association tolerates Env sequence diversity
- VRC01 engages the CD4-binding site on the gp120 outer domain 5S , and yet this surface is distinctively not conserved in the Env sequence-activity landscape for VRC01 interaction ( Figure 3B, 3D and 3F). Rather, VRCQ1 binding is resistant to most Env single amino acid substitutions within its structurally characterized interface, a result that was suggested by previous small-scale mutational analysis 2 . This is an ideal property of a broadly neutralizing antibody, which limits mechanisms for viral escape.
- Aromatic side chains within the interface core engage Env loop residues 278-281 ; only Env-D279 in the loop, which contacts the indole NH of VRC01 -W100BHC (Kabat numbering), is moderately conserved in the selection (Figure 4F-H).
- Aromatic side chains with hydrogen-bonding potential may be ideally suited to interacting with diverse antigen targets 59 .
- PG16 binds the junction between two gp120 subunits at the Env apex, possibly forming bridging contacts to giycans from each subunit and explaining the antibody's strong preference for trimeric quaternary structure 0 .
- Crystal structures of PG16 and related bNAb PG9 bound to scaffolded V1 -V2 demonstrated extensive contacts to the giycan on Env-N160, with a smaller contact surface to the adjacent giycan on Env-N156 (alternatively N173 in other HIV-1 strains) 31 ' 60 . This correlates with mutagenesis data demonstrating greater importance of the N160 glycosylation motif 39 .
- the first site of Env mutations thai enhance PG18 binding is located at the trimerization interface near the apex ( Figure 5). Twelve of the 20 mutations are found here: Q1 14A, K1 17V/Y, P124D, T163D, R166E/F/L, V200E/T, R315A, and R432T, Nearly ail of these mutations reduce positive charge at. the apical trimer interface, either through substitution of a basic residue, or introduction of an acidic residue (or both). Furthermore, most substitutions of Env-K1 17, R166, and R432 are predicted to enhance PG16 binding in the sequence-activity landscapes.
- the second site of Env mutations for enhanced PG18 binding is a centrally located interfacial region where residues are in contact between Env protomers, and between gp41 and gp120 subunits (Figure 5).
- F223Y in one Env protomer may add a hydrogen bond contact to R557 or N553 from a neighboring protomer.
- T49D would add a salt-bridge contact to R557 of the neighboring protomer.
- R557Q reduces the desolvation penalty of burying a charged group at the interface, yet may still hydrogen bond to partners across the trimer interface.
- L581 D would add favorable electrostatic interactions with R557 and R579 on a neighboring promoter.
- the mutation I595 is found in site 3 at a trimer contact ( Figure 5). I595 of one gp41 subunit occupies a hydrophobic pocket on an adjacent gp41 ; the methionine substitution may better pack in this pocket.
- Site 4 is proximal to the furin cleavage site ( Figure 5), and includes two mutations (G514P and G516Q) that weakly increase PG18 binding for unknown reasons.
- mutation L683N in site 5 ( Figure 5) has an unknown structural effect; residue 663 begins the membrane-proximal external region ( PER) and the structure here is poorly characterized.
- Example 7 Stabilizators of ars Env corrformat ors for ersharsced PG16 binding
- Env loses conformational flexibility upon proteolytic processing, increasing affinity for certain conformation-dependent antibodies, including PG16 62 .
- Western blot shows that wildtype, QES.iOi and QES.i02 gp160 Sa L were all cleaved to gp120 ( Figure 8A), and over-expression of furin to mitigate any differences in furin-dependent cleavage did not change the central observation that more PG16 binds to cells expressing QES mutants ( Figure 8B).
- Q769.d22 and Q842.d12 are tier 2 strains from ciade A
- YU-2 is a tier 2 strain from clade B
- 2571 1 and DU422 are tier 1 B and 2 strains from ciade C, respectively 5 .
- the mutations generally had little positive impact on PG16 binding to YU-2, 2571 1 , or DU422 Env. However, many of the QES mutations increased PG16 binding to Q769.d22 and Q842.d22 Env (Table 3), and combinations of mutations were screened for even higher PG16 binding.
- Q769-QES.1Q3 has three mutations (A200E;F223Y;I595M), and bound PG16 with similar affinity (apparent D of 3.7 ⁇ 0.6 nM and 5 ⁇ 3 nM for Q769-QES.103 and wildtype Env, respectively) but 2.7-fold higher binding at saturation (Figure 7B).
- Example 10 A QES mutation within the core of Env can destabilize the CD4-bound state From the deep mutational scan , mutations within the Env core to enhance PG16 binding were investigated. Mutations to 12 buried residues were incorporated into a combinatorial library of extracellular gp14G B aL fused to a non-native TM helix for surface display: this served to both increase surface expression for higher PG18 binding signals, and ensured the selection didn't simply enrich for premature stop codons in the cytoplasmic tail. The combinatorial library was sorted for binding to PG16 for three rounds, and then individual clones were screened .
- Mutation 1181 L is a subtie mutation just below the surface of the apical tip where PG16 binds (Figure 1 1 D), perhaps stabilizing local packing.
- V254T and V255IVS are centrally positioned in the linker connecting the inner and outer domains of gp120.
- V254T adds a hydrogen bond to the backbone carbonyl of L261 in strand [39 of the outer domain, while V255M increases hydrophobic packing to aromatic residues in the inner domain ( Figure 1 1 D).
- the cavity occupied by V255 collapses in the open conformation with insufficient space for large hydrophobics ( Figure 1 1 D), and the deep mutational scan predicts this mutation decreases CD4 interactions.
- V255F was similarly found to increase PG16 binding while decreasing CD4 interactions.
- V255 is therefore unique amongst the QES mutations described here in thai it also destabilizes the open state.
- PGT145 binding increased or decreased in different QES constructs ( Figure 15), reflecting antagonism between stabilization of the PGT145-recognized closed conformation versus amino acid changes within the apical cavity that can disrupt direct antibody contacts.
- Size exclusion chromatography was used to determine whether some of the QES mutations could shift purified soluble gp14Q and gp12Q towards higher molecular weight species, but observed no decrease in elution volume compared to the wildtype proteins ( Figure 17). This suggests the QES mutations alone may be insufficient for stabilizing trimers of extracellular Env fragments, and instead tested QES mutations in the BG505 SOSIP 20 . Many of the QES mutations increased PG18 binding to ceils expressing BG505 SOSIP anchored to the plasma membrane via a non-native TM helix (Table 5). Mutations were combined to generate BG5Q5- QES.i03.c01 SOSIP (containing V181 L;A200E;F223Y;V255M; I595M).
- Proteolytic processing increased from -35 % of wiidtype to -50 % of QES.i03.c01 ( Figure 18B).
- the mutations described herein are also applicable to a soluble extracellular construct.
- PGT121 and PGT128 recognize the N332 giycan supersite on the gp12Q outer domain 29,68 ; antibodies targeting this site are frequently elicited bNAbs from multiple germiine precursors, and therefore the N332 supersite may be an especially vulnerable epitope for the human antibody response to target 65 68 ⁇ 71 .
- the majority of the QES mutations neutralized positive charge at the apical protomer interfaces, thereby reducing electrostatic repulsion between the apical tips thai contributes to dynamic instability 61 .
- inclusion of a mutation (V255M) in the gp120 core to destabilize the open state reduced CD4 binding and exposure of V3 region epitopes. These mutations were effective in both full-length Env and soluble BG505 SOSiP.
- Example 13 A deep mutational scars of DU422 gp140 for binding to CD4 and PG18.
- a deep mutational scan which involves using next generation sequencing to track the in vitro evolution or selection of a diverse library of sequence variants 34 , requires a tight link between genotype and phenotype.
- this can be accomplished by transfecting library DNA with a large excess of carrier DNA, such that a ceil typically acquires no more than one coding sequence 47 .
- a synthetic codon-optimized gene encoding gp160 from the DU422 strain was fused downstream of a CDS ieader sequence, and expressed from an episomal plasmid that can replicate extra-chromosomally.
- Soluble gp140 has increased conformational heterogeneity compared to full-length Env 21 ⁇ 72 ⁇ 73 , and therefore interesting mutations identified by the deep mutational scan are subsequently validated in the full protein.
- DU422 gp140 was expressed on the cell surface at high levels based on flow cytometric analysis of PG16 and soluble CD4 (sCD4: domains D1 -D2) binding , even when diluted with excess carrier DNA during transfection .
- SS libraries were prepared spanning gp14Q DU 422 residues N31 -N279 (NT library), N280-Q577 (central library), and T578-N677 (CT library). Together, the three libraries covered the full length of gp14G D u42 2 , and encoded all 12,820 single amino acid substitutions.
- Expi293F ceil cultures transiently expressing each library were fluorescently labeled with sCD4 or PG16, and cells expressing gp140 sequences with the highest ligand-binding signals were collected by FACS (Table 6).
- Example 15 The closed state of gp14Q D u422 imposes tight conservation on the apical trimerization domain.
- PG18 primarily makes sequence-independent contacts to glycans on the upper apical surface that provide the antibody with broad strain reactivity 60 , and yet gp140ou 22 residues preferentially under tight conservation for PG18 binding span almost the entire trimer interface (Figure 21 B).
- High conservation in the PG16-CD4 difference map continues deep within the folded core of the apical trimerization domain, dramatically emphasizing thai the V1 , V2 and V3 regions are constrained in sequence space for adopting the trimeric PG16- recognized closed conformation.
- a defining feature of the BaL gp160 sequence-activity landscape was that neutralization of electropositive charge at the apical trimer interface stabilized the PG16-bound closed conformation. This is not the case for DU422 gp140.
- most substitutions to basic residues K1 1 7 and R166 at the apex are generally predicted to be neutral, and (excluding the central library where data quality is poor) overall very few substitutions are predicted from the mutational scan to increase PG16 binding. This agrees with prior targeted mutagenesis, where mutations that increased PG16 recognition of BaL gp180 did not have the same effect in DU422 gp160.
- Example 16 Mutations irs DU422 gp160 at the inner-outer domain interface cars increase expression of the PG16 ⁇ recognized closed trimer.
- T283P is also located between the inner and outer domains, and while the mechanism by which T283P enhances PG16 binding is unclear, it may be that the hydrophobic proline disfavors open or partially open conformations where it becomes more solvent-accessible ( Figure 22B).
- the inner-outer domain interface undergoes substantial structural rearrangement upon CD4 ligation ( Figure 22B), and its stabilization may be an under-explored avenue for Env conformational engineering.
- Env F382 and Y484 are also universally conserved in all HIV-1 clades, raising the possibiliiy that mutations to these residLfes in particular may be broadly effective in different strains.
- Binley, J. M. et al. A recombinant human immunodeficiency virus type 1 envelope glycoprotein complex stabilized by an intermolecular disulfide bond between the gp120 and gp41 subunits is an antigenic mimic of the trimeric virion-associated structure. J. Virol, 74, 627-643 (2000).
- SOSIP.664 gp140 expresses multiple epitopes for broadly neutralizing but not non- neutralizing antibodies.
- glycoprotein trimers adopt a native-like conformation, Proc. Nati. Acad. Sci. U.S.A. 110,
- ROSETTA3 an object-oriented software suite for the simulation and design of macromolecules. Meth. Enzymol. 487, 545-574 (201 1).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Mycology (AREA)
- Communicable Diseases (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- Hematology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Tropical Medicine & Parasitology (AREA)
- AIDS & HIV (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Provided herein are HIV-1 Env proteins or fragments thereof comprising one or more amino acid mutations; and nucleic acid molecule encoding the same. Further provided is a method of screening a compound for binding to one or more mutant HIV-1 Env proteins; and methods for eliciting an immune response against an HIV-1 infected cell, comprising administering to a subject an amount of a mutant HIV-1 Env protein, a fragment thereof, a mutant HIV-1 Env trimeric complex, or portion thereof, effective to elicit an immune response in the subject. Further provided is a pharmaceutical composition, such as a vaccine, comprising the mutant HIV-1 Env protein or fragment thereof.
Description
ENGINEERED VARIANTS OF HIV-1 ENV FOR PRESENTATION
OF GUARTERNARY EPITOPES
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT
This invention was made with government support under contract number R01 AI 12971 9 awarded by the National Institutes of Health. The government has certain rights in the invention. PRIORITY
This application claims the benefit of U .S. Ser. No, 62/534,1 91 , filed July 1 8, 2017, which is incorporated herein by reference in its entirety.
BACKGROUND
HIV-1 engages target cells through interactions between the viral spike glycoprotein Env and host receptors. H IV-1 Env is formed by a homotrimeric complex of gp160 subunits that are cleaved by host proteases during maturation into extracellular gp120 and membrane-tethered gp41 , which remain non-covaientiy associated in a 'closed' conformation \ During infection, the gp120 subunit binds the primary host receptor GD4, inducing a change to an Open' conformation of Env that exposes binding sites for a secondary co-receptor 2~4. This co-receptor is one of either two chemokine receptors, CCR5 or CXCR4, and once bound , further conformational changes release fusogenic regions of gp41 that mediate membrane fusion and viral entry into the host cell.
Env is the only viral protein on the outside of a HIV-1 virion accessible to the humoral immune system, and therefore has been extensively studied for vaccine development 5. Mature Env has a complex structural organization. At the apex most distal from the membrane is a trimerization domain that mediates contacts between gp120 subunits, and is formed by variable regions V1 , V2, and V3 6"11. In the central region of the Env spike are the gp120 inner and outer domains, which face in towards the trimer axis or out towards bulk solvent, respectively. Below, the N- and C-termini of gp120 are encircled and 'grasped' by the extracellular region of gp41 , with the gp41 heptad repeat HR1 forming trimer contacts that resemble a helical-bundle 'spine' at the center of the complex. Next is a trimeric association of gp41 transmembrane helices 2, followed by gp41 cytoplasmic tails. Infection is initiated by GD4 binding to Env in a closed conformation , where there are close interactions between apical tips of the trimerization domains 6. CD4 binding stabilizes large conformational changes that break apical contacts and promote opening of the structure 6 13. The closed and open conformations have distinct antigenic profiles, with many broadly neutralizing antibodies (bNAbs) binding preferentially to closed Env 14·15, while the open state presents strain-specific, poorly neutralizing epitopes in the V3 region 16,17.
Env sequence diversity, exposure of non-neutralizing or strain-specific immunodominant epitopes, and epitope shielding by extensive giycosyiation, ail act to limit potency and breadth of the host response. Design and purification of Env immunogens that correctly fold into native-like, pre-fusion closed trimers is also challenging , due to intrinsic conformational flexibility. The most notable engineered form of Env for vaccine purposes contains the so-called SOSIP mutations
(an introduced disulfide between residues 501 and 605 to prevent gp120-gp41 dissociation 1S, and an I559P mutation that destabilizes the post-fusion trimeric conformation 19; ail residue numbers throughout are based on the HXB2 reference strain), which permit the expression and purification of soluble extracellular Env as native trimers 20,21. The best studied SOSIP construct is in the ciade A strain BG5Q5 sequence, but SOSIP mutations have also been introduced into Env from other strains in different clades. SOSIP constructs have been engineered with additional mutations and/or disulfide bonds to further stabilize the closed conformation recognized by most bNAbs 22-¾, reduce exposure of V3 region epitopes 17·22-24, be expressed as single chain non-proteolyzed native trimers 25-27 , and to bind germline B cells with higher affinity to stimulate lineages that mature into potent bNAb secretors 24,28. More reductionist approaches have trimmed down the extracellular regions of Env to produce stable fragments of gp120 9,30 or, at the most extreme, stabilize isolated epitopes for focusing an immune response 3 i-33, Understanding how Env sequence dictates conformation can therefore assist the design of sophisticated Env immunogens for optimum immunogenicity. Compared to these previous efforts, full or close-to-full length Env that contains the transmembrane domain has not been as extensively engineered to stabilize closed trimeric conformations. This is despite full-length Env being well suited for some vaccine formats, such as a DNA vaccine, virus-like particles (VLPs), or purified protein embedded in membrane nanodiscs.
Deep mutational scanning couples directed evolution of diverse sequence populations with next generation sequencing to track the phenotypic fitness of thousands of mutations simultaneously 34. The method has been used for vaccine design to screen for mutations within SOSIP constructs that, enhance direct interactions with an antibody and its germline precursors, reduce exposure of V3 epitopes, and improve thermostability 24,35 22. Tissue culture propagation of viruses expressing Env variants has also been followed by next generation sequencing, and the mutational tolerance observed in these experiments closely aligns with observed diversity of natural Env sequences 36. However, this experimental system has proven insightful for characterizing Env mutations that allow Hi V-1 to escape neutralization from a broadly-neutralizing antibody (bNAb) 37.
DESC !PTfON OF THE DRAWINGS
Fig. 1. Sequence-activity landscapes of BaL Ersv interacting with protein ligands.
Merged data from in vitro evolution of three SSM libraries thai together fully span the mature E vsaL protein. The libraries were evolved by FACS for high binding signals to (A) 200 nM CD4(D1 -D2), (B) 5 n VRC01 , and (C) 2 nM PG18. The En sequence is on the vertical axis (HXB2 numbering, BaL numbering in parentheses), and single amino acid substitutions are on the horizontal axis. *, stop codon, Log2 enrichment ratios are plotted from < -2 (depleted, black) to > +3 (enriched, white). Mutations missing in the libraries are black. The left schematic outlines sequence features of gp120 (dark grey) and gp41 (light grey), with an arrowhead indicating the proteolysis site. V1 -V5, variable regions; FP, fusion peptide; NHR/CHR, N-/C-terminal heptad
repeat: MPER, membrane-proximal external region; TM, transmembrane domain; KE, Kennedy epitope. Average of two replicate experiments (averaged on a linear scale before converting to log base 2).
Fig. 2. Assessment of data reproducibility. (A-C) Env libraries were sorted twice for high binding signals to (A) soluble CD4, (B) VRC01 , and (C) PG16. Log2 enrichment ratios from the two replicates are plotted, and qualitatively agree. Rarer mutations in the libraries (frequency < 6 x10"5) are grey. Mutations with a frequency < 6 x1 Q~6 are considered absent from the naive libraries and are not plotted. R2 values are calculated for mutations in black (frequency > 6 x1 G~ 5 in the naive libraries). (D-F) Conservation scores for each residue were calculated by averaging the iog2 enrichment ratios for all substitutions at that position. Conservation scores for libraries sorted for binding (D) soluble CD4, (E) VRC01 , and (F) PG16 show agreement between replicate experiments.
Fig. 3. Mapping conserved sites for ligand binding to Env structure, (A-C) Conservation scores from selecting Env libraries for binding (A) soluble CD4, (B) VRC01 , or (C) PG16 are mapped to the surface of an Env proiomer, from < -2 (conserved, black) to > 0 (variable or under selection for change, white). The second and third protomers in the trimeric spike are shown as dark and pale grey ribbons. The binding sites for CD4, VRC01 , and PG16 are shown with dashed circles. The model of BaL Env in the closed state was generated by sequence threading to PDB 5FYK, followed by loop building, and side chain and backbone minimization. (D) Differences between conservation scores for binding soluble CD4 and VRC01 are plotted from -2 (more conserved for CD4 binding, white) to +2 (more conserved for VRC01 binding, black) on the surface of an Env protomer oriented as above. (E) CD4-PG16 difference conservation plot colored from -2 (more conserved for CD4 binding, white) to +2 (more conserved for PG16 binding, black). (F) VRC01 -PG16 difference conservation plot colored from -2 (more conserved for VRC01 binding, white) to +2 (more conserved for PG16 binding, black). (G) As in (E), but now plotting the CD4-PG18 difference conservation scores to a modeled structure of ΕηνΒ3ι_ in the open CD4- bound conformation (based on PDB 5VN3). A single CD4 domain D1 is shown as a black ribbon.
Fig. 4. EnvBaL residues that physically contact CD4 are conserved for CD4 binding, whife VRC01 and PG16 interactions are tolerant of Env sequence diversity. (A-E) Structural features of the CD4-gp120 interface are shown alongside heatmaps of the experimental enrichment ratios for CD4 binding. Log2 enrichment ratios are plotted from < -3 (depleted, black) to > +1 (neutral / enriched, white). *, stop codons. The structural model was generated by threading the BaL Env sequence on to PDB 1 GC1 with side chain-backbone minimization. CD4 is grey, and Env is colored by conservation score (most conserved residues are black). (F-H) Heatmaps of the experimental enrichment ratios from Env selection for VRCQ1 binding are shown alongside regions of the Env-VRC01 interface. The structural model was generated from PDB 5FYK as a template. VRC01 is grey and labeled according to Kabat numbering. In these panels, only Env-D279 (F) is highly conserved for VRC01 binding. (i-J) Heatmaps of iog2 enrichment
ratios from the evolution of Env for PG16 binding are shown alongside a PG16-EnveaL structural model (generated from PDB 4DQO as the template). PG16 is grey, and Env is colored by conservation score (most conserved residues are black). Env-N160, a site of glycosylation, is highly conserved for PG18 binding, whereas many other Env substitutions are tolerated.
Fig. 5. Neutralization of the electropositive apical cavity stabilizes Env in a PG16- reeognized conformation. From the mutational scan, substitutions were identified that were both predicted to enhance PG16 binding, and were localized on subunit surfaces not expected to be major sites of direct bNAb interactions. The substitutions validated to enhance PG16 binding signal when expressed on Expi293F ceils clustered to five sites, shown on a structural model of closed E vaaL. PG18 is shown as a black cartoon, interacting glycans are white sticks, two Env protomers are shown as dark and pale grey surfaces, and the third Env protomer is shown as a pale grey ribbon. Mutations are indicated in the magnified insets. In the close-up of site 1 at left, positive electrostatic potential on the surface of two Env protomers is shown in black.
Fig. 6. Reduced PG16 binding to ceils expressing Env variants that were depleted in the sequence-activity landscape. Twenty representative mutations were chosen that were depleted following FAGS-based selection for PG16 binding in both replicate experiments. All 20 mutants were found to have reduced PG16 (2 nM) binding signal by flow cytometry when transfected in to Expi293F cells. Shown are histograms from one of two replicates. Wildtype is black, mutants are various shades of grey. The percent positive cells from both replicates is tabulated in the legend. Loss of PG16 binding signal may be due to reduced antibody affinity, incorrect folding, or decreased surface expression.
Fig. 7. (A-C) Engineered QES variants of (A) BaL, (B) Q769.d22, and (C) Q842,d12 Env show enhanced PG16 binding by flow cytometry when expressed on Expi293F cells. Wildtype proteins are grey, QES mutants are black, (n = 3, mean ± SD). (D-F) Binding of soluble CD4 to QES mutants of (D) BaL, (E) Q769.d22, and (F) Q842.d12 Env expressed on Expi293F cells, (n = 3, mean ± SD).
Fig. 8, Increased PG18 binding to Env mutated at the subunit interfaces is not mediated by changes in fur n-dependent cleavage. (A) Polyclonal anti-Env blot of iysates from ceils expressing BaL gp160 variants. (B) Cells v/ere co-transfected with plasrnids driving BaL gp180 and furin over-expression, and PG16 binding was measured by flow cytometry, (n = 3, mean + SD).
Fig. 9. Mutations at the Env subunit interfaces that stabilize the PG18-recognized closed state do not prevent exposure of V3 region epitopes. Expi293F cells expressing wildtype BaL (light grey), BaL-QES.i01 (dark grey), or BaL-QES.i02 gp180 (black) were incubated with V3 region Abs (A) 2442, (B) 268-D IV, (G) 39F, and (D) 3074. Bound antibody was detected with APC-conjugated anti-human igG and flow cytometry, (n = 3, mean ± SD).
Fig. 10. Env~QES variants are competent for membrane fusion. (A) Ceils expressing the CD4 and CCR5 receptors were co-incubated with ceils expressing wildtype BaL, or BaL-
QES.01 Env. The cytoplasm was stained with caicein and nuclei were stained with Hoechst 33342. Fused syncytia were obsea¾d as enlarged cells. (B) Enlarged/fused ceils were quantified by flow cytometry after co-incubating receptor- and Env-expressing ceils, (n = 10, mean ± SE , Student's two-tailed unpaired t-test).
Fig. 11. Mutations within the Env core for increased PG16 binding. (A) A combinatorial library of surface-displayed gp14(W was sorted for high PG18 binding. Wiidtype sequence is at top, with core mutations present in the library listed below each residue position. An alignment of 7 enriched clones/sequences with higher PG16 binding is shown, with the consensus in bold. (B) PG16 binding titration curves based on flow cytometry analysis of cells expressing surface-displayed wiidtype (light grey), QES.I01 (dark grey), QES.iQ2 (black) or clone- 27 (medium grey) gp14QBaL. n = 4, mean ± SD. (C) Substitutions found in cione-27 decrease PG16 binding to ceils expressing full-length gp18QBaL, even when combined with QES.iOI (grey with dark grey outline) and QESJ02 mutations (grey with black outline). Data are mean (n = 2), with error bars showing the range. (D) Local structure of EnveaL surrounding buried residues 1181 , V254 and V255. Individual mutations found to enhance PG18 binding in full-length Env are shown in black. A predicted hydrogen bond from V254T to the backbone carbonyl of L261 is shov/n with a dashed line. An apolar cavity filled by V255 in the closed state becomes absent in the CD4- bound open conformation, in which only a single 'bent' rota me r of methionine can sterieai!y fit.
Fig. 12. Hesitation V255M! within the Ersv core destabilizes the CD4-bound open conformation and reduces exposure of V3 region epitopes. (A) Ceils expressing QES variants containing mutations to subunit surfaces (dark grey), or additional mutations to core residues (black), bind more PG16 than wiidtype Env (pale grey). Env variants were tested from five HIV-1 strains (from top to bottom: BaL, Q769.d22, Q842.d12PG16, 2571 1 , and DU422). Data are mean ± SD, n = 3-4. (B) Binding of CD4(D1 -D2) to ceils expressing Env variants. Inclusion of the V255 core mutation in constructs BaL-QES.i01 .cQ1 , Q769.d22-QES.i03.V255M, and DU422-QES.c03, reduces CD4 binding. Data are mean (n = 2), with error bars showing the range. (C) Binding of V3-targeting antibodies (from top to bottom: monoclonal 2442, 288-D IV, 39F, and 3074) to cells expressing wiidtype (grey) or QES.iQ1 .c01 (black) BaL Env. Data are mean (n = 2), with error bars showing the range.
Fig. 13. Mutations that stabilize the PG18-reeognized conformation of Env also increase binding to PGT121 targeting the SM332 g!ycan sispersite. Binding of PGT121 to transfected cells expressing wiidtype (grey) or QES variant (black) Env sequences from five HIV- 1 strains: (A) BaL, (B) Q769.d22, (C) Q842.d12, (D) 2571 1 , and (E) DU422). Data are mean (n = 2), with error bars showing the range.
Fig. 14. Mutations that stabilize the PG18-recognized conformation of Env also increase binding to PGT128 targeting the M332 glycan sispersite. Binding of PGT128 to transfected cells expressing wiidtype (grey) or QES variant (black) Env sequences from five HIV-
1 strains: (A) BaL, (B) Q769.d22, (C) Q842.d12, (D) 2571 1 , and (E) DU422). Data are mean (n = 2), with error bars showing the range.
Fig. 15. Mutations that stabilize the PG18-recognized conformation of Er may increase or decrease binding to PGT14S targeting the apical cavity. Binding of PGT145 to transfected ceiis expressing wi!dtype (grey) or QES variant (black) Env sequences from five H IV-
1 strains: (A) BaL, (B) Q769.d22, (C) Q842.d12, (D) 2571 1 , and (E) DU422). Data are mean (n = 2), with error bars showing the range.
Fig. 16. Ercv~GES variants can catalyze membrane fusion. The formation of fused syncytia was measured v/hen full-length Env-expressing and CD4/CCR5-expressing ceils were co-incubated. QES mutations stabilizing the closed state do not significantly decrease ceil fusion, but mutation V255M that destabilizes the CD4-bound open state does inhibit fusion (compare BaL-QES.i01 .c01 to BaL-QES.i01 , Q769.d22-QES.i03.V255IV1 to Q769.d22~QES.i03, and DU422-QES.C03 to DU422 wiidtype). Mean ± SEM from n = 1 0 replicates.
Fig. 17. Purified Env sufounits from t e BaL. Q769.d22, and Q842.d12 strains containing QES mutations are not shifted towards higher molecular weight forms.
(A) Purified 8his-tagged BaL gp140 was separated by SEC on a Superose 6 10/300 column . In the absence of SOSIP mutations, the BaL-QES variants (dark grey and black) are indistinguishable from wiidtype (light grey). (B) Purified 8his-tagged BaL gp120 was run on a Superose 6 10/300 gel filtration column. BaL-QES.101 and BaL-QES. i02 share the same gp120 sequence. (C) SEC traces of purified wiidtype Q769.d22 and Q769-QES.Q3 gp120. (D) SEC traces of purified wiidtype Q842.d12 and Q842-QES.04 gp120.
Fig. 18. QES mutations stabilize a BG50S SOSIP trimer recognized by PG18. (A) His- tagged wiidtype (grey) and QES.i03.c03 (black) BG505 SQSiP.664 were purified by nickel affinity chromatography and separated by SEC on a Superose 6 10/300 column. The trimer peak at left was identified based on a near identical elution volume to purified soluble gp140BaL (Figure 17A) and high affinity binding to PG16. (B) Coomassie-stained SDS electrophoresis gel of purified BG505 SQSIP.664 proteins. (C) BG505-QES.i03.c03 (black) binds higher levels of PG16 by ELISA than wiidtype protein (grey). Mean ± SD, n = 4. (D) By EL!SA, purified wiidtype (grey) and QES.i03.c03 (black) BG505 SOSIP.664 bind VRC01 the same. Data are mean (n = 2), with error bars showing the range. (E) Binding of tetrameric CD4~lgG2 to wiidtype (grey; n = 4) and QES.i03.cQ3 (blue; n = 3) BG5Q5 SOSiP.664 by ELiSA. Mean + SD.
Fig. 19. Sequence-activity landscapes of g 140Du 22 for interacting with the host CD4 receptor and bMAb PG16. (A) Three gp14QDu422 SSM libraries were separately expressed in Expi293F ceils and sorted for binding to sCD4. Log2 enrichment ratios were calculated by comparing mutation frequencies in the sorted ceils to the naive libraries, and are plotted from < -
2 (i.e. depleted, black) to > +3 (i.e. enriched , white). The primary structure of gp140 is on the horizontal axis, and amino acid substitutions are on the vertical axis. *, stop codons. In the upper schematic, gp120 and gp41 are dark and pale grey, respectively, the cleavage site is indicated
with an arrow head, and notable regions are shaded black. (B) The sequence-activity landscape of gp140Du422 under FACS-based selection for binding to PG16.
Fig. 2D. Corrections between rep!icate experiments. (A-C) FACS-based selections for sCD4 binding were repeated twice. Agreement between the replicate log2 enrichment ratios for each gp140DU422 mutation are plotted for the (A) NT, (B) central, and (C) CT libraries. (D-F) Agreement between the residue conservation scores from replicate selections of the (A) NT, (B) central, and (C) CT libraries for sCD4 binding. (G-i) Log2 enrichment ratios for every single amino acid substitution of gp140ou422 are plotted for two independent experiments where the (G) NT, (H) central, and (I) CT SS libraries were selected for PG16 binding. (J-L) Agreement between the residue conservation scores from replicate selections of the (A) NT, (B) central, and (C) CT libraries for PG16 binding.
Fig. 21. Residues at the En Du 22 irimer interface are more conserved for PG18 binding than for CD4 interactions. (A) Cartoon structure of the gp120 (dark grey) and gp41 (pale grey) protomer in the closed conformation (based on PDB 5FYK 85). V1 , V2, and V3 (shown as various shades of grey) form the apical trimerization domain. (B) An atomic model of trimeric DU422 gp140 in the closed conformation, with one protomer shown as a surface, and the other protomers shown as grey ribbons. The PG16-CD4 conservation difference scores are mapped to the protomer surface in the same orientation as (A), with black indicating residues preferentially conserved for PG16 binding, and white indicating residues more conserved for CD4 binding. On the right is a cutaway through the protomer surface, showing that preferential conservation for PG16 binding extends into the core of the trimerization domain. (C) Cryo-EM structure of gp120 (dark grey) and gp41 (pale grey) from a single protomer in the CD4-bound open conformation (PDB 5VN3 i3). Electron density was absent for V1 and V2 regions. (D) A model of DU422 gp140 in the open state bound to CD4 (black ribbon; CD4 is shown bound to only a single protomer). Colored as described in (B). The orientation of the protomer shown as a surface matches the orientation in (C).
Fig. 22. increased ydrophobic packing at the gp120 inner-outer domain interface enhances expression of a PG16-recognized conformation. (A) Expi293F cells were transfected with the indicated gp160Du422 mutants, and binding of 2 n PG16 (dark grey) or 50 nM sCD4 (light grey) was measured by flow cytometry. V181 L was previously shown to increase PG16 binding. Mean ± SD, n = 3. (B) Structures of DU422 Env (gp120, pale grey; gp41 , dark grey) were modeled in closed and CD4-bound open conformations. Mutations are indicated in black.
SUMMA Y
An embodiment provides an HIV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations listed in Table 1 , wherein the amino acids are numbered by HXB2 numbering.
Another embodiment provides an HIV-1 Env protein or fragment thereof comprising one or more of the sets of amino acid mutations iisted in Tabie 2, wherein the amino acids are numbered by HXB2 numbering.
Even another embodiment provides an HIV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations listed in Tabie 1 or Tabie 2, wherein the protein or fragment thereof has at least one mutation shown in Tables 1 or 2 and otherwise has about 95% or more sequence identity to an HIV-1 Env protein (such as a wild-type HIV-1 Env protein).
Yet another embodiment provides a trimeric complex or portion thereof comprising H IV- 1 Env proteins or fragments comprising one or more of the mutations iisted in Table and Tabie 2 in a trimeric conformation.
Still another embodiment provides an immunogen comprising an HIV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations Iisted in Table 1 or Table 2 or an H IV-1 Env trimeric complex or portions thereof comprising one or more of the amino acid mutations iisted in Table 1 or Tabie 2.
Even another embodiment provides a method of screening a compound for binding to one or more proteins thereof, wherein the one or more proteins comprise an H IV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations iisted in Table 1 or Tabie 2, a trimeric complex or portions thereof comprising one or more of the amino acid mutations listed in Table 1 or Tabie 2, or combinations thereof. The method comprises providing the one or more proteins, fragments, complexes or portions thereof; contacting the one or more proteins, fragments, complexes or portions thereof with the compound ; and determining the ability of the compound to bind to the one or more proteins, fragments, complexes or portions. The one or more proteins, fragments, trimeric complexes, or portions thereof can comprise 2, 5, 10, 1 5, or more proteins, fragments, trimeric complexes, or portions thereof. The compound can inhibit an HiV-mediated activity. The compound can be provided in a library.
An embodiment provides a library comprising two or more (e.g., 2, 5, 10, 20, 30, 50, 100 or more) HIV-1 Env proteins or fragments thereof comprising one or more of the amino acid mutations iisted in Table 1 or Tabie 2 or an HIV-1 Env trimeric complex or portions thereof comprising one or more of the amino acid mutations iisted in Table 1 or Table 2.
Another embodiment provides a nucleic acid molecule encoding an HIV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations Iisted in Table 1 or Tabie 2 or a trimeric complex or portions thereof comprising one or more of the amino acid mutations iisted in Table 1 or Table 2.
Still another embodiment provides a vector comprising a nucleic acid molecule described herein.
Yet another embodiment provides a host ceil comprising a vector described herein. Even another embodiment provides a method of producing an H IV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof comprising cuituring a host cell
described herein in a culture medium to produce the protein, fragment, complex, or portion thereof. The host ceil can be a mammalian cell having the ability to glycosylate proteins.
An embodiment provides a composition comprising one or more HIV-1 Env proteins or fragments thereof described herein, one or more HIV-1 Env trimeric complexes or portions thereof described herein, and a pharmaceutically acceptable carrier. The composition can comprise one or more HIV-1 Env proteins or fragments thereof or one or more HIV-1 Env trimeric complexes or portions thereof. The composition can also comprise one or more HIV-1 Env proteins or fragments thereof and one or more HIV-1 Env trimeric complexes or portions thereof. The composition can further comprise an adjuvant.
Even another embodiment provides method for eliciting an immune response against an
HIV-1 infected ceil in a subject comprising administering to the subject an amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof described herein, effective to elicit an immune response in the subject.
Yet another embodiment provides a method for preventing a subject from becoming infected with HIV-1 comprising administering to the subject a prophylactically effective amount of an amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof described herein, such that the subject is prevented from becoming infected with HIV-1 .
Still another embodiment provides a method for reducing the likelihood of a subject becoming infected with HIV-1 comprising administering to the subject an amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof described herein, effective to reduce the likelihood of the subject becoming infected with HIV-1 . The subject may have been exposed to HIV-1 .
Another embodiment provides a method for delaying the onset, of, or slowing the rate of progression of, an HIV-1 -related disease or symptom in an HIV-1 -infected subject comprising administering to the subject an amount of an amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof described herein, effective to delay the onset of, or slow the rate of progression of the HIV-1 -related disease or symptom in the subject.
An embodiment provides a method of isolating antibodies that specifically bind to an HIV- 1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof described herein. The method comprises administering an effective amount of an HIV-1 Env trimeric complex or portion thereof, an HIV-1 Env protein or fragment thereof, an HIV-1 Env nucleic acid molecule, a vector, a host cell or a pharmaceutical composition described herein to a subject to generate antibodies that specifically bind to an HIV-1 Env protein or HIV-1 Env trimeric complex; and isolating the antibodies.
Another embodiment provides a method of identifying antibodies that specifically bind to an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof as described herein. The method comprises administering an effective amount of an immunogen selected from: an HIV-1 Env trimeric complex or portion thereof, an HIV-1 Env protein or fragment
thereof, an HIV-1 Env nucleic acid moiecule, a vector, a host cell or a pharmaceutical composition described herein to B cells in an in vitro cell culture system to generate antibodies that specifically bind to the HIV-1 Env protein, fragment thereof, HIV-1 En trimeric complex or portion thereof. Antibodies specific for the administered complex or composition are then isolated.
Yet another embodiment provides a method of making an isolated hybridoma that produces a broadly neutralizing antibody that specifically binds to an HIV-1 Env trimeric complex, portion thereof, an HIV-1 Env protein, or fragment thereof. The method comprises
immunizing a mammal with an effective amount of: an HIV-1 Env trimeric complex or portion thereof, an HIV-1 Env protein or fragment thereof, an HIV-1 Env nucleic acid molecule, a vector, a host cell or a pharmaceutical composition described herein. Splenocytes are isolated from the immunized mammal and the isolated splenocytes are fused with an immortalized ceil line to form hybridomas. individual hybridomas are screened for production of an antibody that specifically binds with the HIV-1 Env protein or fragment thereof or HIV-1 Env trimeric complex or portion thereof to isolate the hybridoma.
Still another embodiment provides a method of producing a stable HIV-1 Env trimer in a closed conformation. The method comprises making one or more of the amino acid mutations or sets of mutations described herein in an HIV-1 Env protein and expressing the protein such that a stable HIV-1 En trimer in a dosed conformation is produced.
HIV-1 infection is initiated by viral Env engaging the host receptor CD4, triggering Env to transition from a 'closed' to Open' conformation during the early events leading to virus-cell membrane fusion. Using deep mutational scanning, sequence-activity landscapes were defined for Env interacting with CD4, antibody VRC01 that binds the CD4 site but fails to induce the open state, and antibody PG16 that recognizes closed Env. Compared to CD4 or VRC01 binding, the Env trimer interface was under selection for PG16 recognition, and mutations that enhance presentation of the PG16 quaternary epitope frequently reduce positive charge at the Env apex, suggesting this region is primed for opening by electrostatic repulsion. Positive stabilization of the closed state is insufficient to reduce GD4 binding, membrane fusion, or V3 epitope exposure, which instead requires explicit destabiiization of the open conformation. Mutations described herein stabilize a closed Env conformation, are broadly applicable to different HIV-1 strains, and can assist in the engineering of Env-based immunogens that better present epitopes recognized by broadly neutralizing antibodies.
Env sequence preferences are determined independent of infection and virus propagation for interactions with three protein ligands that act as conformational probes: CD4, which induces the open Env conformation and binds monomeric gp120 with highest affinity; bNAb VRC01 , which binds tightly to both monomeric gp120 and mature Env without inducing the open conformation; and bNAb PG16, which exclusively binds closed trimeric Env 8~44, While soluble SOSIP proteins have been extensively engineered, less focus has been applied to conformational stabilization of full-length Env that may be better suited for virus-like particle or DNA vaccines. Mutations are
provided herein thai stabilize the PG16 quaternary epitope in full-length Env sequences from representative strains in clades A, B and C, while simultaneously enhancing presentation of epitopes recognized by PGT121 and PGT128 bNAbs, and also revealing an electrostatic repulsion mechanism for inducing the closed-to-open transition, it would be ideal if there were a suite of mutations for applying broadly to any HIV-1 strain, which stabilize Env in a ciosed trimer for improved bNAb elicitation. A HIV-1 vaccine could then be rapidly modified and updated to contain stabilized Env sequences from local prevailing strains. The HIV-1 Env mutants described herein address a pressing need in that they can be rapidly used as a focused mutational screen to conformational^ stabilize Env from diverse HIV-1 strains.
DETAILED DESCRIPTION
Alignments of protein sequences observed in nature are very effective at revealing conserved residues in primary structure for correct folding and function. However, a natural sequence like HIV-1 Env is shaped by multiple activities; Env must fold, traffic to the cell surface, be incorporated into a budding virion, bind target receptors, mediate membrane fusion, and escape antibody neutralization. Here, in vitro selection is used to focus on the specific activities of folding to a trimeric closed conformation and binding to the GD4 receptor. Sequence-activity landscapes provide insight into Env mutational tolerance for acquiring closed and CD4-bound conformations, information which is not at ail obvious from a multiple sequence alignment. This information provides mechanistic insights, and is leveraged for engineering full-length Env with properties that may prove especially useful for vaccines that incorporate membrane-anchored Env (e.g. virus-like particles or DNA vaccines), and can also be applied to soluble extracellular constructs like SOSIP.
Increased presentation of the PG16-recognized conformation can enhance fusion to target membranes, consistent with the ciosed state being relevant to the molecular events of infection and an excellent target for neutralization by vaccines. Env-QES.i01 and QESJ02 variants still bind CD4 and expose V3 region epitopes, either because of dynamic or induced conformational fluctuations, or persistent conformational heterogeneity that includes trimeric, monomeric, closed, open and/or misfolded forms. V3 region epitopes are hidden only by inclusion of an additional core mutation (V255 ) to destabilize the CD4-bound open state, and some of the mutations identified herein from the mutational scan of DU422 gp14Q (e.g. Y484W) may similarly act to destabilize the CD4-bound open state. Likewise, trimer-stabilized SOSIP gp140 constructs also have persistent binding to V3 antibodies 17,2°, and induce undesirable V3 non- neutralizing responses in immunized animals 16·17. This has necessitated negative selection strategies to explicitly reduce V3 loop exposure 17,24. The findings described herein emphasize that positive stabilization alone appears insufficient to prevent Env opening, and the open state must be explicitly destabilized.
HfV-1 Env Protein Mytatiorss
HIV-1 is completely dependent upon the Env protein to enter cells. HIV-1 Env is formed by a homotrimeric complex of gp160 subunits that are cleaved by host proteases during maturation into extracellular gp120 and membrane-tethered gp41 , which remain non-covalently associated in a 'closed' conformation. Production of Envtrimeric complexes that mimic the native spike, however, is challenging in part because the recombinant trimers either are unstable or aggregate. Therefore, mutants of Env proteins that can form stable trimeric complexes in the closed conformation are desirable. Membrane distal and membrane proximal aspects of the HIV- 1 trimer in the closed conformation include several distinct structural elements that are absent from the corresponding regions of the HIV-1 Env trimer in its CD4-bound open conformation. The following mutations can be used to generate mutant, stable En trimeric complexes in the closed conformation across many clades of HIV-1 , For example, the amino acid substitutions disclosed herein can be used to alter the Env protein in any clades or subtypes of Group M, O, N, or P HIV- 1 strains.
HIV-1 Env proteins and nucleic acid sequences encoding Env proteins and methods for the manipulation and insertion of such nucleic acid sequences into vectors, are well known (see, e.g., HIV Sequence Compendium, Division of AIDS, National Institute of Allergy and Infectious Diseases (2013); HIV Sequence Database (hiv-web.lanl.gov/conteniihiv-db/mainpage. html); Sambrook et ai. (Molecular Cloning: A Laboratory Manual, 4t" ed, Cold Spring Harbor, N.Y., 2012); Ausubel et al. (in Current Protocols in Molecular Biology, John Wiley & Sons, New York, through supplement 104, 2013), HIV-1 Env protein sequences are known and are available in the HIV Sequence Database (hiv-web.lanl.gov/content/hiv-db/mainpage.html).
Amino acid mutations or substitutions are described herein. An amino acid substitution is the replacement of one amino acid in a polypeptide with a different amino acid or with no amino acid (i.e., a deletion).
An embodiment provides an HIV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations) in Table A. A fragment can be about 10, 20, 30, 40, 50, 75, 100, 200, 300, 400, 500, 600, or more amino acids as long as it. contains an amino acid mutation listed in Tables A-H and can induce an immunogenic response in a subject (e.g., a mammal such as a human). The amino acids are numbered by HXB2 numbering.
Table A,
T49D
Q1 14A
K1 17V
K1 17Y
P124D
T163D
R186E
An embodiment provides an HiV-1 Env protein or fragment thereof comprising one or more of the combination of amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more sets of mutations) in Table B. The amino acids are numbered by HXB2 numbering.
Table B.
A200E + F223Y + 15$ 15 + V1 I 31 L + V255M (< 3ES.i03.c01 ) I
An embodiment provides an HIV-1 EnvBaL protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 , 2, 3, 4, 5, or more sets of mutations) in Table C. The amino acids are numbered by HXB2 numbering.
Table C.
An embodiment provides an HIV-1 EnvDU422 protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 , 2, 3, 4, 5, or more sets of mutations) in Table D. The amino acids are numbered by HXB2 numbering.
Table D.
An embodiment provides an HIV-1 EnvQ789.d22 protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 , 2, 3, 4, 5, or more sets of mutations) in Table E. The amino acids are numbered by HXB2 numbering.
Table E.
An embodiment provides an HIV-1 Env Q842.d12 protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 , 2, 3, 4, 5, or more sets of mutations) in Table F. The amino acids are numbered by HXB2 numbering.
An embodiment provides an HIV-1 Env 25711 protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 , 2, 3, 4, 5, or more sets of mutations) in Table G. The amino acids are numbered by HXB2 numbering.
Table G
An embodiment provides an HIV-1 BG505 SOSIP.664 protein or fragment thereof comprising one or more of the amino acid mutations (e.g., 1 , 2, 3, 4, 5, or more mutations or 1 ,
2, 3, 4, 5, or more sets of mutations) in Table H. The amino acids are numbered by HXB2 numbering.
Table H.
An HIV-1 Env mutant protein described herein comprises one or more of the amino acid substitutions described herein (e.g., those shown in Tables A, B, C, D, E, F, G, or H). HIV-1 Env mutant proteins described herein can comprise the disclosed amino acid mutation or set of amino acid mutations and otheavise have 75, 80, 90, 95, 99% or more sequence identity to any HIV-1 Env protein (e.g., an HIV-1 ΕηνΒ3_ protein, an HIV-1 EnvDU422 protein, an HIV-1 EnvQ769.d22 protein, an HIV-1 Env Q842.d12 protein, an HIV-1 Env 2571 1 protein or other HIV-1 Env proteins). In some examples, an amino acid in a polypeptide is substituted with an amino acid from a homologous polypeptide, for example, an amino acid in a recombinant Clade A HIV-1 Env polypeptide can be substituted with the corresponding amino acid from a Clade B HIV-1 Env polypeptide.
All amino acid numbering of HIV-1 Env used herein refers to HXB2 number. HXB2 numbering is described in detail in, for example, Korber ef a/. Numbering Positions in HIV Relative to HXB2CG, in Korber et a!., eds., Human Retroviruses and AIDS 1998, pp. 111-102- 111-1 1 1 , Los
Alamos National Laboratory, Los Alamos, NM, report LA-UR 99-1704, which is incorporated by reference in its entirety.
Korber presents a clearly numbered set of proteins, and the full length genome, for HIV HXB2, GenBank accession number K03455. HIV HXB2 is also known as: HXBc2, for HXB clone 2; HXB2R, and HXB2CG in GenBank, for HXB2 complete genome. The HXB2 Env sequence is shown in SEQ ID NO:1 below.
1 mrvkekyqhl wrwgwrwgtm llgmlmicsa teklwvtvyy gvpvwkeatt tlfcasdaka 61 ydtevhnvwa thacvptdpn pqewlvnvt enfnmwkndm veqmhediis lwdqslkpcv 121 kltplcvslk ctdlkndtnt nsssgrmime kgeikncsfn istsirgkvq keyaffykld 181 iipidndtts ykltscntsv itqacpkvsf epipihycap agfailkcnn ktfngtgpct
241 nvs vqcthg irpws qll lngslaeeev virsvnftdn aktiivqlnt sveinct rpn 301 nntrkririq rgpgrafvti gklgiunrqah cnisrakmn tlkqiasklr eqfgnnktii 361 fkqssggdpe ivthsfncgg effycnstql fnst frxstw stegsnnteg sdtitlpcri 421 kqiinmwqkv gkaniyappis gqircssn.it gllltrdggn snneseifrp gggdmrdnwr 481 selykykvvk ieplgvaptk akrrvvqrek ravglgalfl gflgaagstm gaasiatltvq
541 arqllsgivq qqnnllraie aqqhllqltv gikqlqari laverylkdq qllgiwgcsg 601 klicttavpw naswsnksle qivrahttwme wdreinnyts lihslieesq nqqekneqel 661 leldkwaslw nwfnitnwlw yiklfind g glvglri fa vlsivnrvrq gysplsfqth 721 lptprgpdrp egieeegger drdrsirl n gslaliwddl rslclfsyhr Irdlllivtr 781 ivellgrrgw ealkywwnll qywsqelkns avsllnatai avaeg tdrvi evvqgacrai
841 rhiprrirqg lerill (SEQ ID NO:l),
Therefore, the HIV-1 Env amino acid mutation "T49D" means that the T at position 49 of the Env sequence is changed to D. in some cases the first amino acid of the mutation abbreviation may not match precisely to the HXB2 numbering. HXB2 has a V at position 200, but one mutation described herein is A200E. That means the HIV strain studied has an A at the HXB2 200 position and that the A is mutated to E. One of skill in the art is well-versed in the HXB2 numbering system.
A protein is a polymer of amino acids covaientiy linked by amide bonds. A protein can be post-translationally modified. A purified protein is a protein preparation that is substantially free of cellular material, other types of proteins, chemical precursors, chemicals used in synthesis of the protein, or combinations thereof. A protein preparation that is substantially free of cellular material, culture medium, chemical precursors, chemicals used in synthesis of the protein, etc., has less than about 30%, 20%, 10%, 5%, 1 % or more of other proteins, culture medium, chemical precursors, and/or other chemicals used in synthesis. Therefore, a purified protein is about 70%, 80%, 90%, 95%, 99% or more pure. A purified protein does not include unpurified or semi-purified cell extracts or mixtures of protein that are less than 70% pure.
The term "proteins" can refer to one or more of one type of protein (a set of proteins). "Proteins" can also refer to mixtures of two or more different types of proteins (a mixture of proteins). The terms "proteins" or "protein" can each also mean "one or more proteins." As used in the specification, "proteins" refers to both full-length proteins and fragments of proteins. The HIV-1 Env proteins comprising one or more mutations described herein are non-naturally occurring.
HIV-1 Env proteins can be fragments of the proteins described herein. For example an HIV-Env can comprise a fragment of an HIV-1 Env protein, having one or more of the mutations
described herein. A fragment can be about 20, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 500, 600, 7QQ, 800 or more amino acids in length. A fragment can be about 800, 700, 600, 500, 450, 425, 400, 375, 350, 325, 300, 275, 250, 225, 200, 175, 150, 125, 100, 75, 50, 20, or less amino acids in length. In an embodiment, an HIV-1 Env protein has about 1 , 5, 10, 20, 30, 40, 50 or more amino acids truncated from the C-terminus. Such truncations can advantageously remove motifs for internalization that reduce surface expression.
An HIV-1 Env protein or fragment thereof can be linked to an epitope or affinity tag such as polyhistidine, DYKDDD (SEQ ID NO:2) tag, c-myc tag, Strep tag, TAP tag, and HA tag.
A mutated protein comprises at least one deleted, inserted, and/or substituted amino acid, which can be accomplished via mutagenesis of polynucleotides encoding these amino acids. Mutagenesis includes well-known methods in the art, and includes, for example, site-directed mutagenesis by means of PCR or via oligonucleotide-mediated mutagenesis as described in Sambrook et a/., Molecular Cloning-A Laboratory Manual, 2nd ed., Vol. 1 -3 (1989).
A protein can include multiple polypeptide chains. For example, mature HIV-1 Env comprises gp120 and gp41 polypeptide chains. A single contiguous polypeptide chain of amino acid residues can include multiple polypeptides. For example, a single chain HIV-1 Env can comprise a gp120 polypeptide linked to a gp41 polypeptide by a peptide linker.
Proteins and polynucleotides have about 75, 80, 85, 90, 95, 98, 97, 98, 99% or more sequence identify to proteins and polynucleotides described herein (e.g., proteins have one or more of the mutations show in Table A and Table B) can be used herein. Proteins and polynucleotides that have about 75, 80, 85, 90, 95, 98, 97, 98, 99% or more sequence identity to polypeptides and polynucleotides described herein while retaining one or more of the mutations show in Table A and Table B can also be used herein.
Sequence identity is the similarity between amino acid sequences and is expressed in terms of similarity between sequences. Sequence identity can be measured in terms of percentage identity (or similarity or homology): the higher the percentage, the more similar the two sequences are. Homologs, orthoiogs, or variants of a protein or nucleic acid molecule will have a relatively high degree of sequence identity when aligned using standard methods.
Methods of alignment of sequences for comparison are well known in the art. Programs and alignment algorithms are described in, for example, Smith & Waterman, Adv. Appl. Math. 2:482, 1981 ; Needieman & Wunsch, J. Moi. Biol. 48:443, 1970; Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444, 1988; Higgins & Sharp, Gene, 73:237-44, 1988; Higgins & Sharp, CABIOS 5:151 -3, 1989; Corpet et at., Nuc. Acids Res. 16:10881 -90, 1988; Huang et a/. Computer Appls. in the Biosciences 8, 155-65, 1992; and Pearson et ai, Meth. Mol. Bio. 24:307-31 , 1994. Aitschul et ai., J. Moi. Biol. 215:403-10, 1990, provides a detailed discussion of sequence alignment methods and homology calculations.
Two sequences can be aligned and the number of matches can be determined by counting the number of positions where an identical nucleotide or amino acid residue is present in both sequences. The percent sequence identity is calculated by dividing the number of matches either by the length of the sequence set forth in the identified sequence, or by an articulated length (such as 100 consecutive nucleotides or amino acid residues from a sequence set forth in an identified sequence), followed by multiplying the resulting value by 100. For example, a peptide sequence thai has 1776 matches when aligned with a test sequence having 2000 is 88.8 percent identical to the test sequence (1776 /2000 x 100 = 88.8). The percent sequence identity value is rounded to the nearest tenth. For example, 88.1 1 , 88.12, 88,13, and 88.14 are rounded down to 88.1 , while 88.15, 88,16, 88.17, 88.18, and 88.19 are rounded up to 88.2. The length value will always be an integer.
Homoiogs and variants of a protein and nucleic acid molecule are typically characterized by possession of at least about 75%, for example at least about 75%, 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identify counted over the full length alignment with the amino acid or nucleic acid sequence of interest. Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homoiogs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website.
For sequence comparison of nucleic acid sequences, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters are used. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482, 1981 , by the homology alignment algorithm of Needleman & Wunsch, J. Moi. Biol. 48:443, 1970, by the search for similarity method of Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444, 1988, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Sambrook et al. (Molecular Cloning: A Laboratory Manual, 4ih ed, Cold Spring Harbor, N.Y., 2012) and Ausubel et al. (In Current Protocols in Molecular Biology, John Wiley & Sons, New York, through supplement 104, 2013). One example of a useful algorithm is PILEUP. PILEUP uses a simplification of the progressive alignment method of Feng & Dooiittle, J. Mol. Evol. 35:351 -360, 1987. The method
used is similar to the method described by Higgins & Sharp, GABIOS 5:151 -153, 1989. Using PILEUP, a reference sequence is compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (Q.10), and weighted end gaps. PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et a!., Nuci. Acids Res. 12:387-395, 1984).
Another example of algorithms thai are suitable for determining percent sequence identity and sequence similarity are the BLAST and the BLAST 2,0 algorithm, which are described in Aiischu! et at., J. oL Biol. 215:403-410, 1990 and Aifschui et a!., Nucleic Acids Res. 25:3389- 3402, 1977. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (ncbi.nlm.nih.gov). The BLASTN program (for nucleotide sequences) uses as defaults a word length (W) of 1 1 , alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands. The BLASTP program (for amino acid sequences) uses as defaults a word length (W) of 3, and expectation (E) of 10, and the BLOSU 62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915, 1989).
In an embodiment an HIV-1 Env protein is from strain/clade BaL, DU422, YU-2, 2571 1 , Q769.d22, Q842.d12, BG505, 191084, ADS, B41 , SF162P3, 001428, SHIV327C, Hu_A1 Q, AC10, ZM197 , CH1 10, H031 , CH1 1 1 , 257-31 , PVO, CH1 15, or any other HIV-1 strain or clade and comprises one or more of the mutations or sets of mutations described herein.
Libraries
An embodiment provides a library comprising two or more (e.g., 2, 5, 20, 10, 50, 75, 100 or more) of the mutated HIV-1 Env proteins disclosed herein. Another embodiment provides a display library of one or more of the mutated HIV-1 Env proteins disclosed herein. The mutated HIV-1 Env proteins can comprise a fragment of the mutated HIV-1 Env protein or a full-length mutated HIV-1 Env protein. A fragment of the mutated HIV-1 Env protein comprises at least one of the disclosed mutations and is about 10, 20, 50, 100, 200, 300, 400, 500, 600, 700, 800, or more amino acids in length, in an embodiment, a fragment can induce an immune response.
A mutated HIV-1 Env protein or fragment thereof can be displayed on the surface of a library, by for example the C terminus. This is a display library.
A mutant HIV-1 Env display library can comprise a phage display library. A phage display library can be a collection of phage that has been genetically engineered to express one or more mutant HIV-1 Env proteins or fragments thereof on their outer surface, in an embodiment nucleic acid molecules encoding the mutant HIV-1 Env proteins or fragments thereof are inserted in frame into a gene encoding a phage capsule protein. In another embodiment, a phage display library is a collection of phage that displays one or more mutant HIV-1 Env proteins or fragments thereof on their outer surface.
A display library can be, for example, a phage display library, a phagemid display library, a virus display library, a bacterial ceil display library, a mammalian cell display library, yeast
display library, a Agt1 1 library, an in vitro library selection system (CIS display), an in vitro compartmentalization library, an antibody-ribosome-mRNA (ARM) ribosome display library, or a ribosome display library.
Methods of making and screening such display libraries are well known to those of skill in the art and described in, e.g., oiek et at. (201 1 ) Molecules 16, 857-887; Boder et al. , (1997) Nat Biotechnol 15, 553-557; Scott et ai, (1990) Science 249, 386-390; Brisette et ai. (2007) Methods Mo I Biol 383, 203-213; Kenrick et al. (2010) Protein Eng Des Sei 23, 9-17; Freudl et al. (1986) J Moi Biol 188, 491 -494; Getz et ai. (2012) Methods Enzymol 503, 75-97; Smith et ai. (2014) Curr Drug Discov Techno! 1 1 , 48-55; Hanes, et ai. (1997) Proc Natl Acad Sci USA 94, 4937-4942; Lipovsek et ai , (2004) J imm Methods 290, 51 -67; Ui!man et ai. (201 1 ) Brief, Fund. Genomics, 10, 125-134; Odegrip ef a/. (2004) Proc Natl Acad Sci USA 101 , 2806-2810; and Miller et al. (2006) Nat Methods 3, 561 -570.
A mutant HIV-1 Env library or display library can be screened for biological activity. There is a need for stabilized HIV-1 Env trimeric complexes that have improved percentage of trimeric complex formation (e.g., about 10, 20, 30, 40, 50 60, 70% or more improved trimeric complex formation as compared to wild-type HIV-1 Env trimeric complex formation), improved trimeric complex yield (e.g., about 10, 20, 30, 40, 50 60, 70% or more improved trimeric complex yield as compared to wild-type HIV-1 trimeric complex yield), and/or improved trimeric complex stability (e.g., about 10, 20, 30, 40, 50 60, 70% or more better HIV-1 Env trimeric complex stability as compared to wild-type HIV-1 Env trimeric complex stability).
An HIV-1 Env trimeric complex comprises HIV-1 Env proteins comprising at least one mutation described in a mature trimeric conformation. Three HIV-1 Env proteins come together to form one HIV-1 Env trimeric complex. Therefore, each HIV-1 Env trimeric complex has three gp120 subunits and three gp41 subunits. A portion of an HIV-1 Env trimeric complex can be about 100, 200, 300, 400, 500, 600, 700 or more amino acids, as long as it contains an amino acid mutation listed in Tables A-H, can induce an immunogenic response in a subject (e.g., a mammal such as a human), and includes at least a portion of three gp120 subunits and at least a portion of three gp41 subunits.
An HIV-1 Env trimeric complex can be a chimeric HIV-1 Env trimeric complex that comprises amino acid sequences from two or more different HIV-1 c!ades or amino acid sequences from two or more different mutant HIV-1 Env proteins.
HIV-1 trimeric complex formation can be measured by an antibody binding assay using antibodies that bind specifically to the trimeric form of the HIV-1 Env protein. Examples of trimeric complex specific antibodies that can be used to defect a trimer form include, but are not limited to, monoclonal antibodies (mAbs) PGT145, PGDM14Q0, PG16, and PGT151 . Any antibody binding assay known in the art can be used to measure the percentage of trimer formation of a recombinant HIV-1 Env protein of the invention, such as ELISA, AlphaLISA, etc.
The amount of HIV-1 Env trimeric complexes formed and the total amount of envelope protein expressed can also be determined using, for example, chromatographic techniques (e.g. , size exclusion chromatography multi-angle light scattering (SEC-MALS) that can separate the trimeric complex form from any other forms of the HIV-1 Env protein , e.g. , the monomer form.
An HIV-1 En trimeric complex can comprise three gp12Q-gp41 protomers comprising a gp120 polypeptide and a gp41 extracellular domain. Mature gp120 includes H IV-1 Env residues from about 31 -51 1 (wherein the amino acids are numbered by HXB2 numbering) , and contains most of the external, surface exposed, domains of the HIV-1 Env trimeric complex. The gp120 portion of the trimeric complex can bind to cellular CD4 receptors and can bind to cellular chemokine receptors. A mature gp120 poiypeptide is an extracellular poiypeptide that interacts with the gp41 extracellular domain (approximately HIV-1 Env positions 512-644) to form an HIV- 1 Env protomer that trimerizes to form an HIV-1 Env trimeric complex. Mature gp41 comprises approximately HIV-1 Env amino acids 512-858, and includes cytosolic, transmembrane, and extracellular-domains. The gp41 extracellular domain comprises HIV-1 Env residues from about 512-644.
In an embodiment an HIV-1 Env protein comprises one or more of the mutations disclosed herein In an extracellular domain, in an embodiment an HiV1 -Env protein comprises a fragment of an HIV-1 Env protein, which includes at least one extracellular domain or a portion of an extracellular domain having one or more of the mutations described herein. An extracellular fragment can be about 20, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, or more amino acids in length.
In an embodiment, the N-terminal residue of the gp120 polypeptide is one of HIV-1 Env positions 1 -35 (i.e. , one or more of amino acids 1 -34 can be absent). In an embodiment, the C- terminal residue of the gp120 polypeptide is one of HIV-1 Env positions 503-512 (i.e., one or more of amino acids 504-512 can be truncated or removed), in an embodiment, the N-terminal residue of the gp41 extracellular domain is one of H IV-1 Env positions 512-522 (i.e. , one or more of amino acids 512-521 are absent). In an embodiment the C-terminal residue of the gp41 extracellular domain is one of HIV-1 Env positions 640-683 (i.e., one or more of amino acids 640-683 is removed). Ail numbering refers to HXB2 numbering.
Truncations of the C-terminus of HIV-1 Env can be useful to (i) increase expression and/or
(ii) make a soluble extracellular fragment.
An HIV-1 Env trimeric complex can be stable in a mature closed conformation. An HIV-1 Env trimeric complex comprises at least one mutant HIV-1 En protein or fragment described herein and can exhibit increased retention of the mature closed conformation upon CD4 binding compared to a corresponding wild-type or naturally occurring HIV-1 Env trimeric complex.
A HIV-1 Env trimeric complex stabilized in the mature closed conformation can have at least about 60, 70, 80, 90, 95, 98, 99% or more reduced transition to the CD4-bound open conformation upon CD4 binding compared to a corresponding native HIV-1 Env trimeric complex.
The stabilization of the mature closed conformation by one or more mutations described herein can be, for example, energetic stabilization (for example, reducing the energy of the mature closed conformation relative to the CD4-bound open conformation) and/or kineiic siabilizatson (for example, reducing the rate of transition from the mature closed conformation to the open conformation) and/or reduced conformational heterogeneity (for example, a greater fraction of the expressed protein is in the dosed conformation). Additionally, stabilization of the HI -1 Env trimeric complex in the mature closed conformation can include an increase in resistance to denaturation compared to a corresponding native HIV-1 Env trimeric complex.
In an embodiment, the inclusion of one or more mutations described herein increases the pool of HIV-1 Env trimeric complexes present in the closed state as compared to wild-type or naturally occurring H IV-1 Env trimeric complexes. That is, use of HIV-1 Env proteins or fragments thereof having one or more mutations described herein can result in about 5, 10, 20, 30, 40, 50, 60, 70, 80, 90% or more HIV-1 Env trimeric complexes present in the closed state as compared to the use of wild-type or naturally occurring HIV-1 proteins or fragments thereof.
Methods of determining if a H IV-1 Env trimeric complex is in the mature closed conformation include, for example, negative stain electron microscopy and antibody binding assays using a mature closed conformation specific antibody, such as VRG26 or PGT145. Methods of determining if a HIV-1 Env trimeric complex is in the CD4-bound open conformation include for example, negative stain electron microscopy and antibody binding assays using a CD4-bound open conformation specific antibody, such as 1 7b, which binds to a CD4-induced epitope.
In an embodiment an H IV-1 Env trimeric complex can comprise a non-natural disulfide bond between cysteine substitutions at positions 201 and 433, a non-natural disulfide bond between cysteine substitutions at positions 501 and 805, and a proline substitution at position 559.
In an embodiment an HIV-1 Env trimeric complex does not specifically bind to a CD4- induced antibody when incubated with a molar excess of soluble GD4.
An embodiment provides an immunogen comprising one or more of the HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof described herein. An immunogen can also be a vector, nucleic acid molecule, or host cell as described herein . An immunogen can induce an immune response in a mammal, including for example, humans infected with HIV-1 or at risk of HIV-1 infection . Administration of an immunogen can lead to protective immunity and/or proactive immunity against HIV-1 .
An immune response is a response of a cell of the immune system, such as a B cell, T ceil, or monocyte, to a stimulus. In one embodiment, the response is specific for a particular HI - 1 Env antigen (an "antigen-specific response"). In one embodiment, an immune response is a T ceil response, such as a CD4+ response or a CD8+ response. In another embodiment, the
response is a B cell response, and results in the production of specific antibodies, in an embodiment, an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof as described herein comprises an epitope or other construct such that the protein or fragment thereof will bind an MHC molecule and induce an immune response, such as a cytotoxic T lymphocyte ("CTL") response, and/or a B cell response (for example, antibody production), and/or a T-helper lymphocyte response against the antigen from which the protein or fragment thereof is derived.
Nucleic Acid Molecules, Vectors, and Host Cells
Embodiments include nucleic acid molecules encoding the mutant HIV-1 Env protein, fragments thereof, HIV-1 Env trimeric complex or portion thereof disclosed herein. Polynucleotides contain less than an entire viral genome and can be single- or double-stranded nucleic acids. A polynucleotide can be RNA, DNA, cDNA, genomic DNA, chemically synthesized RNA or DNA or combinations thereof. A polynucleotide can comprise, for example, a gene, open reading frame, non-coding region, or regulatory element.
A gene is any polynucleotide molecule that encodes a protein or fragments thereof, optionally including one or more regulatory elements preceding (5' non-coding sequences) and following (3' non-coding sequences) the coding sequence. In one embodiment, a gene does not include regulatory elements preceding and following the coding sequence. A naturally occurring or wild-type gene refers to a gene as found in nature, optionally with its own regulatory elements preceding and following the coding sequence. A chimeric or recombinant gene refers to any gene that is not a naturally occurring or wild-type gene, optionally comprising regulatory elements preceding and following the coding sequence, wherein the coding sequences and/or the regulatory elements, in whole or in part, are not found together in nature. Thus, a chimeric gene or recombinant gene comprise regulatory elements and coding sequences that are derived from different sources or regulatory elements and coding sequences that are derived from the same source, but arranged differently than is found in nature. A gene can encompass full-length gene sequences (e.g., as found in nature and/or a gene sequence encoding a full-length polypeptide or protein) and can also encompass partial gene sequences (e.g., a fragment of the gene sequence found in nature and/or a gene sequence encoding a protein or fragment of a polypeptide or protein). A gene can include modified gene sequences (e.g., modified as compared to the sequence found in nature). Thus, a gene is not limited to the natural or full-length gene sequence found in nature.
Polynucleotides can be purified free of other components, such as proteins, lipids and other polynucleotides. For example, the polynucleotide can be 50%, 75%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% purified. A polynucleotide existing among hundreds to millions of other polynucleotide molecules within, for example, cDNA or genomic libraries, or gel slices containing a genomic DNA restriction digest are not to be considered a purified polynucleotide.
Polynucleotides can encode the proteins described herein (e.g., mutant HIV-1 Env proteins and fragments thereof).
Polynucleotides can comprise additional heterologous nucleotides that do not naturally occur contiguously with the polynucleotides. As used herein the term "heterologous" refers to a combination of elements that are not naturally occurring or that are obtained from different sources.
Polynucleotides can comprise other nucleotide sequences, such as sequences coding for linkers, signal sequences, T R stop transfer sequences, transmembrane domains, or ligands useful in protein purification such as giutathione-S-transferase, histidine tag, and Staphylococcal protein A.
Polynucleotides can be isolated. An isolated polynucleotide is a naturally-occurring polynucleotide that is not immediately contiguous with one or both of the 5' and 3' flanking genomic sequences that it is naturally associated with. An isolated polynucleotide can be, for example, a recombinant DNA molecule of any length, provided that the nucleic acid sequences naturally found immediately flanking the recombinant DNA molecule in a naturally-occurring genome is removed or absent, isolated polynucleotides also include non-naturally occurring nucleic acid molecules. Polynucleotides can encode full-length proteins, polypeptide fragments, and variant or fusion polypeptides.
Degenerate polynucleotide sequences encoding polypeptides described herein, as well as homologous nucleotide sequences that are at least about 80, or about 85, 90, 91 , 92, 93, 94, 95, 96, 97, 98, or 99% identical to polynucleotides described herein and the complements thereof are also polynucleotides. Degenerate nucleotide sequences are polynucleotides that encode a protein described herein or fragments thereof but differ in nucleic acid sequence from the wild- type polynucleotide sequence, due to the degeneracy of the genetic code. Complementary DNA (cDNA) molecules, species homologs, and variants of polynucleotides that encode biologically functional polypeptides also are polynucleotides.
Polynucleotides can be obtained from nucleic acid sequences present in, for example, an HIV virion. Polynucleotides can also be synthesized in the laboratory, for example, using an automatic synthesizer. An amplification method such as PCR can be used to amplify polynucleotides from either genomic DNA or cDNA encoding the polypeptides.
Polynucleotides can comprise coding sequences for naturally occurring polypeptides or can encode altered sequences that do not occur in nature. Unless otherwise indicated, the term polynucleotide or gene includes reference to the specified sequence as well as the complementary sequence thereof.
An embodiment includes a vector comprising an HIV-1 Env polynucleotide that encodes a mutant HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof as disclosed herein. A vector is used to introduce a nucleic acid molecule into a host ceil, thereby producing a transformed host ceil. Recombinant vectors are vectors having recombinant DNA. A
vector can include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication . A vector can also include one or more selectable marker genes and other genetic elements known in the art.
If desired , polynucleotides can be cloned into an expression vector comprising expression control elements, including for example, origins of replication, promoters, enhancers, or other regulatory elements thai drive expression of the polynucleotides in host ceils. A vector can be, for example, a virus (e.g. , adenovirus or poxvirus), naked DNA, oligonucleotide, cationic lipid (e.g. , liposome), cationic polymer (e.g ., polysome), virosome, nanoparticle, or dentrimer. Other viral vectors include adeno-associated virus vectors, retrovirus vectors, poxviruses, vaccinia virus, herpesviruses, togaviruses, picornaviruses, and baculoviruses. Other vectors include bacteriophages, phagemids, yeast artificial chromosomes, bacterial artificial chromosomes, virus- like particles, cosmids (piasmids into which phage lambda cos sites have been inserted) and repiicons (genetic elements that are capable of replication under their own control in a ceil).
The nucleic acid molecules of a vector can be encapsulated in a lipid membrane or by structural proteins (e.g. , capsid proteins), that can include one or more viral polypeptides (e.g. , an HIV-1 Env protein or portion thereof). A vector can be used to infect ceils of a subject, such that translation of the heterologous gene(s) of the vector occurs, in an embodiment an H IV-1 Env trimeric complex is formed.
Naked DNA or oligonucleotides encoding one or more of the H IV-1 Env proteins, fragments thereof, HIV-1 trimeric complexes or portions thereof described herein can also be used to express H IV-1 Env proteins in a cell or a subject to promote formation of HIV-1 Env trimeric complexes. See, e.g ., Cohen, Science 259: 1691 -1692 (1993); Fynan et a!. , Proc, Natl. Acad, Sci. USA, 90: 1 1478 (1993); and Wolff et al„ BioTechniques 1 1 :474485 (1 991 ),
A virus-like particle (VLP) can comprise one or more H IV-1 Env proteins, fragments thereof, or HIV-1 Env trimeric complexes as described herein. VLPs lack the viral components that are required for virus replication and thus represent a highly attenuated form of a virus. The VLP can display an HIV-1 Env protein, fragment thereof, trimeric complex or portion thereof that is capable of eliciting an immune response to HIV-1 Env when administered to a subject. Virus like particles and methods of their production are known to the person of ordinary skill in the art, and viral proteins from several viruses are known to form VLPs, including human papillomavirus, HIV, Semliki-Forest virus, human poiyomavirus, rotavirus, and others. The virus like particle can include any of the recombinant HIV-1 Env trimeric complexes or immunogenic fragments thereof thai are disclosed herein .
An embodiment provides a host ceil comprising one or more vectors or nucleic acid molecules as described above. A recombinant host cell, transgenic host cell, or transformed host ceil is a ceil into which one or more foreign or exogenous nucleic acid molecules, synthetic nucleic acid molecules, or piasmids have been introduced or inserted into the cell. The one or more foreign nucleic acid molecules, synthetic nucleic acid molecules, or piasmids do not occur in the
host cell in nature. The cell may be prokaryotic or eukaryotic. The term also includes any progeny of the host ceil. It is understood that ail progeny may not be identical to the parental ceil since there may be mutations that occur during replication. However, such progeny are included when the term "host cell" is used .
Methods of Producing HIV-1 Ertv Proteins
An embodiment provides methods of producing HIV-1 Env proteins, fragments thereof, HiV-1 trimeric complexes or portions thereof comprising one or more of the mutations described herein. In an embodiment nucleic acid molecules capable of expressing H IV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes or portions thereof are cloned into one or more vectors, in an embodiment nucleic acid molecules encoding H IV-1 Env gp120 su bun its are cloned into a first vector and nucleic acid molecules encoding HIV-1 Env gp140 are cloned into a second vector. Both vectors can be introduced into host cells, in an embodiment the nucleic acid molecules encoding HIV-1 proteins or fragments thereof are codon optimized for expression in human ceils.
One or more host cells can be cultured in an appropriate medium to produce HIV-1 Env proteins, fragments thereof, H IV-1 trimeric complexes or portions thereof. A host ceil can be a mammalian ceil having the ability to glycosylate proteins.
An embodiment provides a method of producing a stable H IV-1 Env trimer in a closed conformation. The method comprises making one or more of the amino acid mutations or sets of mutations disclosed herein in an HIV-1 Env protein, fragment thereof, H IV-1 Env trimeric complex or portion thereof and expressing the protein in a host cell.
Screening Methods
An embodiment provides methods of screening a compound or test agent for binding to one or more HIV-1 Env proteins, fragments thereof, HIV-1 Env complexes or portions thereof comprising one or more of the mutations described herein. The one or more mutant H IV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof are contacted with one or more test agents or compounds. The ability of the test agent or compound to bind to the one or more mutant HIV-1 Env proteins, fragments, trimeric complexes or portions thereof is determined. The test agent can be any type of compound, molecule, biological molecule, or drug.
Binding assays such as competitive binding assays and direct binding assays are well known to those of skill in the art.
A plurality of mutant HIV-1 Env proteins (e.g. , 2, 5, 10, 15, or more mutant HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof disclosed herein) can be screened.
A compound or test agent can be tested for inhibition of an H IV-1 -mediated activity. An
HIV-1 -mediated activity can be, for example, viral spread, infection, or cell fusion. Cell fusion may be, for example, target cell entry or syncytial formation . In an embodiment, the compound or test
agent inhibits an HiV-mediated activity. The compound or test agent can be provided in a library or display library.
In an embodiment, a screening step can also serve as the step of recovering a test agent or compound that binds to the mutant HIV-1 Env protein, fragment thereof, or trimeric compound.
Methods well known to those skilled in the art can be applied to screening of libraries or display libraries of test agents or compounds. Examples include solid-phase screening methods and liquid-phase screening methods. Solid-phase screening methods can involve, for example, immobilizing test agents or compounds onto a solid phase, and contacting mutant HIV-1 Env proteins, fragments, trimeric complexes or portions thereof contained in a liquid phase with the test agents or compounds and removing unbound mutant HIV-1 Env proteins, fragments, trimeric complexes or portions thereof and nonspecifically bound mutant HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof and then seiectiveiy separating mutant HIV-1 Env proteins, fragments, trimeric complexes or portions thereof bound with the test agent or compound to screen for a protein, fragment, trimeric complex or portion thereof having, foi¬ example, a desired binding activity. A liquid-phase screening method can involve, for example, contacting mutant HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof with test agents in a solution, removing unbound mutant HIV-1 Env proteins, fragments thereof, trimeric complexes and portions thereof and nonspecifically bound HIV-1 Env proteins, fragments thereof, trimeric complexes and portions thereof and then seiectiveiy separating the HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof bound with test agents or compounds.
Naoodjscs
In an embodiment, an HIV-1 Env protein, fragment thereof, HIV-1 trimeric complex, portion thereof, or combinations thereof can be presented as a membrane protein in nanodiscs. See, e.g., Bayburt et a/., J. Struct. Biol. (1998); 123:37; Civjan et a/,, BioTechniques (2003) 35:556; Hagn et ai, J. Am. Chem. Soc. (2013) 135:1919.
Nanodiscs have a phospholipid bilayer system held together by membrane scaffold proteins (MSPs), which wrap around a patch of a lipid bilayer to form a disc-like particle or nanodisc. MSPs have a hydrophobic surface facing the lipids, and a hydrophilic surface facing outward. Nanodiscs are therefore highly soluble in aqueous solutions. Once assembled into nanodiscs, membrane proteins can be kept in solution in the absence of detergents.
MSPs can be, for example, truncated forms of apolipoproiein (apo) A-l, MSP1 D1 , MSP1 E3D1 , MSP2N2, MSP2N3, or MSP1 D1 dH5. Nanodiscs can be about 7-17 nm in diameter depending on the type of MSP used. MSPs can be derived from for example, mouse, rat or human apo A-1 proteins. Use of mouse or rat apo A-1 proteins can improve antibody specificity when human HIV-1 Env target protein-nanodisc complexes are used for immunization.
Nanodiscs can be used to reconstitute HIV-1 Env in an artificial environment resembling the native membrane. These nanodisc-stabiiized proteins can be directly purified by standard
chromatographic procedures. The resulting purified membrane protein:nanodisc complex can be used in screening applications that require access to both the physiologically intracellular and extracellular surfaces of the protein and thus allows unrestricted access of antagonists, agonists, and other interaction partners. The nanodiscs can also be used as an H IV-1 Env immunogen or HIV-1 Env vaccine.
Nanodiscs can be made using cell-free expression systems. An HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, portions thereof or combinations thereof can be expressed from, for example, a plasmid. Pre-assemb!ed nanodiscs are supplied in the mixture that integrate the nascent HIV-1 Env protein. Nanodiscs can also be made using a two-step reconstitution of detergent-solubilized proteins. Purified HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof or combinations thereof are combined with a suitable detergent, and membrane scaffold proteins and phospholipids are added . Nanodiscs containing the membrane protein form spontaneously, and can be purified by affinity or size exclusion chromatography. Nanodiscs can also be made via direct solubilization from membranes expressing HIV-1 Env proteins, fragments thereof, H IV-1 Env trimeric complexes, portions thereof, or combinations thereof. Starting from membranes expressing the HIV-1 Env protein, detergent and membrane scaffold protein are added . Membrane phospholipids, HIV-1 Env protein and MSP assemble to form the nanodisc complex.
Phospholipids such as dimyristoyl-glycero-phosphocholine (DMPC), paimitoyl-oleoyi- phosphatidylcholine (POPC), and many other phospholipids can be used when making nanodiscs.
An embodiment provides a nanodisc comprising one or more of HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof, or combinations thereof as described herein, a membrane scaffold protein; and one or more phospholipids. In an embodiment, the nanodiscs can be used to screen test agents or compounds for binding or biological activity. In an embodiment, the nanodiscs can be used as an immunogen or vaccine.
A pharmaceutical composition can comprise a mutant HIV-1 Env protein or fragment thereof (which comprise at least one mutation described herein) , an HIV-1 Env trimeric complex comprising at least on mutant HIV-1 Env protein or portion thereof (which comprises at least one mutation described herein), nucleic acid molecule as described herein , a vector as described herein, a host cell as described herein, or a combination thereof combined with a pharmaceutically acceptable carrier.
Pharmaceutically acceptable carriers are well known in the art. See e.g., Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co., Easton , Pa., 1 9th Edition , 1995, which describes compositions and formulations suitable for pharmaceutical delivery.
In general, the nature of the carrier will depend on the particular mode of administration being employed . For instance, parenteral formulations usually comprise injectable fluids that
include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (e.g., powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitoi, lactose, starch, or magnesium stearate. In addition to biologically neutral carriers, pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate. In particular embodiments, a carrier may be sterile, and/or suspended or otherwise contained in a unit dosage form containing one or more measured doses of the composition suitable to induce the desired anti-HIV-1 immune response. It may also be accompanied by medications for its use for treatment purposes. The unit dosage form may be, for example, in a sealed vial that contains sterile contents or a syringe for injection into a subject, or lyophiiized for subsequent solubilization and administration or in a solid or controlled release dosage.
A pharmaceutical composition can comprise an adjuvant to enhance antigenicity. An adjuvant can comprise, for example, a suspension of minerals (alum, aluminum hydroxide, or phosphate); or water-in-oil emulsion, for example, in which antigen solution is emulsified in mineral oil (Freund incomplete adjuvant), sometimes with the inclusion of killed mycobacteria (Freund's complete adjuvant) to further enhance antigenicity (inhibits degradation of antigen and/or causes influx of macrophages). Immunostimulatory oligonucleotides (such as those including a CpG motif) can also be used as adjuvants. Adjuvants can include biological molecules, such as costimulatory molecules. Exemplary adjuvants include IL-2, RANTES, G -CSF, TNF-a, IFN-Y, G-CSF, LFA-3, CD72, B7-1 , B7-2, OX-40L, SA-4-1 BBL and toll-like receptor (TLR) agonists, such as TLR-9 agonists. Adjuvants are well known in the art. See, e.g., Singh (ed.) Vaccine Adjuvants and Delivery Systems. Wiley-lnterscience, 2007).
A pharmaceutical composition can comprise a detergent, such as a non-ionic detergent (e.g., a polyethylene type detergent).
An embodiment provides a method for eliciting an immune response against an HiV-1 infected ceil in a subject (e.g., a mammal such as a human) comprising administering to the subject a therapeutically effective amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof comprising one or more mutations described herein such that an immune response is elicited in the subject. In an embodiment a pharmaceutical composition as described herein can be used to elicit an immune response against an HIV-1 infected cell in a subject.
An embodiment provides a method for delaying the onset of, or slowing the rate of progression of, an HIV-1 -related disease or symptom in an HIV-1 -infected subject. Examples of symptoms of diseases (e.g., AIDS) include, for example, fever, muscle aches, coughing,
sneezing, runny nose, sore throat, headache, chills, diarrhea, vomiting, rash , weakness, dizziness, bleeding under the skin, in internal organs, or from body orifices like the mouth, eyes, or ears, shock, nervous system malfunction, delirium, seizures, renal failure, personality changes, neck stiffness, dehydration, seizures, lethargy, paralysis of the limbs, confusion, back pain, loss of sensation , impaired bladder and bowel function, and sleepiness that can progress into coma or death.
The method comprises administering to the subject (e.g. , a mammal such as a human) a therapeutically effective amount of an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof comprising one or more mutations described herein such that the onset of an HIV-1 disease or symptom is delayed or the progression of HIV-1 symptoms are slowed in comparison to an HIV-1 positive subject who does not receive the administration . In an embodiment a pharmaceutical composition as described herein can be used in the methods.
A therapeutically effective amount refers to an amount of a composition described herein that, when administered to a subject for treating a disease or disorder or at least one symptom of the disease or disorder, is sufficient to affect such disease, disorder, or symptom. A therapeutically effective amount can vary depending , for example, on the composition that is administered, the disease, disorder, and/or symptoms of the disease or disorder, severity of the disease, disorder, and/or symptoms of the disease or disorder, the age, weight, and/or health of the subject to be treated , the capacity of the individual's immune system to synthesize antibodies, the degree of protection desired , the formulation of the composition , the treating doctor's assessment of the medical situation , and other relevant factors. An appropriate amount in any given instance can be readily ascertained by those skilled in the art or capable of determination by routine experimentation. It. is expected that the amount will fail in a relatively broad range that can be determined through routine trials. For example, in the context of administering a therapeutic agent (e.g. , H iV-Env protein, fragments thereof, HIV-1 Env trimeric complexes, portions thereof, and pharmaceutical compositions described herein), the therapeutically effective amount is an amount sufficient to achieve a reduction in the level of HIV (e.g ., as measured by a stabilization or decrease in HIV titer compared to a non-treated control), and/or an increase in the level of neutralizing anti-HIV antisera (e.g ., as measured by an increase in serum neutralizing antibody levels relative to a non-treated control in a luciferase-based virus neutralization assay) as compared to a response obtained without administration of a therapeutic agent described herein, and/or to prevent the propagation of a H IV-1 in a subject (e.g. , a human) having an increased risk of viral infection. I
In an embodiment, a therapeutically effective amount provides a therapeutic effect without causing a substantial cytotoxic effect in the subject. In general, a therapeutically effective amount of a composition administered to a subject (e.g. , a human) will vary depending upon a number of factors associated with that subject, for example the overall health of the subject, the condition to be treated , or the severity of the condition. A therapeutically effective amount of a composition
can be determined by varying the dosage of the product and measuring the resulting therapeutic response.
Administering means giving a dosage of a pharmaceutical composition as described herein to a subject. Administration can be done, for example, intramuscularly, intravenously, intradermal^, percutaneously, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticular^, intraprostatically, intrapleural^, intratracheally, intranasally, iniravitreaily, intravaginally, intrarectal^, topically, intratumorally, peritoneally, subcutaneously, subconjunctival^, intravesicularlly, mucosally, intrapericardialiy, intraumbiiicaily, intraocularly, orally, topically, locally, by inhalation, by injection, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, by catheter, by lavage, by gavage, in creams, or in lipid compositions.
In an embodiment an H IV-1 Env protein , fragment thereof, H IV-1 Env trimeric complex, portion thereof, or pharmaceutical composition induces a neutralizing immune response or a broadly neutralizing immune response to H IV-1 Env in the subject
In an embodiment an administration of the compositions described herein to a subject causes a reduction or decrease of an HIV-mediated activity (e.g ., infection, fusion (e.g. , target ceil entry and/or syncytia formation), viral spread, etc.) and/or a decrease in viral titer). HIV- mediated activity and/or HIV titer may be decreased by about 5%, 10%, 20% , 30%, 40% , 50%, 60%, 70% , 80%, 90%, 95%, 98%, 99% or more compared to that of a control subject (e.g. , an untreated subject or a subject treated with a placebo).
An embodiment provides a vaccine, which is an HIV-1 Env protein , fragment thereof, HIV- 1 Env trimeric complex, portion thereof, or pharmaceutical composition as described herein that can provoke an immune response. Administration of a vaccine to a subject can confer at least some protective immunity against HIV-1 infection (e.g. , enhancement of resistance to new infection , complete resistance to new infection, or reduction or elimination of clinical severity of the disease or symptoms).
An embodiment provides a method for preventing a subject (e.g ., a mammal such as a human) from becoming infected with H IV-1 . The method comprises administering to the subject a prophylactically effective amount of an HIV-1 Env protein, fragment thereof, H IV-1 Env trimeric complex, or portion thereof comprising one or more mutations described herein such that a protective immune response is elicited in the subject, in an embodiment a pharmaceutical composition as described herein can be used to elicit a protective immune response. The subject can be prevented from becoming infected with at least 1 , 2, 3, 4, 5, 6, or more strains of HIV-1 .
A prophylactically effective amount is any amount of an agent (e.g. , an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, portion thereof or pharmaceutical composition described herein) which, when administered to a subject prone to suffer from a disease or disorder, inhibits or prevents the onset of the disease or disorder. The prophylactically effective amount will vary with the subject being treated, the condition to be treated, the agent delivered,
and the route of delivery. A person of ordinary skill in the art can perform routine titration experiments to determine such an amount. A prophylactic treatment is a treatment administered to a subject who does not exhibit signs of a disease or exhibits only early signs for the purpose of decreasing the risk of developing pathology.
A protective immunological response or protective immunity can be demonstrated by either a reduction or lack of clinical signs or symptoms normally displayed by an infected host, a quicker recovery time, and/or a lowered duration of infectivity or lowered pathogen titer in the tissues or body fluids or excretions of the infected host.
An embodiment provides a method for reducing the likelihood of a subject becoming infected with HIV-1 . The method comprises administering to the subject an amount effective to reduce the likelihood of the subject becoming infected with HIV-1 of an HIV-1 Env protein, fragment thereof, HIV-1 Envtrimeric complex or portion thereof comprising one or more mutations described herein such that an immune response is elicited in the subject. In an embodiment a pharmaceutical composition as described herein can be used to elicit an immune response. In an embodiment, the subject has been exposed to HIV-1 .
An embodiment provides a DNA vaccine comprising one or more of the nucleic acid molecules encoding an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof, wherein then protein, fragment, complex or portion comprises one or more of the mutations described herein together with a pharmaceutically acceptable adjuvant. A DNA vaccine comprises genetically engineered DNA that is delivered direcily to ceils to produce an HIV-1 Env antigen (e.g., an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof as described herein), such that an immune response is generated, in an embodiment, the immune response is a protective immune response.
An embodiment provides a recombinant viral vector vaccine, which comprises a recombinant viral vector comprising one or more of the nucleic acid molecules encoding an HIV- 1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof, wherein then protein, fragment, complex or portion comprises one or more of the mutations described herein and a pharmaceutical acceptable adjuvant. The recombinant viral vector can be, for example, vaccinia vector, adenovirus vector, adena-associated virus vector, sendai virus vector, herpes simplex virus vector, human papillomavirus vector, retroviral vector or other viral vector. A recombinant viral vector can be a repiicative viral vector.
An embodiment provides a recombinant bacterial vector vaccine, which comprises a recombinant bacterial vector comprising one or more of the nucleic acid molecules encoding an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof, wherein then protein, fragment, complex or portion comprises one or more of the mutations described herein and a pharmaceutical acceptable adjuvant.
Ex vivo transfection or transduction of ceils can also be used to deliver the HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes or portions thereof to a subject. The
cells can be delivered into a subject to allow for the expression of one or more of the HIV-1 Env proteins, fragments thereof, trimeric complexes or portions thereof described herein. In embodiments, cells can be autologous or heterologous to the treated subject. Cells can be transfected or transduced ex vivo with, for example, one or more vectors or nucleic acid molecules described herein to allow for the temporal or permanent expression of one or more of the HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes, or portions thereof in the treated subject. Once the modified ceils are administered to the subject, the one or more vectors or nucleic acid molecules will be expressed, eliciting protective or therapeutic immune responses directed against the HIV-1 Env proteins or HIV-1 Env trimeric complexes.
Cells that can be isolated and transfected or transduced ex vivo can be, for example, blood ceils, skin cells, fibroblasts, endothelial ceils, skeletal muscle ceils, hepatoc tes, prostate epithelial cells, vascular endothelial cells, and totipotent, pluripotent, multipotent, or unipotent stem cells.
In an embodiment the HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, portion thereof, or pharmaceutical composition can be administered as part of a prime-boost regimen. In an embodiment, the immune response triggered by a single administration (prime) of a composition described herein may not be sufficiently potent and/or persistent to provide effective protection. Therefore, repeated administration (boost), such that a prime-boost regimen is established, may significantly enhance humoral and cellular responses to the antigen(s) of the composition.
The booster is administered to the subject after the primer. A skilled artisan will understand a suitable time interval between administration of the primer composition and the booster composition. In some embodiments, the primer composition, the booster composition, or both primer composition and the booster composition additionally include an adjuvant, in one embodiment, the primer composition is a DNA-based vaccine (or other vaccine based on gene delivery), and the booster composition is a protein-based vaccine.
HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof, or pharmaceutical compositions can be administered in a prophy!acticaily effective amount or a therapeutically effective amount that provides an immunogenic response and/or protective effect against HIV-1 . A protein composition can be administered at between about 1 pg and about 1 mg of protein, or between about 50 pg and about 300 pg of protein.
A viral vector capable of expressing HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes or portions thereof can be administered at least about 1 i o3 viral particles (vp)/dose, between about 1 x101 and about 1 x10,4 vp/dose, between about. 1 x103 and about 1 1 G,2 vp/dose, or between about 1 x10s and about 1 x1 Q, ! vp/dose.
Levels of induced immunity or immune response provided by the compositions can be monitored by, for example, measuring amounts of HIV-1 neutralizing anti-HIV antibodies. The
dosages may then be adjusted or repeated as necessary to trigger the desired level of immune response.
Where a subject is administered an HIV-1 protein, fragment thereof, HIV-1 Env trimeric complex, portion thereof, or pharmaceutical composition the efficacy of treatment can be determined by monitoring the level of the HIV-1 Env proteins, fragments thereof, HIV-1 Env trimeric complexes or portions thereof expressed by or present in a subject following administration. For example, the blood or lymph of a subject can be tested for the HIV-1 Env proteins, using for example, standard assays known in the art (see, e.g., Human Interferon-Alpha Multi-Species ELISA kit and Human Interferon-Alpha Serum Sample kit from Pestka Biomedical Laboratories (PBL), Piscataway, N.J,).
A single dose of one or more of the pharmaceutical compositions described herein can achieve therapy in subjects. Multiple doses (e.g., 2, 3, 4, 5, or more doses) can also be administered to subjects.
HIV-1 proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof oi¬ pharmaceutical compositions can be administered, for example, every 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 45, 50, 55, or 60 minutes, 2, 4, 6, 10, 15, or 24 hours, 2, 3, 5, or 7 days, 2, 4, 6 or 8 weeks, or even 3, 4, or 6 months pre-exposure or pre-diagnosis, or may be administered to the subject every 15-30 minutes or 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 20, 24, 48, or 72 hours, 2, 3, 5, or 7 days, 2, 4, 6 or 8 weeks, 3, 4, 6, or 9 months, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 years or longer post-diagnosis or post-exposure or to HIV-1 . A subject can be administered one or more doses of the HIV-1 proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof or pharmaceutical compositions once daily, weekly, monthly, or yearly. When treating an HIV-1 infection, the compositions can be administered to the subject either before the occurrence of symptoms of an HIV infection or disease/syndrome (e.g., acquired immune deficiency syndrome (AIDS)) or a definitive diagnosis, or after diagnosis or symptoms become evident. HIV-1 proteins, fragments thereof, HIV-1 Env trimeric complexes, portions thereof or pharmaceutical compositions can be administered, for example, immediately after diagnosis or the clinical recognition of symptoms or every 2, 4, 6, 10, 15, or 24 hours, 2, 3, 5, or 7 days, 2, 4, 6 or 8 weeks, or even 3, 4, or 6 months after diagnosis or detection of symptoms.
Antibodies
An embodiment provides antibodies (i.e., an immunoglobulin or an antigen-binding fragment) thai specifically bind and recognize an HIV-1 Env protein, an antigenic fragment thereof, or an HIV-1 Env trimeric complex or antigenic fragment thereof. The HIV-1 Env protein, antigenic fragment thereof or HIV-1 Env trimeric complex or antigenic fragment thereof comprise one or more of the mutations described herein. In an embodiment, antibodies are provided that specificaiiy bind to an HIV-1 En trimeric complex in a closed conformation, wherein the HIV-1 En trimeric complex comprises one or more of the mutations described herein.
Antibodies include monoclonal antibodies, polyclonal antibodies, muitispecific antibodies (e.g., bispecific antibodies), and antibody fragments, as long as they have antigen-binding activity, in an embodiment, antibodies and fragments thereof can be chimeric antibodies (see, e.g., U.S. Patent No. 5,482,858), humanized antibodies (see, e.g., Jones ei al., Nature 321 :522 (1986); Reichmann et al., Nature 332:323 (1988)); Presta, Curr. Op. Struct. Biol. 2:593 (1992)), or human antibodies. Human antibodies can be made by, for example, direct immortalization, phage display, transgenic mice, or a Trimera methodology, see e.g., Reisener et al., Trends Biotechnol. 16:242-248 (1998).
Examples of antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab')2; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and muitispecific antibodies formed from antibody fragments. Antibody fragments include antigen binding fragments either produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA methodologies. See, e.g., Kontermann & Dubel (Ed), Antibody Engineering, Vols. 1 -2, 2nd Ed., Springer Press, 2010).
In an embodiment, an antibody or specific binding fragment thereof that specifically binds
HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof having one or more mutations described herein has a broader and higher neutralization activity to HIV-1 virus when compared to an antibody or fragment produced by induction with a wild-type (i.e., naturally occurring) HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof.
An embodiment provides methods of identifying antibodies that specifically bind to HIV-1
Env proteins or HIV-1 Env trimeric complexes described herein. An effective amount of an immunogen is administered to B cells in an in vitro cell culture system to generate antibodies that neutralize HIV-1 virus. An effective amount is an amount that is sufficient to generate antibodies specific for HIV-1 Env protein, fragment thereof, HIV-1 trimeric complex, or fragment thereof. In an embodiment the HIV-1 virus is heterologous to the virus strain or subtype from which the immunogen was derived. That is, use of the immunogen can generate antibodies that specifically bind HIV-1 Env proteins and HIV-1 Env trimeric complexes from more than one clade. An immunogen can be an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex, or portion thereof described herein. An immunogen can also be a nucleic acid molecule, vector, host cell, or pharmaceutical composition described herein.
In an embodiment, antibodies neutralize HIV-1 or broadly neutralize HIV-1 . Broadly neutralizing Abs (BnAbs) can neutralize infection of a large spectrum of genetically diverse HIV- 1 viruses. BnAbs can reduce the infectious titer of HIV-1 by binding to and inhibiting the function of related HIV-1 Env antigens. Related HIV-1 Env antigens share at least about 85%, 90%, 95%, 96%, 97%, 98%, 99% or more sequence identity with an antigenic surface HIV-1 Env. In some embodiments, broadly neutralizing antibodies to HIV-1 Env are distinct from neutralizing antibodies to HIV-1 Env in that they neutralize with an IDM > 40 a high percentage (e.g., about 50%, 60%, 70%, 80% or more) of the many types of HIV-1 in circulation. In an embodiment, a
BnAb can neutralize the function of HIV-1 Env from more than one clade. Therefore, broadly neutralizing antibodies to HIV-1 Env are distinct from other antibodies to H IV-1 Env in that they neutralize a high percentage of the many types of H IV in circulation.
Examples of broadly neutralizing antibodies include b12 and VRC01 , which bind to the CD4 binding site of gp120; 2F5 and 4E10, which bind to the membrane-proximal external region (MPER) of gp41 ; and PG9 and PG16, which bind to the V1 V2 domains of the trimer. Other examples include PGT122 and 35022.
Methods to assay for neutralization activity are well known in the art and include, but are not limited to, plaque reduction neutralization (PRNT) assays, microneutralization assays, flow cytometry based assays, single-cycle infection assays (see e.g. , Martin et ai. (2003) Nature Biotechnology 21 :71 -76), and pseudovirus neutralization assays (see e.g ., Georgiev et ai (Science, 340, 751 -756, 201 3), Seaman et ai. (J. Virol. , 84, 1439-1452, 2005), Mascola et ai. (J, Virol., 79, 1 0103-10107, 2005).
An antibody can be made in vivo in suitable laboratory animals or in vitro using recombinant DNA techniques. Means for preparing and characterizing antibodies are well known in the art. See, e.g., Dean, Methods Mol. Bioi. 80:23-37 (1998); Dean, Methods Moi. Bioi. 32:361 - 79 (1994); Baileg, Methods Moi. Bioi. 32:381 -88 (1 994); Guliick, Methods Moi. Bioi. 32:389-99 (1994); Drenckhahn et ai Methods Ceii. Bioi. 37:7-56 (1993); Morrison, Ann. Rev. Immunol. 10:239-65 (1 992); Wright et ai. Crit. Rev. Immunol. 12: 125-68 (1992).
"Specifically binds" or "specific for" means that a first antigen, e.g., HIV-1 Env, a portion thereof, a HIV-1 Env trimeric complex or portions thereof recognizes and binds to an antibody or antigen binding fragment thereof with greater affinity than other non-specific molecules. A nonspecific molecule is an antigen that shares no common epitope with the first antigen . In embodiments a non-specific molecule is not an HIV-1 Env and is not related to HIV-1 Env. For example, an antibody raised against a first antigen (e.g. , HIV-1 Env) to which it binds more efficiently than to a non-specific antigen can be described as specifically binding to the first antigen, in embodiments an antibody or antigen-binding fragment thereof specifically binds to an HIV-1 Env, HIV-1 Env trimeric complex, or portion thereof when it binds with a binding affinity Ka of 107 i/mol or more. An antibody or binding fragment thereof can specifically bind to an HIV-1 Env protein, portion thereof, HIV-1 Env trimeric complex or portion thereof when the interaction has a KD of less than 10 s Molar, such as less than 1 0 s Molar, less than 10 s Molar, less than 10" 9, or even less than 1 Q~10 Molar.
In an embodiment an antibody or antigen binding fragment can specifically bind to HIV-1 Env or trimeric complexes of H IV-1 Env from two or more e!ades,
Specific binding can be tested using , for example, an enzyme-linked immunosorbant assay (ELISA), a radioimmunoassay (R!A), or a western blot assay using methodology well known in the art.
In an embodiment an antibody or fragment thereof specifically binds to an HIV-1 Env protein, portion thereof, HIV-1 Env trimeric complex or portion thereof in the presence of a heterogeneous population of proteins and other biologies. Thus, an antibody or fragment thereof specifically binds to a particular target HIV-1 Env protein and does not bind in a significant amount to other proteins or polysaccharides present in the sample or subject.
An embodiment provides a method of treatment of HIV-1 related disease or symptom thereof comprising administrating one or more of the neutralizing or broadly neutralizing antibodies described above to a subject (e.g., a mammal such as a human).
An embodiment provides a method of enhancing the binding of an antibody to an HIV-1 Env trimeric complex or portion thereof. The method comprises making one or more amino acid mutations described herein to one or more HIV-1 Env proteins such that the HIV-1 Env trimeric complex or portion thereof comprises one or more of the mutations. An antibody specific for HIV- 1 Env is contacted with the HIV-1 Env trimeric complex or portion thereof comprising one or more of the mutations. Binding of the antibody is enhanced as compared to binding of the antibody to an HIV-1 Env trimeric complex or portion thereof that does not comprise one or more of the mutations described herein.
An embodiment provides methods for isolating antibodies that specifically bind to a HIV- 1 Env protein or fragment thereof comprising one or more of the mutations described herein or an HIV-1 trimeric complex or portion thereof comprising one or more of the mutations described herein. An effective amount of an immunogen is administered to a subject, such as a mammal and antibodies are isolated. An effective amount is an amount sufficient to elicit antibodies to the HIV-1 Env immunogen.
An embodiment provides a method of identifying antibodies that specifically bind to an HIV-1 Env protein or fragment thereof comprising one or more of the mutations described herein or an HIV-1 Env trimeric complex or fragment thereof comprising one or more of the mutations described herein. Methods comprise, for example, administering an effective amount of an immunogen to B ceils in an in vitro ceil culture system to generate antibodies that specifically bind to the HIV-1 Env protein or the HIV-1 Env trimeric complex and isolating antibodies specific for the administered complex or composition. An effective amount is an amount sufficient to generate antibodies to the HIV-1 Env immunogen.
An embodiment provides a method of making or screening for an isolated hybridoma that produces a broadly neutralizing antibody that specifically binds to an HIV-1 Env protein or fragment thereof comprising one or more of the mutations described herein or an HIV-Env trimeric complex or portion thereof comprising one or more of the mutations described herein. The method comprises immunizing a mammal with an effective amount of an immunogen as described herein and isolating splenocytes from the immunized mammal. An effective amount is an amount sufficient to elicit antibodies to the HIV-1 Env immunogen. The isolated splenocytes are fused
with an immortalized cell line to form hybridomas. Individual hybridomas are screened for production of an antibody that specifically binds with said trimeric complex or protein thereof to isolate the hybridoma.
In all methods described above, an immunogen can be, for example, an HI -1 Env trimeric complex or portion thereof comprising one or more of the mutations described herein; an HIV-1 Env protein or fragment thereof comprising one or more mutations described herein; a nucleic acid molecule, vector, or host cell encoding or capable of expressing an HIV-1 Env protein, fragment thereof, HIV-1 Env trimeric complex or portion thereof comprising one or more of the mutations described herein.
The compositions and methods are more particularly described below and the Examples set forth herein are intended as illustrative only, as numerous modifications and variations therein will be apparent to those skilled in the art. As used in the description herein and throughout the claims that follow, the meaning of "a", "an", and "the" includes plural reference unless the context clearly dictates otherwise. The term "about" in association with a numerical value means that the value varies up or down by 5% . For example, for a value of about 100, means 95 to 1 05 (or any value between 95 and 105).
The terms used in the specification generally have their ordinary meanings in the art, within the context of the compositions and methods described herein, and in the specific context where each term is used. Some terms have been more specifically defined below to provide additional guidance to the practitioner regarding the description of the compositions and methods.
Ail patents, patent, applications, and other scientific or technical writings referred to anywhere herein are incorporated by reference herein in their entirety. The embodiments illustratively described herein suitably can be practiced in the absence of any element or elements, limitation or limitations that are not specifically disclosed herein. Thus, for example, in each instance herein any of the terms "comprising", "consisting essentially of, and "consisting of may be replaced with either of the other two terms, while retaining their ordinary meanings. The terms and expressions which have been employed are used as terms of description and not of limitation, and there is no intention that in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by embodiments, optional features, modification and variation of the concepts herein disclosed may be resorted to by those skilled in the art, and thai such modifications and variations are considered to be within the scope of this invention as defined by the description and the appended claims.
Whenever a range is given in the specification, for example, a temperature range, a time range, or a composition or concentration range, ail intermediate ranges and subranges, as well as all individual values included in the ranges given are intended to be included in the disclosure.
It will be understood that any subranges or individual values in a range or subrange that are included in the description herein can be excluded from the aspects herein.
In addition, where features or aspects of the invention are described in terms of Markush groups or other grouping of alternatives, those skilled in the art will recognize that the invention is also thereby described in terms of any individual member or subgroup of members of the Markush group or other group.
The following are provided for exemplification purposes only and are not intended to limit the scope of the invention described in broad terms above.
EXAMPLES
Example 1 : METHODS
A. Tissue Culture
A derivative of Expi293F cells was used in which CXCR4 expression was knocked out 47 ; these cells do not express CD4, CCR5, or CXCR4 receptors. Ceils were cultured in Expi293 Expression Medium (Life Technologies), 8% CO2, 37 °C, at 125 rpm, and transfected with Expifectamine (Life Technologies). Unless otherwise stated, for testing of targeted mutants, 500 ng piasmid DNA was transfected per 2 x 106 / mL of ceils, and ExpiFectamine Transfection Enhancers 1 and 2 (Life Technologies) were added 18 h later. Ceils were analyzed 24-30 h post- transfection. For transfecting libraries such that, on average, cells acquire no more than one coding sequence "7, 1 ng/ml library DNA was diluted with 1 .5 ,g/ml pCEP4-ACMV carrier DNA, and transfected using Expifectamine into CXCR4-knockout Expi293F cells at a density of 2 x 106 cells/ml. The medium was replaced 2 h post-transfection, and cells were prepared for sorting 24- 28 h post-transfection. The pCEP4-ACMV carrier piasmid was generated by digesting pCEP4 with Sail and iigating the vector backbone back together, effectively removing the CMV promoter, multiple cloning site, and SV40 polyadenylation sequence, but maintaining the EBNA1 gene and oriP replication origin.
B. BaL gp160 library generation
A synthetic, codon-optimized Env gene from the BaL HIV-1 isolate (GenBank Accession No. AAA44191 .1 ) was generated from gBiocks (integrated DNA Technologies) and cloned into the Nhel-Xhol sites of pCEP4 (Invitrogen). The gene encodes ΕηνΒ3_ residues E31 -L856 (numbering based on the HXB2 reference strain) fused to an N-terminal CDS leader peptide (sequence MPMGSLQPLATLYLLGMLVASVLA). When transfecting cells under conditions that yielded a single coding variant per cell, a pCEP4 derivative vector (pCEP4-intron) containing a strong 5' chimeric intron was used for enhanced expression. This was created by cloning the intron from piasmid pRL-SV40 (Promega) into the Kpnl-Nhel sites of pCEP4. These piasmids are deposited with Addgene.
Single site-saturation mutagenesis (SSM) libraries were generated by overlap extension PGR 76. Three separate SSM libraries were constructed focused on the Env N-terminus (a. a. 31 - 265; Library A), center (a. a. 266-529; Library B), and C-terminus (a. a. 530-856; Library C). The
PGR products were cloned by restriction enzyme digestion and ligation into the Nhei-Bgill (Library A), BamHi-Noti (Library B), and Psti-Xhol (Library G) sites of BaLgp160 inserted into the Nhel- Xhol sites of pcDNA3.1 (+) (invitrogen), with the vector Pstl and Bgili sites removed by QisikChange (Agilent) mutagenesis. Ligations were transformed into NEB 5-a electrocompetent E, coli (New England Bioiabs), and p!asmid DNA for each library was prepared using GeneJET axiprep Kit (Thermo Scientific). Following library construction in the pcDNA3,1 (+) vector, the full-length diversified BaLgp160 library inserts was subcioned into the Nhel-Xhol sites of pCEP4- intron. At all cloning steps, the number of transformants was at least an order of magnitude greater than the possible library diversity. Combined, the three BaL gp160 SSM libraries covered 16,332 out of 16,520 possible single amino acid mutations, based on a minimum frequency of 5.7 x 10"6 (corresponding to approximately 10 reads) in the deep sequenced piasmid libraries.
C. DU422 gp140 library construction
A synthetic, codon-optimized gp16Q gene from the DU422 HIV-1 isolate (GenBank Accession No. ABD83641 .1) was cloned into the Nhel-Xhol sites of pCEP4 (invitrogen). This piasmid is deposited with Addgene (# 1 QQ926). Using PCR-based assembly, the gp140 ectodomain (a. a. N31 -N677, HXB2 reference numbering) was fused to a C-terminai gly/ser-rich linker, 6his tag, and the transmembrane helix of HLA class I a chain for surface display, and inserted into the Nhel-Xhol sites of pCEP4.
Overlap extension PGR was used to create the SSM libraries 75. Three separate SSM libraries were constructed focused on the gp140DU422 N-terminus (a. a. 31 -279; NT library), center (a. a. 280-577; central library), and C-terminus (a. a. 578-677; CT library). Mutagenized PCR segments were iigated into the Nhe!-Pf!23li (NT library), Sbfi-Hindiil (central library), or Pfl23ll- Xho1 (CT library) sites of pCEP4-gp140Du422. Ligations were electroporated into NEB 5-β E. coli (New England Bioiabs), and library piasmid DNA was purified using a GeneJET Maxiprep Kit (Thermo Scientific). Based on a minimum frequency of 5 x 10~6, all possible 12,820 single amino acid substitutions were present in the three SSM libraries.
D. Sorting BaL gp160 !ibraries for binding to sCD4, VRC01 and PG16
To evolve Env variants for high binding signals to soluble CD4 (sCD4), ceils were harvested 24-26 hours following transfection with library DNA as described above. Cells were centrifuged at 500 g for 1 min at 4 °G, the pellets were washed with cold phosphate buffered saline supplemented with 0.2% BSA (PBS-BSA), and incubated on ice for 40 minutes with 200 nM SCD4-183 (domains D1 -D2). Soluble recombinant sCD4-183 was obtained through the NIH AIDS Reagent Program, Division of AIDS, NIAID, from Progenies. After incubation, cells were washed twice with cold PBS-BSA, incubated on ice for 30 minutes with FITC-conjugated anti-CD4 (clone M-T441 , Lifespan Biosciences, 1/200 dilution), washed twice, and resuspended in PBS-BSA.
To evolve the Env libraries for high binding signals to VRC01 or PG16, ceils were washed with cold PBS-BSA 24-26 hours post-transfection, incubated on ice for 40 minutes with either 5 nM VRC01 (obtained through the NIH AIDS Reagent Program from John Mascoia) 4 or 2 nM
PG16 (obtained through the NIH AIDS Reagent Program) 3S, washed twice, incubated on ice for 30 minutes with APC-conjugated anti-human IgG Fc antibody (BioLegend, clone HP6017, 1/300 dilution), washed twice more, and resuspended in PBS-BSA.
Labeled cells were sorted on a BD FACS Aria II at the Roy J. Carver Biotechnology Center. Immediately prior to sorting, 1 ug/ml propidium iodide was added to the cells, and dead ceils that were propidium iodide-positive were removed during gating. Auto-fluorescent cells in either the APC channel (after staining with FITC-conjugated anti-CD4) or FITC channel (after staining with APC-conjugated anti-igG Fc) were also removed during gating. In the sort gates for sCD4- or VRC01 -bound ceils, the highest 0.5% (Libraries A and B) and 1 .0% (Library C) of FITC- or APC-positive ceils were collected, respectively. In the sort gates for PG16-bound cells, the highest 0.6% (Libraries A and B) and 0.9% (Library C) of APC-positive cells were collected. These gated cell populations in the respective libraries had similar binding signals. Sort conditions are listed in Table 1 . Sorted ceils were collected by centrifugation (400 g, 3 min, 4 °C) and frozen at -80 °C. To maintain cell viability and mRNA quality during the experiment, samples were sorted for a maximum of 4 hours into tubes that, had been coated overnight with fetal bovine serum. To collect greater numbers of cells than one 4-hour sort provided, libraries were prepared again and frozen sorted cell pellets from multiple days' experiments were pooled during RNA extraction. Each replicate typically required 8 hours of sorting per library.
E. FACS-based selection of the cell libraries expressing DU422 gp14Q
Recombinant sCD4-183 (provided by Progenies) and PG16 39 were obtained from the NIH
AIDS Reagent Program, Division of AIDS, NIAID. To select gp140Du422 variants based on sCD4 binding, ceils were centrifuged at 500 g, 2 min, 4 °C, 24-28 h post-transfection. Ceils were washed with cold phosphate buffered saline supplemented with 0.2% BSA (PBS-BSA), incubated on ice for 40 minutes with 10 n sCD4 in PBS-BSA, washed twice, incubated on ice for 30 minutes with fluorescein isothiocyanate (FITC)-conjugated anti-CD4 (clone M-T441 , Lifespan Biosciences, 1 /200 dilution), washed twice, and resuspended in PBS-BSA. To select gp140[)u»22 variants based on PG16 binding, transfected ceils were washed with cold PBS-BSA, incubated on ice for 40 minutes with 3 nM PG16, washed twice, incubated for 30 minutes with aliophycocyanin (APC)-conjugated anti-human IgG Fc antibody (BioLegend, clone HP6017, 1/250 dilution), washed twice more, and resuspended in PBS-BSA.
Labeled ceils were sorted on a BD FACS Aria II at the Roy J. Carver Biotechnology Center, University of Illinois. Single ceils were gated based on FSC/SSC, and dead cells that were positive for propidium iodide (added to a final concentration of 1 fig/mi) were excluded. Autofluorescent cells in the APC channel (after staining with FITC-conjugated anti-CD4) or FITC channel (after staining with APC-conjugated anti-igG Fc) were also excluded. In the final sort gates, the highest 0.3% (NT library) or 0.4% (central and CT libraries) of FITC-positive cells were collected during the sCD4 binding selections. For sorting PG16-bound ceils, the highest 0.6% of APC-positive ceils were collected. Sorted ceils were centrifuged at 400 g, 3 min, 4 °C, and pellets
were frozen at -80 °C, To maintain ceil viability and mRNA quality, samples were sorted for a maximum of 4 h into tubes thai had been coated overnight with fetal bovine serum. To collect greater numbers of cells than one sort provided (a typical replicate required 8-8 h of sort time), libraries were freshly prepared and frozen cell pellets from multiple sort runs were pooled during RNA extraction. Sorting conditions are summarized in Table 6.
F, Deep sequencing the BaL gp160 libraries
Total RNA was extracted from sorted cells using a GeneJET RNA Purification Kit (Thermo Scientific), and first strand cDNA was synthesized with high-fidelity AccuScript reverse transcriptase (Agiient Technologies) primed with oligonucleotides that annealed downstream of the diversified regions: BALgpl 60_libA_RT_rev (5'-CGTTCAGCTGAACAATGATG-3') (SEQ ID NO:4) annealing to a. a. 284-289 of Library A, BALgpl 60_libB_RT_rev (5 - TGTTGGACAATACCAGACAG-3') (SEQ ID NO:5) annealing to a. a. 545-550 of Library B, and the EBV-Reverse sequencing primer annealing to the 3'-UTR for Library C. To generate fragments for deep sequencing, the cDNA was PGR amplified in two rounds, in the first round (18 thermocycles), primer overhangs added complementary sequences to the lllumina sequencing primers, in the second round (15 thermocycles), primer overhangs added barcodes and adaptor sequences for annealing to the lllumina flow cell. Thermocycling was kept to a minimum to reduce the introduction of PGR biases and errors. Each of the gp160 libraries was amplified as three overlapping fragments to achieve full sequencing coverage. DNA was sequenced at the UiUC Roy J. Carver Biotechnology Center on an lllumina MiSeq v3 (2 x 300nt kit.) or HiSeq 2500 (2 χ 250nt kit).
G. Deep sequencing the DU422 gp140 libraries
Total RNA was extracted from sorted ceils using a GeneJET RNA Purification Kit (Thermo Scientific). For the central and CT libraries, first strand cDNA was synthesized with high-fidelity AccuScript (Agilent Technologies) primed with a gene-specific oligonucleotide and the EBV- Reverse sequencing primer (5 '-GTGGTTTGTCC AAACTC ATC-3 ' (SEQ ID NQ:6); anneals to the 3 -UTR). For the NT library, cDNA was reverse transcribed with Superscript IV Vilo Master Mix (Thermo Scientific). The cDNA was PGR amplified in two rounds to generate fragments for lllumina sequencing. In the first round (18 thermocycies), primer overhangs added complementary sequences to the lllumina sequencing primers. In the second round (9 thermocycies for the NT library, and 15 thermocycies for the central and CT libraries), primer overhangs added barcodes and adaptor sequences for annealing to the lllumina flow cell. Thermocycling was minimized to reduce PCR biases and errors. The NT and central gp140 libraries were each amplified as two overlapping fragments to achieve full sequencing coverage. DNA was sequenced at the UIUC Roy J. Carver Biotechnology Center on an lllumina HiSeq 2500 (2 x 250nt kit).
H. Deep sequencing analysis
Deep sequencing data were analyzed with Enrich 11. Log2 enrichment ratios of mutants were normalized by subtracting the enrichment of the wildtype sequence. Commands are available in the data deposition with NCBI's Gene Expression Omnibus 78 under series accession number GSE102278.
!. Directed evolution of an EnvsaL combinatorial library
The ectodomain of EnvBaL (a. a. E31 - 677) was cloned downstream of a CDS leader peptide and upstream from a gly/ser-rich linker fused to a 6his tag and the T helix of HLA class I chain for surface display. A combinatorial library, containing core mutations enriched in the sequence-activity landscape for PG16 binding, was synthesized by oiigo assembly and cloned into the Nhei-Xhoi sites of pCEP4-intron. Expi293F CXCR4-KO cells (2 χ 106 cells/mi) were transfected using Expifectamine with 1 ng/mi library DNA and 1 .5
pCEP4-AC V. Cells were harvested 24-26 h post-transfection, and stained with PG16 as described for the SSM library selection. Cells with the highest APC fluorescence signal (top 0.3%) were collected on a BD FACS Aria II sorter and frozen at -80 °C. Total RNA was extracted from the frozen cell pellet using a GeneJET RNA Purification Kit (Thermo Scientific), and first strand cDNA was synthesized with Superscript IV VILO Master Mix (Thermo Scientific) reverse transcriptase. The Env insert was PCR-ampiified from the cDNA using Phusion (Thermo Scientific), and re-cloned into pCEP4- intron for another round of enrichment. The numbers of transformants during cloning steps were orders of magnitude greater than the possible library diversity of 9,216 variants, ensuring that all possible mutant combinations in the library were adequately sampled. The library selection was repeated three times. To increase stringency, the PG16 concentration was decreased from 2 nM (sort 1 ; 21 ,500 cells collected) to 1 nM (sort 2; 39,100 cells) to Q.5 (sort 3; 31 ,600 cells). After the third round of directed evolution, plasmid DNA from individual clones was purified and tested, J. EnveaL mutants binding to antibodies
Highly enriched EnvsaL mutants identified in both replicate evolution experiments for PG16 binding were transfected into Expi293F CXCR4-knockout cells. Transfected ceils were washed with cold PBS-BSA 24 h post-transfection, incubated on ice for 40 minutes with PG16 (2 nM or 0.5 nM), washed twice, incubated on ice for 30 minutes with APC-conjugated anti-human IgG Fc antibody (BioLegend, clone HP6Q17, 1/300 dilution), washed twice and analyzed on a BD LSR II flow cytometer. For titrating different antibodies, a 1 :3 serial dilution of the antibody was prepared in a 96-weli round-bottomed plate. Cells were incubated with the antibody at 4 °C on a rocker and washed in the 96-weli plate as described above. 39F 73 80 was provided by the NIH AIDS Reagent Program from Dr. James E. Robinson. 268-D IV 81 , 2442 82 and 3074 were provided by Dr. Susan Zolla-Pazner through the NIH AIDS Reagent Program.
. EnveaL giycosyiation site mutants binding to sCD4 and VRC01
Transfected ΕηνΒ8ι. (WT, N262Q, S264T, and S264A) ceils were washed with cold PBS- BSA 24 h post-transfection. 1 :3 Serial dilutions of sCD4 and VRC01 in PBS-BSA were prepared
in 96-well round-bottomed trays. The washed cells were incubated with the !igands at 4 °C on a rocker for 40 minutes, washed twice, incubated for 30 minutes with secondary antibody (1 /200 FITC~anti-CD4 clone -T441 from Lifespan Biosciences, or 1/300 APC-anti-igG clone HP6017 from BioLegend), washed twice, and analyzed on a BD LSR II flow cytometer.
L, EnvYU2, Env257n, EnvDU422, EnvQ769.d22 arsd ErcvQ8«,di2 binding to antibodies and sCD4 Human codon-optimized Env sequences from HIV-1 strains YU2, 2571 1 , DU422, Q769.d22 and Q842.d12 were cloned into the Nhei-Xhoi sites of pCEP4 from gBlocks (Integrated DNA Technologies). In all cases, the native signal peptides were substituted with the strong CD5 leader sequence. These plasmids are deposited with Addgene. Mutations were made by overlap extension PCR.
Expi293F CXCR4-knockout cells were transfected at a density of 2 x 10s / ml, with 1 ml of cells perweli of a 12-wei! tissue culture treated plate. Cells were transfected with Expifectamine (Life Technologies) using 1000 ng DNA per weli. Eighteen hours post-transfection ExpiFeciamine Transfection Enhancers 1 and 2 (Life Technologies) were added. Cells were harvested 42 h post- transfection, washed with cold PBS-BSA, incubated on ice for 40 minutes with PG18 at the indicated concentrations, washed twice, incubated on ice for 30 minutes with APC-ariti-human igG Fc antibody (BioLegend, clone HP6Q17, 1/300 dilution), washed twice, and analyzed on a BD LSR II flow cytometer. For titration curves with different antibodies, 1 :3 serial dilutions of the antibody were prepared and binding was assayed in 96-well round-bottomed plates. PGT121 68, PGT128 6S, and PGT145 68 were provided by IAVI through the NIH AIDS Reagent Program.
For binding assays to soluble CD4, cells were transfected as just described and collected 42 h post-transfection. Ceils were washed with cold PBS-BSA, incubated on ice for 40 minutes with 1 :3 serial dilutions of sCD4-183 prepared in 96-well round-bottomed plates, washed twice, incubated on ice for 30 minutes with FITC-anti-CD4 antibody (clone M-T441 , Lifespan Biosciences, 1/200 dilution), washed twice, and analyzed on a BD LSR II flow cytometer.
M. Structural modeling
Homology modeling of BaL Env was based on crystal structures of sequences from other HIV-1 strains, VRCOI -bound gp1 40Ba_ in the closed conformation was modeled by threading the BaL strain sequence onto PDB 5FYK 85 with giycans removed, and rebuilding missing loops and minimizing side chain conformations in Foldit 86. CD4-bound gp120Bai. was generated by threading the BaL sequence onto PDB 1 GC1 il6, and minimizing side chain and backbone conformations with Foldit. For modeling open-state gp140BaL bound to CD4, the sequence of BaL Env was threaded onto PDB 5VN3 13, which was then minimized with C3 symmetry using ROSETTA 81. The model of the PG16-bound apical epitope was generated by threading the BaL sequence onto PDB 4DQO 50. Coordinates for the glycan on N160 were kept, and a single N- acetyi-D-glucosamine sugar was added to N156. The structure in Figure 5 was generated by superimposing the model of the PG16-bound epitope to the model of closed Env.
Homology modeling of DU422 Env was based on the crystal structures of JR-FL SOSIP.684 (PDB 5FYK 85) and CD4-bound B41 SOSIP.664 (PDB 5VN3 13). Glycans were removed, the DU422 sequence was threaded on, and missing loops were rebuilt using Foldlt 86. Side chain and backbone conformations were then minimized with C3 symmetry imposed around the trimer axis using xml scripting in ROSETTA S7. Point substitutions were modeled using Foldlt with local side chain minimization. Images were rendered with the Py OL Molecular Graphics System, Schrodinger, LLC.
!SL Western blot
Cells fransfected with BaL gp160 (WT, QES01 , or QES02) were harvested , centrifuged and resuspended in reducing SDS dye. Sonicated samples were run on a 4-20% gradient polyacryiamide gel (Bio-Rad). Gels were transferred to PVDF membrane using a BioRad Mini Trans-Blot apparatus. Blots were blocked in TBST (Tris-buffered saline, 0.1 % TWEEN® polysorbate 20) containing 3% BSA, washed with TBST, stained with goat polyclonal anti-HIV gp160 (1 /500; Abeam ab1 1 7122) for 30 minutes at room temperature, washed in TBST, stained with donkey ant-goat IgG H&L alkaline phosphatase-conjugate (1 /1 000; Abeam ab971 12) for 30 minutes at room temperature, washed and visualized with Thermo Scientific 1 -Step NBT/BCIP Substrate Solution.
O. Syncytia formation assay
Expi293F CXCR4-knockout cells (2 x 106 cells / ml) were co-transfected using Expifectamine with untagged CD4 (50 ng/ml pCMV3-CD4, Sino Biological HG10400-UT) plus N- terminal myc-tagged CCR5 (450 ng/ml pCEP4~myc~CCR5), Partner ceils for fusion were transfected with 500 ng/ml of pCEP4 plasmid encoding Env. For controls, the plasmid was replaced with empty vector. Five hours post-transfecfion 0.2 χ 10s receptor- and Env-expressing ceils were mixed with 600 μΙ Expi293 Expression Medium in a poly-L-lysine-coated well of a 12- well tissue culture tray. Wells had been previously coated with 0.01 % poly-L-lysine (Sigma) for 30 minutes at room temperature, and washed with water and Expi293 Expression Medium. Plates were incubated with no agitation at 37 °C, 8% C02.
For quantitation by flow cytometry, wells were washed 20 h later with warm PBS, ceils were detached for 15 minutes at 37 °C with 0.25% trypsin-2.21 mM EDTA, washed with cold PBS-BSA, and analyzed on a BD LSR I I flow cytometer. The positive gate was set at 1 % of untransfected cells for high FSC/SSC events.
For qualitative microscopic observation, cells were stained 20 h later with 0.06 μΜ caicein-AM (BioLegend) and NucBlue Fixed Ceil Stain (Thermo Scientific) for -10 minutes. Medium was replaced, and cells were visualized on a Leica DMi8 inverted microscope, image overlays were created in Fiji imaged.
M. Protein purification and size exclusion chromatography
To express gp120 subunits, residues E31 -K510 (BaL), A31 -K510 (Q769.d22), and V31 - K510 (Q842.d12) were cloned downstream of a CDS leader peptide, and fused at their C-termini
to a linker (AGG) and 8-his tag. The EnvsaL gp140 construct encoded the soluble extracellular region upstream of the PER (residues E31 -D664) with a CDS leader peptide, and fused at the C-terminus to a linker (GSGSGGSG) (SEQ ID NO:3) and 8-his tag. These coding sequences were cloned into the Nhei-Xhol sites of pcDNA3.1 (+) (Invitrogen).
Plasmids were transfected into Expi293F cultures using a protocol adapted from ss. For each milliliter of culture, 1 μg DNA was mixed with 5 iQ linearized poiyethyieneimine ( W25,000; Polysciences) in 1 Q0 μΙ of OptiMEM (Gibco). The mixture was incubated for 20 minutes at room temperature, then added to the cell culture at a density of 2 x 1 Q6 / ml. Expi293 Transfection Enhancers (Life Technologies) were added 18 h post-transfection. Ceils were centrifuged (1200 x g, 15 minutes) 4 days post-transfection, and secreted protein was purified from the culture supernatant.
Protein was purified at 4 °C. The supernatant was dialyzed against 20 mM Tris pH 8.0 / 225 mM NaCi for 6-8 h, followed by dialysis overnight against 20 mM Tris pH 8.0 / 20 mM imidazole / 300 mM NaCI. Equilibrated NiNTA (50 % slurry, 500 μΙ per 40 mi culture, Thermo Scientific) was incubated with the sample for 1 h on a rocker, collected in a gravity column, and washed with 20 mi of purification buffer (20mM Tris pH 8.0 / 300 mM NaCI) containing 20 mM imidazole. Protein was eluted using a step gradient of purification buffer containing 50, 100 and 250 mM imidazole (1 mi per fraciion). The 100 and 250 mM imidazole fractions were found to contain 8-his-tagged gp120 or gp140 based on SDS-PAGE analysis, and were pooled and concentrated using a 30 kD MWCO centrifugal device (Sartorius). Samples were separated by size exclusion chromatography using a Superose 6 increase 10/300 GL column on an AKTA pure system (GE Healthcare) with PBS as the running buffer.
N. BG505 SOSIP.884 mutant screening, purification and ELISA anaiysis
A codon-optimized gene fragment of BG505 SGSIP.664 (T332N) was cloned into the Nhei-Xhol sites of pCEP4. A CD5 leader peptide was placed at the N-terminus, and the sequence was fused C-terminally via a giy/ser-rich linker to a 6his tag followed by the TM helix of HLA class I chain for tethering to the cell membrane. Mutations were made by overlap extension PGR and screened for PG16 binding in transfected Expi293F CXCR4-KO cells as described above.
For purification, BG505 SOSIP.664 (T332N) was subcloned into pCEP4 (Nhei-Xhol sites) with the C-terminal TM tether replaced by giy/ser-rich linker and Shis tag. The protein was expressed and purified as described above.
For PG18 binding analysis by ELISA, purified BG5Q5 SOSIP protein (50 μΙ per well at 2 μς/ιηΙ in PBS) was incubated for 1 h at room temperature in a copper-coated 96-well plate (Thermo Scientific). Wells were washed 6 times with PBS containing 0.2% TWEEN© polysorbate 20 (PBS-T1 ), blocked with 100 μΙ 5% skim milk in PBS-T for 30 min, and then incubated for 2 h with 50 μΙ PG16 in PBS-T1 containing 2% skim milk. Wells were washed 8 times with PBS-T1 , incubated for 1 h with peroxidase-conjugated donkey anti-human IgG-Fc (50 μΙ of a 1 :15000
dilution in PBS-T1 ; Jackson ImmunoResearch Laboratories), and washed another 6 times with PBS-T1 . For VRC01 binding analysis, BG505 SOSIP (50 μΙ per well at 2
in PBS) was incubated for 1 h at room temperature in a copper-coated 98-we!l plate. Wells were washed 6 times with PBS containing 0.00005% TWEEN® polysorbate 20 (PBS-T2), blocked with 100 μΙ 3% BSA in PBS for 15 min, and then incubated for 2 h with 50 μΙ VRCQ1 in PBS containing 1 .2% BSA. Wells were washed 6 times with PBS-T2, incubated for 1 h with peroxidase-conjugated donkey anti-human IgG-Fc (100 μΙ of a 1 :5Q00 dilution in PBS), and washed another 6 times with PBS-T2. For CD4-lgG2 binding analysis, BG505 SOSIP (50 μΙ per well at 2 μς/ιηΙ in TBS: 50 mM Tris-CI pH 7,5, 150 mM NaCI) was incubated for 1 h at room temperature in a nickel-coated 98- well plate (Thermo Scientific). Weils were washed 5 times with TBS containing 0.05% TWEEN® polysorbate 20 (TBS-T), blocked with 100 μΙ TBS-T containing 3% BSA for 30 min, and then incubated for 2 h with 50 μΙ CD4-igG2 (provided by Progenies Pharmaceuticals through the NIH AIDS Reagent Program) in TBS containing 1 .2% BSA and 0.02% TWEEN® polysorbate 20. Wells were washed 5 times with TBS-T, incubated for 1 h with peroxidase-conjugated donkey anti-human IgG-Fc (100 μΙ of a 1 :5000 dilution in TBS-T), and washed another 5 times with TBS- T. All ELISA plates were developed with 1 -Step Ultra T B-ELISA Substrate Solution (Thermo Scientific), and absorbance was measured at 830 nm.
P. Sequences
Native Env sequences with GenBank accession numbers from tested HiV-1 strains are shown below:
(SEQ ID NO:7) BaL Env (GenBank AAA44191 .1)
1 mrvteirksy qhw r giml lgilmicnae eklwvtvyyg vpvwkeattt Ifcasdrkay
61 dte hriv a" ha cvp"d.prip qevel knvte rifnmwknnm eqrnhediisl wdqs ikpc k
121 1 tpicvtl nc tdlrnatngn dtnttsssrg mvgggernknc s fni ttnirg kvqkeya 1 fy
131 kldiapidnn snnryrlisc ntsvi qacp kvs fepipih ycapagfail kckdkkfngk
2 1 gpctnvstvq cthgirpvvs tqlllngsla eee virsan fadnakviiv qlnesveinc
301 trpnnntrks ihigpgrafy ttgeiigdir qahenIs rak wndtlnkivi klreqfgnkt
361 ivfkhssggd peivths Inc ggeffyens t ql fns twnvt eesnntvenn titlpcrikq
421 iinmwqevgr amyappirgq ircssnitgl 11 rdggped nktevfrpgg gdmrdn rse
481 1 ykyk vkie plgvaptkak rrvvqrekra vgigavflgf lgaagstmga aamt11vqar
5 1 1 llsgivqqq null raieaq qhllqltvwg ikqiqarvla ve ylrdqql Igiwgcsgki
601 icttavp na swsnks Inki wdnmtwiewd reinnytsii yslieesqnq qekneqelle
661 ldkwas lwnw fditkwlwyi ki fimivggl iglrivfs l sivnrvrqgy spls fqthlp
721 s s rgpdrpgg ieeeggerdr drsgplvngf la liwvdlrs 1 fitsyhrlr dlliivmriv
ellglaggwe vlkywwnllq ywsqelknsa vsllnatava vaegtdrvie vlqravrail
8 1 hiprrirqgl erall
(SEQ ID NO:8) DU422 Env (GenBank ABD83641 .1)
1 mr rgiprnw pqwwiwgi1g fwmii icr v gn1 d1v;vtvy ygvpvwkeak ttlfcasdak
61 aydkevhnvw athacvptdp npqeivlenv tenfnmwknd rrivdqrnhedii slwdqsikpc
121 vkltplcvtl ncknvnisan anatatlns s mngeikncsf ntttelrdkk qkvyalfykp
181 d vplnggeh netgeyilin ensstitqac pkvsfdpipi hycapagyai lkcnnktfng
241 tgpcnnvstv qcthgikpvv stqillngsl aeeeiivrse n11nniktii h1nksveik
301 ctrpnnntrk svrigpgqtf yatgei igdi twnstliqvk ek1rebynkt
361 ikfepssggd levtthsfnc rgeffycdtt klfnetklfn eseyvdnkti ilpcrikqii
421 nmwqevgram yappiegni t cksnitglll twdggens te g frpgggnm kdnw se1yk
481 ykvveikpig vaρtk -:rkv vgrekravgi gavilgfiga ags trogaasi tl tvqa ql 1
541 sgivqqqsnl Iraie jqhl lqltvwgikq lqtrvlaier ylkdqqllgl wgcsgklica
601 tavpwnssws ks1adiwdn mtwmawdrei snytnti frl ledsqnqqek nekdllalds
661 wknlwnwfcli tnwlwyikif imivggligi riifgvlaiv krvrqgysp1 sfqtlipnpr
721 gpdrlgriee eggeqdkdrs irlvsgflal awddlrslcl fsyhqlrdfl ltaaraaell
781 grsslrglqr gwevlkylgn Ivqywglelk rsainlfdti aiavaegtdr iieviqricr
841 airyiptrir qgfeaall
(SEQ ID NO:9) 2571 1 Env (GenBank ABL67448.1)
i rorvkgtrksy qqwwiwav1g fwmlml cnvg ^nlwvtvyyg vpvwkeaktt 1 fcasdakgy
61 dkevhnvwat hacvptdpnp qemplenvte nInmwendmv nqmhedvisl wdes Ikpcvk
121 ltplcvtlnc tdvnknvsss dtdnyketmk erknctfnmt telrdknqkk yalfykldiv
181 pldd.ndr.asy ri incnts 11 tqacpkvs fd pipihycapa gyai Ikcknk tfngigpcnk
2 1 vstvqcthgi kpvvstqll 1 ngslaeedi i rs enitdna ktiivhlnes veivci pnn
301 ntrksirigp gqtfyatgdi vgdirqaycn isegkwnktl qrvseklaeh fpns tinfr.s
361 ssggdleict hs fr.cggeff ycntsglfng tyrnnndtksr. dtksnsssii tipcrikqii
421 nmwqevgrav yappiagnit cksnitgill t dgg geev kndtetfrpg ggnmkdnwrs
481 elykykvvei kplgvaptaa krrvverekr avglgavllg flgaagstmg aasitltvqa
541 rqllsgi qq qsnllraiea qqhmlqlt w gikqlqarvl aierylkdqq llgiwgcsgk
601 1 icttavpwn sswsnknqte iwdkmtwmqw dreisiytdt. iy 1 ledsqn qqeknekdl 1
661 eldkwqnlws fni tnwlwy irifimi vgg iigiriifav lsivnrvrqg ysplsfqtla
721 pnprgldrlg rieeeggked rnrs i rlvhg flalawddlr slclfsyhrl rdlilliara
781 vellgqrgwe alkylagivq ywgielkksa vslfdtiaia vaertdriig 1 iqgiera ic
841 niprrirqgf eaa q
(SEQ ID NO:10) Q769.d22 Env (GenBank AAM66234.1 )
1 mramgiqrnw qnlwrwg trni lgmi li cc.saagrilwvtvyy gvpvwrdaet tlfcasdaka
61 ydreahnvwa thacvptdps pqevplgnvt eefnmwknnm veqmhtdiis lwdqslqpcv
121 kltplcvtln csnsnnipsv snitddmkee iknes fnmtt elkdkkqnvy slfyrld vp
181 letktnqnss hsryrlincn tsai tqacpk vs fepipihy capagfailk cndkgf g g
241 lcknvstvqc t gi kpvvs t qlilngsiae gkvmvrseni tnnakniiiq fnns qinct
301 rpgnntrksi hlgpgkvfya tdiigdirka hcnvnrqqwn ktlqdvatql rthfrnrtii
361 fnnslggdle itthsfnerg effycntsgl fngiwngtqe partesndti tlqcrikqii
421 roswqrvgqal yappiqgeir cesnitgl.il trdggiinst eet frpgggd mrdnwrsely
481 kykvvkiepl gvaptkakrr vverekravg fgafflgflg aags tmgaas itltvqarql
541 1sgivqqqnn llraieaqqh llkltv gik qlqarvlave rylkdqqllg i gcsgkfic
601 11cvp r.ss snksqseivjd nmtwmqwdke inny~qiiyd lieesqrqqe kneqdllald
661 kwanlwn fd isn iwyikt findvggiig 1 ri afavi sv inrvrqgysp Is fqthtpnp
721 rdldrpgrie eeggeqdrdr sirlvsgfla la ddlrs lc Ifsyhrlrdf ilvaartvel
781 lghislkglr rg eglkylg nllsy grel kisainlldt iaivvae td riieigqrlc
841 raiiniprri rqgferal 1
(SEQ ID NO:1 1) Q842.d12 Env (GenBank AA 66242.1)
mramgiqmnc qnlwrwgtmi lgmii fcsav dnlwvtvyyg vpvwkeaett Ifcasdakay
61 etekhnvwat hacvptdpnp qeihlenvte efnmwknnmv eqmhtdiisl wdqs Ikpcvk
121 ltplcvtldc nnvtnng tsd mreeikr.es f nmttelrdkr qkvyslfykl di qinedqg
181 nssnnkyrli cntsai qa cpkvtfeplp ihycapagfa ilkekdeefn gigpcknvs
241 vqcthgi kpv vstqlllngs laekevkirc enttnnaktt ivqlv pvki nctrpnnntr
301 ksihigpgqa fyatgdiigd irqancnvnr tewnntlhqv veqlrkhfnk tinfanstgg
361 dleitthsfn eggeffyent tnifnstwnh asmnstesn dtiilpcrik qi inmwq vg
421 qamyappi rg vi rcesn itg iiitrdggnt nstretfrpg ggdmrdnwrs el ykykvvki
481 eplgvaptka krrvverekr avgigavfig flgaags tmg aasitltvqa rqllsgivqq
541 qsnllraiea qqhllkl vw gikqlqarvl averylkdqq llgiwgcsgk licttsvpwn
601 sswsnksqne iwdnmtw1qw dkeis ytqi iydlleesqn qqekneqdli aldkwanlwn
661 wfdisn lwy ikifimivgg liglrivfav Isvinrvrqg ysplsfqtht pnprgldrpe
721 rieeeggeqd knrsirlvsg flalawddlr slclfsyhrl rdfilivart vellghsslk
781 glrigvjeglk ylgnllsyvjg reirisatni ldtiaiviag wtdrvi eigq l craflnip
841 rrirqgfera 11
The following are HIV-1 Env sequences as shown above (SEQ ID NOs:7-1 1) but with the N-terminal signal peptides replaced with a CDS leader sequence (capitalized; P GSLQPLATLYLLG LVASVL (SEQ ID NO:12) for better expression. Experiments were performed using these constructs:
(SEQ ID O:13) CD5-BaL gp16G
MPMGSLQPLATLYLLGMLVASV]jeekl vtvyygvpvv/keatttlfcasdrkaydtevhnvwathacvptdpnpqevelknvten fnmwknnmveqmhediislwdqslkpcvkltplcvtlnctdlrnatngndtnttsssrgmvgggemkncs fnittnirgkvqkeya If kldiapictansnnryriiscntsvitqacp!vsfepipibycapagfailkckdiikfRgkgpctRvstvqcthgirpvvstql lings laeeevvirsanfadnakvi ivqlnesveinctrpnnnt rksihigpgrafyttgeiigdirqahcRIs rakwndtlnkiv iki reqfgnkti vfkhssggdpeivths fncggeffyens tqifns twnvteesnntvenntitlpcrikqiinmwqevgramyap pirgqircssnicgllltrdggpednktevfrpgggdinrdnwrselykykvvkieplgvapckakrrvvqrekravgigavflgfl gaagstmgaaamtltvqarlllsgivqqqniillraieaqqkllqltvwgikqlqarvlaverylrdqqllgi gcsgklicttavp wnaswsnks lnkiwdnmtwiewdreinnyts iiys liees qnqqekneqelleldkwas l nwfditkwlwyiki fimi ggligl rivfsvisivnrvrqgysplsfqthlpssrgpdrpggieeeggerdrdrsgplvngfial twvdi rs 1 fi fsy rlrdi 11 tvmri vel lgiaggweviky vml iqy sqeiknsavsilnatavavaegtdrvievlqravra ilhiprrirqgieral 1
(SEQ ID NO:14) CD5-DU422 gp160
MPMGSLQPLA IiYIJ..GMLVA.SVLAnldlvr^tvyygvpvwkeak t ifcasda kaydkevhnvwathaCA^tdpnpqei le v en fnnmkndinvdqnikediislHdqslkpcvkltplcvtlRcknvnisaRanatatlnssinngeikncsfRCt elrdkkqkvyalfyk pdvvplnggehnet-geyilincnss i qacpkvs fdpiplhycapagyailkcnnktfngtgpcnnvscvqcthgikpwstqll Ingslaeeeiivrsenltnniktiivhlnksveikctrpnnntrksvrigpgqtfyatgeiigdireahcnisretwns tliqvke ki rehynktikfepssggdlevtths fricrgeffycd.ttk.lfnetkl frieseyvdnktii Ipc ikqiinrnwqevgramyappieg nitcksnitgll ltwdggens tegvfrpgggnrakdnwrselykykvveikplgvaptkskrkvvgrekravglgavllgfIgaags tmgaasltltvqarqllsgivqqqsnllraieaqqhllqlcvwgikqlqtrvlaierylkdqqllglwgcsgkl icatavpwnss snkslgdiwdimt mqwdreisnytntifrlledsqnqqeknekdllalds knlwnwfditn l yikifimi ggliglrlifg vlaivkrvrqgysplsfqtllpnprgpdrlgrieeeggeqdkdrsirlvsgflalawddlrslclfsyhqlrdfiltaaraaellg rsslrglqrg evlkylgnlvqyvjglelkrsainlfdtiaiavaegtdriieviqricrairyiptrirqgfeaall
(SEQ ID NO:1 5) CD5-2571 1 gp160
MPMGSLQPLATLYLLGMLVASVLA.nlwvtvyygvpvvikeakttl fcasdakgydkevhnvwathacvptdpnpqemplenvtenfn mwendravnqmhedvisl deslkpcvkltplcvtlnctdvnknvsssdtdnyketmkerknctfnmttelrdknqkkyalfykldi vplddndnasyrlinen s titqacpkvs fdpipihycapagyailkcknktfngigpcnkvstvqcthgikpvvstqllings la eedivirseni tdnakti tvhlnesveivcirpnniitrksirigpgqtfyatgdivgdirqaycnisegkwnktlqrvseklaehf pns ti nfns s sggdiei tths fncggeffycntsgifrig'tymnndtksndtksnsssii tipcrikqi inmwqevgravyappiag nitcksnitgilltrdggrgeevkndcetfrpgggnmkdnwrselykykweikplgvaptaakrrwerekravglgavllgflg aags ragaasitlcvqarqllsgivqqqsnllraieaqqknilqltv gikqlqarvlaierylkdqqllgiwgcsgklicttavpw ns swsnknqteiwdkmtvmqwdreisnytdtiyrlledsqnqqeknekdlleldkwqnlwswfnitn lwyirifiinivggliglr iitavlsiviirvrqgysplsfqtlapnprgldrlgrieeeggkedrnrsirlvhgflalawddlrslclfsyhrlrdlilltarav ellgqrgwea ikylagivqywglelkksavs ifdtiaiavaertdri igiiqgi craicniprrirqgfeaalq
(SEQ ID NO:16) CD5-Q769.CS22 gp160
WPMGSI¾PIATLYLL<¾LVASVLAagnlwtvyygvpwrdaettlfcasdakaydreahnvwathacvptdpspqevplgnvcee fnxnwknninveqtohtdiislwdqslqpcvkltplcvtlncsnsnnipsvsnitddinkeeikncsfnmttelkdkkqnvyslfyrldv vpletkcnqnsshsryrlincntsaitqacpkvsfepipihycapagfailkcndkgfngtglcknvstvqcthglkpwstqlll ngs laegkvmvrsenitnnakniiiqfnns qinctrpgnntrks ihlgpgkvfyatdiigdirkahcnvnrqq nktlqdvatql rthfrnrtiifnns lggdleitths fncrgeffycntsgi fngivjngtqepnrtesndtitlqcrikqiinmvjqrvgqaiyappiq gei rcesnitgl ilt rdggiinsteetfrpgggdinrdn rselykykvvkiepl gvaptkakrrvverekravgfgarfigfigaa gs tnrgaasitlt qarql lsgi qqqnn.il r/aieaqqhi lkltvwgikqlqarvlaverylkdqqllgiwgcsgkfictttvpwns swsRksqseiwdRmt«∞qwdkeinRytqiiydlleesqrqqekneqdllaldkwanlvmwfdisn l yikifimivggliglria fa is inrvrqgysplsfqth pnprdldrpgrieeeggeqdrdrsirlvsgflalawddlrslclfsyhrlrdfilvaar vel lghislkglrrgweglkylgnllsy grelkisainlldtiaivvaewtdriieigqrlcraiiniprrirqgferall
(SEQ ID O:17) CD5-Q842.d12 gp16Q
MPMGSLQPLATLYLLGMLVASV^Avdnl vtvyygvpvwkeaettlfcasdakayetekhnvwathacvptdpnpqeihlenvtee fRmwkRRinveqrnhtdiis1 dqs1kpcvkltpl cvtldcnnvtnngtsdm eei knes fRmttelrdkrqkvysl fykldivqi e dqgRSSRRkyrlitcRtsaitqacpkvtfepipihycapagfailkckdeefRgigpckRvstvqcthglkpwscqlllRgslae kevki rceni tnnakti i qlvnpvkinctrpnnnt ksihigpgqafy tgdi igdirqahcnvnr tewnnt lhq veqlrkhfn kti fanstggdlei ths fncggeffycnt nlfns twnhtasmns tesndtiilpcrikqiinmwqrvgqamyappirgvirce snitgliltrdggntns tretfrpgggdmrdnwrselykykvvkieplgvaptkakrrvverekravgigavfigfIgaags tmga
asitltvqarqllsgivqqqsnllEaleaqqhllkltvwglkqlqarvlaveEylkdqqllgi gcsgklicttsvp nsswsnks qneiwdnmtwlqwdkeisRytqiiydlleesqRqqekneqUlaldkwanlwnwfdisn lwyikifiiiiivggliglEivfavlsv inEvrqgysplsfqthtpnprgldrpeEieeeggeqdkRrsirlvsgflalawddlrslclfsyhElrdfilivarcvellgkssl kglrlgweglkylgnllsywgrelrisatnlldtiai iagwtdrvieigqrlcraflniprrirqgferall
Q, Statistical Reporting
All measurements were from distinct sampies. Replicate deep mutational scans were performed independently on different transfected cultures. Central tendency, variation, sample sizes, and statistical tests are described in figure legends.
R. Data Availability
Analyzed (as an Excel spreadsheet) and raw deep sequencing data are deposited in
NCBI's Gene Expression Omnibus 78 under series accession number GSE102276. This includes commands for running Enrich scripts to replicate data analysis.
S. Plasmid Availability
Piasmids have been deposited with Addgene: www.addgene.org/Erik_Procko/
Example 2. Deep mutational scanrsmg of HlV-l eai. Env
Codon-optimized Env of the BaL isolate (a tier 1 B virus from ciade B)45 with a GD5 leader sequence for enhanced surface expression 46 bound soluble GD4 (domains D1 -D2), PG16 and VRC01 by flow cytometry when expressed on human Expi293F ceils. Previously, deep mutational scanning of HIV-1 receptors CCR5 and CXCR4 found only qualitative agreement between replicate experiments 47 , likely in pari due to under sampling the diverse mutant libraries. To increase sampling of mutations in the much larger Env protein, three separate single site- saturation mutagenesis (SSM) libraries were constructed focused on the Env N-terminus (a, a. 31 -265; numbering based on the HXB2 reference strain), center (a. a, 266-529), and C-terminus (a, a. 530-856). Combined data from separate sorting experiments of each SSM library encompass 16,332 of the possible 16,520 single amino acid substitutions.
To maintain a tight link between genotype and phenotype, the Env libraries were transfected into Expi293F ceils under conditions that yielded close to one sequence variant per ceil, achieved by diluting the piasmid-based libraries with a large excess of carrier DNA 47. However, when diluted to a single sequence variant per cell, Env expression was barely detected. it was critical that expression be increased by addition of an artificial intron in the 5' untranslated region, and cotransfection with carrier DNA hypothesized to promote extra-chromosomal replication of the episomal Env piasmids.
Expi293F cells expressing the Env SSM libraries were bound to soluble CD4, VRCQ1 , or PG16 near the apparent dissociation constants, and were screened by fluorescence-activated ceil sorting (FACS) for highest binding signal (Table 1).
Table 1. Sorting Conditions for Em¾aL Deep Mutational Scanning.
Collected Cells
Ligand Gating
Replicate 1 Replicate 2 sCD4(Dl-D2) Top 0.5% Library A ! 210.000 259,000
(200 nM) Top 0.5% Library B 233,000 101 ,000
To 1.0 % Library C 2 178,000 486,000
VRCOl Top 0.5% Library- A 95,000 162,000
(5 nM) Top 0.5% Library B 90,000 155,000
Top 1.0 % Library C 180.000 203,000
PG16 Top 0.6% Library- A 79,000 92,000
(2 nM) Top 0.6% Library B 217,000 2 ??,000
Top 0,9 % Library- C 136,000 183,000
1 Library A spans a.a. 31-265; Library B a.a, 266-529; Library C a.a. 530-856.
2 Of the three SSM libraries, Library C had the most positive cells after ligand staining, as there are few deleterious mutations in the cytosolic Env tail. Therefore to sort cells with similar binding signals, a higher percentage of Library C was gated and collected.
The enrichment or depletion of Env mutants was determined by comparing the frequencies in the naive plasmid libraries with the transcripts in the evolved populations (Figure 1). Enrichment ratios for each amino acid substitution qualitatively agreed between replicate experiments (Figure 2A-C). Env evolution experiments for GD4 binding had the lowest agreement, perhaps due to poor reproducibility when sorting on a very weak fluorescent signal compared to the antibody binding screens. Conservation scores (mean of the log2 enrichment ratios for ail substitutions at a specific position) were closely correlated between replicate experiments (Figure 2D-F). We consequently identify functional sites with tight sequence constraints from the conservation scores, and validate single mutations of interest individually. Example 3. Env sequence-activity landscapes for interacting with CD4, VRC01 and PG16
The Env sequence-activity landscapes are similar whether screened for CD4, VRC01 or PG16 binding (Figure 1); this is because features of the landscapes that impact protein folding and surface expression will be shared. The highest conservation is in regions maintaining non- covaient association between gp41 and gp120 subunits. This includes gp41 residues both within and upstream of the C-terminal heptad repeat that coil around the similarly consea¾d gp120 Island C-termini. The N-terminal sequence prior to the first variable loop (V1) that forms the gp120 inner domain is also highly consea'ed, and polar substitutions within the hydrophobic transmembrane (TM) helix are depleted. By comparison, V1 to V5 tolerate many substitutions, as do residues on both sides of the furin proteolysis site and within the gp41 fusion peptide.
Premature stop codons prior to the membrane-spanning helix (a.a. 684-705) are depleted, as expected. However, stop codons are tolerated in the cytosolic C-terminus immediately following the membrane anchor; this region contains a GYSPL motif that interacts with the AP-2 complex for clathrin-mediated endocytosis, normally maintaining low levels of surface Env expression 48·49. Premature stop codons are again depleted around the N-terminus of the Kennedy Epitope, but then become highly enriched around residues 731 -759. Env C-terminal deletions have previously been shown to increase surface expression 50, which has been appropriated for elevated Env levels in virus-like particle vaccines. This indicates that even higher
Env SLf rface expression might be achieved in virus-like particles by using alternative premature stop codons (e.g. at position 731 ) to what have already been tested (for example 51 ·52).
Stop codons are again depleted at a. a. 760-782 and 795-837, approximately corresponding to the lentivirus lytic peptide-2 (LLP-2) and LLP-3 to LLP-1 regions, respectively. Premature stop codons are weakly enriched near the very C-terminus, removing another endocytosis signal at the very end of the protein 53 that would otherwise reduce the surface expressed pool. Lysine substitutions are depleted around a. a. 832-851 in LLP-1 , in agreement with prior observations that Env expression is decreased when lysine is mutated into the arginine- rich LLP-1 region M, despite arginine and lysine sharing similar physicochemical properties. Overall, there are clearly distinct cytosoiic sequence elements that modulate surface expression, and yet there is little sequence conservation after the TM helix, suggesting regulatory cytosoiic elements lack folded structure. Disordered cytosoiic tails with embedded regulatory motifs are common amongst transmembrane proteins 55.
While the Env sequence-activity landscapes for interacting with the three protein ligands are similar when viewed globally, unique surface features are immediately apparent when the conservation scores are plotted on a model of trimeric BaL Env in the closed conformation (Figure 3A-G). in particular, different surface patches of gp120 are uniquely conserved for interacting with CD4, VRCQ1 or PG16, while the surface where gp41 -gp120 associate is conserved for all three interactions, likely for correct protein folding and surface presentation. To highlight the regions explicitly conserved for interacting with different ligands, difference plots were mapped to the structure, in which conseivation scores for interacting with one ligand are subtracted from those for interacting with a second (Figure 3D-G). The most notable differences are localized to the structurally characterized VRC01 and PG16 epitopes, the known CD4 binding site, and trimer interfaces.
Example 4. Env residues within the CD4 binding site are conserved
CD4 binds the gp120 outer domain, stabilizing structural elements in the conformational^ flexible subunit 13·56·57. The defined binding site is highly conserved in the selection for CD4 binding (Figure 3A, 3D-E and 3G), and mutation phenotypes agree with atomic modeling (Figure 4A-E). For example, Env-V430 packs within a hydrophobic pocket formed by CD4-W87 and the aliphatic chain of CD4-R84, and Env-V430 substitutions to small or aliphatic hydrophobic residues are tolerated for CD4 binding (Figure 4C). CD4-F68 is sandwiched between highly conserved Env-W427 and Env-1371 , which is primarily restricted to aliphatic hydrophobic side chains M, L, i and V (Figure 4D). The guanidinium group of CD4-R84 contacts or is in close proximity to Env- D388, P369, and N425; most acidic substitutions of these three Env residues are enriched (Figure 4A). Finally, Env-G472 and G473 lie flush against a p-sheei surface of CD4 and are highly conserved, whereas the -carbon of neighboring Env-G471 is directed to a cavity and tolerates most substitutions (Figure 4E).
Example 5. VRC01 ~Env association tolerates Env sequence diversity
VRC01 engages the CD4-binding site on the gp120 outer domain 5S, and yet this surface is distinctively not conserved in the Env sequence-activity landscape for VRC01 interaction (Figure 3B, 3D and 3F). Rather, VRCQ1 binding is resistant to most Env single amino acid substitutions within its structurally characterized interface, a result that was suggested by previous small-scale mutational analysis 2. This is an ideal property of a broadly neutralizing antibody, which limits mechanisms for viral escape. To illustrate with just one example, aromatic antibody side chains within the interface core engage Env loop residues 278-281 ; only Env-D279 in the loop, which contacts the indole NH of VRC01 -W100BHC (Kabat numbering), is moderately conserved in the selection (Figure 4F-H). Aromatic side chains with hydrogen-bonding potential may be ideally suited to interacting with diverse antigen targets 59.
Example 6. Residues at Env subisnit interfaces are under selection for PG18 binding
PG16 binds the junction between two gp120 subunits at the Env apex, possibly forming bridging contacts to giycans from each subunit and explaining the antibody's strong preference for trimeric quaternary structure 0. Crystal structures of PG16 and related bNAb PG9 bound to scaffolded V1 -V2 demonstrated extensive contacts to the giycan on Env-N160, with a smaller contact surface to the adjacent giycan on Env-N156 (alternatively N173 in other HIV-1 strains) 31'60. This correlates with mutagenesis data demonstrating greater importance of the N160 glycosylation motif 39. An unusually long PG16 HCDR3 penetrates between the giycans and forms sequence-independent β-sheet-like interactions with the V1 -V2 backbone 31 'SQ. Consistent with these prior results, most mutations of Env residues within the epitope are tolerated in the deep mutational scan for PG16 binding, with the critical exception of the conserved N180 glycosylation motif (Figures 4I, 4J).
When the Env SSM library is evolved for PG16 interactions, trimer interface residues are under selection and show moderate sequence conservation (Figure 3C, and 3E-G). This is most apparent in the difference plot between conservation scores for CD4 and PG16 binding (Figure 3E and 3G), which preferentially bind monomeric gp120 and trimeric Env, respectively. Therefore, PG16 binding could be used as a selection for evolving Env variants stabilized in a closed, trimeric conformation. However, many previously characterized mutations for stabilizing closed SOSIP irimers were notably neutral in the EnvBa.-PG16 sequence-activity landscape, including E84K 17, H66R Vl , A73E S1 10E A316W ", (Q/R/K)432P 23 , and I559P 19, with only A433P 23 being slightly enriched (however, A73E, S1 10E and A433P are depleted following the selections for CD4 binding). These mutations were identified in SOSIP constructs (primarily from the ciade A BG505 strain) using a variety of strategies, including favorable antigenic profiles, trimer stability, purification, structure, and reduced exposure of CD4i epitopes. Efforts to identify alternative conformation-stabilizing mutations based on EnvL¾L-PG16 binding complements these earlier studies, expanding conformational engineering to full-length Env from a broader range of HIV-1 strains.
Nearly a hundred mutations in the Env sequence-activity landscape for PG16 binding had log2 enrichment ratios greater than 1 .5 in both selection replicates, though it is noted that because most substitutions in the N-terminal SS library were severely depleted, neutral substitutions in V1 -V2 could be misleadingiy enriched. 42 substitutions thai were highly enriched in both replicate selection experiments (Table 2) were individually tested. The screen was biased towards residues located on subunit surfaces in areas less likely to interact with bNAbs, including trimer or gp120-gp41 interfaces, and around the furin cleavage site.
an ++++++++ s > x w tvpe n ng sgna.
Twenty mutations were validated to cause a slight to moderate increase in PG16 binding, and these are clustered at five sites (Figure 5). We refer to these as Quaternary Epitope Selected (QES) mutations, it is noteworthy that finding gain-of-function mutations is challenging, and
presuming such mutations are uncommon, one expects them to be difficult to find amongst the noise of many neutral or deleterious substitutions in a mutational scan. To emphasize this and provide context to the result that 20 out of the 42 tested mutations successfully increased PG16 binding, we also tested by targeted mutagenesis 20 representative depleted mutations from the selection experiments, and found all 20 were indeed deleterious for PG18 binding (Figure 6).
The first site of Env mutations thai enhance PG18 binding is located at the trimerization interface near the apex (Figure 5). Twelve of the 20 mutations are found here: Q1 14A, K1 17V/Y, P124D, T163D, R166E/F/L, V200E/T, R315A, and R432T, Nearly ail of these mutations reduce positive charge at. the apical trimer interface, either through substitution of a basic residue, or introduction of an acidic residue (or both). Furthermore, most substitutions of Env-K1 17, R166, and R432 are predicted to enhance PG16 binding in the sequence-activity landscapes. This unambiguously highlights that neutralization of the electropositive apical trimer interface stabilizes a conformation with increased PG16 binding signal, in this atomic model of BaL Env, this positive region extends 30 A from the apical surface down the central cavity along the C3 axis. It is likely that this electropositive region imposes a 'spring-loaded' mechanism to Env opening, with electrostatic repulsion between apical tips priming the subunits for conformational changes upon receptor binding.
The second site of Env mutations for enhanced PG18 binding is a centrally located interfacial region where residues are in contact between Env protomers, and between gp41 and gp120 subunits (Figure 5). F223Y in one Env protomer may add a hydrogen bond contact to R557 or N553 from a neighboring protomer. Likewise, T49D would add a salt-bridge contact to R557 of the neighboring protomer. R557Q reduces the desolvation penalty of burying a charged group at the interface, yet may still hydrogen bond to partners across the trimer interface. Finally L581 D would add favorable electrostatic interactions with R557 and R579 on a neighboring promoter.
The mutation I595 is found in site 3 at a trimer contact (Figure 5). I595 of one gp41 subunit occupies a hydrophobic pocket on an adjacent gp41 ; the methionine substitution may better pack in this pocket. Site 4 is proximal to the furin cleavage site (Figure 5), and includes two mutations (G514P and G516Q) that weakly increase PG18 binding for unknown reasons. Finally, mutation L683N in site 5 (Figure 5) has an unknown structural effect; residue 663 begins the membrane-proximal external region ( PER) and the structure here is poorly characterized. Example 7. Stabilizators of ars Env corrformat ors for ersharsced PG16 binding
Mutations to engineer BaL En for enhanced PG16 binding (Table 2) were combined. Multiple Env variants with similarly high PG16 binding signals were identified, often combining mutations from separate sites (mutations within a single site likely have epistatic interactions that limit their benefit when combined). Two sequences, termed BaL-QES.i01 and BaL-QES.i02 ("i" for "interfaces", where most of these mutations are localized), were chosen for further characterization. These variants combine mutations T49D;P124D;I595M and T49D;P124D;L663N, respectively. The CD4 binding potential of BaL-QES.i01 and BaL-QES.i02
is unchanged from wildtype (Figure 7D), but ihe proieins display a 1 .6-fold increase in PG16 binding at saturation (Figure 7A), with slightly tighter affinity (apparent KD values for PG16 affinity are 4 + 1 n for wildtype, 1 .2 ± 0.4 nM for BaL-QES.i01 , and 1 .4 ± 0.5 n for BaL-GES.iG2). This data is consistent with expression of diverse conformations on the cell surface, with stabilizing mutations increasing the pool of Env occupying a closed, trimeric state competent for PG16 interaction.
Env loses conformational flexibility upon proteolytic processing, increasing affinity for certain conformation-dependent antibodies, including PG16 62. Western blot shows that wildtype, QES.iOi and QES.i02 gp160SaL were all cleaved to gp120 (Figure 8A), and over-expression of furin to mitigate any differences in furin-dependent cleavage did not change the central observation that more PG16 binds to cells expressing QES mutants (Figure 8B).
Example 8. QES mutations are partiality transferable to other Ertv strains
Most of the QES mutation sites identified in BaL Env are conserved across HIV-1 strains and ciades, though in some cases other strains already carry the substituted amino acid, such as a threonine or tyrosine at positions 200 and 223. (Based on this observation, R315 of gp180BaL was substituted for glutamine, which is found at the equivalent position of Env in other HIV-1 strains, and again found PG16-binding was increased; Table 2.) A subset of the mutations in BaL Env that enhance PG16 binding was tested to determine if the mutations are effective in other HIV-1 strains. Q769.d22 and Q842.d12 are tier 2 strains from ciade A, YU-2 is a tier 2 strain from clade B, and 2571 1 and DU422 are tier 1 B and 2 strains from ciade C, respectively 5.
The mutations generally had little positive impact on PG16 binding to YU-2, 2571 1 , or DU422 Env. However, many of the QES mutations increased PG16 binding to Q769.d22 and Q842.d22 Env (Table 3), and combinations of mutations were screened for even higher PG16 binding. Q769-QES.1Q3 has three mutations (A200E;F223Y;I595M), and bound PG16 with similar affinity (apparent D of 3.7 ± 0.6 nM and 5 ± 3 nM for Q769-QES.103 and wildtype Env, respectively) but 2.7-fold higher binding at saturation (Figure 7B).
w type n ng s gna .
Q769-QES.iQ3 and wildtype Q769.d22 Env bound equivalent levels of soluble CD4 (Figure 7E). G842-GESJG4 has four mutations (P124D;F223Y;R557Q;I595 ), and again bound PG16 with similar affinity (apparent K0 of 5 ± 2 nM and 3.4 + 0.6 nM for Q842-QES.04 and wildtype Env, respectively). Q842-QES.iQ4 Env displayed greatly increased PG16 binding signal at saturation (2.4-fold; Figure 7C), though this may be explained by an increase in surface expression based on a similar 3-fold increase in soluble CD4 binding (Figure 7F). As observed for BaL Env, the variants with the highest PG16 binding signals generally combined mutations from different sites.
Neutralization of positive charge at the BaL, Q789.d22 and Q842.d12 Env apex increased presentation of the PG16 epitope, and excess positive charge v/ithin the turret may prime the closed Env trimer for opening by simple electrostatic repulsion. Instability of closed Env due to positive charge at the apex was also proposed in a recent structural study of PGT145-bound BG505 SOSIP, and it was further hypothesized that an arginine at position 315 increases the dynamics of apex opening 61. However, no correlation between the identity of residue 315 and which Env sequences can be stabilized by neutralizing apex mutations was identified.
Example 9. QES mutants are competent for cata!yziog membrane fusion
The QES mutations described thus far stabilize the closed conformation recognized by PG16 but do not diminish CD4 binding , and BaL-GES.iQ1 and QES.i02 variants still bind V3 region antibody clones 2442, 288-D IV, 39F, and 3074 similarly to vviidtype Env (Figure 9). The variants therefore still sample or can be induced into the open conformation for V3 antibody recognition and tight CD4 binding. It therefore seemed likely that the QES variants might catalyze membrane fusion similar to wildtype Env. Using flow cytometry to detect enlarged syncytia when Env-expressing and CD4/CCR5-expressing cells are co-incubated, BaL~QES,G1 and BaL- QES.02 Env were found to mediate membrane fusion at levels similar to or even greater than the wildtype protein (Figure 1 0A and 1 0B). This is despite the possibility that QES mutations may impair later steps in the fusion pathway (for example, it is predicted L663N will disrupt the gp41 post-fusion state). This is consistent with the closed state of Env being a relevant conformation for target cell interaction and infection.
Example 10. A QES mutation within the core of Env can destabilize the CD4-bound state From the deep mutational scan , mutations within the Env core to enhance PG16 binding were investigated. Mutations to 12 buried residues were incorporated into a combinatorial library of extracellular gp14GBaL fused to a non-native TM helix for surface display: this served to both increase surface expression for higher PG18 binding signals, and ensured the selection didn't simply enrich for premature stop codons in the cytoplasmic tail. The combinatorial library was sorted for binding to PG16 for three rounds, and then individual clones were screened . An alignment of 7 sequences with elevated PG16 binding highlighted mutations I 181 L, T202N, V254T and V255M (Figure 1 1 A). Further characterization of one sequence, clone-27, revealed that while PG16 binding to extracellular gp140 was increased (Figure 1 1 B), this set of mutations instead diminished PG16 binding to gp160 (Figure 1 1 C), and therefore extracellular gp140 is an imperfect replacement for studying full Env. The four consensus mutations were therefore tested individually in full-length Env; 11 8 L, V254T, and V255 increased PG16 binding , while T202N was deleterious and excluded (Table 4).
Mutation 1181 L is a subtie mutation just below the surface of the apical tip where PG16 binds (Figure 1 1 D), perhaps stabilizing local packing. V254T and V255IVS are centrally positioned in the linker connecting the inner and outer domains of gp120. V254T adds a hydrogen bond to the backbone carbonyl of L261 in strand [39 of the outer domain, while V255M increases
hydrophobic packing to aromatic residues in the inner domain (Figure 1 1 D). The cavity occupied by V255 collapses in the open conformation with insufficient space for large hydrophobics (Figure 1 1 D), and the deep mutational scan predicts this mutation decreases CD4 interactions. (V255F was similarly found to increase PG16 binding while decreasing CD4 interactions.) V255 is therefore unique amongst the QES mutations described here in thai it also destabilizes the open state.
QES mutations within the core could be broadly applied to full-length Env from strains DU422, 2571 1 , Q842.d12 and Q769,d22 (Table 4), Mutations were combined to create Env constructs BaL-QES.i01 .c01 ("c" for "core", containing 1181 L and V255 ), Q769-QES.i03,V255 , Q842-QES.i04,!181 L, 2571 1 -QES.C02 (1181 L;V254T), and DU422-QES.C03 (V181 L;V254T;V255 ), which bound up to 5-fold more PG16 at saturation when expressed on the cell surface (Figure 12A). Only variants harboring the V255IV1 mutation had reduced CD4 binding (Figure 12B), indicating that stabilization of the closed state alone is insufficient to prevent dynamic sampling or induction of the CD4-bound open state, which must instead be explicitly destabilized, in agreement, BaL-QES.i01 .c01 Env now has reduced exposure of V3 region epitopes (Figure 12C). Finally, the QES variants have increased presentation of the tertiary epitopes recognized by bNAbs PGT121 and PGT128 (Figures 13 and 14), which contact the N332 giycan supersite on the outer surface of gp120 64_67. Hence using PG16 binding as a readout for Env conformational engineering simultaneously increases presentation of other complex structural epitopes. PGT145 binding increased or decreased in different QES constructs (Figure 15), reflecting antagonism between stabilization of the PGT145-recognized closed conformation versus amino acid changes within the apical cavity that can disrupt direct antibody contacts.
The Env-QES variants mediated fusion to receptor-decorated membranes at levels similar to or greater than wildtype controls, unless the variant included the V255 substitution to destabilize the CD4-bound conformation, in which case membrane fusion was decreased (Figure 16).
Example 11. QES mutations stabilize trimeric BG505 SOSIP
Size exclusion chromatography (SEC) was used to determine whether some of the QES mutations could shift purified soluble gp14Q and gp12Q towards higher molecular weight species, but observed no decrease in elution volume compared to the wildtype proteins (Figure 17). This suggests the QES mutations alone may be insufficient for stabilizing trimers of extracellular Env fragments, and instead tested QES mutations in the BG505 SOSIP 20. Many of the QES mutations increased PG18 binding to ceils expressing BG505 SOSIP anchored to the plasma membrane via a non-native TM helix (Table 5). Mutations were combined to generate BG5Q5- QES.i03.c01 SOSIP (containing V181 L;A200E;F223Y;V255M; I595M).
While SOSIP particles are generally purified using antibodies that recognize correctly folded trimers, 8his-tagged BG505-QES.i03.cQ1 SOSIP was instead purified by nickel affinity chromatography to inspect the full cohort of protein forms. Based on SEC, the protein fraction in the trimer peak was elevated in the QES variant, and monomer/dimer forms also showed slightly reduced elution volume suggestive of increased transient associations (Figure 18A). PG16 binding to trimer fractions was slightly enhanced (Figure 18C), and VRC01 bound wildtype and QES.i03.c01 BG505 SOSIP trimers equally (Figure 18D). The apparent affinity for CD4-lgG2
was substantially reduced 5.5-fold (Figure 18E), consistent with destabilization of the CD4-bound conformation. Proteolytic processing increased from -35 % of wiidtype to -50 % of QES.i03.c01 (Figure 18B). Hence while the deep mutational scan and subsequent engineering was focused on full-length Env, the mutations described herein are also applicable to a soluble extracellular construct.
Example 12, Towards an expanded set of QES mutations
Thus far, the application of deep mutational scanning to full-length Env from the clade B BaL strain has been described to qualitatively determine the impact of nearly ail single amino acid substitutions on interactions with CD4 and the bNAbs VRCQ1 4 and PG16 39. By combining mutations (referred to as quaternary epitope stabilized or QES mutants) that enhance expression of a PG16-recognized closed trimer, Env was stabilized in a conformation/s that bound bNAbs PG16, PGT121 58, and PGT128 2s , PG16-ciass antibodies bind at the Env apex between two protomers, explaining their strong preference for dosed trimers 40. PGT121 and PGT128 recognize the N332 giycan supersite on the gp12Q outer domain 29,68; antibodies targeting this site are frequently elicited bNAbs from multiple germiine precursors, and therefore the N332 supersite may be an especially vulnerable epitope for the human antibody response to target 65 68~ 71. The majority of the QES mutations neutralized positive charge at the apical protomer interfaces, thereby reducing electrostatic repulsion between the apical tips thai contributes to dynamic instability 61. Furthermore, inclusion of a mutation (V255M) in the gp120 core to destabilize the open state reduced CD4 binding and exposure of V3 region epitopes. These mutations were effective in both full-length Env and soluble BG505 SOSiP.
It would be ideal if there existed a suite of mutations for applying broadly to any HiV-1 strain, which stabilize Env in a closed trimer for improved bNAb eiicitafion, A HIV-1 vaccine could then be rapidly modified and updated to contain stabilized Env sequences from local prevailing strains. However, the identified QES mutations in BaL Env were only partially transferable to other strains. This was especially true of QES mutations at subunit interfaces. Why is it that mutations to neutralize electropositive charge in the apical cavity of BaL or various clade A Env sequences stabilize a closed trimer, yet the equivalent mutations in Env from the clade C DU422 or 2571 1 strains do not? Are there different underlying features in primary structure that regulate the closed-to-open Env transition in different strains? To address this, sequence-activity landscapes of Env were determined from the DU422 strain for binding to CD4 and PG16.
Example 13, A deep mutational scars of DU422 gp140 for binding to CD4 and PG18.
A deep mutational scan, which involves using next generation sequencing to track the in vitro evolution or selection of a diverse library of sequence variants 34, requires a tight link between genotype and phenotype. For in vitro evolution of sequences under selection in human tissue culture, this can be accomplished by transfecting library DNA with a large excess of carrier DNA, such that a ceil typically acquires no more than one coding sequence 47.
A synthetic codon-optimized gene encoding gp160 from the DU422 strain was fused downstream of a CDS ieader sequence, and expressed from an episomal plasmid that can replicate extra-chromosomally. However, when transfected with a large excess of carrier DNA to limit the copy number of coding sequences acquired per cell, DU422 gp160 surface expression in Expi293F cells was not detected . Expression remained undetectable even when the coding sequence was downstream of an intron to promote transcript processing and nuclear export, or when gp180Du422 was cotransfected with carrier DNA designed to promote episomal plasmid replication. Since the cytoplasmic tail of gp160 features multiple motifs that regulate trafficking and endocytic turnover 50, only extracellular gp140ou422 (a. a. N31 -N677) anchored to the membrane via a flexible gly/ser-rich linker and canonical transmembrane helix was expressed. Soluble gp140 has increased conformational heterogeneity compared to full-length Env 21·72·73, and therefore interesting mutations identified by the deep mutational scan are subsequently validated in the full protein. DU422 gp140 was expressed on the cell surface at high levels based on flow cytometric analysis of PG16 and soluble CD4 (sCD4: domains D1 -D2) binding , even when diluted with excess carrier DNA during transfection .
Three SS libraries were prepared spanning gp14QDU422 residues N31 -N279 (NT library), N280-Q577 (central library), and T578-N677 (CT library). Together, the three libraries covered the full length of gp14GDu422, and encoded all 12,820 single amino acid substitutions. Expi293F ceil cultures transiently expressing each library were fluorescently labeled with sCD4 or PG16, and cells expressing gp140 sequences with the highest ligand-binding signals were collected by FACS (Table 6). Cells were incubated with concentrations of sCD4 (10 nM) and PG16 (3 nM) below their apparent dissociation constants (18 and 5 nM, respectively), ensuring that mutants with higher or lower affinity could be distinguished by fluorescence intensity. RNA was extracted from the sorted cell populations, and gene-specific fragments were amplified from cDNA and deep sequenced. The frequencies of all mutations in the sorted populations were compared to the naive libraries. Beneficial mutations increase in frequency and have positive log2 enrichment ratios, whereas deleterious mutations are depleted and have negative log2 enrichment ratios. The enrichment ratios are plotted in Figure 19, and qualitatively define the sequence-activity landscapes for gp140Du422 interacting with CD4 (Figure 1 9A) and PG16 (Figure 1 9B).
The sorting experiments were independently replicated, and the log2 enrichment ratios for all mutations within the NT and CT libraries weakly agree; neutral mutations in the correlation plots are clustered near the origin, while deleterious mutations fall in the negative quadrant (Figures 20A, 20C, 2QG, and 20I). Residue conservation scores, which are calculated by averaging the log2 enrichment ratios for ail twenty amino acids at each residue position, are tightly correlated between replicates (Figures 20D, 2QF, 20J, and 2QL) and define important functional sites with low mutational tolerance, either to maintain tight iigand interactions, fold correctly, or express on the ceil surface. Data reproducibility is very similar to previous mutational scans of transmembrane proteins in human ceils 47. However, the mutational scan across the central library is noisy with poor agreement between replicates, regardless of whether the library was sorted for sCD4 (Figure 20B) or PG16 (Figure 20H) binding signal. This was due to poor reverse transcription and PGR amplification across the central library during fragment preparation for deep sequencing, and could in future be resolved using alternative cDNA synthesis methods. Increased noise in the central library is further apparent as more extreme enrichment ratios in the sequence-activity landscapes (Figure 19). Conservation scores across the central library therefore only approximate the mutational tolerance with some uncertainty (Figures 20E and 2QK).
Example 15. The closed state of gp14QDu422 imposes tight conservation on the apical trimerization domain.
When the gp140[)u»22 sequence is under selection for sCD4 binding, diversity is tolerated in variable regions V1 to V5, and in residues downstream of hepfad repeat HR2 that begin the membrane proximal external region or MPER (Figure 19A). Strikingly, conservation extends into V1 , V2, V3 and HR1 when gp140[>u«2 is selected for PG16 interactions (Figure 19B). These regions make interprotomer contacts in trimeric Env 6-11. V1 , V2 and V3 form the apical trimerization domain, while HR1 motifs from each protomer fold into a three-helix bundle that runs along the central C3 axis. The stringent selection of residues at the trimer interface is further illustrated when conservation scores are mapped to atomic models of gp14GDu422 in the closed and open states (Figure 21). By taking the difference between the conservation scores for sCD4 and PG18 binding, residues preferentially conserved for acquiring the CD4-bound open state or PG16-bound closed state are highlighted; this analysis 'masks' or filters out residues under general conservation for folding and surface expression 47·74. Amino acids making direct atomic contacts with CD4 13·56, for example, are more conserved in the CD4 binding selections, as anticipated (Figure 21 D). PG18 primarily makes sequence-independent contacts to glycans on the upper apical surface that provide the antibody with broad strain reactivity 60, and yet gp140ou 22 residues preferentially under tight conservation for PG18 binding span almost the entire trimer interface (Figure 21 B). High conservation in the PG16-CD4 difference map continues deep within the folded core of the apical trimerization domain, dramatically emphasizing
thai the V1 , V2 and V3 regions are constrained in sequence space for adopting the trimeric PG16- recognized closed conformation.
High conservation within the trimerization domain of DU422 gp140 starkiy contrasts with BaL gp160, where PG16 binding is not only more tolerant of mutations in V1 , V2 and V3, but mutations in these regions can also enhance presentation of the PG16 quaternary epitope. This is likely due to both strain-specific sequence constraints, and differences between gp140 versus gp180. Extracellular gp140 has an unstable structure with substantial conformational diversity, and a sizeable protein fraction likely adopts non-native conformations 18·21·72-73·75. The trimeric closed state of gp140, already destabilized, may therefore be more sensitive to mutational insults than full-length gp160. That said, a defining feature of the BaL gp160 sequence-activity landscape was that neutralization of electropositive charge at the apical trimer interface stabilized the PG16-bound closed conformation. This is not the case for DU422 gp140. For example, most substitutions to basic residues K1 1 7 and R166 at the apex are generally predicted to be neutral, and (excluding the central library where data quality is poor) overall very few substitutions are predicted from the mutational scan to increase PG16 binding. This agrees with prior targeted mutagenesis, where mutations that increased PG16 recognition of BaL gp180 did not have the same effect in DU422 gp160. These strain-specific features justify the decision to deep mutationally scan DU422 Env, as a more comprehensive set of quaternary epitope stabilizing (QES) mutations to favor closed trimers can now be identified from two disparate strains (BaL and DU422), increasing the applicability of QES mutations for engineering Env from any strain of interest for vaccine incorporation.
Example 16. Mutations irs DU422 gp160 at the inner-outer domain interface cars increase expression of the PG16~recognized closed trimer.
Based on predictions from the deep mutational scan, four new QES mutations were screened and validated in full-length gp160Du«2 that show increased PG16 binding when expressed in Expi293F ceils (Figure 22A). Three of these mutations were identified from the mutational scan of the central SS library, demonstrating that even when there is high uncertainty and noise, deep mutational scanning can be an effective screen for rare gain-of-function mutations. V208M is located at the interface between the gp120 inner and outer domains, a region containing the QES mutations V254T and V255M. V2Q8 is directed in towards the inner domain and increases hydrophobic packing (Figure 22B). F382W and Y484W both increase hydrophobic packing at the inner-outer domain interface (Figure 22B). T283P is also located between the inner and outer domains, and while the mechanism by which T283P enhances PG16 binding is unclear, it may be that the hydrophobic proline disfavors open or partially open conformations where it becomes more solvent-accessible (Figure 22B). The inner-outer domain interface undergoes substantial structural rearrangement upon CD4 ligation (Figure 22B), and its stabilization may be an under-explored avenue for Env conformational engineering. Env F382
and Y484 are also universally conserved in all HIV-1 clades, raising the possibiliiy that mutations to these residLfes in particular may be broadly effective in different strains.
References
1 . erk, A. & Subramaniam, S. HIV-1 envelope glycoprotein structure. Curr. Opin. Struct, Biol. 23, 268-276 (201 3).
2. Huang, C.-C. et al. Structures of the CCR5 N terminus and of a tyrosine-sulfated
antibody with HIV-1 gp120 and CD4. Science 317, 1930-1 934 (2007).
3. Wu, L. et al, CD4-induced interaction of primary HIV-1 gp120 glycoproteins with the chemokine receptor CCR-5. Nature 384, 179-183 (1 996).
4. Liu , J., Bartesaghi, A. , Borgnia, M. J. , Sapiro, G. & Subramaniam, S. Molecular
architecture of native HIV-1 gp120 trimers. Nature 455, 109-1 13 (2008).
5. Burton, D. R . et al. A Blueprint for HIV Vaccine Discovery. Cell Host Microbe 12, 396- 407 (2012).
6. Wu, S.-R. et al. Single-particle cryoelectron microscopy analysis reveals the HIV-1 spike as a tripod structure. Proc. Natl. Acad. Sci. U.S.A. 107, 1 8844-1 8849 (2Q1 0).
7. White, T. A. et al. Molecular architectures of trimeric SIV and H IV-1 envelope
glycoproteins on intact viruses: strain-dependent variation in quaternary structure. PLoS
Pathog. 6, e1001249 (201 0).
8. Julien, J. -P. et al. Crystal structure of a soluble cleaved HIV-1 envelope trimer. Science 342, 1477-1483 (2013).
9. Lyumkis, D. et al. Cryo-EM structure of a fully glycosylated soluble cleaved HIV-1
envelope trimer. Science 342, 1484-1490 (2013).
10. Mao, Y. et al. Subunit organization of the membrane-bound HIV-1 envelope glycoprotein trimer. Nat. Struct Mol. Biol. 19, 893-899 (2Q12).
1 1 . Pancera , M. et al. Structure and immune recognition of trimeric pre-fusion H IV-1 Env.
Nature S14, 455-461 (2014).
12. Dev, J. et al. Structural basis for membrane anchoring of HIV-1 envelope spike. Science 353, 172-1 75 (2016).
13. Ozorowski, G. et al. Open and closed structures reveal ailostery and pliability in the HIV- 1 envelope spike. Nature 547, 360-363 (2017).
14. Munro, J. B. et al. Conformational dynamics of single HIV-1 envelope trimers on the surface of native virions. Science 346, 759-763 (2014).
15. McCoy, L. E. & Burton, D. R. identification and specificity of broadly neutralizing
antibodies against H IV. Immunol. Rev. 275, 1 1 -20 (2017).
16. Sanders, R. W. et al. HIV-1 VACCINES. H IV-1 neutralizing antibodies induced by native- like envelope trimers. Science 349, aac4223-aac4223 (201 5).
17. de Taeye, S. W. et al. !mmunogenicity of Stabilized HIV-1 Envelope Trimers with
Reduced Exposure of Non-neutralizing Epitopes. Cell 183, 1 702-171 5 (2015).
18. Binley, J. M. et al. A recombinant human immunodeficiency virus type 1 envelope
glycoprotein complex stabilized by an intermolecular disulfide bond between the gp120 and gp41 subunits is an antigenic mimic of the trimeric virion-associated structure. J. Virol, 74, 627-643 (2000).
19. Sanders, R. W. et al. Stabilization of the soluble, cleaved, trimeric form of the envelope glycoprotein complex of human immunodeficiency virus type 1 . J. Virol. 78, 8875-8889
(2002).
20. Sanders, R. W. et al. A next-generation cleaved, soluble HIV-1 Env trimer, BG505
SOSIP.664 gp140, expresses multiple epitopes for broadly neutralizing but not non- neutralizing antibodies. PLoS Pathog. 9, e1003618 (2013).
21 . Sanders, R. W. & Moore, J. P. Native-like Env trimers as a platform for HIV-1 vaccine design. Immunol. Rev. 275, 161 -182 (2017).
22. Kulp, D. W. et al. Structure-based design of native-like HIV-1 envelope trimers to silence non-neutralizing epitopes and eliminate CD4 binding. Nat Commun 8, 1655 (2017).
23. Kwon, Y. D. et al. Crystal structure, conformational fixation and entry-related interactions of mature ligand-free HIV-1 Env. Nat. Struct. Mol. Biol. 22, 522-531 (2015).
24. Steichen, J. M. et al. HIV Vaccine Design to Target Germline Precursors of Giyean- Dependent Broadly Neutralizing Antibodies, immunity S, 483-496 (2016).
25. Sarkar, A. et al. Structure of a cleavage-independent HIV Env recapitulates the
glycoprotein architecture of the native cleaved trimer. Nat Commun 9, 1956 (2018). 26. Georgiev, I. S. et al. Single-Chain Soluble BG5Q5.SOSIP gp140 Trimers as Structural and Antigenic Mimics of Mature Closed HIV-1 Env. J. Virol. 89, 5318-5329 (2015).
27. Sharma, S. K. et al. Cleavage-independent HIV-1 Env trimers engineered as soluble native spike mimetics for vaccine design. Cell Rep 11 , 539-550 (2015).
28. Escolano, A. et al. Sequential Immunization Elicits Broadly Neutralizing Anti-HIV-1
Antibodies in Ig Knockin Mice. Ce// 166, 1445-1458.e12 (2016).
29. Pejchai, R. et al. A potent and broad neutralizing antibody recognizes and penetrates the HiV glycan shield. Science 334, 1097-1 103 (201 1).
30. Jardine, J. et al. Rational HIV immunogen design to target specific germline B ceil
receptors. Science 340, 71 1 -716 (2013).
31 . McLeilan, J. S. et al. Structure of HIV-1 gp120 V1/V2 domain with broadly neutralizing antibody PG9. Nature 480, 336-343 (201 1 ).
32. Ofek, G. et al. Eiicitation of structure-specific antibodies by epitope scaffolds. Proc. Natl.
Acad. Sci. U.S.A. 107, 17880-17887 (2010).
33. Correia, B. E. et al. Computational design of epitope-scaffolds allows induction of
antibodies specific for a poorly immunogenic HIV vaccine epitope. Structure 1 , 1 1 16-
1 126 (2010).
34. Fowler, D. M. & Fields, S. Deep mutational scanning: a new style of protein science. Nat.
Methods 11 , 801-807 (2014).
35. Jardine, J. G. et al, HIV-1 broadly neutralizing antibody precursor B cells revealed by germline-targeting immunogen. Science 351 , 1458-1463 (2016).
36. Haddox, H. K., Dingens, A. S. & Bloom, J. D. Experimental Estimation of the Effects of All Amino-Acid Mutations to HI V's Envelope Protein on Viral Replication in Ceil Culture. PLoS Pathog. 12, e10061 14 (2016).
37. Dingens, A. S., Haddox, H. K., Overbaugh, J. & Bloom, J. D. Comprehensive Mapping of HIV-1 Escape from a Broadly Neutralizing Antibody. Cell Host Microbe 21 , 777-787. e4 (2017).
38. Kovacs, J. M. et al. Stable, uncleaved HIV-1 envelope glycoprotein gp14Q forms a tightly folded trimer with a native-like structure. Proc. Natl. Acad. Sci. U.S.A. 111 , 18542-18547
(2014).
39. Walker, L. M. et al. Broad and potent neutralizing antibodies from an African donor reveal a new HIV-1 vaccine target. Science 326, 285-289 (2009).
40. Julien, J. -P. et al. Asymmetric recognition of the HIV-1 trimer by broadly neutralizing antibody PG9. Proa Natl. Acad. Sci. U.S.A. 110, 4351-4356 (2013).
41 . Tran, E. E. H. et al. Structural mechanism of trimeric HIV-1 envelope glycoprotein
activation. PLoS Pathog. 8, e1002797 (2012).
42. Li, Y. et al. Mechanism of neutralization by the broadly neutralizing HIV-1 monoclonal antibody VRC01 . J. Virol. 85, 8954-8967 (201 1).
43. Moore, J, P., McKeating, J. A., Weiss, R. A. & Sattentau, Q. J. Dissociation of gp120 from HIV-1 virions induced by soluble CD4. Science 2SD, 1 139-1 142 (1990).
44. Wu, X. et al. Rational design of envelope identifies broadly neutralizing human
monoclonal antibodies to HIV-1 . Science 329, 856-861 (2010).
45. Seaman, M. S. et al. Tiered categorization of a diverse panel of HIV-1 Env pseudoviruses for assessment of neutralizing antibodies. J. Virol. 84, 1439-1452 (2010).
46. Haas, J., Park, E. C. & Seed, B. Codon usage limitation in the expression of HIV-1
envelope glycoprotein. Curr. Biol. 6, 315-324 (1996).
47. Heredia, J. D. et al. Mapping Interaction Sites on Human Chemokine Receptors by Deep Mutational Scanning. J. Immunol. ji1800343 (2018). doi:10.4049/jimmunol.1800343 48. Boge, M., Wyss, S., Bonifacino, J. S. & Thaii, M. A membrane-proximal tyrosine-based signal mediates internalization of the HIV-1 envelope glycoprotein via interaction with the AP-2 clathrin adaptor, J. Biol. Chem. 273, 15773-15778 (1998).
49. LaBranche, C. C. et al. A single amino acid change in the cytoplasmic domain of the simian immunodeficiency virus transmembrane molecule increases envelope
glycoprotein expression on infected cells. J. Virol. 69, 5217-5227 (1995).
50. Postler, T. S. & Desrosiers, R. C. The tale of the long tail: the cytoplasmic domain of HiV- 1 gp41 . J. Virol. 87, 2-15 (2013).
51 . Yao, Q., Kuhlmann, F. M., Eller, R., Compans, R. W. & Chen, C. Production and
characterization of simian-human immunodeficiency virus-like particles. AIDS Res. Hum.
Retroviruses 16, 227-236 (2000).
52. Crooks, E. T. et al. Vaccine-Elicited Tier 2 HIV-1 Neutralizing Antibodies Bind to
Quaternary Epitopes Involving Glycan-Deficient Patches Proximal to the CD4 Binding Site. PLoS Pathog. 11 , e1004932 (2015).
53. Byland, R., Vance, P. J., Hoxie, J. A. & Marsh, M. A conserved dileucine motif mediates clathrin and AP-2-dependent endocyiosis of the HIV-1 envelope protein. Mol. Biol. Cell 18, 414-425 (2007).
54. Kuhlmann, A.-S., Steckbeck, J. D,, Sturgeon, T. J., Craigo, J. K. & Montelaro, R. C.
Unique functional properties of conserved arginine residues in the lentivirus lytic peptide domains of the C-terminal tail of HIV-1 gp41 . J. Biol. Chem. 289, 7630-7840 (2014).
55. Minezaki, Y., Homma, K. & Nishikawa, K. Intrinsically disordered regions of human
plasma membrane proteins preferentially occur in the cytoplasmic segment, J. Mol. Biol. 368, 902-913 (2007).
56. Kwong, P. D. et al. Structure of an HI gp120 envelope glycoprotein in complex with the CD4 receptor and a neutralizing human antibody. Nature 393, 648-659 (1998).
57. Myszka, D. G. et al. Energetics of the HIV gp120-CD4 binding reaction. Proc. Natl. Aoad.
Sci. U.S.A. 97, 9026-9031 (2000).
58. Zhou, T. et al. Structural basis for broad and potent neutralization of HIV-1 by antibody VRC01 . Science 329, 81 1-817 (2010).
59. Peng, H.-P., Lee, K. H., Jian, J.-VV. & Yang, A.-S. Origins of specificity and affinity in antibody-protein interactions. Proo. Natl. Acad. Sci. U.S.A. 111 , E2656-85 (2014).
60. Pancera, M. et al. Structural basis for diverse N-giycan recognition by HIV-1 -neutralizing V1 -V2-directed antibody PG16. Nat. Struct. Mol. Biol. 20, 804-813 (2013).
61 . Lee, J. H. et ai. A Broadly Neutralizing Antibody Targets the Dynamic HIV Envelope Trimer Apex via a Long, Rigidified, and Anionic β-Hairpin Structure, immunity 48, 690-
702 (2017).
62. Haim, H., Saias, I. & Sodroski, J. Proteolytic processing of the human immunodeficiency virus envelope glycoprotein precursor decreases conformational flexibility. J. Virol. 87, 1884-1889 (2013).
63. Grupping, K. et al. MiniCD4 protein resistance mutations affect binding to the HIV-1 gp120 CD4 binding site and decrease entry efficiency. Retroviroiogy 9, 36 (2012).
64. Lee, J. H., de Val, N., Lyumkis, D. & Ward, A. B, Model Building and Refinement of a Natively Glycosylated HIV-1 Env Protein by High-Resolution Cryoelectron Microscopy. Structure 23, 1943-1951 (201 5).
65. Mouquet, H. et al. Complex-type N-glycan recognition by potent broadly neutralizing HIV antibodies. Proc. Natl. Acad. Sci. U.S.A. 109, E3288-77 (2012).
66. Garces, F. et ai. Structural evolution of giycan recognition by a family of potent HIV
antibodies. Cell 1S9, 69-79 (2014).
67. Julien, J. -P. et al. Broadly neutralizing antibody PGT121 allosterically modulates CD4
binding via recognition of the HIV-1 gp120 V3 base and multiple surrounding glycans, PLoS Pathog. 9, e1003342 (2013).
68. Walker, L. M. et ai. Broad neutralization coverage of HIV by multiple highly potent
antibodies. Nature 477, 466-470 (201 1).
69. MacLeod, D. T. et a/. Early Antibody Lineage Diversification and independent Limb
Maturation Lead to Broad HIV-1 Neutralization Targeting the Env High-Mannose Patch. immunity 44, 1215-1226 (2016).
70. Sok, D. et ai. A Prominent Site of Antibody Vulnerability on HIV Envelope incorporates a Motif Associated with CCR5 Binding and Its Camouflaging Glycans. immunity 45, 31 -45 (2016).
71 . Kong, L. et ai, Supersite of immune vulnerability on the glycosylated face of HIV-1
envelope glycoprotein gp120. Nat. Struct. Moi. Bioi. 20, 796-803 (2013).
72. Jeffs, S. A. et ai. Expression and characterisation of recombinant oiigomerie envelope glycoproteins derived from primary isolates of HIV-1 . Vaccine 22, 1032-1046 (2004). 73. Go, E. P. et ai. Native Conformation and Canonical Disulfide Bond Formation Are
Interlinked Properties of HIV-1 Env Glycoproteins. J. Viro!. 90, 2884-2894 (2015).
74. Kowalsky, C. A. et ai. Rapid Fine Conformational Epitope Mapping Using Comprehensive Mutagenesis and Deep Sequencing. J. Bioi. Chem. 290, 26457-26470 (2015).
75. Ringe, R, P. et ai. Cleavage strongly influences whether soluble HIV-1 envelope
glycoprotein trimers adopt a native-like conformation, Proc. Nati. Acad. Sci. U.S.A. 110,
18256-18261 (2013).
76. Procko, E. et ai. Computational design of a protein-based enzyme inhibitor. J. Moi. Biol.
425, 3563-3575 (2013).
77. Fowler, D. M., Araya, C. L., Gerard, W. & Fields, S. Enrich: software for analysis of
protein function by enrichment and depletion of variants. Bioinfor atics 27, 3430-3431
(201 1).
78. Edgar, R., Domrachev, M. & Lash, A. E. Gene Expression Omnibus: NCBi gene
expression and hybridization array data repository. Nucleic Acids Res. 30, 207-210 (2002).
79. Kwong, P. D. et ai. HIV-1 evades antibody-mediated neutralization through
conformational masking of receptor-binding sites. Nature 420, 678-682 (2002).
80. Pantophlet, R., Wilson, I. A. & Burton, D. R. improved design of an antigen with
enhanced specificity for the broadly HIV-neutralizing antibody b12. Protein Eng. Des. Sel. 17, 749-758 (2004).
81 . Gorny, M. K, et ai. Production of site-selected neutralizing human monoclonal antibodies against the third variable domain of the human immunodeficiency virus type 1 envelope glycoprotein. Proc. Natl. Acad. Sci. U.S.A. 88, 3238-3242 (1991 ).
82. Gorny, M. K. et ai. Human monoclonal antibodies specific for conformation-sensitive epitopes of V3 neutralize human immunodeficiency virus type 1 primary isolates from
various clades. J. Virol. 76, 9035-9045 (2002).
83. Gorny, M. K. et ai. Cross-clade neutralizing activity of human anti-V3 monoclonal
antibodies derived from the cells of individuals infected with non-B clades of human immunodeficiency virus type 1 . J. Virol. 80, 6885-6872 (2006).
84. Hioe, C. E. et al. Anii-V3 monoclonal antibodies display broad neutralizing activities
against multiple HiV-1 subtypes. PLoS ONE 5, e10254 (2Q10).
85. Stewart-Jones, G, B. E. et al. Trimeric HiV-1 -Env Structures Define Glycan Shields from Clades A, B, and G. Cell 16S, 813-826 (2016).
86. Cooper, S. et al. Predicting protein structures with a multipiayer online game. Nature 466, 756-760 (2010).
87. Leaver-Fay, A. et al. ROSETTA3: an object-oriented software suite for the simulation and design of macromolecules. Meth. Enzymol. 487, 545-574 (201 1).
88. Nguyen, T. A. et al. Functional Anatomy of the Human Microprocessor. Cell 161 , 1374- 1387 (2015).
Claims
An HIV-1 Env protein or fragment thereof comprising one or more of the amino acid mutations listed below, wherein the amino acids are numbered by HXB2 numbering:
Table 1
An HIV-1 Env protein or fragment thereof comprising one or more of the sets of amino acid mutations listed beiow, wherein the amino acids are numbered by HXB2 numbering:
Table 2
3. A trimeric complex or portion thereof comprising HIV-1 Env proteins or fragments of claim 1 or 2 in a trimeric conformation.
4. An immunogen comprising one or more of the HIV-1 En proteins or fragments thereof of claims 1 -2 or the trimeric complex or portions thereof of claim 3.
5. A method of screening a compound for binding to one or more proteins, fragments, complexes or portions thereof, wherein the one or more proteins, fragments, complexes or portions thereof are selected from those in claims 1-3 comprising: providing the one or more proteins, fragments, complexes or portions; contacting the one or more proteins, fragments, complexes or portions with the compound; and determining the ability of the compound to bind to the one or more proteins, fragments, complexes or portions.
6. The method of claim 5, wherein the one or more proteins, fragments, complexes or portions comprise 2, 5, 10, 15, or more proteins, fragments, complexes or portions selected from those in claims 1-3.
7. The method of claim 5, wherein the compound inhibits an HlV-mediated activity.
8. The method of claim 5, wherein the compound is provided in a library.
9. A library comprising two or more of the proteins, fragments, or trimeric complexes in any of claims 1-3 or.
10. A nucleic acid molecule encoding the HIV-1 Env protein or fragment thereof of claims 1-2.
11 . A vector comprising the nucleic acid molecule of claim 10.
12. A host ceil comprising the vector of claim 11.
13. A method of producing a protein comprising cuituring the host cell of claim 12 in a culture medium to produce the protein.
14. The method of claim 13, wherein the host cell is a mammalian celi having the ability to glycosylate proteins.
15. A composition comprising one or more HIV-1 Env proteins or fragments thereof of claims 1 or 2, and/or one or more HIV-1 Env trimeric complexes or portions thereof of claim 3, and a pharmaceutically acceptable carrier.
16. The composition of claim 15, further comprising an adjuvant.
17. A method for eliciting an immune response against an HIV-1 infected cell in a
subject comprising administering to the subject an amount of the trimeric complex or portion thereof of claim 3, effective to elicit the immune response in the subject.
18. A method for preventing a subject from becoming infected with HIV-1 comprising administering to the subject a prophylactically effective amount of the trimeric complex or portion thereof of claim 3 such that the subject is prevented from becoming infected with HIV-1 .
19. A method for reducing the likelihood of a subject becoming infected with HIV-1 comprising administering to the subject an amount of the trimeric complex or portion thereof of claim 3 effective to reduce the likelihood of the subject becoming infected with HIV-1 .
20. The method of claim 19, wherein the subject has been exposed to HIV-1 .
21 . A method for delaying the onset of, or slowing the rate of progression of, an HIV-1 - related disease or symptom in an Hi -1 -infected subject comprising administering to the subject an amount of the trimeric complex or portion thereof of claim 3 effective to delay the onset of, or slow the rate of progression of the HIV-1 -reiated disease or symptom in the subject.
22. The HIV-1 Env protein of claim 1 or claim 2, wherein the protein has at least one mutation shown in Tables 1 or 2 and otherwise has about 95% or more sequence identity to an HIV-1 Env protein.
23. A method of isolating antibodies that specifically bind to the HIV-1 Env protein or fragment thereof of claims 1 -2 or the trimeric complex or portion thereof of claim 3 comprising:
(a) administering an effective amount of:
(i) the trimeric complex of claim 3;
(ii) the protein of claims 1 -2;
(iii) the nucleic acid of claim 10;
(iv) the vector of claim 1 1 ;
(v) the host ceil of claim 12; or
(vi) the composition of claim 15, to a subject to generate antibodies that specifically bind to the HiV-1 Env protein or trimeric complex; and (b) isolating the antibodies.
23. A method of identifying antibodies that specifically bind to the HIV-1 Env protein or fragment thereof of claims 1 -2 or the trimeric complex or portion thereof of claim 3, comprising:
(a) administering an effective amount of an immunogen selected from:
(i) the trimeric complex of claim 3;
(ii) the protein of claims 1 -2;
(iii) the nucleic acid of claim 10;
(iv) the vector of claim 1 1 ;
(v) the host ceil of claim 12; or
(vi) the composition of claim 15
to B cells in an in vitro cell culture system to generate antibodies that specifically bind to the HiV-1 Env protein or fragment thereof or the trimeric complex or portion thereof; and
isolating antibodies specific for the administered complex or composition.
24. A method of making an isolated hybridoma thai produces a broadly neutralizing antibody that specifically binds to the HiV-1 Env protein or fragment thereof of claims 1 -2 or the trimeric complex or portion thereof of claim 3, comprising:
a) immunizing a mammal with an effective amount of:
(i) the trimeric complex of claim 3;
(ii) the protein of claims 1 -2;
(iii) the nucleic acid of claim 10;
(iv) the vector of claim 1 1 ;
(v) the host cell of claim 12; or
(vi) the composition of claim 15; and
b) isolating splenocytes from the immunized mammal;
c) fusing the isolated splenocytes with an immortalized cell line to form hybridomas; and
d) screening individual hybridomas for production of an antibody that specifically binds with the protein or fragment thereof or trimeric complex or portion thereof to isolate the hybridoma.
25. A method of producing a stable HiV-1 En trimer in a closed conformation comprising making one or more of the amino acid mutations or sets of mutations in an HiV-1 Env protein and expressing the protein, such that a stable HiV-1 Env trimer in a closed conformation is produced.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/631,275 US20200206342A1 (en) | 2017-07-18 | 2018-07-18 | Engineered variants of hiv-1 env for presentation of quartenary epitopes |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762534191P | 2017-07-18 | 2017-07-18 | |
| US62/534,191 | 2017-07-18 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019018475A1 true WO2019018475A1 (en) | 2019-01-24 |
Family
ID=65015340
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/042610 Ceased WO2019018475A1 (en) | 2017-07-18 | 2018-07-18 | Engineered variants of hiv-1 env for presentation of quarternary epitopes |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US20200206342A1 (en) |
| WO (1) | WO2019018475A1 (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11357866B2 (en) * | 2013-04-03 | 2022-06-14 | The Administrators Of The Tulane Educational Fund | Expression of HIV inhibitors by mesenchymal stem cells |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8017126B2 (en) * | 2004-08-27 | 2011-09-13 | Henry M. Jackson Foundation for the Advanvement of Military Medicine Inc. | Modified HIV-1 envelope proteins |
| US8323961B2 (en) * | 2003-09-15 | 2012-12-04 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | HIV vaccines based on adenoviral vectors encoding Env from multiple clades of HIV |
| US20140227311A1 (en) * | 2011-08-23 | 2014-08-14 | Skau Aps | Method for Removing Immunosuppressive Properties of HIV Envelope Glycoproteins |
| US20160039885A1 (en) * | 2013-04-02 | 2016-02-11 | Duke University | Recombinant production of hiv-1 envelope glycoproteins |
| US9580477B2 (en) * | 2015-03-16 | 2017-02-28 | The Catholic University Of America | Approach to produce HIV-1 GP140 envelope protein trimers |
-
2018
- 2018-07-18 US US16/631,275 patent/US20200206342A1/en not_active Abandoned
- 2018-07-18 WO PCT/US2018/042610 patent/WO2019018475A1/en not_active Ceased
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8323961B2 (en) * | 2003-09-15 | 2012-12-04 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | HIV vaccines based on adenoviral vectors encoding Env from multiple clades of HIV |
| US8017126B2 (en) * | 2004-08-27 | 2011-09-13 | Henry M. Jackson Foundation for the Advanvement of Military Medicine Inc. | Modified HIV-1 envelope proteins |
| US20140227311A1 (en) * | 2011-08-23 | 2014-08-14 | Skau Aps | Method for Removing Immunosuppressive Properties of HIV Envelope Glycoproteins |
| US20160039885A1 (en) * | 2013-04-02 | 2016-02-11 | Duke University | Recombinant production of hiv-1 envelope glycoproteins |
| US9580477B2 (en) * | 2015-03-16 | 2017-02-28 | The Catholic University Of America | Approach to produce HIV-1 GP140 envelope protein trimers |
Also Published As
| Publication number | Publication date |
|---|---|
| US20200206342A1 (en) | 2020-07-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7939083B2 (en) | Soluble, stabilized, proteolytically cleaved, trimeric HIV-1 gp140 proteins comprising modifications in the N-terminus of the gp41 ectodomain | |
| Pacheco et al. | Residues in the gp41 ectodomain regulate HIV-1 envelope glycoprotein conformational transitions induced by gp120-directed inhibitors | |
| US11814413B2 (en) | Compositions comprising modified HIV envelopes | |
| US10407470B2 (en) | Method of inducing an immune response against human immunodeficiency virus comprising administering immunogenic compositions comprising authentic trimeric HIV-1 envelope glycoproteins containing a long linker and tag | |
| Heredia et al. | Conformational engineering of HIV-1 Env based on mutational tolerance in the CD4 and PG16 bound states | |
| US12209113B2 (en) | Methods and compositions for protection against lentiviral infections | |
| US20240285790A1 (en) | Antibody-cd4 conjugates and methods of using the same | |
| US9775895B2 (en) | HIV therapeutics and methods of making and using same | |
| Malherbe et al. | Rapid induction of multifunctional antibodies in rabbits and macaques by clade C HIV-1 CAP257 envelopes circulating during epitope-specific neutralization breadth development | |
| Dawood et al. | Generation of HIV-1 potent and broad neutralizing antibodies by immunization with postfusion HR1/HR2 complex | |
| US20120225083A1 (en) | Viral polypeptides and methods | |
| US20200206342A1 (en) | Engineered variants of hiv-1 env for presentation of quartenary epitopes | |
| WO2017139392A1 (en) | Recombinant hiv-1 envelope proteins and their use | |
| Cheng | Elicitation of antibody responses against the HIV-1 gp41 Membrane Proximal External Region (MPER) | |
| US20160122395A1 (en) | Immunogenic compositions and a process for producing same | |
| Smith | Isolation and Characterisation of Novel Broadly Neutralising Antibodies from Rabbits Immunised with the HIV-1 Env/2dCD4S60CImmune Complex | |
| アラムムンタシル | Effect of HIV-1 fusion inhibitor resistant gp41 mutations on the sensitivity to neutralizing antibodies | |
| Alam | Effect of HIV-1 fusion inhibitor resistant gp41 | |
| Moodie | Sequential Adeno-Associated Virus Delivered HIV-1 Subtype C Env Glycoproteins as Novel Vaccine Immunogens | |
| Gray | Characterization of Neutralizing Antibody Epitopes on HIV-1 Subtype C Envelope Glycoproteins to Support Vaccine Design | |
| Kumar | Insights Into Hiv-1 Coreceptor Engagement And Its Contribution To Membrane Fusion | |
| Langhammer | Neutralisierende Antikörper gegen die transmembranen Hüllproteine von Retroviren | |
| Löving | Activation of retrovirus spikes for membrane fusion | |
| Mader | Anti-idiotypic antibody Ab2/3H6 | |
| Walker | Broadly Neutralizing Antibodies and Broadly Neutralizing Sera: Insights into HIV-1 Vaccine Design |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18834744 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 18834744 Country of ref document: EP Kind code of ref document: A1 |























