WO2018227168A1 - Nicotinamide adenine dinucleotide analogues - Google Patents
Nicotinamide adenine dinucleotide analogues Download PDFInfo
- Publication number
- WO2018227168A1 WO2018227168A1 PCT/US2018/036778 US2018036778W WO2018227168A1 WO 2018227168 A1 WO2018227168 A1 WO 2018227168A1 US 2018036778 W US2018036778 W US 2018036778W WO 2018227168 A1 WO2018227168 A1 WO 2018227168A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- optionally substituted
- compound
- substituted
- alkyl
- independently
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CC*(CC*)Oc1cc(*)c(C(*)OC)cc1* Chemical compound CC*(CC*)Oc1cc(*)c(C(*)OC)cc1* 0.000 description 24
- IZCTZTMFYHIGNM-PMHJDTQVSA-O C#CCO[C@H]1[C@H]([n+]2cc(C(N)=O)ccc2)O[C@H](COC(c2ccccc2)=O)[C@H]1OC(c1ccccc1)=O Chemical compound C#CCO[C@H]1[C@H]([n+]2cc(C(N)=O)ccc2)O[C@H](COC(c2ccccc2)=O)[C@H]1OC(c1ccccc1)=O IZCTZTMFYHIGNM-PMHJDTQVSA-O 0.000 description 1
- HARVSKAKYFZLTF-RWTLQYPYSA-N CC(C)(O[C@H]12)O[C@@H]1[C@@](C)(COC(c1ccccc1)=O)OC2OC(C)=O Chemical compound CC(C)(O[C@H]12)O[C@@H]1[C@@](C)(COC(c1ccccc1)=O)OC2OC(C)=O HARVSKAKYFZLTF-RWTLQYPYSA-N 0.000 description 1
- FPILHNBSXUYEMZ-XRKHFAFPSA-O CC(C)[Si+](C(C)CCC(C)[SH+]C(C)C)(OOCC1O[C@H]2OC)[O]=CC1[C@H]2O Chemical compound CC(C)[Si+](C(C)CCC(C)[SH+]C(C)C)(OOCC1O[C@H]2OC)[O]=CC1[C@H]2O FPILHNBSXUYEMZ-XRKHFAFPSA-O 0.000 description 1
- GHVXRUHIBXHDOR-VRKKQRBZSA-N CC(OC([C@@H]1OCC#C)O[C@H](COC(c2ccccc2)=O)[C@H]1OC(c1ccccc1)=O)=O Chemical compound CC(OC([C@@H]1OCC#C)O[C@H](COC(c2ccccc2)=O)[C@H]1OC(c1ccccc1)=O)=O GHVXRUHIBXHDOR-VRKKQRBZSA-N 0.000 description 1
- QORUMDGDNKDHFS-FUKBKCBYSA-N CC(OC([C@@H]1OCCCC#C)O[C@H](COC(c2ccccc2)=O)[C@H]1OC(c1ccccc1)=O)=O Chemical compound CC(OC([C@@H]1OCCCC#C)O[C@H](COC(c2ccccc2)=O)[C@H]1OC(c1ccccc1)=O)=O QORUMDGDNKDHFS-FUKBKCBYSA-N 0.000 description 1
- NALRCAPFICWVAQ-KVTDHHQDSA-N CO[C@@H]([C@@H]1O)O[C@H](CO)[C@H]1O Chemical compound CO[C@@H]([C@@H]1O)O[C@H](CO)[C@H]1O NALRCAPFICWVAQ-KVTDHHQDSA-N 0.000 description 1
- NMROJJWKPMCXDF-FNCVBFRFSA-N CO[C@@H]([C@@H]1OCC#C)O[C@H](CO)[C@H]1O Chemical compound CO[C@@H]([C@@H]1OCC#C)O[C@H](CO)[C@H]1O NMROJJWKPMCXDF-FNCVBFRFSA-N 0.000 description 1
- JEMJSFAMRFCJPZ-GLHSZLCASA-N CO[C@@H]([C@@H]1OCC#C)O[C@H](COC(c2ccccc2)=O)[C@H]1OC(c1ccccc1)=O Chemical compound CO[C@@H]([C@@H]1OCC#C)O[C@H](COC(c2ccccc2)=O)[C@H]1OC(c1ccccc1)=O JEMJSFAMRFCJPZ-GLHSZLCASA-N 0.000 description 1
- NHHMANIYTTXBSH-GWOFURMSSA-N CO[C@@H]([C@@H]1OCCCC#C)O[C@H](CO)[C@H]1O Chemical compound CO[C@@H]([C@@H]1OCCCC#C)O[C@H](CO)[C@H]1O NHHMANIYTTXBSH-GWOFURMSSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07F—ACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
- C07F9/00—Compounds containing elements of Groups 5 or 15 of the Periodic Table
- C07F9/02—Phosphorus compounds
- C07F9/547—Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom
- C07F9/6561—Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom containing systems of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring or ring system, with or without other non-condensed hetero rings
- C07F9/65616—Heterocyclic compounds, e.g. containing phosphorus as a ring hetero atom containing systems of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring or ring system, with or without other non-condensed hetero rings containing the ring system having three or more than three double bonds between ring members or between ring members and non-ring members, e.g. purine or analogs
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H19/00—Compounds containing a hetero ring sharing one ring hetero atom with a saccharide radical; Nucleosides; Mononucleotides; Anhydro-derivatives thereof
- C07H19/02—Compounds containing a hetero ring sharing one ring hetero atom with a saccharide radical; Nucleosides; Mononucleotides; Anhydro-derivatives thereof sharing nitrogen
- C07H19/04—Heterocyclic radicals containing only nitrogen atoms as ring hetero atom
- C07H19/16—Purine radicals
- C07H19/20—Purine radicals with the saccharide radical esterified by phosphoric or polyphosphoric acids
- C07H19/207—Purine radicals with the saccharide radical esterified by phosphoric or polyphosphoric acids the phosphoric or polyphosphoric acids being esterified by a further hydroxylic compound, e.g. flavine adenine dinucleotide or nicotinamide-adenine dinucleotide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H15/00—Compounds containing hydrocarbon or substituted hydrocarbon radicals directly attached to hetero atoms of saccharide radicals
- C07H15/02—Acyclic radicals, not substituted by cyclic structures
- C07H15/04—Acyclic radicals, not substituted by cyclic structures attached to an oxygen atom of the saccharide radical
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H15/00—Compounds containing hydrocarbon or substituted hydrocarbon radicals directly attached to hetero atoms of saccharide radicals
- C07H15/18—Acyclic radicals, substituted by carbocyclic rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H19/00—Compounds containing a hetero ring sharing one ring hetero atom with a saccharide radical; Nucleosides; Mononucleotides; Anhydro-derivatives thereof
- C07H19/02—Compounds containing a hetero ring sharing one ring hetero atom with a saccharide radical; Nucleosides; Mononucleotides; Anhydro-derivatives thereof sharing nitrogen
- C07H19/04—Heterocyclic radicals containing only nitrogen atoms as ring hetero atom
- C07H19/16—Purine radicals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H19/00—Compounds containing a hetero ring sharing one ring hetero atom with a saccharide radical; Nucleosides; Mononucleotides; Anhydro-derivatives thereof
- C07H19/02—Compounds containing a hetero ring sharing one ring hetero atom with a saccharide radical; Nucleosides; Mononucleotides; Anhydro-derivatives thereof sharing nitrogen
- C07H19/04—Heterocyclic radicals containing only nitrogen atoms as ring hetero atom
- C07H19/16—Purine radicals
- C07H19/20—Purine radicals with the saccharide radical esterified by phosphoric or polyphosphoric acids
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/573—Immunoassay; Biospecific binding assay; Materials therefor for enzymes or isoenzymes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/90—Enzymes; Proenzymes
- G01N2333/91—Transferases (2.)
- G01N2333/91091—Glycosyltransferases (2.4)
- G01N2333/91142—Pentosyltransferases (2.4.2)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2440/00—Post-translational modifications [PTMs] in chemical analysis of biological material
- G01N2440/40—Post-translational modifications [PTMs] in chemical analysis of biological material addition of nucleotides or derivatives, e.g. adenylation, flavin attachment
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2458/00—Labels used in chemical analysis of biological material
Definitions
- PTMs protein post-translational modifications
- ARTs protein ADP-ribosylation catalyzed by a superfamily of enzymes named ADP-ribosyltransferases (ARTs) with nicotinamide adenine dinucleotide (NAD + ) as a cofactor.
- the human genome is found to encode 20 ART enzymes including intracellular poly-ADP-ribose polymerases (PARPs), sirtuins (SIRTs), and extracellular ART1-5, which possess poly- or mono-ADP-ribosylation activity.
- PARPs poly-ADP-ribose polymerases
- SIRTs sirtuins
- ART1-5 extracellular ART1-5, which possess poly- or mono-ADP-ribosylation activity.
- Protein ADP-ribosylation is shown to play vital roles in regulating genome stability, protein homeostasis, cell proliferation, differentiation, and apoptosis. Abnormally increased ARTs activities are causatively linked with various human diseases such as cancer, immune disorders, and neurodegenerative diseases. However, the cellular functions and physiological and pathophysiological roles for most PARPs have remained elusive.
- each of R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , and R 11 independently is a hydrogen, -N 3 , a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C 2 -Ci 0 alkynyl, an optionally substituted Ci-Cio alkoxy, -SR 30 , an optionally substituted C 6 -Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z;
- X 5 is -S-, -0-, or -NR 20 -; each R 20 and R 30 is independently a hydrogen or an optionally substituted Ci-Cio alkyl;
- Z is
- P is a cationic polypeptide of about 5 to 30 amino acid residues in length;
- Y is a hydrogen, an optionally substituted Ci-C 6 alkyl, an optionally substituted C 2 -C 10 alkenyl, an optionally substituted C 2 -C 10 alkynyl, an optionally substituted C 6 -Cio aryl, an optionally substituted 5-15 membered heteroaryl, or -LV 5 ;
- each of R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , and R 11 independently is a hydrogen, -N 3 , a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C 2 -Ci 0 alkynyl, an optionally substituted Ci-Cio alkoxy, -SR 30 , an optionally substituted C 6 -Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z;
- X 5 is -S-, -0-, or -NR 20 -; each R 20 and R 30 is independently a hydrogen or an optionally substituted Ci-Cio alkyl;
- Z is
- each Y is independently selected from the group consisting of:
- P is a cationic polypeptide of about 5-30 amino acid residues in length;
- L 5 is a hydrogen, an optionally substituted Ci-C 6 alkyl, or -LV 5 ;
- each R 100 is independently - ⁇ , ⁇ optionally substituted Ci-Cio alkyl group, or an optionally substituted Ci-Cio alkoxy; and Y 35 is a hydroxyl or an optionally substituted Ci-C 6 alkoxy.
- each R 1 , R 2 , R 3 , and R 4 independently is a hydrogen or an optionally substituted Ci-C 6 alkyl or Z;
- X is -S-, -0-, or -NR 20 -;
- R 20 is a hydrogen or an optionally substituted Ci-Cio alkyl;
- Z is
- P is a cationic polypeptide of about 5-30 amino acid residues
- Y is a hydrogen, an optionally substituted Ci-C 6 alkyl, an optionally substituted C 2 -C 1 0 alkenyl, an optionally substituted C 2 -Ci 0 alkynyl, an optionally substituted C 6 -Ci 0 aryl, an optionally substituted 5- 15 membered heteroaryl, or -LV 5
- each of R 1 , R 2 , R 3 , and R 4 independently is a hydrogen or an optionally substituted Ci-C 6 alkyl or Z;
- X is -S-, -0-, or -NR 20 -;
- R 20 is a hydrogen or an optionally substituted Ci-Cio alkyl;
- L 10 is a hydrogen, an optionally substituted Ci-C 6 alkyl, or -I ⁇ Y 35 ;
- each R 1 , R 2 , R 3 , and R 4 independently is a hydrogen or an optionally substituted Ci-C 6 alkyl or Z;
- X is -S-, -0-, or -NR 20 -;
- X 5 is -S-, -0-, or -NR 20 -;
- R 100 is -O ⁇ , an optionally substituted C 1 -C 10
- P is a cationic polypeptide of 9-30 amino acid residues in length; and each R and R is independently a hydrogen or an optionally substituted Ci-Cio alkyl.
- This disclosure also provides a compound of Table 1, 2, 3 or 4.
- This disclosure also provides a method of monitoring and/or tracking ADP- ribosylation in a cell or sample comprising a PARP enzyme, the method comprising contacting the cell or sample with a compound of as disclosed above under conditions that favor a PARP catalyzed reaction to produce a reaction product; labeling a PARP catalyzed reaction product; and detecting the product of the PARP catalyzed reaction, thereby monitoring and/or tracking ADP-ribosylation.
- click chemistry is used to label the reaction product.
- a method of purifying a PARP substrate protein comprising: contacting a cell or sample comprising PARP with a compound as disclosed herein under conditions that favor a PARP catalyzed reaction; labeling a PARP catalyzed reaction product with an affinity label, and purifying the product of the PARP catalyzed reaction by selecting for the affinity labeled product.
- click chemistry is used to label the reaction product.
- a method of identifying a protein as a PARP substrate comprising contacting a cell or sample comprising the PARP with a compound as disclosed herein under conditions that favor a PARP catalyzed reaction; labeling a PARP catalyzed reaction product with an affinity label; and purifying and characterizing the product of the PARP catalyzed reaction being bound to the affinity label.
- click chemistry is used to label the reaction product.
- a method of labeling a PARP substrate protein comprising contacting a cell or sample comprising PARP with a compound as disclosed herein under conditions that favor a PARP catalyzed reaction; and labeling a product of a PARP catalyzed reaction.
- click chemistry is used to label the product.
- kits comprising one or more compounds as disclosed herein and instructions for use.
- reagents for carrying out the methods as disclosed herein are further provided in the kits.
- FIG. 1 is a schematic showing novel molecular tools for studying ADP-ribosylation in live cells.
- Cell-permeable nicotinamide (Nam) riboside (NR) analogues enable in situ generation of clickable nicotinamide adenine dinucleotide (NAD + ) analogues through NR kinase (NRK) and nicotinamide mononucleotide adenylyltransferase (NMNAT).
- NAD + analogues generally recognized by native PARPs allow non-invasive tracking of cellular ADP-ribosylation.
- FIG. 2 shows a cellular imaging of ADP-ribosylation using generated NRl analogue (compound 8 in Scheme 1).
- HeLa cells were cultured in growth medium supplemented with 0.1 or 1 mM NRl for 48 hr, followed by labeling with fluorescent dye via click chemistry.
- FIGS. 3 A-3B are visualizations of cellular ADP-ribosylation through the generated NRl analogue.
- HeLa cells were cultured in growth medium supplemented with NRl at indicated concentrations for 6-12 hr in the absence or presence of topotecan and 6-(5H)- phenanthridinone, followed by labeling with fluorescent dye via click chemistry.
- FIG. 4 shows an immunoblot analysis of lysates of Expi293 cells treated with 1 mM NR, and 1 mM NRl analogue for 12 hr in the absence or presence of varied concentrations of topotecan.
- FIGS. 5A-5B illustrate the in vitro biosynthesis of NAD1 analogue by NRK1 and NMNAT1.
- FIG. 5A shows the SDS-PAGE gel of purified NRK1 and NMNAT1 from E. coli.
- FIG. 5B shows the HPLC chromatographic analysis of the time-dependent generation of NAD1 analogue catalyzed by purified NRKl and NMNAT1.
- FIGS. 6A-6B show the LC-MS analysis of NRl in the cellular extracts of Expi293 cells treated with 10 mM NRl for 10 hr.
- FIG. 6A shows the reverse-phase liquid
- FIG. 6B shows the mass spectrometry of the selected fraction for detection of cellular NRl analogue.
- FIGS. 7A-7B show the LC-MS analysis of NAD 1 in the cellular extracts of Expi293 cells treated with 10 mM NRl for 10 hr.
- FIG. 7A shows the reverse-phase liquid
- FIG. 7B shows the mass spectrometry of the selected fraction for detection of cellular NAD + 1.
- FIG. 8 shows the MS (ESI) of the reaction to synthesize NAD + 27; the units for the X- axis are: m/z, Da, and the units for the Y-axis are: intensity, cps.
- a cell includes a plurality of cells, including mixtures thereof.
- compositions and methods are intended to mean that the compounds, compositions and methods include the recited elements, but not exclude others.
- Consisting essentially of when used to define compounds, compositions and methods shall mean excluding other elements of any essential significance to the combination. Thus, a composition consisting essentially of the elements as defined herein would not exclude trace contaminants, e.g., from the isolation and purification method and pharmaceutically acceptable carriers, preservatives, and the like.
- Consisting of shall mean excluding more than trace elements of other ingredients. Embodiments defined by each of these transition terms are within the scope of this technology.
- Topotecan is a compound that induces cellular DNA damage that would activate PARP activity in the cells.
- the cells treated by the compounds of the disclosure show increased fluorescence activity in the nucleus. This demonstrates the utility of the compounds in visualizing the cellular ADP-ribosylation catalyzed by PARP enzymes.
- Alkyl refers to monovalent saturated aliphatic hydrocarbyl groups having from 1 to 10 carbon atoms and preferably 1 to 6 carbon atoms. This term includes, by way of example, linear and branched hydrocarbyl groups such as methyl (CH 3 -), ethyl (CH 3 CH 2 -), n-propyl (CH 3 CH 2 CH 2 -), isopropyl ((CH 3 ) 2 CH-), n-butyl (CH 3 CH 2 CH 2 CH 2 -), isobutyl
- Alkynyl refers to straight or branched monovalent hydrocarbyl groups having from 2 to 6 carbon atoms and preferably 2 to 3 carbon atoms and having at least 1 and preferably from 1 to 2 sites of acetylenic (-C ⁇ C-) unsaturation.
- alkynyl groups include acetylenyl (-C ⁇ CH), and propargyl (-CH 2 C ⁇ CH).
- Substituted alkyl refers to an alkyl group having from 1 to 5, preferably 1 to 3, or more preferably 1 to 2 substituents selected from the group consisting of alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl,
- aminothiocarbonyl aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl, carboxyl ester, (carboxyl ester)amino, (carboxyl ester)oxy, cyano, cycloalkyl, substituted cycloalkyl, cycloalkyloxy, substituted cycloalkyloxy, cycloalkylthio, substituted cycloalkylthio, cycloalkenyl, substituted cycloalkenyl, cycloalkenyloxy, substituted cycloalkenyloxy, cycloalkenylthio, substituted cycloalkenylthio, guanidino, substituted
- heterocyclyloxy heterocyclylthio, substituted heterocyclylthio, nitro, S0 3 H, substituted sulfonyl, substituted sulfonyloxy, thioacyl, thiol, alkylthio, and substituted alkylthio, wherein said substituents are as defined herein.
- Substituted alkenyl refers to alkenyl groups having from 1 to 3 substituents, and preferably 1 to 2 substituents, selected from the group consisting of alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl,
- aminothiocarbonyl aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl, carboxyl ester, (carboxyl ester)amino, (carboxyl ester)oxy, cyano, cycloalkyl, substituted cycloalkyl, cycloalkyloxy, substituted cycloalkyloxy, cycloalkylthio, substituted cycloalkylthio, cycloalkenyl, substituted cycloalkenyl, cycloalkenyloxy, substituted cycloalkenyloxy, cycloalkenylthio, substituted cycloalkenylthio, guanidino, substituted
- Substituted alkynyl refers to alkynyl groups having from 1 to 3 substituents, and preferably 1 to 2 substituents, selected from the group consisting of alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl,
- aminothiocarbonyl aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl, carboxyl ester, (carboxyl ester)amino, (carboxyl ester)oxy, cyano, cycloalkyl, substituted cycloalkyl, cycloalkyloxy, substituted cycloalkyloxy, cycloalkylthio, substituted cycloalkylthio, cycloalkenyl, substituted cycloalkenyl, cycloalkenyloxy, substituted cycloalkenyloxy, cycloalkenylthio, substituted cycloalkenylthio, guanidino, substituted
- Alkylene refers to divalent saturated aliphatic hydrocarbyl groups preferably having from 1 to 6 and more preferably 1 to 3 carbon atoms that are either straight-chained or branched. This term is exemplified by groups such as methylene (-CH 2 -), ethylene
- alkenylene and alkynylene refer to an alkylene moiety containing respective 1 or 2 carbon carbon double bonds or a carbon carbon triple bond.
- Substituted alkylene refers to an alkylene group having from 1 to 3 hydrogens replaced with substituents selected from the group consisting of alkyl, substituted alkyl, alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminoacyl, aryl, substituted aryl, aryloxy, substituted aryloxy, cyano, halogen, hydroxyl, nitro, carboxyl, carboxyl ester, cycloalkyl, substituted cycloalkyl, heteroaryl, substituted heteroaryl, heterocyclic, substituted heterocyclic, and oxo wherein said substituents are defined herein.
- Alkoxy refers to the group -O-alkyl wherein alkyl is defined herein. Alkoxy includes, by way of example, methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, t-butoxy, sec-butoxy, and n-pentoxy.
- Substituted alkoxy refers to the group -0-(substituted alkyl) wherein substituted alkyl is defined herein.
- Acyl refers to the groups H-C(O)-, alkyl-C(O)-, substituted alkyl-C(O)-, alkenyl-C(O)-, substituted alkenyl-C(O)-, alkynyl-C(O)-, substituted alkynyl-C(O)-, cycloalkyl-C(O)-, substituted cycloalkyl-C(O)-, cycloalkenyl-C(O)-, substituted
- Acyl includes the "acetyl" group CH 3 C(0)-.
- R 47 is hydrogen or alkyl and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
- alkyloxy refers to the groups alkyl-C(0)0-, substituted alkyl-C(0)0-,
- An animal, subject or patient for diagnosis or treatment refers to an animal such as a mammal, or a human, ovine, bovine, feline, canine, equine, simian, etc.
- Non-human animals subject to diagnosis or treatment include, for example, simians, murine, such as, rat, mice, canine, leporid, livestock, sport animals, and pets.
- Amino refers to the group -NH 2 .
- Substituted amino refers to the group -NR 48 R 49 where R 48 and R 49 are
- R 48 is hydrogen and R 49 is alkyl
- the substituted amino group is sometimes referred to herein as alkylamino.
- R 48 and R 49 are alkyl
- the substituted amino group is sometimes referred to herein as dialkylamino.
- a monosubstituted amino it is meant that either R or R is hydrogen but not both.
- a disubstituted amino it is meant that neither R 48 nor R 49 are hydrogen.
- Aminocarbonyl refers to the group -C(O) R 50 R 51 where R 50 and R 51 are
- Aminothiocarbonyl refers to the group -C(S) R 50 R 51 where R 50 and R 51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R 50 and R 51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl
- Aminocarbonylamino refers to the group -NR 47 C(O) R 50 R 51 where R 47 is hydrogen or alkyl and R 50 and R 51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic, and where R 50 and R 51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted substituted alky
- Aminothiocarbonylamino refers to the group - R 47 C(S) R 50 R 51 where R 47 is hydrogen or alkyl and R 50 and R 51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted
- cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic where R 50 and R 51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
- Aminocarbonyloxy refers to the group -O-C(O) R 50 R 51 where R 50 and R 51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R 50 and R 51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, ary
- Aminosulfonyl refers to the group -SO 2 R 50 R 51 where R 50 and R 51 are
- Aminosulfonyloxy refers to the group -O-SO 2 R 50 R 51 where R 50 and R 51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R 50 and R 51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, substituted cycloal
- Aminosulfonylamino refers to the group -NR 47 SO 2 R 50 R 51 where R 47 is hydrogen or alkyl and R 50 and R 51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R 50 and R 51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted substituted alky
- heterocyclic and substituted heterocyclic are as defined herein.
- Aryl refers to a monovalent aromatic carbocyclic group of from 6 to 14 carbon atoms having a single ring (e.g., phenyl) or multiple condensed rings (e.g., naphthyl or anthryl) which condensed rings may or may not be aromatic (e.g., 2-benzoxazolinone, 2H-l,4-benzoxazin-3(4H)-one-7-yl, and the like) provided that the point of attachment is at an aromatic carbon atom.
- Preferred aryl groups include phenyl and naphthyl.
- Substituted aryl refers to aryl groups which are substituted with 1 to 5, preferably 1 to 3, or more preferably 1 to 2 substituents selected from the group consisting of alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl, aminothiocarbonyl, aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl, carboxyl ester, (carboxyl ester)amino, (carboxyl ester)oxy, cyano,
- heterocyclyloxy heterocyclylthio, substituted heterocyclylthio, nitro, S0 3 H, substituted sulfonyl, substituted sulfonyloxy, thioacyl, thiol, alkylthio, and substituted alkylthio, wherein said substituents are as defined herein.
- Aryloxy refers to the group -O-aiyl, where aryl is as defined herein, that includes, by way of example, phenoxy and naphthoxy.
- Substituted aryloxy refers to the group -0-(substituted aryl) where substituted aryl is as defined herein.
- Arylthio refers to the group -S-aryl, where aryl is as defined herein.
- Substituted arylthio refers to the group -S-(substituted aryl), where substituted aryl is as defined herein.
- Carboxyl or “carboxy” refers to -COOH or salts thereof.
- Carboxyl ester or “carboxy ester” refers to the
- cycloalkenyl, -C(0)0-heteroaryl, -C(0)0-substituted heteroaryl, -C(0)0-heterocyclic, and -C(0)0-substituted heterocyclic wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
- heteroaryl - R 47 C(0)0-heterocyclic, and - R 47 C(0)0-substituted heterocyclic
- R ' is alkyl or hydrogen, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
- (Carboxyl ester)oxy refers to the group -0-C(0)0-alkyl, -0-C(0)0-substituted alkyl, -0-C(0)0-alkenyl, -0-C(0)0-substituted
- heteroaryl -0-C(0)0-heterocyclic, and -0-C(0)0-substituted heterocyclic wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
- a "composition” as used herein, intends an active agent, such as a compound as disclosed herein and a carrier, inert or active.
- the carrier can be, without limitation, solid such as a bead or resin, or liquid, such as phosphate buffered saline.
- Administration or treatment in “combination” refers to administering two agents such that their pharmacological effects are manifest at the same time. Combination does not require administration at the same time or substantially the same time, although combination can include such administrations.
- Cyano refers to the group -CN.
- Cycloalkyl refers to cyclic alkyl groups of from 3 to 10 carbon atoms having single or multiple cyclic rings including fused, bridged, and spiro ring systems.
- the fused ring can be an aryl ring provided that the non aryl part is joined to the rest of the molecule.
- suitable cycloalkyl groups include, for instance, adamantyl, cyclopropyl, cyclobutyl, cyclopentyl, and cyclooctyl.
- Substituted cycloalkyl and “substituted cycloalkenyl” refers to a cycloalkyl or cycloalkenyl group having from 1 to 5 or preferably 1 to 3 substituents selected from the group consisting of oxo, thioxo, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl, aminothiocarbonyl, aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl
- cycloalkylthio cycloalkenyl, substituted cycloalkenyl, cycloalkenyloxy, substituted cycloalkenyloxy, cycloalkenylthio, substituted cycloalkenylthio, guanidino, substituted guanidino, halo, hydroxy, heteroaryl, substituted heteroaryl, heteroaryloxy, substituted heteroaryloxy, heteroarylthio, substituted heteroarylthio, heterocyclic, substituted
- heterocyclic heterocyclyloxy, substituted heterocyclyloxy, heterocyclylthio, substituted heterocyclylthio, nitro, S0 3 H, substituted sulfonyl, substituted sulfonyloxy, thioacyl, thiol, alkylthio, and substituted alkylthio, wherein said substituents are as defined herein.
- Cycloalkyloxy refers to -O-cycloalkyl.
- Substituted cycloalkyloxy refers to -0-(substituted cycloalkyl).
- Cycloalkylthio refers to -S-cycloalkyl.
- Substituted cycloalkylthio refers to -S-(substituted cycloalkyl).
- Cycloalkenyloxy refers to -O-cycloalkenyl.
- Substituted cycloalkenyloxy refers to -0-(substituted cycloalkenyl).
- Cycloalkenylthio refers to -S-cycloalkenyl.
- Substituted cycloalkenylthio refers to -S-(substituted cycloalkenyl).
- Halo or "halogen” refers to fluoro, chloro, bromo and iodo.
- Heteroaryl refers to an aromatic group of from 1 to 10 carbon atoms and 1 to 4 heteroatoms selected from the group consisting of oxygen, nitrogen and sulfur within the ring.
- Such heteroaryl groups can have a single ring (e.g., pyridinyl or furyl) or multiple condensed rings (e.g., indolizinyl or benzothienyl) wherein the condensed rings may or may not be aromatic and/or contain a heteroatom provided that the point of attachment is through an atom of the aromatic heteroaryl group.
- the nitrogen and/or the sulfur ring atom(s) of the heteroaryl group are optionally oxidized to provide for the N-oxide (N ⁇ 0), sulfinyl, or sulfonyl moieties.
- N ⁇ 0 N-oxide
- sulfinyl N-oxide
- sulfonyl moieties Certain non-limiting examples include pyridinyl, pyrrolyl, indolyl, thiophenyl, oxazolyl, thizolyl, and furanyl.
- Substituted heteroaryl refers to heteroaryl groups that are substituted with from 1 to 5, preferably 1 to 3, or more preferably 1 to 2 substituents selected from the group consisting of the same group of substituents defined for substituted aryl.
- Heteroaryl oxy refers to -O-heteroaiyl.
- Substituted heteroaryl oxy refers to the group -0-(substituted heteroaryl).
- Heteroarylthio refers to the group -S -heteroaryl.
- Heterocycle or “heterocyclic” or “heterocycloalkyl” or “heterocyclyl” refers to a saturated or partially saturated, but not aromatic, group having from 1 to 10 ring carbon atoms and from 1 to 4 ring heteroatoms selected from the group consisting of nitrogen, sulfur, or oxygen. Heterocycle encompasses single ring or multiple condensed rings, including fused bridged and spiro ring systems.
- one or more the rings can be cycloalkyl, aryl, or heteroaryl provided that the point of attachment is through a non-aromatic ring.
- the nitrogen and/or sulfur atom(s) of the heterocyclic group are optionally oxidized to provide for the N-oxide, sulfinyl, or sulfonyl moieties.
- Substituted heterocyclic or “substituted heterocycloalkyl” or “substituted heterocyclyl” refers to heterocyclyl groups that are substituted with from 1 to 5 or preferably 1 to 3 of the same substituents as defined for substituted cycloalkyl.
- Heterocyclyloxy refers to the group -O-heterocycyl.
- Substituted heterocyclyloxy refers to the group -0-(substituted heterocycyl).
- Heterocyclylthio refers to the group -S-heterocycyl.
- Substituted heterocyclylthio refers to the group -S-(substituted heterocycyl).
- heterocycle and heteroaryls include, but are not limited to, azetidine, pyrrole, furan, thiophene, imidazole, pyrazole, pyridine, pyrazine, pyrimidine, pyridazine, indolizine, isoindole, indole, dihydroindole, indazole, purine, quinolizine, isoquinoline, quinoline, phthalazine, naphthylpyridine, quinoxaline, quinazoline, cinnoline, pteridine, carbazole, carboline, phenanthridine, acridine, phenanthroline, isothiazole, phenazine, isoxazole, phenoxazine, phenothiazine, imidazolidine, imidazoline, piperidine, piperazine, indoline, phthalimide, 1,2,3,4-te
- Niro refers to the group -N0 2 .
- Phenylene refers to a divalent aryl ring, where the ring contains 6 carbon atoms.
- Substituted phenylene refers to phenylenes which are substituted with 1 to 4, preferably 1 to 3, or more preferably 1 to 2 substituents selected from the group consisting of alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl, aminothiocarbonyl, aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl, carboxyl ester, (carboxyl ester)amino, (carboxyl ester)oxy, cyano,
- heterocyclyloxy heterocyclylthio, substituted heterocyclylthio, nitro, SO 3 H, substituted sulfonyl, substituted sulfonyloxy, thioacyl, thiol, alkylthio, and substituted alkylthio, wherein said substituents are as defined herein.
- Spirocycloalkyl and “spiro ring systems” refers to divalent cyclic groups from 3 to 10 carbon atoms having a cycloalkyl or heterocycloalkyl ring with a spiro union (the union formed by a single atom which is the only common member of the rings) as exemplified by the following structure:
- Substituted sulfonyl refers to the group -S0 2 -alkyl, -S0 2 -substituted
- cylcoalkyl -S0 2 -cycloalkenyl, -S0 2 -substituted cylcoalkenyl, -S0 2 -aryl, -S0 2 -substituted aryl, -S0 2 -heteroaryl, -S0 2 -substituted heteroaryl, -S0 2 -heterocyclic, -S0 2 -substituted heterocyclic, wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
- Substituted sulfonyl includes groups such as
- Substituted sulfonyloxy refers to the group -OS0 2 -alkyl, -OS0 2 -substituted alkyl, -OS0 2 -alkenyl, -OS0 2 -substituted alkenyl, -OS0 2 -cycloalkyl, -OS0 2 -substituted cylcoalkyl, -OS0 2 -cycloalkenyl, -OS0 2 -substituted cylcoalkenyl,-OS0 2 -aryl, -OS0 2 -substituted aryl, -OS0 2 -heteroaryl, -OS0 2 -substituted heteroaryl, -OS0 2 -heterocyclic, -OS0 2 -substituted heterocyclic, wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, substituted al
- Thioacyl refers to the groups H-C(S)-, alkyl-C(S)-, substituted alkyl-C(S)-, alkenyl-C(S)-, substituted alkenyl-C(S)-, alkynyl-C(S)-, substituted alkynyl-C(S)-, cycloalkyl-C(S)-, substituted cycloalkyl-C(S)-, cycloalkenyl-C(S)-, substituted
- Thiol refers to the group -SH.
- Alkylthio refers to the group -S-alkyl wherein alkyl is as defined herein.
- Substituted alkylthio refers to the group -S-(substituted alkyl) wherein substituted alkyl is as defined herein.
- Optionally substituted refers to a group selected from that group and a substituted form of that group. Substituted groups are defined herein. In one embodiment, subtituents are selected from Ci-Ci 0 or Ci-C 6 alkyl, C 2 -C 6 alkenyl, C 2 -C 6 alkynyl, C 6 -Ci 0 aryl, C 3 -C 8 cycloalkyl, C 2 -C 1 0 heterocyclyl, C 1 -C 1 0 heteroaryl, halo, -N 3 , nitro, cyano, -CO 2 H or a Ci-C 6 alkyl ester thereof.
- stereochemically pure denotes a compound which has 80% or greater by weight of the indicated stereoisomer and 20% or less by weight of other stereoisomers.
- the compound of Formula (I), (II), or (III) has 90% or greater by weight of the stated stereoisomer and 10% or less by weight of other stereoisomers.
- the compound of Formula (I), (II), or (III) has 95% or greater by weight of the stated stereoisomer and 5% or less by weight of other stereoisomers.
- the compound of formula (I), (II), or (III) has 97%) or greater by weight of the stated stereoisomer and 3% or less by weight of other stereoisomers.
- “Pharmaceutically acceptable salt” refers to salts of a compound, which salts are suitable for pharmaceutical use and are derived from a variety of organic and inorganic counter ions well known in the art and include, when the compound contains an acidic functionality, by way of example only, sodium, potassium, calcium, magnesium, ammonium, and tetraalkylammonium; and when the molecule contains a basic functionality, salts of organic or inorganic acids, such as hydrochloride, hydrobromide, tartrate, mesylate, acetate, maleate, and oxalate (see Stahl and Wermuth, eds., "Handbook of Pharmaceutically
- pharmaceutically acceptable salts are those salts that retain substantially one or more of the desired pharmacological activities of the parent compound and which are suitable for in vivo administration.
- Pharmaceutically acceptable salts include acid addition salts formed with inorganic acids or organic acids.
- Inorganic acids suitable for forming pharmaceutically acceptable acid addition salts include, by way of example and not limitation, hydrohalide acids ⁇ e.g., hydrochloric acid, hydrobromic acid, hydroiodic acid, etc.), sulfuric acid, nitric acid, phosphoric acid, and the like.
- Organic acids suitable for forming pharmaceutically acceptable acid addition salts include, by way of example and not limitation, acetic acid, trifluoroacetic acid, propionic acid, hexanoic acid, cyclopentanepropionic acid, glycolic acid, oxalic acid, pyruvic acid, lactic acid, malonic acid, succinic acid, malic acid, maleic acid, fumaric acid, tartaric acid, citric acid, palmitic acid, benzoic acid, 3-(4-hydroxybenzoyl) benzoic acid, cinnamic acid, mandelic acid, alkylsulfonic acids ⁇ e.g., methanesulfonic acid, ethanesulfonic acid, 1,2- ethane-disulfonic acid, 2-hydroxy ethanesulfonic acid, etc.), arylsulfonic acids ⁇ e.g., benzenesulfonic acid, 4-chlorobenzenesulfonic acid,
- Pharmaceutically acceptable salts also include salts formed when an acidic proton present in the parent compound is either replaced by a metal ion (e.g., an alkali metal ion, an alkaline earth metal ion, or an aluminum ion) or by an ammonium ion (e.g., an ammonium ion derived from an organic base, such as, ethanolamine, diethanolamine, triethanolamine, morpholine, piperidine, dimethylamine, diethylamine, triethylamine, and ammonia).
- a metal ion e.g., an alkali metal ion, an alkaline earth metal ion, or an aluminum ion
- an ammonium ion e.g., an ammonium ion derived from an organic base, such as, ethanolamine, diethanolamine, triethanolamine, morpholine, piperidine, dimethylamine, diethylamine, triethylamine, and ammonia.
- a solvate of a compound is a solid-form of a compound that crystallizes with less than one, one or more than one molecules of a solvent inside in the crystal lattice.
- solvents that can be used to create solvates, such as pharmaceutically acceptable solvates, include, but are not limited to, water, Ci-C 6 alcohols (such as methanol, ethanol, isopropanol, butanol, and can be optionally substituted) in general, tetrahydrofuran, acetone, ethylene glycol, propylene glycol, acetic acid, formic acid, and solvent mixtures thereof.
- Other such biocompatible solvents which may aid in making a pharmaceutically acceptable solvate are well known in the art.
- solvate can be referred to as a hydrate.
- one molecule of a compound can form a solvate with from 0.1 to 5 molecules of a solvent, such as 0.5 molecules of a solvent (hemisolvate, such as hemihydrate), one molecule of a solvent (monosolvate, such as monohydrate) and 2 molecules of a solvent (disolvate, such as dihydrate).
- an "effective amount” is an amount sufficient to effect beneficial or desired results.
- An effective amount can be administered in one or more administrations, applications or dosages and is determined by the system in which the drug or compound is delivered, e.g., an effective amount for in vitro purposes is not the same as an effective amount for in vivo purposes.
- the delivery and "effective amount" is dependent on a number of variables including the time period for which the individual dosage unit is to be used, the bioavailability of the therapeutic agent, the route of administration, etc.
- treating or “treatment” of a disease in a patient refers to (1) preventing the symptoms or disease from occurring in an animal that is predisposed or does not yet display symptoms of the disease; (2) inhibiting the disease or arresting its
- beneficial or desired results can include one or more, but are not limited to, alleviation or amelioration of one or more symptoms, diminishment of extent of a condition (including a disease), stabilized (i.e., not worsening) state of a condition (including disease), delay or slowing of condition (including disease), progression, amelioration or palliation of the condition
- polypeptide refers to cell permeable peptides that can cross the cell membrane.
- Non-limiting examples of polypeptides include cationic polypeptides having from about 3 to about 30 amino acids having 5 or more positively charged amino acids, e.g., independently one or more of arginine or lysine.
- Other examples include: NH 2 - RRRRRRRRR-COOH, NH 2 -YGRKKRRQRRR-COOH, NH 2 - TRS SRAGLQFP VGRVHRLLRK-COOH, NH 2 -
- the polypeptide is represented by the variable P.
- the polypeptide is attached to the carbonyl via its N-terminus.
- the polypeptide is a lysine and/or arginine rich polypeptide.
- the polypeptide comprises 9-30 amino acid residues.
- Other cell permeable polypeptides that can cross the cell membrane are well-known in the art.
- proteins and polypeptides as used herein are not limited to human- derived proteins but may have an amino acid sequence derived from other animals, particularly, a warm-blooded animal (e.g., rat, guinea pig, mouse, chicken, rabbit, pig, sheep, cow, monkey, etc.).
- a warm-blooded animal e.g., rat, guinea pig, mouse, chicken, rabbit, pig, sheep, cow, monkey, etc.
- PARPs Poly-(ADP-ribose) polymerases
- PARPs Poly-(ADP-ribose) polymerases
- NAD ⁇ the source of ADP-ribose
- PARPs use a catalytic triad of His-Tyr-Glu to facilitate binding of NAD and positioning of the end of the existing poly-ADP ribose chain on the target protein; the Glu facilitates catalysis and formation of a (l->2) O- glycosidic linkage between two ribose molecules.
- ADP Addenosine diphosphate ribose
- ribosyltransferase activity intends the intracellular action of the addition of one or more ADP-ribose moieties to a protein. It is a reversible post-translational modification that is involved in many cellular processes, including cell signaling, DNA repair, gene regulation and apoptosis. Improper ADP- ribosylation has been implicated in some forms of cancer.
- NAD + NAD +
- DPN+ diphosphopyridine nucleotide
- Coenzyme I Coenzyme found in all cells.
- the compound is a dinucleotide, and it consists of two nucleotides joined through their phosphate groups, groups.
- the chemical structure is provide below:
- a "signal reagent” intends an agent (chemical, biological or otherwise) that emits a detectable signal.
- ADP-ribosyltransferase inhibitor intends a molecule or an agent that inhibits the activity of ADP-ribosyltransferease.
- Poly (ADP-ribose) polymerase (PARP) is a family of proteins involved in a number of cellular processes such as DNA repair, genomic stability, and programmed cell death.
- the PARP family comprises 17 members.
- PARP is composed of four domains of interest: a DNA-binding domain, a caspase -cleaved domain, an auto-modification domain, and a catalytic domain.
- the DNA-binding domain is composed of two zinc finder motifs.
- PARP refers to all different PARP isoforms (>15) from human genome, such as PARP1, 2, 3, 4, 5A, 5B, 10, 14, 15, 16, etc.
- Under conditions that favor a PARP catalyzed reaction intends suitable temperature, salt and necessary co-factors for PARP to act on a substrate. Such conditions are known in the art, see, e.g., Jiang et al. (2010) J. Am. Chem. Soc. 132(27):9363-9372, and described herein.
- the term "detectable label” intends a directly or indirectly detectable compound or composition that is conjugated directly or indirectly to the composition to be detected, e.g., N-terminal histadine tags (N-His), magnetically active isotopes, e.g., 115 Sn, 117 Sn and 119 Sn, a non-radioactive isotopes such as 13 C and 15 N, polynucleotide or protein such as an antibody so as to generate a "labeled" composition.
- N-terminal histadine tags N-terminal histadine tags
- magnetically active isotopes e.g., 115 Sn, 117 Sn and 119 Sn
- a non-radioactive isotopes such as 13 C and 15 N
- polynucleotide or protein such as an antibody so as to generate a "labeled” composition.
- the term also includes sequences conjugated to the polynucleotide that will
- the label may be detectable by itself (e.g. radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
- the labels can be suitable for small scale detection or more suitable for high-throughput screening.
- suitable labels include, but are not limited to magnetically active isotopes, non-radioactive isotopes, radioisotopes, fluorochromes, luminescent compounds, dyes, and proteins, including enzymes.
- the label may be simply detected or it may be quantified.
- a response that is simply detected generally comprises a response whose existence merely is confirmed
- a response that is quantified generally comprises a response having a quantifiable (e.g., numerically reportable) value such as an intensity, polarization, and/or other property.
- the detectable response may be generated directly using a luminophore or fluorophore associated with an assay component actually involved in binding, or indirectly using a luminophore or fluorophore associated with another (e.g., reporter or indicator) component.
- luminescent labels that produce signals include, but are not limited to bioluminescence and chemiluminescence. Detectable luminescence response generally comprises a change in, or an occurrence of, a luminescence signal. Suitable methods and luminophores for luminescently labeling assay components are known in the art and described for example in Haugland, Richard P. (1996) Handbook of Fluorescent Probes and Research Chemicals (6 th ed.). Examples of luminescent probes include, but are not limited to, aequorin and luciferases.
- fluorescent labels include, but are not limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malacite green, stilbene, Lucifer Yellow, Cascade BlueTM, and Texas Red.
- suitable optical dyes are described in the Haugland, Richard P. (1996) Handbook of Fluorescent Probes and Research Chemicals (6 th ed.).
- affinity label refers to a compound, that may be appended to a protein or another compound so that the protein or other compound can be purified from its crude source using an affinity purification technique, for example affinity chromatography, wherein the purification processes selects for the affinity label and the protein or other compound appened thereto based on the label's interactions with an affinity matrix used for the purification. These interactions include, but are not limited to, antigen-antibody interactions, enzyme-substrate interactions, receptor-ligand interactions, hydrogen bonding, ionic interactions or electrostatic interactions.
- Non-limiting examples of affinity labels include chitin binding protein (CBP), maltose binding protein (MBP), Strep-tag, glutathione- S-transferase (GST), poly(His) tags, NE-tag, Spot-tag, albumin-binding protein (ABP), alkaline phosphatase (AP), AU epitopes, bacteriophage T7 or V5 epitope, HSV epitope, biotin-carboxy carrier protein, biotin, and bluetounge virus tag (B-tag).
- Non limiting examples of matrices include, but are not limited to, albumin/low pH, mAb/low pH, avidin or streptavidin/biotin or denaturation, calmodulin/EGTA or EGTA and high salt,
- chloramphenicol/chloramphenicol chitin, choline, methotrexate/folate, galactose, glutathione, and a divalent metal.
- the term "contacting" intends bringing the reagents into close proximity with each other so that a chemical or biochemical reaction can occur among the reagents.
- the term intends admixing the components, either in a reaction vessel or on a plate or dish. In another aspect, it intends in vivo administration to a subject.
- binding or “binds” as used herein are meant to include interactions between molecules that may be covalent or non-covalent which, in one embodiment, can be detected using, for example, a hybridization assay.
- the terms are also meant to include “binding” interactions between molecules. Interactions may be, for example, protein-protein, antibody-protein, protein-nucleic acid, protein-small molecule or small molecule-nucleic acid in nature. This binding can result in the formation of a “complex” comprising the interacting molecules.
- a “complex” refers to the binding of two or more molecules held together by covalent or non-covalent bonds, interactions or forces.
- polypeptide is used interchangeably with the term “protein” and in its broadest sense refers to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics.
- the subunits may be linked by peptide bonds. In another embodiment, the subunit may be linked by other bonds, e.g., ester, ether, etc.
- amino acid refers to natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics.
- a peptide of three or more amino acids is commonly called an oligopeptide if the peptide chain is short. If the peptide chain is long, the peptide is commonly called a polypeptide or a protein.
- peptide fragment as used herein, also refers to a peptide chain.
- polynucleotide, polypeptide or protein mentioned herein also includes equivalents thereof.
- an equivalent polynucleotide is one that hybridizes under stringent conditions to the polynucleotide or complement of the polynucleotide as described herein for use in the described methods.
- an equivalent antibody or antigen binding polypeptide intends one that binds with at least 70 %, or alternatively at least 75 %, or alternatively at least 80 %, or alternatively at least 85 %, or alternatively at least 90 %, or alternatively at least 95 % affinity or higher affinity to a reference antibody or antigen binding fragment.
- an equivalent thereof competes with the binding of the antibody or antigen binding fragment to its antigen under a competitive ELISA assay.
- an equivalent intends at least about 80 % homology or identity and alternatively, at least about 85 %, or alternatively at least about 90 %, or alternatively at least about 95 %, or alternatively 98 % percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid.
- Homology or “identity” or “similarity” are synonymously and refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences. An "unrelated” or “non-homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences of the present invention.
- novel molecular tools to study protein ADP-ribosylation in live cells can be in situ converted to NAD + analogues as universal ART cofactors and will thus provide invaluable and generally applicable tools for non-invasive monitoring and tracking of global ADP-ribosylation with striking
- FIG. 1 spatiotemporal resolution
- each R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , and R 11 independently is a hydrogen, -N 3 , a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C 2 -C 10 alkynyl, an optionally substituted C 1 -C 10 alkoxy, -SR 30 , an optionally substituted C 6 -Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z;
- X 5 is -S-, -0-, or - R 20 -; each R 20 and R 30 is independently a hydrogen or an optionally substituted C 1 -C 10 alkyl;
- Z is
- Y is a hydrogen, an optionally substituted Ci-C 6 alkyl, an optionally substituted C 2 - Cio alkenyl, an optionally substituted C 2 -Ci 0 alkynyl, an optionally substituted C 6 -Ci 0 aryl, an optionally substituted 5-15 membered heteroaiyl, or -I ⁇ Y 35 ;
- each R 100 is independently -O ⁇ , an optionally substituted Ci-Cio alkyl group, or an optionally substituted Ci-Cio alkoxy; and Y 35 is a hydroxyl or an optionally substituted Ci-C 6 alkoxy, and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
- each n is independently 1, 3, or 4.
- each R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , and R 11 independently is a hydrogen, -N 3 , a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C 2 -Ci 0 alkynyl, an optionally substituted Ci-Cio alkoxy, -SR 30 , an optionally substituted C 6 -Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z;
- X 5 is -S-, -0-, or -NR 20 -; each R 20 and R 30 is independently a hydrogen or an optionally substituted Ci-Cio alkyl;
- Z is
- Y is a hydrogen, an optionally substituted Ci-C 6 alkyl, an optionally substituted C Cio alkenyl, an optionally substituted C 2 -C 10 alkynyl, an optionally substituted C 6 -Cio aryl, optionally substituted 5-15 membered heteroaryl, or -I ⁇ Y 35 ;
- each R 100 is independently - ⁇ ⁇ , ⁇ optionally substituted C 1 -C 10 alkyl group, or an optionally substituted C 1 -C 10 alkoxy; and Y 35 is a hydroxyl or an optionally substituted Ci-C 6 alkoxy; and and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues
- each n is independently 1, 3, or 4.
- the compound of Formula (I-A) is of Formula (I-AA):
- each R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , and R 11 independently is a hydrogen, -N 3 , a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C 2 -C 10 alkynyl, an optionally substituted C 1 -C 10 alkoxy, -SR 30 , an optionally substituted C 6 -Ci 0 aryl, an optionally substituted 5-15 membered heteroaryl, or Z;
- X 5 is -S-, -0-, or -NR 20 -; each R 20 and R 30 is independently a hydrogen or an optionally substituted C 1 -C 10 alkyl;
- Z is
- L 5 is a hydrogen, an optionally substituted Ci-C 6 alkyl, or -I ⁇ Y 35 ;
- each n is independently 1, 3, or 4.
- each R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , and R 11 independently is a hydrogen, -N 3 , a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C 2 -Ci 0 alkynyl, an optionally substituted Ci-Cio alkoxy, -SR 30 , an optionally substituted C 6 -Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z;
- X 5 is -S-, -0-, or -NR 20 -; each R 20 and R 30 is independently a hydrogen or an optionally substituted Ci-Cio alkyl;
- Z is
- L 5 is a hydrogen, an optionally substituted Ci-C 6 alkyl, or -I ⁇ Y 35 ;
- each n is independently 1, 3, or 4.
- the compound of Formula (I-B) is of Formula (I-BB):
- each R 1 , R 2 , R 3 , and R 4 independently is a hydrogen or an optionally substituted Ci-C 6 alkyl or Z;
- X is -S-, -0-, or -NR 20 -;
- R 20 is a hydrogen or an optionally substituted Ci-Cio alkyl;
- Z is
- Y is a hydrogen, an optionally substituted Ci-C 6 alkyl, an optionally substituted C 2 - Cio alkenyl, an optionally substituted C 2 -Cio alkynyl, an optionally substituted C 6 -Cio aryl, an optionally substituted 5-15 membered heteroaiyl, or -I ⁇ Y 35 ;
- each R 100 is independently -O ⁇ , an optionally substituted Ci-Cio alkyl group, or an optionally substituted Ci-Cio alkoxy; and Y 35 is a hydroxyl or an optionally substituted Ci-C 6 alkoxy, and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
- each n is independently 1, 3, or 4.
- each R 1 , R 2 , R 3 , and R 4 independently is a hydrogen or an optionally substituted Ci-C 6 alkyl or Z;
- X is -S-, -0-, or -NR 20 -;
- R 20 is a hydrogen or an optionally substituted Ci-Cio alkyl;
- Y is a hydrogen, an optionally substituted Ci-C 6 alkyl, an optionally substituted C 2 - Cio alkenyl, an optionally substituted C 2 -Cio alkynyl, an optionally substituted C 6 -Cio aryl, an optionally substituted 5-15 membered heteroaryl, or -I ⁇ Y 35 ;
- each R 100 is independently -O ⁇ , an optionally substituted Ci-Cio alkyl group, or an optionally substituted Ci-Cio alkoxy;
- Y 35 is a hydroxyl or an optionally substituted Ci-C 6 alkoxy and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
- each n is independently 1, 3, or 4.
- the compound of Formula (I-C) is of Formula (I-CC):
- each R 1 , R 2 , R 3 , and R 4 independently is a hydrogen or an optionally substituted Ci-C 6 alkyl or Z;
- X is -S-, -0-, or -NR 20 -;
- R 20 is a hydrogen or an optionally substituted Ci-Cio alkyl;
- L 10 is a hydrogen, an optionally substituted Ci-C 6 alkyl, or -I ⁇ Y 35 ;
- each n is independently 1, 2, 3, or 4;
- each Y 15 is independently a hydrogen, -N0 2 , a halo, a cyano, a hydroxyl, an optionally substituted Ci-C 6 alkyl, or an optionally substituted Ci-C 6 alkoxy;
- each Y 25 is independently a hydrogen or an optionally substituted Ci-C 6 alkyl, and each Y 20 is independently selected from the group consisting of:
- each R 1 , R 2 , R 3 , and R 4 independently is a hydrogen or an optionally substituted Ci-C 6 alkyl or Z;
- X is -S-, -0-, or -NR 20 -;
- R 20 is a hydrogen or an optionally substituted Ci-Cio alkyl;
- L 10 is a hydrogen, an optionally substituted Ci-C 6 alkyl, or -I ⁇ Y 35 ;
- each R 1 , R 2 , R 3 , and R 4 independently is a hydrogen or an optionally substituted Ci-C 6 alkyl or Z;
- X is -S-, -0-, or -NR 20 -;
- X 5 is -S-, -0-, or -NR 20 -;
- R 100 is -O ⁇ , an optionally substituted Ci-Cio al
- each n is independently 1, 2, 3, or 4; efach Y is independently a hydrogen, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C 6 alkyl, or an optionally substituted Ci-C 6 alkoxy; each Y 25 is independently a hydrogen or an optionally substituted Ci-C 6 alkyl, and each Y 20 is independently selected from the group consisting of:
- each R 20 and R 30 is independently a hydrogen or an optionally substituted Ci-Cio alkyl and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
- each n is independently 1, 3, or 4.
- each R 1 , R 2 , R 3 , and R 4 independently is a hydrogen or an optionally substituted C C 6 alkyl or Z;
- X is -S-, -0-, or -NR 20 -;
- X 5 is -S-, -0-, or -NR 20 -;
- R 100 is -O ⁇ , an optionally substituted C 1 -C 10 alkyl
- each R 20 and R 30 is independently a hydrogen or an optionally substituted Ci-Cio and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
- each n is independently 1, 3, or 4.
- the compound of Formula (I) is of Formula (II):
- the compound of Formula (I) is of Formula (III):
- R 1 is a hydrogen. In some embodiments, R 1 is an optionally substituted Ci-C 6 alkyl. In some embodiments, R 1 is Z. [0168] In some embodiments, R 2 is a hydrogen. In some embodiments, R 2 is an optionally substituted Ci-C 6 alkyl. In some embodiments, R 2 is Z.
- R 3 is a hydrogen. In some embodiments, R 3 is an optionally substituted Ci-C 6 alkyl. In some embodiments, R 3 is Z.
- R 4 is a hydrogen. In some embodiments, R 4 is an optionally substituted Ci-C 6 alkyl. In some embodiments, R 4 is Z.
- X is -S-. In some embodiments, X is -0-. In some embodiments, X is - R 20 -.
- X 5 is -S-. In some embodiments, X 5 is -0-. In some embodiments, X 5 is -NR 20 -.
- R 5 is a hydrogen. In some embodiments, R 5 is -N 3 . In some embodiments, R 5 is a hydroxyl. In some embodiments, R 5 is an optionally substituted C 1 -C 10 alkyl. In some embodiments, R 5 is an optionally substituted C 2 -C 10 alkynyl. In some embodiments, R 5 is an optionally substituted C 1 -C 10 alkoxy. In some embodiments, R 5 is - SR 30 . In some embodiments, R is an optionally substituted C 6 -Cio aryl. In some
- R 5 is an optionally substituted 5-15 membered heteroaryl. In some embodiments, R 5 is Z.
- R 6 is a hydrogen. In some embodiments, R 6 is -N 3 . In some embodiments, R 6 is a hydroxyl. In some embodiments, R 6 is an optionally substituted C 1 -C 10 alkyl. In some embodiments, R 6 is an optionally substituted C 2 -C 10 alkynyl. In some embodiments, R 6 is an optionally substituted C 1 -C 10 alkoxy. In some embodiments, R 6 is - SR 30 . In some embodiments, R is an optionally substituted C 6 -Cio aryl. In some
- R 6 is an optionally substituted 5-15 membered heteroaryl. In some embodiments, R 6 is Z.
- R 7 is a hydrogen. In some embodiments, R 7 is -N 3 . In some embodiments, R 7 is a hydroxyl. In some embodiments, R 7 is an optionally substituted C 1 -C 10 alkyl. In some embodiments, R 7 is an optionally substituted C 2 -C 10 alkynyl. In some embodiments, R 7 is an optionally substituted C 1 -C 10 alkoxy. In some embodiments, R 7 is - SR . In some embodiments, R is an optionally substituted C 6 -Cio aryl. In some
- R 7 is an optionally substituted 5-15 membered heteroaiyl. In some embodiments, R 7 is Z.
- R 8 is a hydrogen. In some embodiments, R 8 is -N 3 . In some embodiments, R 8 is a hydroxyl. In some embodiments, R 8 is an optionally substituted Ci-Cio alkyl. In some embodiments, R 8 is an optionally substituted C 2 -Ci 0 alkynyl. In some embodiments, R 8 is an optionally substituted Ci-Cio alkoxy. In some embodiments, R 8 is - SR 30 . In some embodiments, R is an optionally substituted C 6 -Cio aryl. In some
- R 8 is an optionally substituted 5-15 membered heteroaiyl. In some embodiments, R 8 is Z.
- R 9 is a hydrogen. In some embodiments, R 9 is -N 3 . In some embodiments, R 9 is a hydroxyl. In some embodiments, R 9 is an optionally substituted Ci-Ci 0 alkyl. In some embodiments, R 9 is an optionally substituted C 2 -Cio alkynyl. In some embodiments, R 9 is an optionally substituted Ci-Cio alkoxy. In some embodiments, R 9 is - SR 30 . In some embodiments, R is an optionally substituted C 6 -Cio aryl. In some
- R 9 is an optionally substituted 5-15 membered heteroaiyl. In some embodiments, R 9 is Z.
- R 7 , R 9 and R 11 are each hydrogen.
- R 10 is a hydrogen. In some embodiments, R 10 is -N 3 . In some embodiments, R 10 is a hydroxyl. In some embodiments, R 10 is an optionally substituted Ci- Cio alkyl. In some embodiments, R 10 is an optionally substituted C 2 -Ci 0 alkynyl. In some embodiments, R 10 is an optionally substituted Ci-Cio alkoxy. In some embodiments, R 10 is - SR 30 . In some embodiments, R is an optionally substituted C 6 -Cio aryl. In some embodiments, R 10 is an optionally substituted 5-15 membered heteroaiyl. In some embodiments, R 10 is Z.
- R 11 is a hydrogen. In some embodiments, R 11 is -N 3 . In some embodiments, R 11 is a hydroxyl. In some embodiments, R 11 is an optionally substituted Ci- Cio alkyl. In some embodiments, R 11 is an optionally substituted C 2 -Cio alkynyl. In some embodiments, R 11 is an optionally substituted Ci-Cio alkoxy. In some embodiments, R 11 is - SR 30 . In some embodiments, R is an optionally substituted C 6 -Cio aryl. In some embodiments, R 11 is an optionally substituted 5-15 membered heteroaiyl. In some embodiments, R 11 is Z.
- R 100 is -O ⁇ .
- R 100 is an optionally substituted Ci-Cio alkyl group.
- R 100 is an optionally substituted Ci- Cio alkoxy.
- R 100 is a methyl.
- R 100 is a methoxy.
- R 100 is a Ci-Cio alkyl group optionally substituted with a C 2 alkynyl.
- R 100 is a Ci-C 6 alkyl group optionally substituted with a C 2 alkynyl.
- R 100 is
- R is selected from the group consisting of:
- R is a methyl. In some embodiments, R is an optionally substituted methyl. In some embodiments, R 100 is a methoxy. In some embodiments, R 100 is an optionally substituted methoxy.
- R 20 is a hydrogen. In some embodiments, R 20 is an optionally substituted Ci-Cio alkyl.
- R 30 is a hydrogen. In some embodiments, R 30 is an optionally substituted Ci-Cio alkyl.
- Z is
- polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
- Z is
- Z is
- each Y is independently a hydrogen. In some embodiments, each Y 15 is independently a -N0 2 . In some embodiments, each Y 15 is independently a halo. In some embodiments, each Y 15 is independently a cyano. In some embodiments, each Y 15 is independently a hydroxyl. In some embodiments, each Y 15 is independently an optionally substituted Ci-C 6 alkyl. In some embodiments, each Y 15 is independently an optionally substituted Ci-C 6 alkoxy.
- each Y 25 is independently a hydrogen. In some embodiments, each Y 25 is independently an optionally substituted Ci-C 6 alkyl.
- each Y 20 is independently:
- each Y is independently
- each Y is independently
- each Y is independently
- each Y is independently
- each Y is independently
- Z is:
- Z is
- Z is
- Z is
- Z is
- n is 1, 2, 3, or 4. In some embodiments, n is 1, 3, or 4. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4.
- each Y 15 is independently a hydrogen. In some embodiments, each Y 15 is independently a -N0 2 . In some embodiments, each Y 15 is independently a halo. In some embodiments, each Y 15 is independently a cyano. In some embodiments, each Y 15 is independently a hydroxyl. In some embodiments, each Y 15 is independently an optionally substituted Ci-C 6 alkyl. In some embodiments, each Y 15 is independently an optionally substituted Ci-C 6 alkoxy.
- each Y 25 is independently a hydrogen. In some embodiments, each Y 25 is independently an optionally substituted Ci-C 6 alkyl.
- each Y 20 is independently:
- each Y is independently:
- each Y is independently:
- each Y is independently:
- each Y 20 is independently:
- Z is:
- Y is a hydrogen. In some embodiments, Y is an optionally substituted Ci-C 6 alkyl. In some embodiments, Y 40 is an optionally substituted C 2 -C 10 alkenyl. In some embodiments, Y 40 is an optionally substituted C 2 -C 10 alkynyl. In some embodiments, Y 40 is an optionally substituted C 6 -Ci 0 aryl. In some embodiments, Y 40 is an optionally substituted 5-15 membered heteroaryl. In some embodiments, Y 40 is -I ⁇ Y 35 , wherein L 1 is as defined above. In some embodiments, Y 35 is a hydroxyl. In some embodiments, Y 35 is an optionally substituted Ci-C 6 alkoxy.
- L 5 is a hydrogen. In some embodiments, L 5 is an optionally substituted Ci-C 6 alkyl. In some embodiments, L 5 is -I ⁇ Y 35 , wherein each of L 1 and Y 35 are as defined as above.
- Y 30 is a hydrogen. In some embodiments, Y 30 is an optionally substituted Ci-C 6 alkyl. In some embodiments, Y 30 is an optionally substituted C 2 -Ci 0 alkenyl. In some embodiments, Y 30 is an optionally substituted C 2 -C 10 alkynyl. In some embodiments, Y 30 is an optionally substituted C 6 -Cio aryl. In some embodiments, Y 30 is an optionally substituted 5-15 membered heteroaryl. In some embodiments, Y 30 is -I ⁇ Y 35 , wherein each of L 1 and Y 35 are as defined above
- L 10 is a hydrogen. In some embodiments, L 10 is an optionally substituted Ci-C 6 alkyl. In some embodiments, L 10 is -I ⁇ Y 35 , wherein each of L 1 and Y 35 are as defined as above.
- R 3 and R 4 are H or Z. In some embodiments, R 3 and R 4 are H. In some embodiments, R 3 and R 4 are Z.
- R 1 and R 2 are H or Z. In some embodiments, R 1 and R 2 are H. In some embodiments, R 1 and R 2 are Z.
- X is O.
- X 5 is O.
- L 1 is -P0 2 - or -PO 3 -PO 2 -. In some embodiments, L 1 is -PO 3 -
- each R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , and R 11 is independently selected from -N3, a hydroxyl, an optionally substituted C 2 -C 10 alkynyl, an optionally substituted Ci- C 10 alkoxy, -SR 30 , an optionally substituted 5-15 membered heteroaryl, or Z.
- At least one of R 6 and R 7 and at least one of R 8 and R 9 is independently selected from -N 3 , a hydroxyl, an optionally substituted C 2 -C 10 alkynyl, an optionally substituted Ci-Cio alkoxy, -SR , an optionally substituted 5-15 membered heteroaryl, or Z.
- R 6 and R 8 is independently selected from -N 3 , a hydroxyl, an optionally substituted C 2 -C 10 alkynyl, an optionally substituted C 1 -C 10 alkoxy, -SR 30 , an optionally substituted 5-15 membered heteroaryl, or Z.
- each R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , and R 11 is independently selected from -N3, a hydroxyl, an optionally substituted C 2 -C 10 alkoxy, or an optionally substituted 5- 15 membered heteroaryl.
- At least one of R 6 and R 7 and at least one of R 8 and R 9 is independently selected from -N 3 , a hydroxyl, an optionally substituted C 2 -Ci 0 alkoxy, or an optionally substituted 5-15 membered heteroaryl.
- R 6 and R 8 is independently selected from -N 3 , a hydroxyl, an optionally substituted C 2 -C 10 alkoxy, or an optionally substituted 5-15 membered heteroaryl.
- the optionally substituted 5-15 membered heteroaryl is an optionally substituted 6-10 membered heteroaryl.
- the 6-10 membered heteroaryl is optionally substituted with one, two, three, four, or five R 15 groups, as defined below.
- the 6-10 membered heteroaryl is optionally substituted with an aminocarbonyl group.
- the optionally substituted 5-15 membered heteroaryl is an optionally substituted 6 membered heteroaryl.
- the 6 membered heteroaryl is optionally substituted with one, two, three, four, or five R 15 groups, as defined below.
- the 6 membered heteroaryl is optionally substituted with an aminocarbonyl group.
- the optionally substituted 5-15 membered heteroaryl is an optionally substituted pyridyl.
- the pyridyl group is optionally substituted with one, two, three, four, or five R 15 groups, as defined below.
- the pyridyl is optionally substituted with an aminocarbonyl group.
- the o tionally substituted 5-15 membered heteroaryl is:
- R 15 is -C(O) R 60 R 61 , -OC(O) R 60 R 61 , -C(S) R 60 R 61 , or -OC(S) R 60 R 61 .
- R 15 is -C(O) R 60 R 61 .
- R 15 is - OC(O) R 60 R 61 .
- R 15 is -C(S) R 60 R 61 .
- R 15 is - OC(S) R 60 R 61 .
- each R 60 and R 61 is a hydrogen or an optionally substituted Ci- C 6 alkyl.
- R 60 is a hydrogen.
- R 60 is an optionally substituted Ci-C 6 alkyl.
- R 61 is a hydrogen.
- R 61 is an optionally substituted Ci-C 6 alkyl.
- R 60 and R 61 are hydrogen.
- each R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , and R 11 independently is selected from the roup consisting of:
- R 5 is:
- R 5 is:
- At least one of R 6 and R 7 is a hydroxyl.
- At least one of R 6 and R 7 is:
- At least one of R 6 and R 7 is:
- At least one of R 6 and R 7 is:
- At least one of R 6 and R 7 is:
- At least one of R 6 and R 7 is:
- At least one of R 6 and R 7 is:
- At least one of R 6 and R 7 is:
- At least one of R 6 and R 7 is:
- At least one of R 6 and R 7 is:
- At least one of R 6 and R 7 is:
- At least one of R 6 and R 7 is:
- At least one of R 6 and R 7 is -N 3 .
- At least one of R 8 and R 9 is hydroxyl. [0252] In some embodiments, at least one of R 8 and R 9 is:
- At least one of R 8 and R 9 is:
- At least one of R 8 and R 9 is:
- At least one of R 8 and R 9 is:
- At least one of R 8 and R 9 is:
- At least one of R 8 and R 9 is:
- At least one of R 8 and R 9 is -N 3 .
- At least one of R 6 , R 8 , and R 10 IS .
- At least one of R 6 and R 8 is Z.
- R 6 and R 8 are hydroxyl.
- R 10 is:
- R is as defined above. [0263] In some embodiments, R is
- R 60 and R 61 are as defined above.
- R 11 is
- R 11 is
- R 60 and R 61 are as defined above.
- the compounds provided herein include individual, separated enantiomers and diastereomers that are stereochemically pure or enriched, tautomers, and pharmaceutically acceptable salts, and/or a solvate thereof, wherever applicable.
- stereochemically pure denotes a compound which has 80% or greater by weight of the indicated stereoisomer and 20% or less by weight of other stereoisomers.
- the compounds as described herein have 90% or greater by weight of the denoted
- the compounds of this disclosure have 95% or greater by weight of the denoted stereoisomer and 5% or less by weight of other stereoisomers. In a still further embodiment, the compounds have 97% or greater by weight of the denoted stereoisomer and 3% or less by weight of other stereoisomers. Any one or more of the compounds can be provided as compositions, e.g., of pharmaceutically acceptable salt, and/or a solvate thereof.
- the compounds and the intermediates are separated from the reaction mixture, when desired, following art known methods such as crystallization, chromatography, distillation, and the like.
- the compounds and the intermediates are characterized by art known methods such as thin layer chromatography, nuclear magnetic resonance spectroscopy, high performance liquid chromatography, and the like.
- a racemic or diastereomeric mixture of the compound can be separated or enriched to the enantiomers and diastereomers and tested and used diagnostically or therapeutically as described herein.
- compositions including pharmaceutical compositions comprising the compounds described herein can be manufactured by means of conventional mixing, dissolving, granulating, dragee-making levigating, emulsifying, encapsulating, entrapping, or
- compositions can be formulated in conventional manner using one or more physiologically acceptable carriers, diluents, excipients, or auxiliaries which facilitate processing of the compounds provided herein into preparations which can be used pharmaceutically.
- the compounds of the technology can be administered by admixing in an in vitro system, parenteral (e.g., intramuscular, intraperitoneal, intravenous, ICV, intracisternal injection or infusion, subcutaneous injection, or implant), oral, by inhalation spray nasal, vaginal, rectal, sublingual, urethral (e.g., urethral suppository) or topical routes of parenteral (e.g., intramuscular, intraperitoneal, intravenous, ICV, intracisternal injection or infusion, subcutaneous injection, or implant), oral, by inhalation spray nasal, vaginal, rectal, sublingual, urethral (e.g., urethral suppository) or topical routes of
- administration e.g., gel, ointment, cream, aerosol, etc.
- suitable dosage unit formulations containing conventional non-toxic
- this disclosure relates to a composition comprising a compound as described herein and a carrier.
- this disclosure relates to a pharmaceutical composition comprising a compound as described herein and a pharmaceutically acceptable carrier.
- this disclosure relates to a pharmaceutical composition
- a pharmaceutical composition comprising a therapeutically effective amount of a compound as described herein and a pharmaceutically acceptable carrier.
- compositions for the administration of the compounds can be conveniently presented in dosage unit form and can be prepared by any of the methods well known in the art of pharmacy.
- the pharmaceutical compositions can be, for example, prepared by uniformly and intimately bringing the compounds provided herein into association with a liquid carrier, a finely divided solid carrier or both, and then, if necessary, shaping the product into the desired formulation.
- the compound provided herein is included in an amount sufficient to produce the desired therapeutic effect.
- compositions of this disclsoure may take a form suitable for virtually any mode of administration, including, for example, topical, ocular, oral, buccal, systemic, nasal, injection, infusion, transdermal, rectal, and vaginal, or a form suitable for administration by inhalation or insufflation.
- the compounds can be formulated as solutions, gels, ointments, creams, suspensions, etc., as is well-known in the art.
- Systemic formulations include those designed for administration by injection (e.g., subcutaneous, intravenous, infusion, intramuscular, intrathecal, or intraperitoneal injection) as well as those designed for transdermal, transmucosal, oral, or pulmonary administration.
- Useful injectable preparations include sterile suspensions, solutions, or emulsions of the compounds provided herein in aqueous or oily vehicles.
- the compositions may also contain formulating agents, such as suspending, stabilizing, and/or dispersing agents.
- the formulations for injection can be presented in unit dosage form, e.g., in ampules or in multidose containers, and may contain added preservatives.
- the injectable formulation can be provided in powder form for reconstitution with a suitable vehicle, including but not limited to sterile pyrogen free water, buffer, and dextrose solution, before use.
- a suitable vehicle including but not limited to sterile pyrogen free water, buffer, and dextrose solution, before use.
- the compounds provided herein can be dried by any art-known technique, such as lyophilization, and reconstituted prior to use.
- the pharmaceutical compositions may take the form of, for example, lozenges, tablets, or capsules prepared by conventional means with
- binding agents e.g., pregelatinised maize starch, polyvinylpyrrolidone, or hydroxypropyl methylcellulose
- fillers e.g., lactose, microcrystalline cellulose, or calcium hydrogen phosphate
- lubricants e.g., magnesium stearate, talc, or silica
- disintegrants e.g., potato starch or sodium starch glycolate
- wetting agents e.g., sodium lauryl sulfate.
- the tablets can be coated by methods well known in the art with, for example, sugars, films, or enteric coatings.
- compositions intended for oral use can be prepared according to any method known to the art for the manufacture of pharmaceutical compositions, and such compositions may contain one or more agents selected from the group consisting of sweetening agents, flavoring agents, coloring agents, and preserving agents in order to provide pharmaceutically elegant and palatable preparations.
- Tablets contain the compounds provided herein in admixture with non-toxic pharmaceutically acceptable excipients which are suitable for the manufacture of tablets. These excipients can be for example, inert diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents (e.g., corn starch or alginic acid); binding agents (e.g.
- a time delay material such as glyceryl
- compositions of the technology may also be in the form of oil-in-water emulsions.
- Liquid preparations for oral administration may take the form of, for example, elixirs, solutions, syrups, or suspensions, or they can be presented as a dry product for constitution with water or other suitable vehicle before use.
- Such liquid preparations can be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, cellulose derivatives, or hydrogenated edible fats); emulsifying agents (e.g., lecithin, or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol, cremophoreTM, or fractionated vegetable oils); and preservatives (e.g., methyl or
- the preparations may also contain buffer salts, preservatives, flavoring, coloring, and sweetening agents as appropriate.
- compositions of the present invention are also useful in the preparation of medicaments.
- the methods and techniques for preparing medicaments of a composition are known in the art.
- pharmaceutical formulations and routes of delivery are detailed herein.
- compositions described above can be used by applying standard pharmaceutical manufacturing procedures to prepare medicaments to treat the many disorders described herein.
- medicaments can be delivered to the subject by using delivery methods known in the pharmaceutical arts.
- compositions and compounds as disclosed herein are useful in assay and detection methods in vitro in a cell-free system or in vivo in a cell or subject, wherein the cell-free system, in vivo in a cell or subject, also comprise a PARP enzyme and a possible substrate protein for the PARP enzyme.
- a cell in one aspect, provided herein are methods of monitoring and/or tracking ADP- ribosylation in the above-noted cell-free system, a cell, a live cell, a tissue or a subject.
- the subject is, or the cell is isolated from, or cultured from, an animal, e.g., a mammal such as a human, a murine, a canine, a feline, an equine, an ovine, or a bovine.
- the subject is a human.
- the cells can be from commercially available or laboratory generated cell lines or isolated from a subject and used to monitor therapy, e.g., a tissue biopsy.
- the assays can be performed at various time points using samples isolated from the same subject.
- compositions and compounds as disclosed herein are useful in methods of identifying and profiling substrates of ADP-ribosyltransferases in a cell-free system, a cell, a tissue or a subject.
- compositions and compounds as disclosed herein also are useful in methods of modulating enzymatic activities of ADP-ribosyltransferases in a cell-free system, a cell, a tissue or a subject.
- compositions and compounds as disclosed herein are useful in methods of modulating the levels, extents, and patterns of ADP-ribosylation in a subject in need thereof.
- the subject is, or the cell is isolated from, or cultured from, an animal, e.g., a human, a mammal such as a murine, a canine, a feline, an equine, an ovine, or a bovine.
- the compositions and compounds as disclosed herein are useful in methods of modulating the metabolism of cellular NAD + and its associated metabolic and signaling pathways in a cell-free system, a cell, a tissue or a subject.
- the subject is, or the cell is isolated from, or cultured from, an animal, e.g., a human, a mammal such as a murine, a canine, a feline, an equine, an ovine, or a bovine.
- an animal e.g., a human, a mammal such as a murine, a canine, a feline, an equine, an ovine, or a bovine.
- compositions and compounds as disclosed herein are useful in methods of modulating post-translational modifications related to NAD + cofactor in a cell-free system, a cell, a tissue or a subject.
- the subject is, or the cell is isolated from, or cultured from, an animal, e.g., a mammal such as a human, a murine, a canine, a feline, an equine, an ovine, or a bovine.
- the post-translational modification is protein acetylation.
- the post-translational modification is protein
- compositions and compounds as disclosed herein are useful in methods of purifying a PARP substrate protein from a cell, a tissue or a subject.
- the subject is, or the cell is isolated from, or cultured from, an animal, e.g., a mammal such as a human, a murine, a canine, a feline, an equine, an ovine, or a bovine.
- the methods include contacting a sample comprising the protein, PARP and a compound of disclosed herein under conditions that favor PARP enzyme activity and with an affinity label to produce ADP- ribosylated protein, where the ribose is labeled, and affinity purifying the ADP-ribosylated protein.
- the click chemistry is used to label the protein.
- compositions and compounds as disclosed herein are useful in methods of identifying a protein as a substrate for PARP in a cell, a tissue or a subject.
- the subject is, or the cell or tissue is isolated from, or cultured from, an animal, e.g., a mammal such as a human, a murine, a canine, a feline, an equine, an ovine, or a bovine.
- the subject is a human.
- the disclosed methods can be performed in a cell free system with a cellular extract containing a PARP, or in a cell or tissue culture, or in a subject.
- the methods include contacting a sample including the PARP, and a compound disclosed herein under conditions for PARP to act on a substrate (e.g. a histone or non-histone protein, and with an affinity or detectable label to a labeled product of the PARP reaction.
- a substrate e.g. a histone or non-histone protein, and with an affinity or detectable label to a labeled product of the PARP reaction.
- the affinity label is used to purify the ADP-ribosylated protein; and the method optionally comprises further characterizing the ADP-ribosylated protein.
- the method uses a detectable label which is then imaged based on the label used.
- Suitable labels are known in the art and described herein, e.g., the label comprises an alkyne. In some embodiments the label comprises an azide. In some embodiments the label is a fluorescent label, e.g., a fluorophore. Non-limiting examples of detectable labels are describe herein.
- an effective amount of the compound and label can be administered to the subject.
- the method can be used to screen for novel combination therapies, formulations or treatment regimens, prior to administration to a human patient.
- compositions and compounds as disclosed herein also are useful in methods of labeling a PARP substrate protein in a cell-free system, a cell, a tissue or a subject.
- This disclosure also provides the labeled products produced therefrom.
- the subject is, or the cell or tissue is isolated from, or cultured from, an animal, e.g., a mammal such as a human, a murine, a canine, a feline, an equine, an ovine, or a bovine.
- the methods include contacting a sample comprising a PARP with a compound of this disclosure under conditions that allow the activity of the PARP enzyme, and a detectable label.
- the label comprises an alkyne.
- the label comprises an azide.
- the label is a fluorescent label, e.g., a fluorophore.
- the compound of the disclosure contacted with PARP comprises a coupling moiety configured to couple with a complementary coupling moiety of the label.
- the compound of the disclosure contacted with PARP comprises a pi-system capable of reacting with a pi-system of the label.
- the reaction of the two pi-systems is a cycloaddition reaction.
- the compound of the disclosure contacted with PARP comprises an alkyne and the label comprises an azide.
- the compound of the disclosure contacted with PARP comprises an azide and the label comprises an alkyne.
- the alkyne is a terminal alkyne.
- the compounds and labels are administered in an effective amount by a suitable route of administration.
- a suitable route of administration e.g., an appropriate mouse model
- the method can be used to screen for novel combination therapies, formulations or treatment regimens, prior to administration to a human patient.
- kits can further contain instructions for use.
- reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 6 hours, the reaction mixture was quenched with saturated aqueous NH 4 C1 (20 mL) and extracted with EtOAc (3X50 mL). The combined organic layers were washed water (3X50 mL), dried over anhydrous Na 2 S0 4 , filtered and concentrated and purified by a flash column chromatography on silica gel to afford the compound (3) (987 mg, 60%) as a colorless oil.
- Ci 4 Hi 8 N 2 0 8 P + (M+H) + requires 373.0795, Found: 373.0788.
- NAD + 2 is prepared following the procedure as described above with the necessary modifications well-understood b the skilled artisan.
- reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 8 hours, the reaction mixture was quenched with saturated aqueous NH 4 C1 (20 mL) and extracted with EtOAc (3X50 mL). The combined organic layers were washed water (3X50 mL), dried over anhydrous Na 2 S0 4 , filtered and concentrated and purified by a flash column chromatography on silica gel to afford the compound (3-3) (1.69 g, 40%) as a colorless oil.
- Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product.
- the activated 5'-AMP was dissolved in dried DMF (1 mL) and compound (3-9) (0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H 2 0 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC. Fractions containing the desired product were concentrated and lyophilized to yield corresponding NAD + 3 .
- the activated 5'- AMP was dissolved in dried DMF (1 mL) and compound (7-8) or 9-8 (0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H 2 0 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC. Fractions containing the desired product were concentrated and lyophilized to yield the corresponding NAD + 7 and NAD + 9.
- NAD + 8 is prepared following the procedure as described above with the necessary modifications well-understood by the skilled artisan.
- reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 6 hours, the reaction mixture was quenched with saturated aqueous H 4 C1 (20 mL) and extracted with EtOAc (3X50 mL). The combined organic layers were washed water (3X50 mL), dried over anhydrous Na 2 S0 4 , filtered and concentrated and purified by a flash column chromatography on silica gel to afford the compound 2cc.
- Adenosine 5 '-monophosphate (5'-AMP) 52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) were added 1, 1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 ⁇ ., 0.16 mmol. 1.6 eq).
- CDI 1-carbonyldiimidazole
- triethylamine 23 ⁇ ., 0.16 mmol. 1.6 eq.
- the reaction mixture was stirred at room temperature for 14 hours, and then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum and the residue was coevaporated 3 times each with 1.00 ml of dried DMF.
- the activated 5'-AMP was dissolved in dried DMF (1 mL) and compound 8ee (0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H 2 0 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC. Fractions containing the desired product were concentrated and lyophilized to yield the NAD + 20 and 26.
- Compound 2ff was prepared according to the reported method (Synlett 2007, No. 20, 3149-3154). If the target compound is, for example NAD + 22, then R 66 is -C ⁇ ; If the target compound is, for example NAD + 23, then R 66 is ( ⁇ LCI LC ⁇ ⁇
- nicotinamide had dissolved. Then a solution of compound 4ff (0.10 mmol) was added to the solution of nicotinamide with TMSOTf at 0 °CThen the reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) and purified by a flash column chromatography on silica gel to afford the compound 5ff.
- NAD + 22 is prepared following the procedure as described above with the necessary modifications well-understood by the skilled artisan.
- Ci 3 Hi 6 N 2 0 8 P +1 (M) + requires 359.1, Found: 360.5.
- the activated 5'-AMP was dissolved in dried DMF (1 mL) and compound 9gg (37 mg, 0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H 2 0 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC. Fractions containing the desired product were concentrated and lyophilized to yield the corresponding NAD + 24-25.
- NAD + 25 is prepared following the procedure as described above with the necessary modifications well-understood by the skilled artisan.
- Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with TFIF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 2ii.
- NAD + 27 [0457] General procedure for the synthesis of NAD + 27: To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) is added 1, 1- carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 ⁇ ⁇ , 0.16 mmol. 1.6 eq). The reaction mixture is stirred at room temperature for 14 hours, and is then quenched with 0.100 ml dried methanol. The solvent is removed under vacuum and the residue is coevaporated 3 times each with 1.00 ml of dried DMF.
- 5'-AMP Adenosine 5 '-monophosphate
- CDI 1- carbonyldiimidazole
- triethylamine 23 ⁇ ⁇ , 0.16 mmol. 1.6 eq
- Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with TUF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product.
- HeLa cells grown in DMEM with 10% FBS were treated with R1 at indicated concentrations (0.1 and 1 mM) for 48 hours, followed by fixation, permeabilization, and fluorescent staining through Cu(I)-catalyzed click chemistry using Azide-fluor 545.
- the stained cells were imaged by confocal microscope (see FIG. 2).
- HeLa cells grown in DMEM with 10% FBS were treated with R1 at indicated concentrations (2 mM) for 6-12 hours in the absence or presence of topotecan and 6-(5H)-phenanthridinone at indicated concentrations (5 um), followed by fixation, permeabilization, and fluorescent staining through Cu(I)-catalyzed click chemistry using Azide-fluor 545.
- the stained cells were imaged by confocal microscope.
- HA fiuorescently labeled ADP- ribosylation to hydroxylamine
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Food Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Provided herein are nicotinamide adenine dinucleotide analogues, compositions comprising such compounds, and methods of using such analogues and compositions.
Description
NICOTINAMIDE ADENINE DINUCLEOTIDE ANALOGUES
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority under 35 U.S.C. § 119(e) to U.S. Provisional Patent Application No. 62/517,784, filed June 9, 2017, and U.S. Provisional Patent Application No. 62/529,989, filed July 7, 2017, the disclosures each of which are incorporated by reference in their entireties.
BACKGROUND
[0002] Numerous biological processes are orchestrated by protein post-translational modifications (PTMs). Among key PTMs is protein ADP-ribosylation catalyzed by a superfamily of enzymes named ADP-ribosyltransferases (ARTs) with nicotinamide adenine dinucleotide (NAD+) as a cofactor. The human genome is found to encode 20 ART enzymes including intracellular poly-ADP-ribose polymerases (PARPs), sirtuins (SIRTs), and extracellular ART1-5, which possess poly- or mono-ADP-ribosylation activity.
[0003] Protein ADP-ribosylation is shown to play vital roles in regulating genome stability, protein homeostasis, cell proliferation, differentiation, and apoptosis. Abnormally increased ARTs activities are causatively linked with various human diseases such as cancer, immune disorders, and neurodegenerative diseases. However, the cellular functions and physiological and pathophysiological roles for most PARPs have remained elusive.
[0004] Conventional approaches require invasive procedures for imaging ADP-ribosylation in live cells and are incapable of dissecting ADP-ribosylated networks at physiological and pathophysiological conditions. Accordingly, non-invasive procedures for imaging ADP- ribosylation in live cells are needed.
SUMMARY
[0005] In some aspects, provided is a compound of Formula (I- A):
(I-A)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each of R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C2-Ci0 alkynyl, an optionally substituted Ci-Cio alkoxy, -SR30, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z; X5 is -S-, -0-, or -NR20-; each R20 and R30 is independently a hydrogen or an optionally substituted Ci-Cio alkyl; Z is
each n is independently 1-4 or 1, 3, or 4; each Y is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
P is a cationic polypeptide of about 5 to 30 amino acid residues in length; Y is a hydrogen, an optionally substituted Ci-C6 alkyl, an optionally substituted C2-C10 alkenyl, an optionally substituted C2-C10 alkynyl, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or -LV5; L1 is -P02-, -PO3-PO2-, -PO3-PO3-PO2-, - P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is independently -O © , an optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy; and Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy.
(I-B)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each of R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C2-Ci0 alkynyl, an optionally substituted Ci-Cio alkoxy, -SR30, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z; X5 is -S-, -0-, or -NR20-; each R20 and R30 is independently a hydrogen or an optionally substituted Ci-Cio alkyl; Z is
each n is independently 1-4 or 1, 3, or 4; each Y is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted
Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and
each Y is independently selected from the group consisting of:
P is a cationic polypeptide of about 5-30 amino acid residues in length; L5 is a hydrogen, an optionally substituted Ci-C6 alkyl, or -LV5; L1 is -Ρ02-, -Ρ03-Ρ02-, -P03-P03- P02-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -
P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is independently -θΘ, αη optionally substituted Ci-Cio alkyl group, or an optionally substituted Ci-Cio alkoxy; and Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy.
[0007] In some aspects, provided is a compound of Formula (I-C):
(I-C)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein each R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted Ci-C6 alkyl or Z; X is -S-, -0-, or -NR20-; R20 is a hydrogen or an optionally substituted Ci-Cio alkyl; Z is
each n is independently 1 -4 or 1 , 3, or 4; each Y is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
P is a cationic polypeptide of about 5-30 amino acid residues; Y is a hydrogen, an optionally substituted Ci-C6 alkyl, an optionally substituted C2-C10 alkenyl, an optionally substituted C2-Ci0 alkynyl, an optionally substituted C6-Ci0 aryl, an optionally substituted 5- 15 membered heteroaryl, or -LV5; L1 is -Ρ02-, -Ρ03-Ρ02-, -Ρ03-Ρ03-Ρ02-, -P(=0)(R100)-, - P(=O)(R100)OP(=O)(R100)-, or -P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is
independently -O O , an optionally substituted Ci-Cio alkyl group, or an optionally substituted Ci-Cio alkoxy; and Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy.
[0008] In some aspects provided is a compound of Formula (I-D):
(I-D)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each of R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted Ci-C6 alkyl or Z; X is -S-, -0-, or -NR20-; R20 is a hydrogen or an optionally substituted Ci-Cio alkyl; L10 is a hydrogen, an optionally substituted Ci-C6 alkyl, or -I^Y35;
L1 is -PO2-, -PO3-PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is independently -0 ©, an optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy; Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy; Z is
each n is independently 1-4 or 1, 3, or 4; each Y is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
(I)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted Ci-C6 alkyl or Z; X is -S-, -0-, or -NR20-; X5 is -S-, -0-, or -NR20-; L1 is -P02-, - PO3-PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or - P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; R100 is -O ©, an optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy; each R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted C1-C10 alkyl, an optionally substituted C2-C10 alkynyl, an optionally substituted C1-C10 alkoxy, -SR30, an optionally substituted C6-Ci0 aryl, an optionally substituted 5-15 membered heteroaryl, or Z; Z is
each n is independently 1-4 or 1, 3, or 4; each Y is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
P is a cationic polypeptide of 9-30 amino acid residues in length; and each R and R is independently a hydrogen or an optionally substituted Ci-Cio alkyl.
[0010] This disclosure also provides a compound of Table 1, 2, 3 or 4.
[0011] This disclosure also provides a method of monitoring and/or tracking ADP- ribosylation in a cell or sample comprising a PARP enzyme, the method comprising contacting the cell or sample with a compound of as disclosed above under conditions that favor a PARP catalyzed reaction to produce a reaction product; labeling a PARP catalyzed reaction product; and detecting the product of the PARP catalyzed reaction, thereby monitoring and/or tracking ADP-ribosylation. In one aspect, click chemistry is used to label the reaction product.
[0012] Also provided is a method of purifying a PARP substrate protein, the method comprising: contacting a cell or sample comprising PARP with a compound as disclosed herein under conditions that favor a PARP catalyzed reaction; labeling a PARP catalyzed reaction product with an affinity label, and purifying the product of the PARP catalyzed reaction by selecting for the affinity labeled product. In one aspect, click chemistry is used to label the reaction product.
[0013] In some aspects, provided is a method of identifying a protein as a PARP substrate, the method comprising contacting a cell or sample comprising the PARP with a compound as disclosed herein under conditions that favor a PARP catalyzed reaction; labeling a PARP catalyzed reaction product with an affinity label; and purifying and characterizing the product of the PARP catalyzed reaction being bound to the affinity label. In one aspect, click chemistry is used to label the reaction product.
[0014] In some aspects, provided is a method of labeling a PARP substrate protein, the method comprising contacting a cell or sample comprising PARP with a compound as disclosed herein under conditions that favor a PARP catalyzed reaction; and labeling a product of a PARP catalyzed reaction. In one aspect, click chemistry is used to label the product.
[0015] Methods to prepare the compounds as disclosed herein are further provided.
[0016] Also provided herein are kits comprising one or more compounds as disclosed herein and instructions for use. Optionally reagents for carrying out the methods as disclosed herein are further provided in the kits.
BRIEF DESCRIPTION OF THE DRAWINGS
[0017] FIG. 1 is a schematic showing novel molecular tools for studying ADP-ribosylation in live cells. Cell-permeable nicotinamide (Nam) riboside (NR) analogues enable in situ generation of clickable nicotinamide adenine dinucleotide (NAD+) analogues through NR kinase (NRK) and nicotinamide mononucleotide adenylyltransferase (NMNAT). NAD+ analogues generally recognized by native PARPs allow non-invasive tracking of cellular ADP-ribosylation.
[0018] FIG. 2 shows a cellular imaging of ADP-ribosylation using generated NRl analogue (compound 8 in Scheme 1). HeLa cells were cultured in growth medium supplemented with 0.1 or 1 mM NRl for 48 hr, followed by labeling with fluorescent dye via click chemistry.
[0019] FIGS. 3 A-3B are visualizations of cellular ADP-ribosylation through the generated NRl analogue. HeLa cells were cultured in growth medium supplemented with NRl at indicated concentrations for 6-12 hr in the absence or presence of topotecan and 6-(5H)- phenanthridinone, followed by labeling with fluorescent dye via click chemistry.
[0020] FIG. 4 shows an immunoblot analysis of lysates of Expi293 cells treated with 1 mM NR, and 1 mM NRl analogue for 12 hr in the absence or presence of varied concentrations of topotecan.
[0021] FIGS. 5A-5B illustrate the in vitro biosynthesis of NAD1 analogue by NRK1 and NMNAT1. FIG. 5A shows the SDS-PAGE gel of purified NRK1 and NMNAT1 from E. coli. FIG. 5B shows the HPLC chromatographic analysis of the time-dependent generation of NAD1 analogue catalyzed by purified NRKl and NMNAT1.
[0022] FIGS. 6A-6B show the LC-MS analysis of NRl in the cellular extracts of Expi293 cells treated with 10 mM NRl for 10 hr. FIG. 6A shows the reverse-phase liquid
chromatography for separation of the cellular extracts. FIG. 6B shows the mass spectrometry of the selected fraction for detection of cellular NRl analogue.
[0023] FIGS. 7A-7B show the LC-MS analysis of NAD 1 in the cellular extracts of Expi293 cells treated with 10 mM NRl for 10 hr. FIG. 7A shows the reverse-phase liquid
chromatography for separation of the cellular extracts. FIG. 7B shows the mass spectrometry of the selected fraction for detection of cellular NAD+1.
[0024] FIG. 8 shows the MS (ESI) of the reaction to synthesize NAD+ 27; the units for the X- axis are: m/z, Da, and the units for the Y-axis are: intensity, cps.
DETAILED DESCRIPTION
[0025] Throughout this disclosure, various publications, patents and published patent specifications are referenced by an identifying citation. The disclosures of these publications, patents and published patent specifications are hereby incorporated by reference into the present disclosure in their entirety to more fully describe the state of the art to which this invention pertains.
Definitions
[0026] The practice of the present technology will employ, unless otherwise indicated, conventional techniques of organic chemistry, pharmacology, immunology, molecular biology, microbiology, cell biology and recombinant DNA, which are within the skill of the art. See, e.g., Sambrook, Fritsch and Maniatis, Molecular Cloning: A Laboratory Manual, 2nd
edition (1989); Current Protocols In Molecular Biology (F. M. Ausubel, et al. eds., (1987)); the series Methods in Enzymology (Academic Press, Inc.): PCR 2: A Practical Approach (M.J. MacPherson, B.D. Hames and G.R. Taylor eds. (1995)), Harlow and Lane, eds. (1988) Antibodies, a Laboratory Manual, and Animal Cell Culture (R.I. Freshney, ed. (1987)).
[0027] As used in the specification and claims, the singular form "a," "an" and "the" include plural references unless the context clearly dictates otherwise. For example, the term "a cell" includes a plurality of cells, including mixtures thereof.
[0028] As used herein, the term "comprising" is intended to mean that the compounds, compositions and methods include the recited elements, but not exclude others. "Consisting essentially of when used to define compounds, compositions and methods, shall mean excluding other elements of any essential significance to the combination. Thus, a composition consisting essentially of the elements as defined herein would not exclude trace contaminants, e.g., from the isolation and purification method and pharmaceutically acceptable carriers, preservatives, and the like. "Consisting of shall mean excluding more than trace elements of other ingredients. Embodiments defined by each of these transition terms are within the scope of this technology.
[0029] All numerical designations, e.g., pH, temperature, time, concentration, and molecular weight, including ranges, are approximations which are varied (+) or (-) by increments of 1, 5, or 10%. It is to be understood, although not always explicitly stated that all numerical designations are preceded by the term "about." It also is to be understood, although not always explicitly stated, that the reagents described herein are merely exemplary and that equivalents of such are known in the art.
[0030] "Topotecan" is a compound that induces cellular DNA damage that would activate PARP activity in the cells. In the presence of topotecan, the cells treated by the compounds of the disclosure show increased fluorescence activity in the nucleus. This demonstrates the utility of the compounds in visualizing the cellular ADP-ribosylation catalyzed by PARP enzymes.
[0031] "Alkyl" refers to monovalent saturated aliphatic hydrocarbyl groups having from 1 to 10 carbon atoms and preferably 1 to 6 carbon atoms. This term includes, by way of example, linear and branched hydrocarbyl groups such as methyl (CH3-), ethyl (CH3CH2-), n-propyl (CH3CH2CH2-), isopropyl ((CH3)2CH-), n-butyl (CH3CH2CH2CH2-), isobutyl
((CH3)2CHCH2-), sec-butyl ((CH3)(CH3CH2)CH-), t-butyl ((CH3)3C-), n-pentyl
(CH3CH2CH2CH2CH2-), and neopentyl ((CH3)3CCH2-).
[0032] "Alkenyl" refers to monovalent straight or branched hydrocarbyl groups having from 2 to 6 carbon atoms and preferably 2 to 4 carbon atoms and having at least 1 and preferably from 1 to 2 sites of vinyl (>C=C<) unsaturation. Such groups are exemplified, for example, by vinyl, allyl, and but-3-en-l-yl. Included within this term are the cis and trans isomers or mixtures of these isomers.
[0033] "Alkynyl" refers to straight or branched monovalent hydrocarbyl groups having from 2 to 6 carbon atoms and preferably 2 to 3 carbon atoms and having at least 1 and preferably from 1 to 2 sites of acetylenic (-C≡C-) unsaturation. Examples of such alkynyl groups include acetylenyl (-C≡CH), and propargyl (-CH2C≡CH).
[0034] "Substituted alkyl" refers to an alkyl group having from 1 to 5, preferably 1 to 3, or more preferably 1 to 2 substituents selected from the group consisting of alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl,
aminothiocarbonyl, aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl, carboxyl ester, (carboxyl ester)amino, (carboxyl ester)oxy, cyano, cycloalkyl, substituted cycloalkyl, cycloalkyloxy, substituted cycloalkyloxy, cycloalkylthio, substituted cycloalkylthio, cycloalkenyl, substituted cycloalkenyl, cycloalkenyloxy, substituted cycloalkenyloxy, cycloalkenylthio, substituted cycloalkenylthio, guanidino, substituted guanidino, halo, hydroxy, heteroaryl, substituted heteroaryl, heteroaryloxy, substituted heteroaryloxy, heteroarylthio, substituted heteroarylthio, heterocyclic, substituted heterocyclic, heterocyclyloxy, substituted
heterocyclyloxy, heterocyclylthio, substituted heterocyclylthio, nitro, S03H, substituted sulfonyl, substituted sulfonyloxy, thioacyl, thiol, alkylthio, and substituted alkylthio, wherein said substituents are as defined herein.
[0035] "Substituted alkenyl" refers to alkenyl groups having from 1 to 3 substituents, and preferably 1 to 2 substituents, selected from the group consisting of alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl,
aminothiocarbonyl, aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl, carboxyl ester, (carboxyl ester)amino, (carboxyl ester)oxy, cyano, cycloalkyl, substituted cycloalkyl, cycloalkyloxy, substituted cycloalkyloxy, cycloalkylthio, substituted cycloalkylthio, cycloalkenyl, substituted cycloalkenyl, cycloalkenyloxy, substituted cycloalkenyloxy, cycloalkenylthio,
substituted cycloalkenylthio, guanidino, substituted guanidino, halo, hydroxyl, heteroaryl, substituted heteroaryl, heteroaryloxy, substituted heteroaryloxy, heteroarylthio, substituted heteroarylthio, heterocyclic, substituted heterocyclic, heterocyclyloxy, substituted
heterocyclyloxy, heterocyclylthio, substituted heterocyclylthio, nitro, S03H, substituted sulfonyl, substituted sulfonyloxy, thioacyl, thiol, alkylthio, and substituted alkylthio, wherein said substituents are as defined herein and with the proviso that any hydroxyl or thiol substitution is not attached to a vinyl (unsaturated) carbon atom.
[0036] "Substituted alkynyl" refers to alkynyl groups having from 1 to 3 substituents, and preferably 1 to 2 substituents, selected from the group consisting of alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl,
aminothiocarbonyl, aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl, carboxyl ester, (carboxyl ester)amino, (carboxyl ester)oxy, cyano, cycloalkyl, substituted cycloalkyl, cycloalkyloxy, substituted cycloalkyloxy, cycloalkylthio, substituted cycloalkylthio, cycloalkenyl, substituted cycloalkenyl, cycloalkenyloxy, substituted cycloalkenyloxy, cycloalkenylthio, substituted cycloalkenylthio, guanidino, substituted guanidino, halo, hydroxy, heteroaryl, substituted heteroaryl, heteroaryloxy, substituted heteroaryloxy, heteroarylthio, substituted heteroarylthio, heterocyclic, substituted heterocyclic, heterocyclyloxy, substituted
heterocyclyloxy, heterocyclylthio, substituted heterocyclylthio, nitro, SO3H, substituted sulfonyl, substituted sulfonyloxy, thioacyl, thiol, alkylthio, and substituted alkylthio, wherein said substituents are as defined herein and with the proviso that any hydroxyl or thiol substitution is not attached to an acetylenic carbon atom.
[0037] "Alkylene" refers to divalent saturated aliphatic hydrocarbyl groups preferably having from 1 to 6 and more preferably 1 to 3 carbon atoms that are either straight-chained or branched. This term is exemplified by groups such as methylene (-CH2-), ethylene
(-CH2CH2-), n-propylene (-CH2CH2CH2-), iso-propylene
(-CH2CH(CH3)- or -CH(CH3)CH2-), butylene (-CH2CH2CH2CH2-), isobutylene
(-CH2CH(CH3)CH2-), sec-butylene (-CH2CH2(CH3)CH-), and the like. Similarly,
"alkenylene" and "alkynylene" refer to an alkylene moiety containing respective 1 or 2 carbon carbon double bonds or a carbon carbon triple bond.
[0038] "Substituted alkylene" refers to an alkylene group having from 1 to 3 hydrogens replaced with substituents selected from the group consisting of alkyl, substituted alkyl,
alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminoacyl, aryl, substituted aryl, aryloxy, substituted aryloxy, cyano, halogen, hydroxyl, nitro, carboxyl, carboxyl ester, cycloalkyl, substituted cycloalkyl, heteroaryl, substituted heteroaryl, heterocyclic, substituted heterocyclic, and oxo wherein said substituents are defined herein. In some embodiments, the alkylene has 1 to 2 of the aforementioned groups, or having from 1-3 carbon atoms replaced with -0-, -S-, or - RQ- moieties where RQ is H or Ci-C6 alkyl. It is to be noted that when the alkylene is substituted by an oxo group, 2 hydrogens attached to the same carbon of the alkylene group are replaced by "=0". "Substituted alkenylene" and " substituted alkynylene" refer to alkenylene and substituted alkynylene moieties substituted with substituents as described for substituted alkylene.
[0039] "Alkoxy" refers to the group -O-alkyl wherein alkyl is defined herein. Alkoxy includes, by way of example, methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, t-butoxy, sec-butoxy, and n-pentoxy.
[0040] "Substituted alkoxy" refers to the group -0-(substituted alkyl) wherein substituted alkyl is defined herein.
[0041] "Acyl" refers to the groups H-C(O)-, alkyl-C(O)-, substituted alkyl-C(O)-, alkenyl-C(O)-, substituted alkenyl-C(O)-, alkynyl-C(O)-, substituted alkynyl-C(O)-, cycloalkyl-C(O)-, substituted cycloalkyl-C(O)-, cycloalkenyl-C(O)-, substituted
cycloalkenyl-C(O)-, aryl-C(O)-, substituted aryl-C(O)-, heteroaryl-C(O)-, substituted heteroaryl-C(O)-, heterocyclic-C(O)-, and substituted heterocyclic-C(O)-, wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein. Acyl includes the "acetyl" group CH3C(0)-.
[0042] "Acylamino" refers to the groups - R47C(0)alkyl, - R47C(0)substituted
alkyl, - R47C(0)cycloalkyl, - R47C(0)substituted
cycloalkyl, - R47C(0)cycloalkenyl, - R47C(0)substituted
cycloalkenyl, - R47C(0)alkenyl, - R47C(0)substituted
alkenyl, - R47C(0)alkynyl, - R47C(0)substituted
alkynyl, - R47C(0)aryl, - R47C(0)substituted
aryl, - R47C(0)heteroaiyl, - R47C(0)substituted heteroaryl, - R47C(0)heterocyclic, and - R47C(0)substituted heterocyclic wherein R47 is hydrogen or alkyl and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl,
substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0043] "Acyloxy" refers to the groups alkyl-C(0)0-, substituted alkyl-C(0)0-,
alkenyl-C(0)0-, substituted alkenyl-C(0)0-, alkynyl-C(0)0-, substituted alkynyl-C(0)0-, aryl-C(0)0-, substituted aryl-C(0)0-, cycloalkyl-C(0)0-, substituted cycloalkyl-C(0)0-, cycloalkenyl-C(0)0-, substituted cycloalkenyl-C(0)0-, heteroaryl-C(0)0-, substituted heteroaryl-C(0)0-, heterocyclic-C(0)0-, and substituted heterocyclic-C(0)0- wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0044] An animal, subject or patient for diagnosis or treatment refers to an animal such as a mammal, or a human, ovine, bovine, feline, canine, equine, simian, etc. Non-human animals subject to diagnosis or treatment include, for example, simians, murine, such as, rat, mice, canine, leporid, livestock, sport animals, and pets.
[0045] "Amino" refers to the group -NH2.
[0046] "Substituted amino" refers to the group -NR48R49 where R48 and R49 are
independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, substituted heterocyclic, -S02-alkyl, -S02-substituted
alkyl, -S02-alkenyl, -S02-substituted alkenyl, -S02-cycloalkyl, -S02-substituted
cylcoalkyl, -S02-cycloalkenyl, -S02-substituted cylcoalkenyl, -S02-aryl, -S02-substituted aryl, -S02-heteroaryl, -S02-substituted heteroaryl, -S02-heterocyclic, and -S02-substituted heterocyclic and wherein R48 and R49 are optionally joined, together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, provided that R48 and R49 are both not hydrogen, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein. When R48 is hydrogen and R49 is alkyl, the substituted amino group is sometimes referred to herein as alkylamino. When R48 and R49 are alkyl, the substituted amino group is sometimes referred to herein as dialkylamino. When referring to a
monosubstituted amino, it is meant that either R or R is hydrogen but not both. When referring to a disubstituted amino, it is meant that neither R48 nor R49 are hydrogen.
[0047] "Aminocarbonyl" refers to the group -C(O) R50R51 where R50 and R51 are
independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R50 and R51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0048] "Aminothiocarbonyl" refers to the group -C(S) R50R51 where R50 and R51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R50 and R51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0049] "Aminocarbonylamino" refers to the group -NR47C(O) R50R51 where R47 is hydrogen or alkyl and R50 and R51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic, and where R50 and R51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl,
heterocyclic, and substituted heterocyclic are as defined herein.
[0050] "Aminothiocarbonylamino" refers to the group - R47C(S) R50R51 where R47 is hydrogen or alkyl and R50 and R51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted
cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R50 and R51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0051] "Aminocarbonyloxy" refers to the group -O-C(O) R50R51 where R50 and R51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R50 and R51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0052] "Aminosulfonyl" refers to the group -SO2 R50R51 where R50 and R51 are
independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R50 and R51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0053] "Aminosulfonyloxy" refers to the group -O-SO2 R50R51 where R50 and R51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl,
substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R50 and R51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0054] "Aminosulfonylamino" refers to the group -NR47SO2 R50R51 where R47 is hydrogen or alkyl and R50 and R51 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R50 and R51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl,
heterocyclic, and substituted heterocyclic are as defined herein.
[0055] "Amidino" refers to the group -C(= R52) R50R51 where R50, R51, and R52 are independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, aryl, substituted aryl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic and where R50 and R51 are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0056] "Aryl" or "Ar" refers to a monovalent aromatic carbocyclic group of from 6 to 14 carbon atoms having a single ring (e.g., phenyl) or multiple condensed rings (e.g., naphthyl or anthryl) which condensed rings may or may not be aromatic (e.g., 2-benzoxazolinone, 2H-l,4-benzoxazin-3(4H)-one-7-yl, and the like) provided that the point of attachment is at an aromatic carbon atom. Preferred aryl groups include phenyl and naphthyl.
[0057] "Substituted aryl" refers to aryl groups which are substituted with 1 to 5, preferably 1 to 3, or more preferably 1 to 2 substituents selected from the group consisting of alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl, aminothiocarbonyl, aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl, carboxyl ester, (carboxyl ester)amino, (carboxyl ester)oxy, cyano, cycloalkyl, substituted cycloalkyl, cycloalkyloxy, substituted cycloalkyloxy, cycloalkylthio, substituted cycloalkylthio, cycloalkenyl, substituted cycloalkenyl, cycloalkenyloxy, substituted cycloalkenyloxy, cycloalkenylthio, substituted cycloalkenylthio, guanidino, substituted guanidino, halo, hydroxy, heteroaryl, substituted heteroaryl, heteroaryloxy, substituted heteroaryloxy, heteroarylthio, substituted heteroarylthio, heterocyclic, substituted heterocyclic, heterocyclyloxy, substituted
heterocyclyloxy, heterocyclylthio, substituted heterocyclylthio, nitro, S03H, substituted sulfonyl, substituted sulfonyloxy, thioacyl, thiol, alkylthio, and substituted alkylthio, wherein said substituents are as defined herein.
[0058] "Aryloxy" refers to the group -O-aiyl, where aryl is as defined herein, that includes, by way of example, phenoxy and naphthoxy.
[0059] "Substituted aryloxy" refers to the group -0-(substituted aryl) where substituted aryl is as defined herein.
[0060] "Arylthio" refers to the group -S-aryl, where aryl is as defined herein.
[0061] "Substituted arylthio" refers to the group -S-(substituted aryl), where substituted aryl is as defined herein.
[0062] "Azide" refers to the group -Ν=Ν©=ΝΘ .
[0063] "Carbonyl" refers to the divalent group -C(O)- which is equivalent to -C(=0)-.
[0064] "Carboxyl" or "carboxy" refers to -COOH or salts thereof.
[0065] "Carboxyl ester" or "carboxy ester" refers to the
groups -C(0)0-alkyl, -C(0)0-substituted alkyl, -C(0)0-alkenyl, -C(0)0-substituted alkenyl, -C(0)0-alkynyl, -C(0)0-substituted alkynyl, -C(0)0-aryl, -C(0)0-substituted aryl, -C(0)0-cycloalkyl, -C(0)0-substituted
cycloalkyl, -C(0)0-cycloalkenyl, -C(0)0-substituted
cycloalkenyl, -C(0)0-heteroaryl, -C(0)0-substituted heteroaryl, -C(0)0-heterocyclic,
and -C(0)0-substituted heterocyclic wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0066] "(Carboxyl ester)amino" refers to the
group - R47C(0)0-alkyl, - R47C(0)0-substituted
alkyl, - R47C(0)0-alkenyl, - R47C(0)0-substituted
alkenyl, - R47C(0)0-alkynyl, - R47C(0)0-substituted
alkynyl, - R47C(0)0-aryl, - R47C(0)0-substituted
aryl, - R47C(0)0-cycloalkyl, - R47C(0)0-substituted
cycloalkyl, - R47C(0)0-cycloalkenyl, - R47C(0)0-substituted
cycloalkenyl, - R47C(0)0-heteroaiyl, - R47C(0)0-substituted
heteroaryl, - R47C(0)0-heterocyclic, and - R47C(0)0-substituted heterocyclic wherein R' is alkyl or hydrogen, and wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0067] "(Carboxyl ester)oxy" refers to the group -0-C(0)0-alkyl, -0-C(0)0-substituted alkyl, -0-C(0)0-alkenyl, -0-C(0)0-substituted
alkenyl, -0-C(0)0-alkynyl, -0-C(0)0-substituted
alkynyl, -0-C(0)0-aryl, -0-C(0)0-substituted
aryl, -0-C(0)0-cycloalkyl, -0-C(0)0-substituted
cycloalkyl, -0-C(0)0-cycloalkenyl, -0-C(0)0-substituted
cycloalkenyl, -0-C(0)0-heteroaryl, -0-C(0)0-substituted
heteroaryl, -0-C(0)0-heterocyclic, and -0-C(0)0-substituted heterocyclic wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0068] A "composition" as used herein, intends an active agent, such as a compound as disclosed herein and a carrier, inert or active. The carrier can be, without limitation, solid such as a bead or resin, or liquid, such as phosphate buffered saline.
[0069] Administration or treatment in "combination" refers to administering two agents such that their pharmacological effects are manifest at the same time. Combination does not require administration at the same time or substantially the same time, although combination can include such administrations.
[0070] "Cyano" refers to the group -CN.
[0071] "Cycloalkyl" refers to cyclic alkyl groups of from 3 to 10 carbon atoms having single or multiple cyclic rings including fused, bridged, and spiro ring systems. The fused ring can be an aryl ring provided that the non aryl part is joined to the rest of the molecule. Examples of suitable cycloalkyl groups include, for instance, adamantyl, cyclopropyl, cyclobutyl, cyclopentyl, and cyclooctyl.
[0072] "Cycloalkenyl" refers to non-aromatic cyclic alkyl groups of from 3 to 10 carbon atoms having single or multiple cyclic rings and having at least one >C=C< ring unsaturation and preferably from 1 to 2 sites of >C=C< ring unsaturation.
[0073] "Substituted cycloalkyl" and "substituted cycloalkenyl" refers to a cycloalkyl or cycloalkenyl group having from 1 to 5 or preferably 1 to 3 substituents selected from the group consisting of oxo, thioxo, alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl, aminothiocarbonyl, aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl, carboxyl ester, (carboxyl ester)amino, (carboxyl ester)oxy, cyano, cycloalkyl, substituted cycloalkyl, cycloalkyloxy, substituted cycloalkyloxy, cycloalkylthio, substituted
cycloalkylthio, cycloalkenyl, substituted cycloalkenyl, cycloalkenyloxy, substituted cycloalkenyloxy, cycloalkenylthio, substituted cycloalkenylthio, guanidino, substituted guanidino, halo, hydroxy, heteroaryl, substituted heteroaryl, heteroaryloxy, substituted heteroaryloxy, heteroarylthio, substituted heteroarylthio, heterocyclic, substituted
heterocyclic, heterocyclyloxy, substituted heterocyclyloxy, heterocyclylthio, substituted heterocyclylthio, nitro, S03H, substituted sulfonyl, substituted sulfonyloxy, thioacyl, thiol, alkylthio, and substituted alkylthio, wherein said substituents are as defined herein.
[0074] "Cycloalkyloxy" refers to -O-cycloalkyl.
[0075] "Substituted cycloalkyloxy refers to -0-(substituted cycloalkyl).
[0076] "Cycloalkylthio" refers to -S-cycloalkyl.
[0077] "Substituted cycloalkylthio" refers to -S-(substituted cycloalkyl).
[0078] "Cycloalkenyloxy" refers to -O-cycloalkenyl.
[0079] "Substituted cycloalkenyloxy" refers to -0-(substituted cycloalkenyl).
[0080] "Cycloalkenylthio" refers to -S-cycloalkenyl.
[0081] "Substituted cycloalkenylthio" refers to -S-(substituted cycloalkenyl).
[0082] "Guanidino" refers to the group - HC(= H) H2.
[0083] "Substituted guanidino" refers to - R53C(= R53)N(R53)2 where each R53 is independently selected from the group consisting of hydrogen, alkyl, substituted alkyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, cycloalkyl, substituted cycloalkyl, heterocyclic, and substituted heterocyclic and two R53 groups attached to a common guanidino nitrogen atom are optionally joined together with the nitrogen bound thereto to form a heterocyclic or substituted heterocyclic group, provided that at least one R53 is not hydrogen, and wherein said substituents are as defined herein.
[0084] "Halo" or "halogen" refers to fluoro, chloro, bromo and iodo.
[0085] "Hydroxy" or "hydroxyl" refers to the group -OH.
[0086] "Heteroaryl" refers to an aromatic group of from 1 to 10 carbon atoms and 1 to 4 heteroatoms selected from the group consisting of oxygen, nitrogen and sulfur within the ring. Such heteroaryl groups can have a single ring (e.g., pyridinyl or furyl) or multiple condensed rings (e.g., indolizinyl or benzothienyl) wherein the condensed rings may or may not be aromatic and/or contain a heteroatom provided that the point of attachment is through an atom of the aromatic heteroaryl group. In one embodiment, the nitrogen and/or the sulfur ring atom(s) of the heteroaryl group are optionally oxidized to provide for the N-oxide (N→0), sulfinyl, or sulfonyl moieties. Certain non-limiting examples include pyridinyl, pyrrolyl, indolyl, thiophenyl, oxazolyl, thizolyl, and furanyl.
[0087] "Substituted heteroaryl" refers to heteroaryl groups that are substituted with from 1 to 5, preferably 1 to 3, or more preferably 1 to 2 substituents selected from the group consisting of the same group of substituents defined for substituted aryl.
[0088] "Heteroaryl oxy" refers to -O-heteroaiyl.
[0089] "Substituted heteroaryl oxy" refers to the group -0-(substituted heteroaryl).
[0090] "Heteroarylthio" refers to the group -S -heteroaryl.
[0091] "Substituted heteroarylthio" refers to the group -S-(substituted heteroaryl).
[0092] "Heterocycle" or "heterocyclic" or "heterocycloalkyl" or "heterocyclyl" refers to a saturated or partially saturated, but not aromatic, group having from 1 to 10 ring carbon atoms and from 1 to 4 ring heteroatoms selected from the group consisting of nitrogen, sulfur, or oxygen. Heterocycle encompasses single ring or multiple condensed rings, including fused bridged and spiro ring systems. In fused ring systems, one or more the rings can be cycloalkyl, aryl, or heteroaryl provided that the point of attachment is through a non-aromatic ring. In one embodiment, the nitrogen and/or sulfur atom(s) of the heterocyclic group are optionally oxidized to provide for the N-oxide, sulfinyl, or sulfonyl moieties.
[0093] "Substituted heterocyclic" or "substituted heterocycloalkyl" or "substituted heterocyclyl" refers to heterocyclyl groups that are substituted with from 1 to 5 or preferably 1 to 3 of the same substituents as defined for substituted cycloalkyl.
[0094] "Heterocyclyloxy" refers to the group -O-heterocycyl.
[0095] "Substituted heterocyclyloxy" refers to the group -0-(substituted heterocycyl).
[0096] "Heterocyclylthio" refers to the group -S-heterocycyl.
[0097] "Substituted heterocyclylthio" refers to the group -S-(substituted heterocycyl).
[0098] Examples of heterocycle and heteroaryls include, but are not limited to, azetidine, pyrrole, furan, thiophene, imidazole, pyrazole, pyridine, pyrazine, pyrimidine, pyridazine, indolizine, isoindole, indole, dihydroindole, indazole, purine, quinolizine, isoquinoline, quinoline, phthalazine, naphthylpyridine, quinoxaline, quinazoline, cinnoline, pteridine, carbazole, carboline, phenanthridine, acridine, phenanthroline, isothiazole, phenazine, isoxazole, phenoxazine, phenothiazine, imidazolidine, imidazoline, piperidine, piperazine, indoline, phthalimide, 1,2,3,4-tetrahydroisoquinoline, 4,5,6,7-tetrahydrobenzo[b]thiophene, thiazole, thiazolidine, thiophene, benzo[b]thiophene, morpholinyl, thiomorpholinyl (also referred to as thiamorpholinyl), 1, 1-dioxothiomorpholinyl, piperidinyl, pyrrolidine, and tetrahy drofuranyl .
[0099] "Nitro" refers to the group -N02.
[0100] "Oxo" refers to the atom (=0).
[0101] Phenylene refers to a divalent aryl ring, where the ring contains 6 carbon atoms.
[0102] Substituted phenylene refers to phenylenes which are substituted with 1 to 4, preferably 1 to 3, or more preferably 1 to 2 substituents selected from the group consisting of alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, alkoxy, substituted alkoxy, acyl, acylamino, acyloxy, amino, substituted amino, aminocarbonyl,
aminothiocarbonyl, aminocarbonylamino, aminothiocarbonylamino, aminocarbonyloxy, aminosulfonyl, aminosulfonyloxy, aminosulfonylamino, amidino, aryl, substituted aryl, aryloxy, substituted aryloxy, arylthio, substituted arylthio, carboxyl, carboxyl ester, (carboxyl ester)amino, (carboxyl ester)oxy, cyano, cycloalkyl, substituted cycloalkyl, cycloalkyloxy, substituted cycloalkyloxy, cycloalkylthio, substituted cycloalkylthio, cycloalkenyl, substituted cycloalkenyl, cycloalkenyloxy, substituted cycloalkenyloxy, cycloalkenylthio, substituted cycloalkenylthio, guanidino, substituted guanidino, halo, hydroxy, heteroaryl, substituted heteroaryl, heteroaryloxy, substituted heteroaryloxy, heteroarylthio, substituted heteroarylthio, heterocyclic, substituted heterocyclic, heterocyclyloxy, substituted
heterocyclyloxy, heterocyclylthio, substituted heterocyclylthio, nitro, SO3H, substituted sulfonyl, substituted sulfonyloxy, thioacyl, thiol, alkylthio, and substituted alkylthio, wherein said substituents are as defined herein.
[0103] "Spirocycloalkyl" and "spiro ring systems" refers to divalent cyclic groups from 3 to 10 carbon atoms having a cycloalkyl or heterocycloalkyl ring with a spiro union (the union formed by a single atom which is the only common member of the rings) as exemplified by the following structure:
[0104] "Sulfonyl" refers to the divalent group -S(0)2-.
[0105] "Substituted sulfonyl" refers to the group -S02-alkyl, -S02-substituted
alkyl, -S02-alkenyl, -S02-substituted alkenyl, -S02-cycloalkyl, -S02-substituted
cylcoalkyl, -S02-cycloalkenyl, -S02-substituted cylcoalkenyl, -S02-aryl, -S02-substituted aryl, -S02-heteroaryl, -S02-substituted heteroaryl, -S02-heterocyclic, -S02-substituted heterocyclic, wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein. Substituted sulfonyl includes groups such as methyl-S02-, phenyl-S02-, and 4-methylphenyl-S02-.
[0106] "Substituted sulfonyloxy" refers to the group -OS02-alkyl, -OS02-substituted alkyl, -OS02-alkenyl, -OS02-substituted alkenyl, -OS02-cycloalkyl, -OS02-substituted cylcoalkyl, -OS02-cycloalkenyl, -OS02-substituted
cylcoalkenyl,-OS02-aryl, -OS02-substituted aryl, -OS02-heteroaryl, -OS02-substituted heteroaryl, -OS02-heterocyclic, -OS02-substituted heterocyclic, wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0107] "Thioacyl" refers to the groups H-C(S)-, alkyl-C(S)-, substituted alkyl-C(S)-, alkenyl-C(S)-, substituted alkenyl-C(S)-, alkynyl-C(S)-, substituted alkynyl-C(S)-, cycloalkyl-C(S)-, substituted cycloalkyl-C(S)-, cycloalkenyl-C(S)-, substituted
cycloalkenyl-C(S)-, aryl-C(S)-, substituted aryl-C(S)-, heteroaryl-C(S)-, substituted heteroaryl-C(S)-, heterocyclic-C(S)-, and substituted heterocyclic-C(S)-, wherein alkyl, substituted alkyl, alkenyl, substituted alkenyl, alkynyl, substituted alkynyl, cycloalkyl, substituted cycloalkyl, cycloalkenyl, substituted cycloalkenyl, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocyclic, and substituted heterocyclic are as defined herein.
[0108] "Thiol" refers to the group -SH.
[0109] "Thiocarbonyl" refers to the divalent group -C(S)- which is equivalent to -C(=S)-.
[0110] "Thioxo" refers to the atom (=S).
[0111] "Alkylthio" refers to the group -S-alkyl wherein alkyl is as defined herein.
[0112] "Substituted alkylthio" refers to the group -S-(substituted alkyl) wherein substituted alkyl is as defined herein.
[0113] "Optionally substituted" refers to a group selected from that group and a substituted form of that group. Substituted groups are defined herein. In one embodiment, subtituents are selected from Ci-Ci0 or Ci-C6 alkyl, C2-C6 alkenyl, C2-C6 alkynyl, C6-Ci0 aryl, C3-C8 cycloalkyl, C2-C10 heterocyclyl, C1-C10 heteroaryl, halo, -N3, nitro, cyano, -CO2H or a Ci-C6 alkyl ester thereof.
[0114] "Tautomer" refer to alternate forms of a compound that differ in the position of a proton, such as enol-keto and imine-enamine tautomers, or the tautomeric forms of heteroaryl groups containing a ring atom attached to both a ring - H- moiety and a ring =N- moiety such as pyrazoles, imidazoles, benzimidazoles, triazoles, and tetrazoles.
[0115] As used herein, the term stereochemically pure denotes a compound which has 80% or greater by weight of the indicated stereoisomer and 20% or less by weight of other stereoisomers. In a further embodiment, the compound of Formula (I), (II), or (III) has 90%
or greater by weight of the stated stereoisomer and 10% or less by weight of other stereoisomers. In a yet further embodiment, the compound of Formula (I), (II), or (III) has 95% or greater by weight of the stated stereoisomer and 5% or less by weight of other stereoisomers. In a still further embodiment, the compound of formula (I), (II), or (III) has 97%) or greater by weight of the stated stereoisomer and 3% or less by weight of other stereoisomers.
[0116] "Pharmaceutically acceptable salt" refers to salts of a compound, which salts are suitable for pharmaceutical use and are derived from a variety of organic and inorganic counter ions well known in the art and include, when the compound contains an acidic functionality, by way of example only, sodium, potassium, calcium, magnesium, ammonium, and tetraalkylammonium; and when the molecule contains a basic functionality, salts of organic or inorganic acids, such as hydrochloride, hydrobromide, tartrate, mesylate, acetate, maleate, and oxalate (see Stahl and Wermuth, eds., "Handbook of Pharmaceutically
Acceptable Salts," (2002), Verlag Helvetica Chimica Acta, Ziirich, Switzerland), for a discussion of pharmaceutical salts, their selection, preparation, and use.
[0117] Generally, pharmaceutically acceptable salts are those salts that retain substantially one or more of the desired pharmacological activities of the parent compound and which are suitable for in vivo administration. Pharmaceutically acceptable salts include acid addition salts formed with inorganic acids or organic acids. Inorganic acids suitable for forming pharmaceutically acceptable acid addition salts include, by way of example and not limitation, hydrohalide acids {e.g., hydrochloric acid, hydrobromic acid, hydroiodic acid, etc.), sulfuric acid, nitric acid, phosphoric acid, and the like.
[0118] Organic acids suitable for forming pharmaceutically acceptable acid addition salts include, by way of example and not limitation, acetic acid, trifluoroacetic acid, propionic acid, hexanoic acid, cyclopentanepropionic acid, glycolic acid, oxalic acid, pyruvic acid, lactic acid, malonic acid, succinic acid, malic acid, maleic acid, fumaric acid, tartaric acid, citric acid, palmitic acid, benzoic acid, 3-(4-hydroxybenzoyl) benzoic acid, cinnamic acid, mandelic acid, alkylsulfonic acids {e.g., methanesulfonic acid, ethanesulfonic acid, 1,2- ethane-disulfonic acid, 2-hydroxy ethanesulfonic acid, etc.), arylsulfonic acids {e.g., benzenesulfonic acid, 4-chlorobenzenesulfonic acid, 2-naphthalenesulfonic acid, 4- toluenesulfonic acid, camphorsulfonic acid, etc.), glutamic acid, hydroxynaphthoic acid, salicylic acid, stearic acid, muconic acid, and the like.
[0119] Pharmaceutically acceptable salts also include salts formed when an acidic proton present in the parent compound is either replaced by a metal ion (e.g., an alkali metal ion, an alkaline earth metal ion, or an aluminum ion) or by an ammonium ion (e.g., an ammonium ion derived from an organic base, such as, ethanolamine, diethanolamine, triethanolamine, morpholine, piperidine, dimethylamine, diethylamine, triethylamine, and ammonia).
[0120] A solvate of a compound is a solid-form of a compound that crystallizes with less than one, one or more than one molecules of a solvent inside in the crystal lattice. A few examples of solvents that can be used to create solvates, such as pharmaceutically acceptable solvates, include, but are not limited to, water, Ci-C6 alcohols (such as methanol, ethanol, isopropanol, butanol, and can be optionally substituted) in general, tetrahydrofuran, acetone, ethylene glycol, propylene glycol, acetic acid, formic acid, and solvent mixtures thereof. Other such biocompatible solvents which may aid in making a pharmaceutically acceptable solvate are well known in the art. Additionally, various organic and inorganic acids and bases can be added to create a desired solvate. Such acids and bases are known in the art. When the solvent is water, the solvate can be referred to as a hydrate. In some embodiments, one molecule of a compound can form a solvate with from 0.1 to 5 molecules of a solvent, such as 0.5 molecules of a solvent (hemisolvate, such as hemihydrate), one molecule of a solvent (monosolvate, such as monohydrate) and 2 molecules of a solvent (disolvate, such as dihydrate).
[0121] An "effective amount" is an amount sufficient to effect beneficial or desired results. An effective amount can be administered in one or more administrations, applications or dosages and is determined by the system in which the drug or compound is delivered, e.g., an effective amount for in vitro purposes is not the same as an effective amount for in vivo purposes. For in vivo purposes, the delivery and "effective amount" is dependent on a number of variables including the time period for which the individual dosage unit is to be used, the bioavailability of the therapeutic agent, the route of administration, etc. It is understood, however, that specific dose levels of the therapeutic agents disclosed herein for any particular subject depends upon a variety of factors including the activity of the specific compound employed, bioavailability of the compound, the route of administration, the age of the animal and its body weight, general health, sex, the diet of the animal, the time of administration, the rate of excretion, the drug combination, and the severity of the particular disorder being treated and form of administration. In general, one will desire to administer an amount of the compound that is effective to achieve a serum level commensurate with the
concentrations found to be effective in vivo. These considerations, as well as effective formulations and administration procedures are well known in the art and are described in standard textbooks.
[0122] As used herein, "treating" or "treatment" of a disease in a patient refers to (1) preventing the symptoms or disease from occurring in an animal that is predisposed or does not yet display symptoms of the disease; (2) inhibiting the disease or arresting its
development; or (3) ameliorating or causing regression of the disease or the symptoms of the disease. As understood in the art, "treatment" is an approach for obtaining beneficial or desired results, including clinical results. For the purposes of this technology, beneficial or desired results can include one or more, but are not limited to, alleviation or amelioration of one or more symptoms, diminishment of extent of a condition (including a disease), stabilized (i.e., not worsening) state of a condition (including disease), delay or slowing of condition (including disease), progression, amelioration or palliation of the condition
(including disease), states and remission (whether partial or total), whether detectable or undetectable.
[0123] As used herein, the term "polypeptide" refers to cell permeable peptides that can cross the cell membrane. Non-limiting examples of polypeptides include cationic polypeptides having from about 3 to about 30 amino acids having 5 or more positively charged amino acids, e.g., independently one or more of arginine or lysine. Other examples include: NH2- RRRRRRRRR-COOH, NH2-YGRKKRRQRRR-COOH, NH2- TRS SRAGLQFP VGRVHRLLRK-COOH, NH2-
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR-COOH, NH2- GRKKRRQRRRPPQ-COOH, NH2-WEAKLAKALAKALAKHLAKALAKALKACEA- COOH, NH2-INLKALAALAKKI-COOH, NH2-RQIKIWFQNRRMKWKKGG-COOH, NH2-KETWWETWWTEWSQPKKKRKV-COOH, NH2- KETWWETWWTEWSQPKKKRKV-COOH, and NH2-
YTIWMPENPRPGTPCDIFTNSRGKRASNG-COOH. In some embodiments, the polypeptide is represented by the variable P. In some embodiments, the polypeptide is attached to the carbonyl via its N-terminus. In some embodiments, the polypeptide is a lysine and/or arginine rich polypeptide. In some embodiments the polypeptide comprises 9-30 amino acid residues. Other cell permeable polypeptides that can cross the cell membrane are well-known in the art.
[0124] However, the proteins and polypeptides as used herein are not limited to human- derived proteins but may have an amino acid sequence derived from other animals, particularly, a warm-blooded animal (e.g., rat, guinea pig, mouse, chicken, rabbit, pig, sheep, cow, monkey, etc.).
[0125] "Poly adenosine diphosphate ribose (ADP) transferase activity" intends the activity of
Poly-(ADP-ribose) polymerases (PARPs) that are found mostly in eukaryotes and catalyze the transfer of multiple ADP-ribose molecules to target proteins. As with, mono- ADP ribosylation, the source of ADP-ribose is NAD÷. PARPs use a catalytic triad of His-Tyr-Glu to facilitate binding of NAD and positioning of the end of the existing poly-ADP ribose chain on the target protein; the Glu facilitates catalysis and formation of a (l->2) O- glycosidic linkage between two ribose molecules. There are several other enzymes that recognize poly-ADP ribose chains, hydro!yse them or form branches.
[0126] "Adenosine diphosphate ribose (ADP) ribosyltransferase activity" intends the intracellular action of the addition of one or more ADP-ribose moieties to a protein. It is a reversible post-translational modification that is involved in many cellular processes, including cell signaling, DNA repair, gene regulation and apoptosis. Improper ADP- ribosylation has been implicated in some forms of cancer.
[0127] "Nicotinamide adenine dinucleotide (NAD+) (also known as diphosphopyridine nucleotide (DPN+) and Coenzyme I) intends the coenzyme found in all cells. The compound is a dinucleotide, and it consists of two nucleotides joined through their phosphate groups, groups. The chemical structure is provide below:
[0128] A "signal reagent" intends an agent (chemical, biological or otherwise) that emits a detectable signal.
[0129] The term "ADP-ribosyltransferase inhibitor" intends a molecule or an agent that inhibits the activity of ADP-ribosyltransferease.
[0130] Poly (ADP-ribose) polymerase (PARP) is a family of proteins involved in a number of cellular processes such as DNA repair, genomic stability, and programmed cell death. The PARP family comprises 17 members. PARP is composed of four domains of interest: a DNA-binding domain, a caspase -cleaved domain, an auto-modification domain, and a catalytic domain. The DNA-binding domain is composed of two zinc finder motifs. In the presence of damaged DNA (base pair-excised), the DNA-binding domain will bind the DNA and induce a conformational shift. It has been hypothesized that this binding occurs independent of the other domains. The auto-modification domain is responsible for releasing the protein from the DNA after catalysis. As used herein "PARP" intends means all different PARP isoforms (>15) from human genome, such as PARP1, 2, 3, 4, 5A, 5B, 10, 14, 15, 16, etc. "Under conditions that favor a PARP catalyzed reaction" intends suitable temperature, salt and necessary co-factors for PARP to act on a substrate. Such conditions are known in the art, see, e.g., Jiang et al. (2010) J. Am. Chem. Soc. 132(27):9363-9372, and described herein.
[0131] As used herein, the term "detectable label" intends a directly or indirectly detectable compound or composition that is conjugated directly or indirectly to the composition to be detected, e.g., N-terminal histadine tags (N-His), magnetically active isotopes, e.g., 115Sn, 117Sn and 119Sn, a non-radioactive isotopes such as 13C and 15N, polynucleotide or protein such as an antibody so as to generate a "labeled" composition. The term also includes sequences conjugated to the polynucleotide that will provide a signal upon expression of the inserted sequences, such as green fluorescent protein (GFP) and the like. The label may be detectable by itself (e.g. radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable. The labels can be suitable for small scale detection or more suitable for high-throughput screening. As such, suitable labels include, but are not limited to magnetically active isotopes, non-radioactive isotopes, radioisotopes, fluorochromes, luminescent compounds, dyes, and proteins, including enzymes. The label may be simply detected or it may be quantified. A response that is simply detected generally comprises a response whose existence merely is confirmed, whereas a response that is quantified generally comprises a response having a quantifiable (e.g., numerically reportable) value such as an intensity, polarization, and/or other property. In luminescence or fluorescence assays, the detectable response may be generated directly using a luminophore or fluorophore
associated with an assay component actually involved in binding, or indirectly using a luminophore or fluorophore associated with another (e.g., reporter or indicator) component.
[0132] Examples of luminescent labels that produce signals include, but are not limited to bioluminescence and chemiluminescence. Detectable luminescence response generally comprises a change in, or an occurrence of, a luminescence signal. Suitable methods and luminophores for luminescently labeling assay components are known in the art and described for example in Haugland, Richard P. (1996) Handbook of Fluorescent Probes and Research Chemicals (6th ed.). Examples of luminescent probes include, but are not limited to, aequorin and luciferases.
[0133] Examples of suitable fluorescent labels include, but are not limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malacite green, stilbene, Lucifer Yellow, Cascade Blue™, and Texas Red. Other suitable optical dyes are described in the Haugland, Richard P. (1996) Handbook of Fluorescent Probes and Research Chemicals (6th ed.).
[0134] "Affinity label" as used herein refers to a compound, that may be appended to a protein or another compound so that the protein or other compound can be purified from its crude source using an affinity purification technique, for example affinity chromatography, wherein the purification processes selects for the affinity label and the protein or other compound appened thereto based on the label's interactions with an affinity matrix used for the purification. These interactions include, but are not limited to, antigen-antibody interactions, enzyme-substrate interactions, receptor-ligand interactions, hydrogen bonding, ionic interactions or electrostatic interactions. Non-limiting examples of affinity labels include chitin binding protein (CBP), maltose binding protein (MBP), Strep-tag, glutathione- S-transferase (GST), poly(His) tags, NE-tag, Spot-tag, albumin-binding protein (ABP), alkaline phosphatase (AP), AU epitopes, bacteriophage T7 or V5 epitope, HSV epitope, biotin-carboxy carrier protein, biotin, and bluetounge virus tag (B-tag). Non limiting examples of matrices include, but are not limited to, albumin/low pH, mAb/low pH, avidin or streptavidin/biotin or denaturation, calmodulin/EGTA or EGTA and high salt,
chloramphenicol/chloramphenicol, chitin, choline, methotrexate/folate, galactose, glutathione, and a divalent metal.
[0135] As used herein, the term "contacting" intends bringing the reagents into close proximity with each other so that a chemical or biochemical reaction can occur among the
reagents. In one aspect, the term intends admixing the components, either in a reaction vessel or on a plate or dish. In another aspect, it intends in vivo administration to a subject.
[0136] The term "binding" or "binds" as used herein are meant to include interactions between molecules that may be covalent or non-covalent which, in one embodiment, can be detected using, for example, a hybridization assay. The terms are also meant to include "binding" interactions between molecules. Interactions may be, for example, protein-protein, antibody-protein, protein-nucleic acid, protein-small molecule or small molecule-nucleic acid in nature. This binding can result in the formation of a "complex" comprising the interacting molecules. A "complex" refers to the binding of two or more molecules held together by covalent or non-covalent bonds, interactions or forces.
[0137] The term "polypeptide" is used interchangeably with the term "protein" and in its broadest sense refers to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics. The subunits may be linked by peptide bonds. In another embodiment, the subunit may be linked by other bonds, e.g., ester, ether, etc. As used herein the term "amino acid" refers to natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics. A peptide of three or more amino acids is commonly called an oligopeptide if the peptide chain is short. If the peptide chain is long, the peptide is commonly called a polypeptide or a protein. The term "peptide fragment," as used herein, also refers to a peptide chain.
[0138] It is to be inferred without explicit recitation and unless otherwise intended, that when the present invention relates to a polypeptide, protein, polynucleotide or antibody, an equivalent or a biologically equivalent of such is intended within the scope of this invention. As used herein, the term "biological equivalent thereof is intended to be synonymous with "equivalent thereof when referring to a reference protein, antibody, fragment, polypeptide or nucleic acid, intends those having minimal homology while still maintaining desired structure or functionality. Unless specifically recited herein, it is contemplated that any
polynucleotide, polypeptide or protein mentioned herein also includes equivalents thereof. In one aspect, an equivalent polynucleotide is one that hybridizes under stringent conditions to the polynucleotide or complement of the polynucleotide as described herein for use in the described methods. In another asect, an equivalent antibody or antigen binding polypeptide intends one that binds with at least 70 %, or alternatively at least 75 %, or alternatively at least 80 %, or alternatively at least 85 %, or alternatively at least 90 %, or alternatively at least 95 % affinity or higher affinity to a reference antibody or antigen binding fragment. In
another aspect, the equivalent thereof competes with the binding of the antibody or antigen binding fragment to its antigen under a competitive ELISA assay. In another aspect, an equivalent intends at least about 80 % homology or identity and alternatively, at least about 85 %, or alternatively at least about 90 %, or alternatively at least about 95 %, or alternatively 98 % percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid.
[0139] "Homology" or "identity" or "similarity" are synonymously and refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences. An "unrelated" or "non-homologous" sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences of the present invention.
Modes for Carrying Out the Disclosure
[0140] Provided herein are novel molecular tools to study protein ADP-ribosylation in live cells. The compounds provided herein can be in situ converted to NAD+ analogues as universal ART cofactors and will thus provide invaluable and generally applicable tools for non-invasive monitoring and tracking of global ADP-ribosylation with striking
spatiotemporal resolution (FIG 1). These novel chemical tools can be applied virtually to any types of primary or established cells and even organisms for in vitro and in vivo functionally exploring ADP-ribosylation across entire ART superfamily.
Compounds
[0141] In one aspect, provided herein is a compound of Formula (I-A):
(I-A)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the
foregoing, wherein: each R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C2-C10 alkynyl, an optionally substituted C1-C10 alkoxy, -SR30, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z; X5 is -S-, -0-, or - R20-; each R20 and R30 is independently a hydrogen or an optionally substituted C1-C10 alkyl; Z is
each n is independently 1, 2, 3 or 4 or 1-4; each Y is independently a hydrogen, - NO2, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, an each Y20 is independently selected from the group consisting of:
Y is a hydrogen, an optionally substituted Ci-C6 alkyl, an optionally substituted C2- Cio alkenyl, an optionally substituted C2-Ci0 alkynyl, an optionally substituted C6-Ci0 aryl, an optionally substituted 5-15 membered heteroaiyl, or -I^Y35; L1 is -Ρ02-, -Ρ03-Ρ02-, -P03- Ρ03-Ρ02-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -
P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is independently -O ©, an optionally substituted Ci-Cio alkyl group, or an optionally substituted Ci-Cio alkoxy; and Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy, and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
[0142] In some embodiments, each n is independently 1, 3, or 4.
[0143] In one aspect, provided herein is a compound of Formula (I-A):
(I-A)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C2-Ci0 alkynyl, an optionally substituted Ci-Cio alkoxy, -SR30, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z; X5 is -S-, -0-, or -NR20-; each R20 and R30 is independently a hydrogen or an optionally substituted Ci-Cio alkyl; Z is
each n is independently 1, 2, 3 or 4; each Y is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, an each Y20 is independently selected from the group consisting of:
Y is a hydrogen, an optionally substituted Ci-C6 alkyl, an optionally substituted C Cio alkenyl, an optionally substituted C2-C10 alkynyl, an optionally substituted C6-Cio aryl, optionally substituted 5-15 membered heteroaryl, or -I^Y35; L1 is -PO2-, -PO3-PO2-, -PO3- PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -
P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is independently -θ Θ, αη optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy; and Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy; and and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues
[0144] In some embodiments, each n is independently 1, 3, or 4.
(I-AA)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein the variables are as defined as in any of the above embodiments.
[0146] In one aspect, provided herein is a compound of Formula (I-B):
(I-B)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C2-C10 alkynyl, an optionally substituted C1-C10 alkoxy, -SR30, an optionally substituted C6-Ci0 aryl, an optionally substituted 5-15 membered heteroaryl, or Z; X5 is -S-, -0-, or -NR20-; each R20 and R30 is independently a hydrogen or an optionally substituted C1-C10 alkyl; Z is
each n is independently 1, 2, 3, or 4; each Y is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
L5 is a hydrogen, an optionally substituted Ci-C6 alkyl, or -I^Y35; L1 is -P02-, -PO3- PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or - P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is independently -θ Θ, αη optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy; and Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy, and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
[0147] In some embodiments, each n is independently 1, 3, or 4.
[0148] In one aspect, provided herein is a compound of Formula (I-B):
(I-B)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C2-Ci0 alkynyl, an optionally substituted Ci-Cio alkoxy, -SR30, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z; X5 is -S-, -0-, or -NR20-; each R20 and R30 is independently a hydrogen or an optionally substituted Ci-Cio alkyl; Z is
each n is independently 1, 2, 3, or 4; each Y is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
L5 is a hydrogen, an optionally substituted Ci-C6 alkyl, or -I^Y35; L1 is -P02-, -PO3- PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or - P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is independently -θΘ, αη optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy; and Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
[0149] In some embodiments, each n is independently 1, 3, or 4.
(I-BB)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein the variables are as defined in any of the embodiments above.
[0151] In one aspect, provided herein is a compound of Formula (I-C):
(I-C)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted Ci-C6 alkyl or Z; X is -S-, -0-, or -NR20-; R20 is a hydrogen or an optionally substituted Ci-Cio alkyl; Z is
each n is independently 1, 2, 3, or 4; each Y is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
Y is a hydrogen, an optionally substituted Ci-C6 alkyl, an optionally substituted C2- Cio alkenyl, an optionally substituted C2-Cio alkynyl, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaiyl, or -I^Y35; L1 is -Ρ02-, -Ρ03-Ρ02-, -P03- Ρ03-Ρ02-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -
P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is independently -O © , an optionally substituted Ci-Cio alkyl group, or an optionally substituted Ci-Cio alkoxy; and Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy, and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
[0152] In some embodiments, each n is independently 1, 3, or 4.
(I-C)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted Ci-C6 alkyl or Z; X is -S-, -0-, or -NR20-; R20 is a hydrogen or an optionally substituted Ci-Cio alkyl;
Z is
each n is independently 1, 2, 3, or 4; each Y is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
Y is a hydrogen, an optionally substituted Ci-C6 alkyl, an optionally substituted C2- Cio alkenyl, an optionally substituted C2-Cio alkynyl, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or -I^Y35; L1 is -Ρ02-, -Ρ03-Ρ02-, -P03- Ρ03-Ρ02-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -
P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is independently -O ©, an optionally substituted Ci-Cio alkyl group, or an optionally substituted Ci-Cio alkoxy; Y35 is a hydroxyl
or an optionally substituted Ci-C6 alkoxy and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
[0154] In some embodiments, each n is independently 1, 3, or 4.
[0155] In some embodiments, the compound of Formula (I-C) is of Formula (I-CC):
(I-CC)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein the variables are as defined as in any of the embodiments above.
[0156] In one aspect, provided herein is a compound of Formula (I-D):
(I-D)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted Ci-C6 alkyl or Z; X is -S-, -0-, or -NR20-; R20 is a hydrogen or an optionally substituted Ci-Cio alkyl;
L10 is a hydrogen, an optionally substituted Ci-C6 alkyl, or -I^Y35; L1 is -Ρ02-, -Ρ03-Ρ02-, - Ρ03-Ρ03-Ρ02-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or - P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is independently -O ©, an optionally substituted Ci-Cio alkyl group, or an optionally substituted Ci-Cio alkoxy; Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy, and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues;
Z is
each n is independently 1, 2, 3, or 4;
each Y15 is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy;
each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
(I-D)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted Ci-C6 alkyl or Z; X is -S-, -0-, or -NR20-; R20 is a hydrogen or an optionally substituted Ci-Cio alkyl; L10 is a hydrogen, an optionally substituted Ci-C6 alkyl, or -I^Y35;
L1 is -PO2-, -PO3-PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; each R100 is independently -O Θ , an optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy; Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy.
Z is
each n is independently 1, 2, 3, or 4; each Y is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
(I-DD)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein the variables are as defined in any of the embodiments above.
[0161] In one aspect, provided herein is a compound of Formula (I):
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted Ci-C6 alkyl or Z; X is -S-, -0-, or -NR20-; X5 is -S-, -0-, or -NR20-; L1 is -P02-, - PO3-PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -
P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-; R100 is -O ©, an optionally substituted Ci-Cio alky- group, or an optionally substituted Ci-Cio alkoxy; each R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C2-Ci0 alkynyl, an optionally substituted Ci-Cio alkoxy, -SR30, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z;
Z is
each n is independently 1, 2, 3, or 4; efach Y is independently a hydrogen, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
each R20 and R30 is independently a hydrogen or an optionally substituted Ci-Cio alkyl and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
[0162] In some embodiments, each n is independently 1, 3, or 4.
[0163] In one aspect, provided herein is a compound of Formula (I):
(I)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein: each R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted C C6 alkyl or Z; X is -S-, -0-, or -NR20-; X5 is -S-, -0-, or -NR20-; L1 is -P02-, - PO3-PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or - P(=O)(R100)OP(=O)(R100)OP(=O)(R100); R100 is -O© , an optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy; each R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted C1-C10 alkyl, an optionally substituted C2-C10 alkynyl, an optionally substituted C1-C10 alkoxy, -SR30, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z;
Z is
each n is independently 1, 2, 3, or 4; each Y is independently a hydrogen, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
each R20 and R30 is independently a hydrogen or an optionally substituted Ci-Cio and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
[0164] In some embodiments, each n is independently 1, 3, or 4.
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein the variables are as defined in any of the above embodiments.
[0166] In some embodiments, the compound of Formula (I) is of Formula (III):
(III)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein the variables are as defined in any of the above embodiments.
[0167] In some embodiments, R1 is a hydrogen. In some embodiments, R1 is an optionally substituted Ci-C6 alkyl. In some embodiments, R1 is Z.
[0168] In some embodiments, R2 is a hydrogen. In some embodiments, R2 is an optionally substituted Ci-C6 alkyl. In some embodiments, R2 is Z.
[0169] In some embodiments, R3 is a hydrogen. In some embodiments, R3 is an optionally substituted Ci-C6 alkyl. In some embodiments, R3 is Z.
[0170] In some embodiments, R4 is a hydrogen. In some embodiments, R4 is an optionally substituted Ci-C6 alkyl. In some embodiments, R4 is Z.
[0171] In some embodiments, X is -S-. In some embodiments, X is -0-. In some embodiments, X is - R20-.
[0172] In some embodiments, X5 is -S-. In some embodiments, X5 is -0-. In some embodiments, X5 is -NR20-.
[0173] In some embodiments, L1 is -PO2-. In some embodiments, L1 is -PO3-PO2-. In some embodiments, L1 is -PO3-PO3-PO2-. In some embodiments, L1 is -P(=0)(R100)-. In some embodiments, L1 is -P(=O)(R100)OP(=O)(R100)-. In some embodiments, L1 is - P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-.
[0174] In some embodiments, R5 is a hydrogen. In some embodiments, R5 is -N3. In some embodiments, R5 is a hydroxyl. In some embodiments, R5 is an optionally substituted C1-C10 alkyl. In some embodiments, R5 is an optionally substituted C2-C10 alkynyl. In some embodiments, R5 is an optionally substituted C1-C10 alkoxy. In some embodiments, R5 is - SR30. In some embodiments, R is an optionally substituted C6-Cio aryl. In some
embodiments, R5 is an optionally substituted 5-15 membered heteroaryl. In some embodiments, R5 is Z.
[0175] In some embodiments, R6 is a hydrogen. In some embodiments, R6 is -N3. In some embodiments, R6 is a hydroxyl. In some embodiments, R6 is an optionally substituted C1-C10 alkyl. In some embodiments, R6 is an optionally substituted C2-C10 alkynyl. In some embodiments, R6 is an optionally substituted C1-C10 alkoxy. In some embodiments, R6 is - SR30. In some embodiments, R is an optionally substituted C6-Cio aryl. In some
embodiments, R6 is an optionally substituted 5-15 membered heteroaryl. In some embodiments, R6 is Z.
[0176] In some embodiments, R7 is a hydrogen. In some embodiments, R7 is -N3. In some embodiments, R7 is a hydroxyl. In some embodiments, R7 is an optionally substituted C1-C10 alkyl. In some embodiments, R7 is an optionally substituted C2-C10 alkynyl. In some embodiments, R7 is an optionally substituted C1-C10 alkoxy. In some embodiments, R7 is -
SR . In some embodiments, R is an optionally substituted C6-Cio aryl. In some
embodiments, R7 is an optionally substituted 5-15 membered heteroaiyl. In some embodiments, R7 is Z.
[0177] In some embodiments, R8 is a hydrogen. In some embodiments, R8 is -N3. In some embodiments, R8 is a hydroxyl. In some embodiments, R8 is an optionally substituted Ci-Cio alkyl. In some embodiments, R8 is an optionally substituted C2-Ci0 alkynyl. In some embodiments, R8 is an optionally substituted Ci-Cio alkoxy. In some embodiments, R8 is - SR30. In some embodiments, R is an optionally substituted C6-Cio aryl. In some
embodiments, R8 is an optionally substituted 5-15 membered heteroaiyl. In some embodiments, R8 is Z.
[0178] In some embodiments, R9 is a hydrogen. In some embodiments, R9 is -N3. In some embodiments, R9 is a hydroxyl. In some embodiments, R9 is an optionally substituted Ci-Ci0 alkyl. In some embodiments, R9 is an optionally substituted C2-Cio alkynyl. In some embodiments, R9 is an optionally substituted Ci-Cio alkoxy. In some embodiments, R9 is - SR30. In some embodiments, R is an optionally substituted C6-Cio aryl. In some
embodiments, R9 is an optionally substituted 5-15 membered heteroaiyl. In some embodiments, R9 is Z.
[0179] In some embodiments, R7, R9 and R11 are each hydrogen.
[0180] In some embodiments, R10 is a hydrogen. In some embodiments, R10 is -N3. In some embodiments, R10 is a hydroxyl. In some embodiments, R10 is an optionally substituted Ci- Cio alkyl. In some embodiments, R10 is an optionally substituted C2-Ci0 alkynyl. In some embodiments, R10 is an optionally substituted Ci-Cio alkoxy. In some embodiments, R10 is - SR30. In some embodiments, R is an optionally substituted C6-Cio aryl. In some embodiments, R10 is an optionally substituted 5-15 membered heteroaiyl. In some embodiments, R10 is Z.
[0181] In some embodiments, R11 is a hydrogen. In some embodiments, R11 is -N3. In some embodiments, R11 is a hydroxyl. In some embodiments, R11 is an optionally substituted Ci- Cio alkyl. In some embodiments, R11 is an optionally substituted C2-Cio alkynyl. In some embodiments, R11 is an optionally substituted Ci-Cio alkoxy. In some embodiments, R11 is - SR30. In some embodiments, R is an optionally substituted C6-Cio aryl. In some embodiments, R11 is an optionally substituted 5-15 membered heteroaiyl. In some embodiments, R11 is Z.
[0182] In some embodiments, R100 is -O © . In some embodiments, R100 is an optionally substituted Ci-Cio alkyl group. In some embodiments, R100 is an optionally substituted Ci- Cio alkoxy. In some embodiments, R100 is a methyl. In some embodiments, R100 is a methoxy. In some embodiments, R100 is a Ci-Cio alkyl group optionally substituted with a C2 alkynyl. In some embodiments, R100 is a Ci-C6 alkyl group optionally substituted with a C2 alkynyl. In some embodiments, R100 is
[0183] In some embodiments, R is selected from the group consisting of:
[0184] In some embodiments, R is a methyl. In some embodiments, R is an optionally substituted methyl. In some embodiments, R100 is a methoxy. In some embodiments, R100 is an optionally substituted methoxy.
[0185] In some embodiments, R20 is a hydrogen. In some embodiments, R20 is an optionally substituted Ci-Cio alkyl.
[0186] In some embodiments, R30 is a hydrogen. In some embodiments, R30 is an optionally substituted Ci-Cio alkyl.
0187] In some embodiments, Z is
Wherein: each Y is independently a hydrogen, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy; each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
and polypeptide is a cationic polypeptide having about 5 to 30 amino acid residues.
[0189] In some embodiments, Z is
[0190] In some embodiments, Z is
[0191] In some embodiments, each Y is independently a hydrogen. In some embodiments, each Y15 is independently a -N02. In some embodiments, each Y15 is independently a halo. In some embodiments, each Y15 is independently a cyano. In some embodiments, each Y15 is independently a hydroxyl. In some embodiments, each Y15 is independently an optionally substituted Ci-C6 alkyl. In some embodiments, each Y15 is independently an optionally substituted Ci-C6 alkoxy.
[0192] In some embodiments, each Y25 is independently a hydrogen. In some embodiments, each Y25 is independently an optionally substituted Ci-C6 alkyl.
[0198] In some embodiments, each Y is independently
[0203] In some embodiments, Z is
[0205] In some embodiments, n is 1, 2, 3, or 4. In some embodiments, n is 1, 3, or 4. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4.
[0206] In some embodiments, each Y15 is independently a hydrogen. In some embodiments, each Y15 is independently a -N02. In some embodiments, each Y15 is independently a halo. In some embodiments, each Y15 is independently a cyano. In some embodiments, each Y15 is independently a hydroxyl. In some embodiments, each Y15 is independently an optionally substituted Ci-C6 alkyl. In some embodiments, each Y15 is independently an optionally substituted Ci-C6 alkoxy.
[0207] In some embodiments, each Y25 is independently a hydrogen. In some embodiments, each Y25 is independently an optionally substituted Ci-C6 alkyl.
[0208] In some embodiments each Y20 is independently:
[0212] In some embodiments, each Y20 is independently:
[0213] In some embodiments, Z is:
[0214] In some embodiments, Y is a hydrogen. In some embodiments, Y is an optionally substituted Ci-C6 alkyl. In some embodiments, Y40 is an optionally substituted C2-C10 alkenyl. In some embodiments, Y40 is an optionally substituted C2-C10 alkynyl. In some embodiments, Y40 is an optionally substituted C6-Ci0 aryl. In some embodiments, Y40 is an optionally substituted 5-15 membered heteroaryl. In some embodiments, Y40 is -I^Y35, wherein L1 is as defined above. In some embodiments, Y35 is a hydroxyl. In some embodiments, Y35 is an optionally substituted Ci-C6 alkoxy.
[0215] In some embodiments, L5 is a hydrogen. In some embodiments, L5 is an optionally substituted Ci-C6 alkyl. In some embodiments, L5 is -I^Y35, wherein each of L1 and Y35 are as defined as above.
[0216] In some embodiments, Y30 is a hydrogen. In some embodiments, Y30 is an optionally substituted Ci-C6 alkyl. In some embodiments, Y30 is an optionally substituted C2-Ci0 alkenyl. In some embodiments, Y30 is an optionally substituted C2-C10 alkynyl. In some embodiments, Y30 is an optionally substituted C6-Cio aryl. In some embodiments, Y30 is an optionally substituted 5-15 membered heteroaryl. In some embodiments, Y30 is -I^Y35, wherein each of L1 and Y35 are as defined above
[0217] In some embodiments, L10 is a hydrogen. In some embodiments, L10 is an optionally substituted Ci-C6 alkyl. In some embodiments, L10 is -I^Y35, wherein each of L1 and Y35 are as defined as above.
[0218] In some embodiments, R3 and R4 are H or Z. In some embodiments, R3 and R4 are H. In some embodiments, R3 and R4 are Z.
[0219] In some embodiments, R1 and R2 are H or Z. In some embodiments, R1 and R2 are H. In some embodiments, R1 and R2 are Z.
[0220] In some embodiments, X is O.
[0221] In some embodiments, X5 is O.
[0222] In some embodiments, L1 is -P02- or -PO3-PO2-. In some embodiments, L1 is -PO3-
[0223] In some embodiments, each R5, R6, R7, R8, R9, R10, and R11 is independently selected from -N3, a hydroxyl, an optionally substituted C2-C10 alkynyl, an optionally substituted Ci- C10 alkoxy, -SR30, an optionally substituted 5-15 membered heteroaryl, or Z.
[0224] In some embodiments, at least one of R6 and R7 and at least one of R8 and R9 is independently selected from -N3, a hydroxyl, an optionally substituted C2-C10 alkynyl, an
optionally substituted Ci-Cio alkoxy, -SR , an optionally substituted 5-15 membered heteroaryl, or Z.
[0225] In some embodiments, R6 and R8 is independently selected from -N3, a hydroxyl, an optionally substituted C2-C10 alkynyl, an optionally substituted C1-C10 alkoxy, -SR30, an optionally substituted 5-15 membered heteroaryl, or Z.
[0226] In some embodiments, each R5, R6, R7, R8, R9, R10, and R11 is independently selected from -N3, a hydroxyl, an optionally substituted C2-C10 alkoxy, or an optionally substituted 5- 15 membered heteroaryl.
[0227] In some embodiments, at least one of R6 and R7 and at least one of R8 and R9 is independently selected from -N3, a hydroxyl, an optionally substituted C2-Ci0 alkoxy, or an optionally substituted 5-15 membered heteroaryl.
[0228] In some embodiments, R6 and R8 is independently selected from -N3, a hydroxyl, an optionally substituted C2-C10 alkoxy, or an optionally substituted 5-15 membered heteroaryl.
[0229] In some embodiments, the optionally substituted 5-15 membered heteroaryl is an optionally substituted 6-10 membered heteroaryl. In some embodiments, the 6-10 membered heteroaryl is optionally substituted with one, two, three, four, or five R15 groups, as defined below. In some embodiments, the 6-10 membered heteroaryl is optionally substituted with an aminocarbonyl group.
[0230] In some embodiments, the optionally substituted 5-15 membered heteroaryl is an optionally substituted 6 membered heteroaryl. In some embodiments, the 6 membered heteroaryl is optionally substituted with one, two, three, four, or five R15 groups, as defined below. In some embodiments, the 6 membered heteroaryl is optionally substituted with an aminocarbonyl group.
[0231] In some embodiments, the optionally substituted 5-15 membered heteroaryl is an optionally substituted pyridyl. In some embodiments, the pyridyl group is optionally substituted with one, two, three, four, or five R15 groups, as defined below. In some embodiments, the pyridyl is optionally substituted with an aminocarbonyl group.
[0232] In some embodiments, the o tionally substituted 5-15 membered heteroaryl is:
wherein R15 is -C(O) R60R61, -OC(O) R60R61, -C(S) R60R61, or -OC(S) R60R61.
[0233] In some embodiments, R15 is -C(O) R60R61. In some embodiments, R15 is - OC(O) R60R61. In some embodiments, R15 is -C(S) R60R61. In some embodiments, R15 is - OC(S) R60R61.
[0234] In some embodiments, each R60 and R61 is a hydrogen or an optionally substituted Ci- C6 alkyl. In some embodiments, R60 is a hydrogen. In some embodiments, R60 is an optionally substituted Ci-C6 alkyl. In some embodiments, R61 is a hydrogen. In some embodiments, R61 is an optionally substituted Ci-C6 alkyl. In some embodiments, R60 and R61 are hydrogen.
[0235] In some embodiments, each R5, R6, R7, R8, R9, R10, and R11 independently is selected from the roup consisting of:
[0238] In some embodiments, at least one of R6 and R7 is a hydroxyl.
[0246] In some embodiments, at least one of R6 and R7 is:
[0247] In some embodiments at least one of R6 and R7 is:
[0248] In some embodiments, at least one of R6 and R7 is:
[0249] In some embodiments at least one of R6 and R7 is:
[0250] In some embodiments, at least one of R6 and R7 is -N3.
[0251] In some embodiments, at least one of R8 and R9 is hydroxyl.
[0252] In some embodiments, at least one of R8 and R9 is:
[0255] In some embodiments, at least one of R8 and R9 is:
[0258] In some embodiments, at least one of R8 and R9 is -N3.
[0259] In some embodiments, at least one of R6 , R8, and R10 IS .
[0260] In some embodiments, at least one of R6 and R8 is Z.
[0261] In some embodiments, R6 and R8 are hydroxyl.
wherein R is as defined above.
[0263] In some embodiments, R is
wherein R60 and R61 are as defined above.
wherein R is as defined above.
[0265] In some embodiments, R11 is
wherein R60 and R61 are as defined above.
[0266] In another aspect, provided herein is a compound selected from Tables 1-3 below.
Table 1
Table 2
[0267] In another aspect, provided herein is a compound selected from Tables 1-4.
Table 4
[0268] The compounds provided herein include individual, separated enantiomers and diastereomers that are stereochemically pure or enriched, tautomers, and pharmaceutically acceptable salts, and/or a solvate thereof, wherever applicable. As used herein, the term stereochemically pure denotes a compound which has 80% or greater by weight of the indicated stereoisomer and 20% or less by weight of other stereoisomers. In a further aspect, the compounds as described herein have 90% or greater by weight of the denoted
stereoisomer and 10% or less by weight of other stereoisomers. In a yet further embodiment, the compounds of this disclosure have 95% or greater by weight of the denoted stereoisomer and 5% or less by weight of other stereoisomers. In a still further embodiment, the compounds have 97% or greater by weight of the denoted stereoisomer and 3% or less by weight of other stereoisomers. Any one or more of the compounds can be provided as compositions, e.g., of pharmaceutically acceptable salt, and/or a solvate thereof.
Synthesis
[0269] The following general synthetic scheme is used to prepare the compounds provided herein. For example, compounds of formula I are synthesized as shown in the reaction scheme below:
[0270] These and other compounds provided herein are synthesized following art recognized methods with the appropriate substitution of commercially available reagents as needed. For example, and without limitation, methods for synthesizing certain other compounds are described in J. Am. Chem. Soc. 2015, 137, 3558-3564; Angew. Chem. Int. Ed. 2014, 53, 8159-8162; J. Am. Chem. Soc. 2014, 136, 5201-5204; Nucleosides, Nucleotides and Nucleic Acids, 2013, 32, 646-659; Bioorganic & Medicinal Chemistry Letters, 2002, 12, 1135-1137; and Biochemistry, 2009, 48, 2878-2890, each of which are incorporated herein by reference, which methods can be adapted by the skilled artisan upon reading this disclosure and/or based on synthetic methods well known in the art, to prepare the compounds provided herein. Protection deprotection methods and protecting groups useful for such purposes are well known in the art, for example in Greene's Protective Groups in Organic Synthesis, 4th Edition, Wiley, 2006, or a later edition of the book.
[0271] The compounds and the intermediates are separated from the reaction mixture, when desired, following art known methods such as crystallization, chromatography, distillation, and the like. The compounds and the intermediates are characterized by art known methods such as thin layer chromatography, nuclear magnetic resonance spectroscopy, high performance liquid chromatography, and the like. As described in detail herein, a racemic or diastereomeric mixture of the compound can be separated or enriched to the enantiomers and diastereomers and tested and used diagnostically or therapeutically as described herein.
[0272] Methods of testing and using the compounds provided herein are performed following art recognized in vitro (cell free), ex vivo or in vivo methods. For example, and without
limitation, certain methods for testing and using other compounds are described in Carter- O'Connell, L, Jin, H., Morgan, R. K., David, L. L., and Cohen, M. S. (2014) Engineering the substrate specificity of ADP-ribosyltransferases for identifying direct protein targets. J. Am. Chem. Soc. 136, 5201-5204; Gibson, B. A., Zhang, Y., Jiang, H., Hussey, K. M., Shrimp, J. H., Lin, H., Schwede, F., Yu, Y., and Kraus, W. L. (2016) Chemical genetic discovery of PARP targets reveals a role for PARP-1 in transcription elongation. Science 353, 45-50; Wallrodt, S., Buntz, A., Wang, Y., Zumbusch, A., and Marx, A. (2016) Bioorthogonally Functionalized NAD(+) Analogues for In-Cell Visualization of Poly(ADP-Ribose)
Formation. Angew. Chem. Int. Ed. Engl. 55, 7660-7664; and Buntz, A., Wallrodt, S., Gwosch, E., Schmalz, M., Beneke, S., Ferrando-May, E., Marx, A., and Zumbusch, A. (2016) Real-Time Cellular Imaging of Protein Poly(ADP-ribos)ylation. Angew. Chem. Int. Ed. Engl. 55, 1 1256-1 1260, each of which is incorporated herein by reference in its entirety, which methods can be adapted by the skilled artisan upon reading this disclosure and/or based on methods well known in the art, to test and use the compounds provided herein.
Compositions
[0273] Compositions, including pharmaceutical compositions comprising the compounds described herein can be manufactured by means of conventional mixing, dissolving, granulating, dragee-making levigating, emulsifying, encapsulating, entrapping, or
lyophilization processes. The compositions can be formulated in conventional manner using one or more physiologically acceptable carriers, diluents, excipients, or auxiliaries which facilitate processing of the compounds provided herein into preparations which can be used pharmaceutically.
[0274] The compounds of the technology can be administered by admixing in an in vitro system, parenteral (e.g., intramuscular, intraperitoneal, intravenous, ICV, intracisternal injection or infusion, subcutaneous injection, or implant), oral, by inhalation spray nasal, vaginal, rectal, sublingual, urethral (e.g., urethral suppository) or topical routes of
administration (e.g., gel, ointment, cream, aerosol, etc.) and can be formulated, alone or together, in suitable dosage unit formulations containing conventional non-toxic
pharmaceutically acceptable carriers, adjuvants, excipients, and vehicles appropriate for each route of administration.
[0275] In one embodiment, this disclosure relates to a composition comprising a compound as described herein and a carrier.
[0276] In another embodiment, this disclosure relates to a pharmaceutical composition comprising a compound as described herein and a pharmaceutically acceptable carrier.
[0277] In another embodiment, this disclosure relates to a pharmaceutical composition comprising a therapeutically effective amount of a compound as described herein and a pharmaceutically acceptable carrier.
[0278] The pharmaceutical compositions for the administration of the compounds can be conveniently presented in dosage unit form and can be prepared by any of the methods well known in the art of pharmacy. The pharmaceutical compositions can be, for example, prepared by uniformly and intimately bringing the compounds provided herein into association with a liquid carrier, a finely divided solid carrier or both, and then, if necessary, shaping the product into the desired formulation. In the pharmaceutical composition the compound provided herein is included in an amount sufficient to produce the desired therapeutic effect. For example, pharmaceutical compositions of this disclsoure may take a form suitable for virtually any mode of administration, including, for example, topical, ocular, oral, buccal, systemic, nasal, injection, infusion, transdermal, rectal, and vaginal, or a form suitable for administration by inhalation or insufflation.
[0279] For topical administration, the compounds can be formulated as solutions, gels, ointments, creams, suspensions, etc., as is well-known in the art.
[0280] Systemic formulations include those designed for administration by injection (e.g., subcutaneous, intravenous, infusion, intramuscular, intrathecal, or intraperitoneal injection) as well as those designed for transdermal, transmucosal, oral, or pulmonary administration.
[0281] Useful injectable preparations include sterile suspensions, solutions, or emulsions of the compounds provided herein in aqueous or oily vehicles. The compositions may also contain formulating agents, such as suspending, stabilizing, and/or dispersing agents. The formulations for injection can be presented in unit dosage form, e.g., in ampules or in multidose containers, and may contain added preservatives.
[0282] Alternatively, the injectable formulation can be provided in powder form for reconstitution with a suitable vehicle, including but not limited to sterile pyrogen free water, buffer, and dextrose solution, before use. To this end, the compounds provided herein can be dried by any art-known technique, such as lyophilization, and reconstituted prior to use.
[0283] For transmucosal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are known in the art.
[0284] For oral administration, the pharmaceutical compositions may take the form of, for example, lozenges, tablets, or capsules prepared by conventional means with
pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinised maize starch, polyvinylpyrrolidone, or hydroxypropyl methylcellulose); fillers (e.g., lactose, microcrystalline cellulose, or calcium hydrogen phosphate); lubricants (e.g., magnesium stearate, talc, or silica); disintegrants (e.g., potato starch or sodium starch glycolate); or wetting agents (e.g., sodium lauryl sulfate). The tablets can be coated by methods well known in the art with, for example, sugars, films, or enteric coatings.
[0285] Compositions intended for oral use can be prepared according to any method known to the art for the manufacture of pharmaceutical compositions, and such compositions may contain one or more agents selected from the group consisting of sweetening agents, flavoring agents, coloring agents, and preserving agents in order to provide pharmaceutically elegant and palatable preparations. Tablets contain the compounds provided herein in admixture with non-toxic pharmaceutically acceptable excipients which are suitable for the manufacture of tablets. These excipients can be for example, inert diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents (e.g., corn starch or alginic acid); binding agents (e.g. starch, gelatin, or acacia); and lubricating agents (e.g., magnesium stearate, stearic acid, or talc). The tablets can be left uncoated or they can be coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period. For example, a time delay material such as glyceryl
monostearate or glyceryl distearate can be employed. They may also be coated by the techniques well known to the skilled artisan. The pharmaceutical compositions of the technology may also be in the form of oil-in-water emulsions.
[0286] Liquid preparations for oral administration may take the form of, for example, elixirs, solutions, syrups, or suspensions, or they can be presented as a dry product for constitution with water or other suitable vehicle before use. Such liquid preparations can be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, cellulose derivatives, or hydrogenated edible fats); emulsifying agents (e.g., lecithin, or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol, cremophore™, or fractionated vegetable oils); and preservatives (e.g., methyl or
propyl-p-hydroxybenzoates or sorbic acid). The preparations may also contain buffer salts, preservatives, flavoring, coloring, and sweetening agents as appropriate.
Use of Compounds for Preparing Medicaments
[0287] The compounds and compositions of the present invention are also useful in the preparation of medicaments. The methods and techniques for preparing medicaments of a composition are known in the art. For the purpose of illustration only, pharmaceutical formulations and routes of delivery are detailed herein.
[0288] Thus, one of skill in the art would readily appreciate that any one or more of the compositions described above, including the many specific embodiments, can be used by applying standard pharmaceutical manufacturing procedures to prepare medicaments to treat the many disorders described herein. Such medicaments can be delivered to the subject by using delivery methods known in the pharmaceutical arts.
Methods of Use
[0289] The compositions and compounds as disclosed herein are useful in assay and detection methods in vitro in a cell-free system or in vivo in a cell or subject, wherein the cell-free system, in vivo in a cell or subject, also comprise a PARP enzyme and a possible substrate protein for the PARP enzyme.
[0290] In one aspect, provided herein are methods of monitoring and/or tracking ADP- ribosylation in the above-noted cell-free system, a cell, a live cell, a tissue or a subject. In one aspect, the subject is, or the cell is isolated from, or cultured from, an animal, e.g., a mammal such as a human, a murine, a canine, a feline, an equine, an ovine, or a bovine. In some embodiments, the subject is a human. The cells can be from commercially available or laboratory generated cell lines or isolated from a subject and used to monitor therapy, e.g., a tissue biopsy. Thus, the assays can be performed at various time points using samples isolated from the same subject.
[0291] The compositions and compounds as disclosed herein are useful in methods of identifying and profiling substrates of ADP-ribosyltransferases in a cell-free system, a cell, a tissue or a subject. The compositions and compounds as disclosed herein also are useful in methods of modulating enzymatic activities of ADP-ribosyltransferases in a cell-free system, a cell, a tissue or a subject.
[0292] The compositions and compounds as disclosed herein are useful in methods of modulating the levels, extents, and patterns of ADP-ribosylation in a subject in need thereof. In one aspect, the subject is, or the cell is isolated from, or cultured from, an animal, e.g., a human, a mammal such as a murine, a canine, a feline, an equine, an ovine, or a bovine.
[0293] The compositions and compounds as disclosed herein are useful in methods of modulating the metabolism of cellular NAD+ and its associated metabolic and signaling pathways in a cell-free system, a cell, a tissue or a subject. In one aspect, the subject is, or the cell is isolated from, or cultured from, an animal, e.g., a human, a mammal such as a murine, a canine, a feline, an equine, an ovine, or a bovine.
[0294] The compositions and compounds as disclosed herein are useful in methods of modulating post-translational modifications related to NAD+ cofactor in a cell-free system, a cell, a tissue or a subject. In one aspect, the subject is, or the cell is isolated from, or cultured from, an animal, e.g., a mammal such as a human, a murine, a canine, a feline, an equine, an ovine, or a bovine. In some embodiments, the post-translational modification is protein acetylation. In some embodiments, the post-translational modification is protein
succinylation. Other examples of post-translational modifications are well known in the art.
[0295] The compositions and compounds as disclosed herein are useful in methods of purifying a PARP substrate protein from a cell, a tissue or a subject. In one aspect, the subject is, or the cell is isolated from, or cultured from, an animal, e.g., a mammal such as a human, a murine, a canine, a feline, an equine, an ovine, or a bovine. The methods include contacting a sample comprising the protein, PARP and a compound of disclosed herein under conditions that favor PARP enzyme activity and with an affinity label to produce ADP- ribosylated protein, where the ribose is labeled, and affinity purifying the ADP-ribosylated protein. In one aspect, the click chemistry is used to label the protein.
[0296] The compositions and compounds as disclosed herein are useful in methods of identifying a protein as a substrate for PARP in a cell, a tissue or a subject. In one aspect, the subject is, or the cell or tissue is isolated from, or cultured from, an animal, e.g., a mammal such as a human, a murine, a canine, a feline, an equine, an ovine, or a bovine. In some embodiments, the subject is a human.
[0297] The disclosed methods can be performed in a cell free system with a cellular extract containing a PARP, or in a cell or tissue culture, or in a subject. When performed in vitro or in a cell free system, the methods include contacting a sample including the PARP, and a compound disclosed herein under conditions for PARP to act on a substrate (e.g. a histone or non-histone protein, and with an affinity or detectable label to a labeled product of the PARP reaction. In one aspect) the affinity label is used to purify the ADP-ribosylated protein; and the method optionally comprises further characterizing the ADP-ribosylated protein.
Methods to characterize the protein are known in the art, non-limiting examples of such
include e.g., mass spectrometry, liquid or gas chromatography/mass spectrometry, nuclear magnetic resonance imaging. Alternatively, the method uses a detectable label which is then imaged based on the label used. Suitable labels are known in the art and described herein, e.g., the label comprises an alkyne. In some embodiments the label comprises an azide. In some embodiments the label is a fluorescent label, e.g., a fluorophore. Non-limiting examples of detectable labels are describe herein. When performed in vivo, an effective amount of the compound and label can be administered to the subject. When practiced in a non-human animal, e.g., an appropriate mouse model, the method can be used to screen for novel combination therapies, formulations or treatment regimens, prior to administration to a human patient.
[0298] The compositions and compounds as disclosed herein also are useful in methods of labeling a PARP substrate protein in a cell-free system, a cell, a tissue or a subject. This disclosure also provides the labeled products produced therefrom. In one aspect, the subject is, or the cell or tissue is isolated from, or cultured from, an animal, e.g., a mammal such as a human, a murine, a canine, a feline, an equine, an ovine, or a bovine. When performed in vitro, the methods include contacting a sample comprising a PARP with a compound of this disclosure under conditions that allow the activity of the PARP enzyme, and a detectable label. Suitable labels are known in the art and described herein, e.g., the label comprises an alkyne. In some embodiments the label comprises an azide. In some embodiments the label is a fluorescent label, e.g., a fluorophore.
[0299] In some embodiments the compound of the disclosure contacted with PARP comprises a coupling moiety configured to couple with a complementary coupling moiety of the label. In some embodiments the compound of the disclosure contacted with PARP comprises a pi-system capable of reacting with a pi-system of the label. In some
embodiments, the reaction of the two pi-systems is a cycloaddition reaction. In some embodiments the compound of the disclosure contacted with PARP comprises an alkyne and the label comprises an azide. In some embodiments the compound of the disclosure contacted with PARP comprises an azide and the label comprises an alkyne. In some embodiments, the alkyne is a terminal alkyne.
[0300] When practiced in vivo in a patient such as an animal or human, the compounds and labels are administered in an effective amount by a suitable route of administration. When practiced in a non-human animal, e.g., an appropriate mouse model, the method can be used
to screen for novel combination therapies, formulations or treatment regimens, prior to administration to a human patient.
Kits
[0301] The compounds and compositions, as described herein, can be provided in kits. The kits can further contain instructions for use.
[0302] The following examples are included to demonstrate some embodiments of the disclosure. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the disclosure.
EXAMPLES
Example 1. Synthesis of NAD+1
Scheme 1. Synthesis of a 2 '-substituted NAD+ analo ue
[0303] General procedure for the synthesis of (6aR,8R,9R,9aR)-2,2,4,4-tetraisopropyl-8- methoxy-7-ol-tetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocine (2a): To a stirred solution of Methyl β-D-ribofuranoside (SMI) (3.1 g, 19.0 mmol) in pyridine (24 mL) was added the TIDPSCI2 (9.0 g, 28.5 mmol) at 0 °C. The reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 24 hours, the reaction mixture was diluted with EtOAc (100 mL), and the organic phase was washed successively with ice-water (50
mL), aq 1M HC1 (2X50 mL), H20 (2 X 50 mL), dried over anhydrous Na2S04, filtered and concentrated to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the compound (2a) (7.0 g, 90%) as a colorless oil.
[0304] (6aR,8R,9R,9aR)-2,2,4,4-tetraisopropyl-8-methoxy-7-ol-tetrahydro-6H-furo[3,2- f][l,3,5,2,4]trioxadisilocine (2a). A colorless oil, 90% yield; 1H MR (400 MHz, CDC13): δ 1.06-1.10 (m, 28H, 4CH+8CH3), 3.31 (s, 3H, OCH3), 3.75 (dd, 1H, J= 10.8, 8.8 Hz, CH2), 3.99-4.07 (m, 3H, CH2+2CH), 4.50 (t, 1H, J= 5.2 Hz, CH), 4.82 (s, 1H, CH); 13C NMR (100 MHz, CDC13): δ 12.5, 12.8, 13.25, 13.27, 16.94, 16.97, 17.0, 17.2, 17.36, 17.38, 17.4, 17.5, 54.9, 66.2, 75.0, 75.7, 82.7, 107.2.
[0305] General procedure for the synthesis of (6aR,8R,9R,9aR)-2,2,4,4-tetraisopropyl-8- methoxy-9-(prop-2-yn-l-yloxy)tetrahy-dro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocine (3): To a stirred solution of compound (2a) (1.5 g, 3.7 mmol) in anhydrous THF (25 mL) was added NaH (180 mg, 4.5 mmol, 1.2 eq, 60% dispersion in mineral oil) at 0 °C followed by the addition of propargyl bromide (660 mg, 5.6 mmol, 1.5 eq) at the same temperature. Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 6 hours, the reaction mixture was quenched with saturated aqueous NH4C1 (20 mL) and extracted with EtOAc (3X50 mL). The combined organic layers were washed water (3X50 mL), dried over anhydrous Na2S04, filtered and concentrated and purified by a flash column chromatography on silica gel to afford the compound (3) (987 mg, 60%) as a colorless oil.
[0306] (6aR,8R,9R,9aR)-2,2,4,4-tetraisopropyl-8-methoxy-9-(prop-2-yn-l-yloxy)tetrahy-dro- 6H-furo[3,2-f][l,3,5,2,4]trioxadisilocine (3). A colorless oil, 60% yield; 1H NMR (400 MHz, CDC13): δ 1.02-1.08 (m, 28H, 4CH+8CH3), 2.43 (t, 1H, J= 2.4 Hz, CH), 3.32 (s, 3H, OCH3), 3.84-3.88 (m, 1H, CH2), 3.96-4.02 (m, 3H, CH2+2CH), 4.42-4.51 (m, 3H, CH2+CH), 4.77 (s, 1H, CH); 13C NMR (100 MHz, CDC13): δ 12.6, 12.7, 13.1, 13.3, 16.97, 17.01, 17.09, 17.17, 17.29, 17.30, 17.4, 54.7, 58.2, 63.6, 73.9, 74.8, 79.7, 80.6, 80.9, 105.9.
HO
[0307] General procedure for the synthesis of (2R,3R,4R,5R)-2-(hydroxymethyl)-5-methoxy- 4-(prop-2-yn-l-yloxy)tetrahydrofuran-3-ol (4): To a 0 °C solution of compound (3) (934 mg, 2.1 mmol) in anhydrous THF (25 mL) was added AcOH (180 μΐ., 3.2 mmol, 1.5 eq) followed by the addition of TBAF (3.2 mL, 3.2 mmol, 1.0 M in THF, 1.5 eq). Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 14 hours, the reaction mixture was concentrated under reduced pressure to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the compound (4) (386 mg, 91%) as a colorless oil.
[0308] (2R,3R,4R,5R)-2-(hydroxymethyl)-5-methoxy-4-(prop-2-yn-l-yloxy)tetrahydro- furan-3-ol (4). A colorless oil, 91% yield; 1H MR (400 MHz, CDC13): δ 2.52 (t, 1H, J= 2.4 Hz, CH), 3.43 (s, 3H, OCH3), 3.64 (dd, 1H, J= 12.4, 3.6 Hz, CH2), 3.80 (dd, 1H, J= 12.4, 2.4 Hz, CH), 3.99 (dd, 1H, J= 5.6, 1.2 Hz, CH), 4.05-4.08 (m, 1H, CH), 4,28-4.39 (m, 3H, CH2+CH), 4.98 (s, 1H, CH); 13C NMR (100 MHz, CDC13): δ 55.9, 58.5, 63.0, 70.9, 75.7, 78.7, 82.7, 85.6, 106.5.
[0309] General procedure for the synthesis of ((2R, 3R, 4R, 5R)-3-(benzoyloxy)-5-methoxy- 4-(prop-2-yn-l-yloxy)tetrahydrofuran-2-yl)m ethyl benzoate (5): To a solution of compound (4) (320 mg, 1.7 mmol) in a mixture of anhydrous DCM (10 mL) and anhydrous pyridine (10 mL) was added BzCl (588 μL, 5.1 mmol, 3 eq) at 0 °C. Then the reaction mixture was allowed to warm to room temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the compound (5) (558 mg, 80%) as a colorless oil.
[0310] ((2R, 3R, 4R, 5R)-3-(benzoyloxy)-5-methoxy-4-(prop-2-yn-l-yloxy)tetrahydrofuran- 2-yl)methyl benzoate (5). A colorless oil, 91% yield; 1H NMR (400 MHz, CDC13): δ 2.39 (t, 1H, J= 2.4 Hz, CH), 3.38 (s, 3H, OCH3), 4.23 (dd, 1H, J= 16.0, 2.4 Hz, CH2), 4.29 (dd, 1H, J= 16.0, 2.4 Hz, CH2), 4.40 (dd, 1H, J= 4.8, 1.2 Hz, CH), 4.43-4.49 (m, 1H, CH2), 4.59-4.66 (m, 2H, CH2+CH), 5.08 (d, 1H, J= 0.4 Hz, CH), 5.55 (dd, 1H, J= 6.4, 4.8 Hz, CH), 7.39 (t, 2H, J= 8.0 Hz, ArH), 7.45 (t, 2H, J= 8.0 Hz, ArH), 7.51-7.56 (m, 1H, ArH), 7.57-7.61 (m,
1H, ArH), 8.05-8.07 (m, 4H, ArH); i3C NMR (100 MHz, CDC13): δ 55.4, 58.5, 64.7, 73.6, 75.3, 78.7, 78.9, 80.4, 106.8, 128.3, 128.5, 129.3, 129.73, 129.76, 129.84, 133.1, 133.4, 165.8, 166.2.
[0311] General procedure for the synthesis of (2R,3R,4R,5S)-5-acetoxy-2- ((benzoyloxy)methyl)-4-(prop-2-yn-l-yloxy)tetrahyd-rofuran-3-yl benzoate (6): Compound (5) (534 mg, 1.3 mmol) was dissolved in a mixture of TFA/H20 (9/1, 15 mL) and the resulting mixture was stirred at room temperature until the reaction complete (monitoring by TLC). Then the reaction was diluted with DCM (60 mL) and the solution was added dropwise to a stirred mixture of ice and saturated aqueous NaHC03. Solid NaHC03 was added during the addition to maintain a PH of 7. The mixture was extracted with DCM (3X50 mL), and the combined organic extracts was washed with H20 (50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. Ac20 (0.5 mL) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the compound (6) (445 mg, 78%) as a colorless oil.
[0312] (2R,3R,4R,55)-5-acetoxy-2-((benzoyloxy)methyl)-4-(prop-2-yn-l-yloxy)tetrahyd- rofuran-3-yl benzoate (6). 1H NMR (400 MHz, CDC13): δ 1.98 (s, 3H, CH3), 2.39 (t, 1H, J = 2.4 Hz, CH), 4.23-4.32 (m, 2H, CH2), 4.43-4.48 (m, 1H, CH2), 4.51 (d, 1H, J= 5.2 Hz, CH), 4.67-4.73 (m, 2H, CH+CH2), 4.53 (dd, 1H, J= 6.8, 4.8 Hz, CH), 6.32 (s, 1H, CH), 7.40 (t, 2H, J= 8.0 Hz, ArH), 7.46 (t, 2H, J= 8.0 Hz, ArH), 7.55 (t, 1H, J= 8.0 Hz, ArH), 7.58-7.62 (m, 1H, ArH), 8.05-8.07 (m, 4H, ArH); 13C NMR (100 MHz, CDC13): δ 21.0, 58.5, 63.7, 72.3, 75.6, 78.5, 79.7, 79.8, 99.0, 128.4, 128.5, 129.0, 129.6, 129.8, 129.9, 133.2, 133.6, 165.9, 166.0, 169.5.
[0313] General procedure for the synthesis of l-((2R,3R,4R,5R)-4-(benzoyloxy)-5- ((benzoyloxy)methyl)-3-(prop-2-yn-l-yloxy)t-etrahydrofuran-2-yl)-3-carbamoyl-pyridin-l- ium bromide (7): Compound (6) (307 mg, 0.70 mmol) was dissolved in toluene (10 mL) and cooled to 0 °C. HBr (33wt% in acetic acid) (257 mg, 1.05 mmol, 1.5 eq) was added dropwise and the reaction was stirred at 0 °C for 5 hours. After the starting material was consumed, the reaction was concentrated under reduced pressure to give a residue. The residue was azeotroped with toluene (3X20 mL) to remove remaining acetic acid and dried in vacuo. The crude product and nicotinamide (103 mg, 0.84 mmol, 1.2 eq) was dissolved in CH3CN (20 mL). The reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) and purified by a flash column chromatography on silica gel to afford the compound (7) (277 mg, 68%) as a colorless solid.
[0314] l-((2R,3R,4R,5R)-4-(benzoyloxy)-5-((benzoyloxy)methyl)-3-(prop-2-yn-l-yloxy)t- etrahydrofuran-2-yl)-3-carbamoylpyridin-l-ium bromide (7). 1H MR (400 MHz, CDC13,
TMS): δ 2.45 (t, 1H, J= 2.0 Hz, CH), 4.28 (dd, 1H, J= 16.0, 2.0 Hz, CH2), 4.39 (dd, 1H, J = 16.0, 2.0 Hz, CH2), 4.66 (d, 2H, J= 3.6 Hz, CH2), 5.25 (t, 1H, J= 5.2 Hz, CH), 5.51 (m, 1H, CH), 5.80 (dd, 1H, J= 5.2, 2.0 Hz, CH), 6.15 (s, 1H, H), 7.31 (d, 1H, J= 5.2 Hz, CH), 7.37 (t, 2H, J= 8.0 Hz, ArH), 7.51-7.58 (m, 3H, ArH), 7.60-7.64 (m, 1H, ArH), 7.66-7.68 (m, 2H, ArH), 8.03 (m, 1H, ArH), 8.09-8.11 (m, 2H, ArH), 9.14 (d, 1H, J= 6.0 Hz, ArH), 9.22 (d, 1H, J= 7.2 Hz, ArH), 9.31 (s, 1H, ArH), 10.45 (s, 1H, ArH); 13C NMR (100 MHz, CDC13, TMS): δ 59.9, 63.8, 71.5, 77.4, 77.5, 77.6, 84.8, 95.1, 126.6, 128.1, 128.7, 128.81, 128.83, 129.6, 129.9, 132.8, 133.7, 134.1, 141.8, 143.0, 146.7, 162.7, 165.0, 165.9.
[0315] General procedure for the synthesis of 3-carbamoyl-l-((2R,3R,4R,5R)-4-hydroxy-5- (hydroxymethyl)-3-(prop-2-yn-l-yloxy)tetrahydrofuran-2-yl)pyridin-l-ium bromide (8,
NRl): Compound (7) (260 mg, 0.45 mmol) was dissolved in ammonia (18 mL, 7 N in MeOH) and the reaction was stirred at -10 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 8 (also referred to as NRl) (121 mg, 72%) as a colorless solid.
[0316] 3-carbamoyl-l-((2R,3R,4R,5R)-4-hydroxy-5-(hydroxymethyl)-3-(prop-2-yn-l-ylo- xy)tetrahydrofuran-2-yl)pyridin-l-ium bromide (8, NRl). 1H MR (400 MHz, D20): δ 2.94 (t, 1H, J= 2.4 Hz, CH), 3.79 (dd, 1H, J= 13.2, 4.4 Hz, CH2), 3.91 (dd, 1H, J= 13.2, 2.8 Hz, CH2), 4.31 (dd, 1H, J= 16.0, 2.4 Hz, CH2), 4.38 (dd, 1H, J= 16.0, 2.4 Hz, CH2), 4.56-4.58 (m, 1H, CH), 4.83 (dd, 1H, J= 6.4, 3.2 Hz, CH), 4.88 (t, 1H, J= 5.2 Hz, CH), 6.67 (d, 1H, J = 5.2 Hz, CH), 8.20-8.24 (m, 1H, ArH), 8.96 (d, 1H, J= 7.6 Hz, ArH), 9.12 (d, 1H, J= 6.8 Hz, ArH), 9.33 (s, 1H, ArH); 13C MR (100 MHz, D20): δ 59.0, 60.9, 69.3, 76.9, 78.5, 78.7, 89.4, 95.4, 126.9, 132.4, 141.2, 143.7, 145.2, 165.8; HRMS (ESI) Calcd. For Ci4Hi7N205 + (M+) requires 293.1132, Found: 293.1134.
[0317] General procedure for the synthesis of ((2R,3R,4R,5R)-5-(3-carbamoylpyridin-l-ium- l-yl)-3-hydroxy-4-(prop-2-yn-l-yloxy)tetrahydrofuran-2-yl)methyl hydro-gen phosphate (9, NM1): To a stirred solution of compound (8, NRl) (100 mg, 0.27 mmol) in
trimethylphosphate (2 mL) was added P(0)C13 ( 175 μΐ^, 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. A few drops H20 was then added to quench the reaction. Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 9 (also referred to as NM1) (60 mg, 60%) as a colorless solid.
[0318] ((2R,3R,4R,5R)-5-(3-carbamoylpyridin-l-ium-l-yl)-3-hydroxy-4-(prop-2-yn-l- yloxy)tetrahydrofuran-2-yl)methyl hydrogen phosphate (9). 1H NMR (400 MHz, D20): δ
2.87 (t, 1H, J= 2.4 Hz, CH), 4.04-4.10 (m, 1H, CH2), 4.13-4.18 (m, 1H, CH2), 4.26 (dd, 1H, J= 16.4, 2.4 Hz, CH2), 4.32 (dd, 1H, J= 16.4, 2.4 Hz, CH2), 4.60 (dd, 1H, J= 4.8, 1.6 Hz, CH), 4.86 (t, 1H, J= 1.6 Hz, CH), 4.89-4.91 (m, 1H, CH), 6.62 (d, 1H, J= 6.0 Hz, CH), 8.15 (m, 1H, ArH), 8.90 (d, 1H, J= 8.0 Hz, ArH), 9.06 (d, 1H, J= 6.4 Hz, ArH), 9.28 (s, 1H, ArH); 13C NMR (100 MHz, D20): δ 59.0, 64.8 (d, J= 4.5 Hz), 69.3, 76.8, 78.5, 78.7, 87.8 (d, J= 8.5 Hz), 95.5, 126.9, 132.4, 141.2, 143.7, 145.2, 165.8; HRMS (ESI) Calcd. For
Ci4Hi8N208P+ (M+H)+ requires 373.0795, Found: 373.0788.
[0319] General procedure for the synthesis of l-((2R,3R,4R,5R)-5-((((((((2R,3S,4R,5R)-5-(6- amino-9H-purin-9-yl)-3,4-dihydr-oxytetrahydrofuran-2-yl)methoxy)(hydroxy)p- hosphoryl)oxy)oxidophosphoryl)o-xy)methyl)-4-hydroxy-3-(prop-2-yn-l-yloxy)tet- rahydrofuran-2-yl)-3-carbamoy-lpyridin-l-ium (10, NAD+ 1): To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) were added 1, 1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μΐ., 0.16 mmol. 1.6 eq). The reaction mixture was stirred at room temperature for 14 hours, and then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum and the residue was coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'- AMP was dissolved in dried DMF (1 mL) and compound (9, NM1) (37 mg, 0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H20 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC (C18-A column, 150X4.6 mm, 5 μπι) (mobile phase A: 0.1% formic acid (aq), mobile B: 0.1% formic acid in acetonitrile; flow rate = 1.0 ml/min; 0-16 min: 0-6.7% B, 16-18 min: 6.7-0%) B). Fractions containing the desired product were concentrated and lyophilized to yield NAD+ 1 (32 mg, 45%> yield) as a colorless solid.
[0320] l-((2R,3R,4R,5R)-5-((((((((2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydr- oxytetrahydrofuran-2-yl)methoxy)(hydroxy)phosphoryl)oxy)oxidophosphoryl)o-xy)methyl)- 4-hydroxy-3-(prop-2-yn-l-yloxy)tetrahydrofuran-2-yl)-3-carbamoy-lpyridin-l-ium (10, NAD+ 1). 1H NMR (400 MHz, D20): δ 2.87 (br, 1H, CH), 4.12-4.14 (m, 1H, CH), 4.24-4.33
(m, 5H, 2CH2+CH), 4.40 (br, 1H, CH), 4.51 (t, 1H, J= 4.0 Hz, CH2), 4.63 (d, 1H, J= 2.8 Hz, CH), 4.71 (t, 1H, J= 5.2 Hz, CH), 4.87-4.89 (m, 2H, 2CH), 6.06 (d, 1H, J= 5.2 Hz, CH), 6.59 (d, 1H, J= 5.6 Hz, CH), 8.09-8.13 (m, 1H, ArH), 8.31 (br, 1H, ArH), 8.61 (br, 1H, ArH), 8.86 (d, 1H, J= 8.0 Hz, ArH), 8.01 (d, 1H, J= 6.0 Hz, ArH), 9.19 (s, 1H, ArH); 13C NMR (100 MHz, D20): δ 59.0, 65.2, 69.3, 70.2, 74.6, 76.7, 78.5, 78.7, 84.1, 87.3, 87.9, 95.6, 126.8, 132.1, 140.9, 143.7, 145.0, 147.6, 148.5, 151.8, 165.2.; HRMS (ESI) Calcd. For C24H28N7Na2Oi4P2 + (M+H)+ requires 746.0965, Found: 746.0955.
Example 2. Synthesis of NAD+ 2-6 and 21
[0321] General procedure for the synthesis of compound 3aa: To a stirred solution of (6aR,8R,9R,9aS)-2,2,4,4-tetraisopropyl-8-methoxytetrahydro-6H-furo[3,2- f][l,3,5,2,4]trioxadisilocin-9-ol in anhydrous THF was added NaH at 0 °C followed by the addition of corresponding R200Br or R200OTf (R200 may be -(CH2)nC≡CH wherein n is 1, 2, or 3) at the same temperature. Then reaction mixture was allowed to warm to room
temperature. After stirring at this temperature for 6 hours, the reaction mixture was quenched with saturated aqueous NH4C1 (20 mL) and extracted with EtOAc (3X50 mL). The combined organic layers were washed water (3X50 mL), dried over anhydrous Na2S04, filtered and concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 3aa.
[0322] General procedure for the synthesis of compound 4aa: To a 0 °C solution of compound 3aa (2.1 mmol) in anhydrous THF (25 mL) was added AcOH (3.2 mmol, 1.5 eq) followed by the addition of TBAF (3.2 mL, 3.2 mmol, 1.0 M in THF, 1.5 eq). Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 14 hours, the reaction mixture was concentrated under reduced pressure to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the compound 4aa
BzO' >O e
BzO ' Oc R200
5aa
[0323] General procedure for the synthesis of compound 5aa: To a solution of compound 4aa (1.7 mmol) in a mixture of anhydrous DCM (10 mL) and anhydrous pyridine (10 mL) was added BzCl (588 μΐ., 5.1 mmol, 3 eq) at 0 °C. Then the reaction mixture was allowed to warm to room temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed
successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 5aa.
[0324] General procedure for the synthesis of compound 6aa: Compound 5aa (1.3 mmol) was dissolved in a mixture of TFA/H20 (9/1, 15 mL) and the resulting mixture was stirred at room temperature until the reaction complete (monitoring by TLC). Then the reaction was diluted with DCM (60 mL) and the solution was added dropwise to a stirred mixture of ice and saturated aqueous NaHC03. Solid NaHC03 was added during the addition to maintain a PH of 7. The mixture was extracted with DCM (3X50 mL), and the combined organic extracts was washed with H20 (50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. Ac20 (0.5 mL) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 6aa.
[0325] General procedure for the synthesis of compound 7aa: Compound 6aa (0.70 mmol) was dissolved in toluene (10 mL) and cooled to 0 °C. HBr (33wt% in acetic acid) (257 mg, 1.05 mmol, 1.5 eq) was added dropwise and the reaction was stirred at 0 °C for 5 hours. After the starting material was consumed, the reaction was concentrated under reduced pressure to give a residue. The residue was azeotroped with toluene (3X20 mL) to remove remaining acetic acid and dried in vacuo. The crude product and nicotinamide (103 mg, 0.84 mmol, 1.2 eq) was dissolved in CH3CN (20 mL). The reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) and purified by a flash column chromatography on silica gel to afford the corresponding compound 7aa.
[0326] General procedure for the synthesis of compound 8aa: Compound 7aa (0.45 mmol) was dissolved in ammonia (18 mL, 7 N in MeOH) and the reaction was stirred at -10 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the corresponding desired product 8aa
[0327] General procedure for the synthesis of compound 9aa: To a stirred solution of compound 8aa (0.27 mmol) in trimethylphosphate (2 mL) was added P(0)C13 ( 175 μL, 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. A few drops H20 was then added to quench the reaction. Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the corresponding desired product 9aa.
NAD+ 2-6
[0328] General procedure for the synthesis ofNAD+ 3-6 and NAD+ 21 : To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) were added 1, 1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μΐ., 0.16 mmol. 1.6 eq). The reaction mixture was stirred at room temperature for 14 hours, and then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum and the residue was coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'- AMP was dissolved in dried DMF (1 mL) and compound 9aa (0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H20 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative FIPLC (C18-A column, 150X4.6 mm, 5 μπι) (mobile phase A: 0.1% formic acid (aq), mobile B: 0.1% formic acid in acetonitrile; flow rate = 1.0 ml/min; 0-16 min: 0-6.7% B, 16-18 min: 6.7- 0% B). Fractions containing the desired product were concentrated and lyophilized to yield corresponding NAD+ 3-6 and NAD+ 21.
[0329] NAD+ 2 is prepared following the procedure as described above with the necessary modifications well-understood b the skilled artisan.
3-2
[0330] General procedure for the synthesis of (2R,3S,4R,5R)-2-(((tert- butyldiphenylsilyl)oxy)methyl)-5-methoxytetrahydrofuran-3,4-diol (3-2): To a stirred solution of Methyl- -D-Ribofuranoside (3-1) (1.64 g, 10.0 mmol) and imidazole (1.36 g, 20.0 mmol, 2.0 eq) in anhydrous DMF (20 mL) was added TBDPSC1 (3.02g, 11.0 mmol, 1.1 eq) at 0 °C. Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 24 h, the reaction mixture was diluted with EtOAc (100 mL), and the organic phase was washed successively with ice-water (50 mL), aq 1M HC1 (2X50 mL), H20 (2X50 mL), dried over anhydrous Na2S04, filtered and concentrated to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the compound (3-2) (3.62 g, 90%) as a colorless oil.
[0331] (2R,35',4R,5R)-2-(((tert-butyldiphenylsilyl)oxy)methyl)-5-methoxytetrahydrofuran- 3,4-diol (3-2). A colorless oil, 90% yield; 1H MR (400 MHz, CDC13): δ 1.07 (s, 9H, 3CH3), 2.30 (d, 1H, J= 5.6 Hz, OH), 2.62 (d, 1H, J= 3.2 Hz, OH), 3.31 (s, 3H, OCH3), 3.77 (dd, 1H, J= 10.8, 6.0 Hz, CH2), 3.83 (dd, 1H, J= 10.8, 4.4 Hz, CH2), 4.01-4.05 (m, 2H, 2CH), 4.32- 4.36 (m, 1H, CH), 4.84 (s, 1H, CH), 7.37-7.46 (m, 6H, ArH), 7.68-7.70 (m, 4H, ArH); 13C MR (100 MHz, CDC13): δ 19.2, 26.8, 55.2, 65.1, 72.7, 75.3, 82.9, 108.1, 127.75, 127.78, 129.80, 129.83, 133.2, 135.6.
[0332] General procedure for the synthesis of compound (3-3): To a stirred solution of (2R,3S,4R,5R)-2-(((tert-butyldiphenylsilyl)oxy)methyl)-5-methoxytetrahydrofura-n-3,4-diol (3-2) (3.62 g, 9.0 mmol) in anhydrous THF (30 mL) was added NaH (432 mg, 10.8 mmol, 1.2 eq, 60% dispersion in mineral oil) at 0 °C followed by the addition of pent-4-yn-l-yl trifluoromethanesulfonate (2.92 g, 13.5 mmol, 1.5 eq) at the same temperature. Then the reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 8 hours, the reaction mixture was quenched with saturated aqueous NH4C1 (20 mL) and extracted with EtOAc (3X50 mL). The combined organic layers were washed water (3X50
mL), dried over anhydrous Na2S04, filtered and concentrated and purified by a flash column chromatography on silica gel to afford the compound (3-3) (1.69 g, 40%) as a colorless oil.
[0333] (2R,3R,4R,5R)-2-(((tert-butyldiphenylsilyl)oxy)methyl)-5-methoxy-4-(pent-4-yn-l- yloxy)tet-rahydrofuran-3-ol (3-3). A colorless oil, 40% yield; 1H MR (400 MHz, CDC13): δ 1.07 (s, 9H, 3CH3), 1.81-1.88 (m, 2H, CH2), 1.99 (t, 1H, J= 2.8 Hz, CH), 2.30-2.36 (m, 2H, CH2), 2.56 (d, 1H, J= 8.0 Hz, OH), 3.35 (s, 3H, OCH3), 3.65-3.85 (m, 5H, 2CH2+CH), 4.01 (dd, 1H, J= 10.0, 4.0 Hz, CH), 4.28-4.33 (m, 1H, CH), 4.91 (d, 1H, J= 0.8 Hz, CH), 7.36- 7.45 (m, 6H, ArH), 7.70-7.73 (m, 4H, ArH); 13C MR (100 MHz, CDC13): δ 15.2, 19.3, 26.8, 28.3, 55.3, 64.6, 69.0, 69.2, 71.0, 82.7, 83.5, 84.6, 105.8, 127.66, 127.68, 129.63, 129.67, 133.39, 133.41, 135.6.
[0334] General procedure for the synthesis of (2R,3R,4R,5R)-2-(hydroxymethyl)-5-methoxy- 4-(pent-4-yn-l-yloxy)tetrahydrofuran-3-ol (3-4): To a 0 °C solution of (2R,3R,4R,5R)-2- (((tert-butyldiphenylsilyl)oxy)methyl)-5-methoxy-4-(pent-4-yn-l-yloxy)tet-rahydrofuran-3-ol (3-3) (1.17 g, 2.50 mmol) in anhydrous THF (25 mL) was added AcOH (225 mg, 3.75 mmol, 1.5 eq) followed by the addition of TBAF (3.75 mL, 3.75 mmol, 1.0 M in THF, 1.5 eq). Then the reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 14 hours, the reaction mixture was concentrated under reduced pressure to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the compound (2R,3R,4R,5R)-2-(hydroxymethyl)-5-methoxy-4-(pent-4-yn-l- yloxy)tetrahydrofuran-3-ol (3-4) (524 mg, 91%) as a colorless oil.
[0335] (2R,3R,4R,5R)-2-(hydroxymethyl)-5-methoxy-4-(pent-4-yn-l-yloxy)tetrahydrofuran- 3-ol (3-4). A colorless oil, 91% yield; 1H NMR (400 MHz, CDC13): δ 1.78-1.85 (m, 2H, CH2), 1.98 (t, 1H, J= 2.4 Hz, CH), 2.28-2.32 (m, 2H, CH2), 2.77 (d, 1H, J= 8.0 Hz, OH), 3.40 (s, 3H, OCH3), 3.58-3.69 (m, 2H, CH2), 3.73-3.79 (m, 3H, CH2+CH), 4.01-4.04 (m, 1H, CH), 4.22-4.27 (m, 1H, CH), 4.88 (d, 1H, J= 1.2 Hz, CH); 13C NMR (100 MHz, CDC13): δ 15.2, 28.2, 55.7, 63.1, 69.1, 69.3, 70.9, 83.1, 83.4, 85.6, 106.5.
[0336] General procedure for the synthesis of compound ((2R,3R,4R,5R)-3-(benzoyloxy)-5- methoxy-4-(pent-4-yn-l-yloxy)tetrahydrofuran-2-yl)m ethyl benzoate (3-5): To a solution of (2R,3R,4R,5R)-2-(hydroxymethyl)-5-methoxy-4-(pent-4-yn-l-yloxy)tetrahydrofuran-3-ol (3- 4) (460 mg, 2.0 mmol) in a mixture of anhydrous DCM (10 mL) and anhydrous pyridine (10 mL) was added BzCl (691 μΐ., 6.0 mmol, 3 eq) at 0 °C. Then the reaction mixture was allowed to warm to room temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound ((2R,3R,4R,5R)-3-(benzoyloxy)-5-methoxy-4-(pent-4- yn-l-yloxy)tetrahydrofuran-2-yl)methyl benzoate (3-5) (702 mg, 80%) as a colorless oil.
[0337] ((2R,3R,4R,5R)-3-(benzoyloxy)-5-methoxy-4-(pent-4-yn-l-yloxy)tetrahydrofuran-2- yl)met-hyl benzoate (3-5). A colorless oil, 80% yield; 1H MR (400 MHz, CDC13): δ 1.68- 1.75 (m, 2H, CH2), 1.84 (t, 1H, J= 2.4 Hz, CH), 2.12-2.23 (m, 2H, CH2), 3.37 (s, 3H, OCH3), 3.57-3.62 (m, 1H, CH2), 3.65-3.70 (m, 1H, CH2), 4.17 (d, 1H, J= 4.8 Hz, CH), 4.45 (dd, 1H, J= 11.6, 4.8 Hz, CH2), 4.58-4.67 (m, 2H, CH2+CH), 4.98 (s, 1H, CH), 5.48 (dd, 1H, J= 6.6, 4.8 Hz, CH), 7.37-7.41 (m, 2H, ArH), 7.43-7.47 (m, 2H, ArH), 7.52-7.60 (m, 2H, ArH), 8.04- 8.05 (m, 2H, ArH), 8.06-8.07 (m, 2H, ArH); 13C MR (100 MHz, CDC13): δ 14.9, 28.6, 55.2, 64.8, 68.6, 69.4, 73.9, 78.6, 81.3, 83.5, 106.8, 128.3, 128.5, 129.4, 129.7, 129.8, 133.1, 133.4, 165.9, 166.3.
[0338] General procedure for the synthesis of (2R,3R,4R)-5-acetoxy-2- ((benzoyloxy)methyl)-4-(pent-4-yn-l-yloxy)tetrahydrofuran-3-yl benzoate (3-6): Compound (3-5) (570 mg, 1.3 mmol) was dissolved in a mixture of TFA/H20 (9/1, 15 mL) and the resulting mixture was stirred at room temperature until the reaction complete (monitoring by
TLC). Then the reaction was diluted with DCM (60 mL) and the solution was added dropwise to a stirred mixture of ice and saturated aqueous NaHC03. Solid NaHC03 was added during the addition to maintain a pH of 7. The mixture was extracted with DCM (3X50 mL), and the combined organic extracts was washed with H20 (50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. Ac20 (0.5 mL) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound (2R,3R,4R)-5-acetoxy-2- ((benzoyloxy)methyl)-4-(pent-4-yn-l-yloxy)tetrahydrofuran-3-yl benzoate (3-6) (473 mg, 78%) as a colorless oil.
[0339] (2R,3R,4R)-5-acetoxy-2-((benzoyloxy)methyl)-4-(pent-4-yn- 1 -yloxy)tetrahydrofuran- 3-yl b-enzoate (3-6). A colorless solid, 78% yield; 1H MR (400 MHz, CDC13): δ 1.68-1.74 (m, 2H, CH2), 1.84 (t, 1H, J= 2.8 Hz, CH), 1.97 (s, 3H, CH3), 2.14-2.19 (m, 2H, CH2), 3.57- 3.62 (m, 1H, CH2), 3.71-3.76 (m, 1H, CH2), 4.27 (d, 1H, J= 5.2 Hz, CH), 4.42-4.47 (m, 1H, CH2), 4.6 8-4.74 (m, 2H, CH2+CH), 5.45 (dd, 1H, J= 7.2, 4.8 Hz, CH), 6.23 (s, 1H, CH), 7.37-7.41 (m, 2H, ArH), 7.44-7.47 (m, 2H, ArH), 7.52-7.56 (m, 1H, ArH), 7.58-7.62 (m, 1H, ArH), 8.04-8.07 (m, 4H, ArH); 13C MR (100 MHz, CDC13): δ 14.9, 21.0, 28.4, 63.7, 68.7, 69.5, 72.6, 79.5, 80.7, 83.4, 99.1, 128.4, 128.5, 129.0, 129.6, 129.7, 129.8, 133.2, 133.6, 166.96, 166.05, 169.6.
[0340] General procedure for the synthesis of l-((2R,3R,4R,5R)-4-(benzoyloxy)-5- ((benzoyloxy)methyl)-3-(pent-4-yn-l-yloxy)tetrahydrofuran-2-yl)-3-carbamoylpyridin-l-ium bromide (3-7): Compound (3-6) (327 mg, 0.70 mmol) was dissolved in toluene (10 mL) and cooled to 0 °C. HBr (33wt% in acetic acid) (257 mg, 1.05 mmol, 1.5 eq) was added dropwise and the reaction was stirred at 0 °C for 5 hours. After the starting material was consumed, the
reaction was concentrated under reduced pressure to give a residue. The residue was azeotroped with toluene (3X20 mL) to remove remaining acetic acid and dried in vacuo. The crude product and nicotinamide (103 mg, 0.84 mmol, 1.2 eq) was dissolved in CH3CN (20 mL). The reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) and purified by a flash column chromatography on silica gel to afford the corresponding compound 1- ((2R,3R,4R,5R)-4-(benzoyloxy)-5-((benzoyloxy)methyl)-3-(pent-4-yn-l- yloxy)tetrahydrofuran-2-yl)-3 -carbarn oylpyri din- 1-ium bromide (3-7) (290 mg 68%) as a colorless solid.
[0341] l-((2R,3R,4R,5R)-4-(benzoyloxy)-5-((benzoyloxy)methyl)-3-(pent-4-yn-l- yloxy)tetrahydrof-uran-2-yl)-3 -carbarn oylpyri din- 1-ium bromide (3-7). A colorless solid, 68% yield; 1H MR (400 MHz, CD3OD): δ 1.53-1.67 (m, 2H, CH2), 1.92-1.96 (m, 2H, CH2), 2.09 (t, 1H, J= 2.4 Hz, CH), 3.75-3.86 (m, 2H, CH2), 4.73 (d, 2H, J= 4.8 Hz, CH2), 5.08 (t, 1H, J= 6.0 Hz, CH), 5.56 (t, 1H, J= 4.8 Hz, CH), 5.95 (dd, 1H, J= 4.8, 0.8 Hz, CH), 6.87 (d, 1H, J= 6.0 Hz, CH), 7.40-7.43 (m, 2H, ArH), 7.53-7.62 (m, 3H, ArH), 7.66-7.69 (m, 3H, ArH), 8.12-8.14 (m, 2H, ArH), 8.26 (dd, 1H, J= 8.0, 6.4 Hz, ArH), 9.04 (d, 1H, J= 8.0 Hz, ArH), 9.28 (d, 1H, J= 6.4 Hz, ArH), 9.53 (s, 1H, ArH); 13C MR (100 MHz, CD3OD): δ 14.3, 28.1, 63.6, 68.8, 70.7, 71.1, 78.9, 82.3, 85.2, 95.1, 126.6, 128.36, 128.46, 128.55, 129.0, 129.32, 129.33, 133.1, 133.3, 133.5, 141.1, 143.6, 144.9, 163.4, 164.7, 166.0.
[0342] General procedure for the synthesis of 3-carbamoyl-l-((2R,3R,4R,5R)-4-hydroxy-5- (hydroxymethyl)-3-(pent-4-yn-l-yloxy)tetrahydrofuran-2-yl)pyri din- 1-ium bromide (3-8): Compound (3-7) (274 mg, 0.45 mmol) was dissolved in ammonia (20 mL, 7 N in MeOH) and the reaction was stirred at 0 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the corresponding desired product 3-carbamoyl-l-((2R,3R,4R,5R)-4-hydroxy-5- (hydroxymethyl)-3 -(pent-4-yn- 1 -yloxy)tetrahydrofuran-2-yl)pyridin- 1 -ium bromide (3-8) (130 mg, 72%)) as a colorless solid.
[0343] 3-carbamoyl-l-((2R,3R,4R,5R)-4-hydroxy-5-(hydroxymethyl)-3-(pent-4-yn-l- yloxy)tetrahy-drofuran-2-yl)pyridin-l-ium bromide (3-8). A colorless solid, 72% yield; 1H NMR (400 MHz, D20): δ 1.63-1.71 (m, 2H, CH2), 2.02-2.17 (m, 2H, CH2), 2.32-2.37 (m, 1H, CH), 3.67-3.81 (m, 3H, CH2+CH2), 3.91 (dd, 1H, J= 12.8, 2.8 Hz, CH2), 4.51-4.53 (m, 1H, CH), 4.70 (t, 1H, J= 5.2 Hz, CH), 4.81-4.83 (m, 1H, CH), 6.87 (d, 1H, J= 5.6 Hz, CH), 8.23-8.27 (m, 1H, ArH), 8.99 (d, 1H, J= 7.6 Hz, ArH), 9.14 (d, 1H, J= 5.6 Hz, ArH), 9.32 (s, 1H, ArH); 13C NMR (100 MHz, D20): δ 14.3, 27.4, 61.0, 69.3, 69.9, 70.4, 79.5, 84.6, 89.4, 95.5, 127.0, 132.3, 141.2, 143.5, 145.2, 165.7.
[0344] General procedure for the synthesis of ((2R,3R,4R,5R)-5-(3-carbamoylpyridin-l-ium- l-yl)-3-hydroxy-4-(pent-4-yn-l-yloxy)tetrahydrofuran-2-yl)m ethyl hydrogen phosphate (3- 9): To a stirred solution of compound (3-8) (108 mg, 0.27 mmol) in trimethylphosphate (2 mL) was added P(0)C13 ( 175 μΐ., 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 h. A few drops H20 was then added to quench the reaction.
Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the corresponding desired product ((2R,3R,4R,5R)-5-(3- carbam oylpyridin- 1 -ium- 1 -yl)-3 -hydroxy -4-(pent-4-yn- 1 -yloxy)tetrahydrofuran-2-yl)methyl hydrogen phosphate (3-9) (65 mg, 60%) as a colorless solid.
[0345] ((2R, 3R,4R, 5R)-5 -(3 -carbamoylpyridin- 1 -ium- 1 -yl)-3 -hy droxy-4-(pent-4-yn- 1 - yloxy)tetrah-ydrofuran-2-yl)methyl hydrogen phosphate (3-9). A colorless solid, 60% yield; 1H MR (400 MHz, D20): δ 1.63-1.69 (m, 2H, CH2), 2.01-2.18 (m, 2H, CH2), 2.32 (t, 1H, J = 2.4 Hz, CH), 3.70-3.81 (m, 2H, CH2), 4.04-4.09 (m, 1H, CH2), 4.12-4.17 (m, 1H, CH2), 4.59 (dd, 1H, J= 4.4, 2.0 Hz, CH), 4.76 (t, 1H, J= 6.0 Hz, CH), 4.93-4.95 (m, 1H, CH), 6.65 (d, 1H, J= 6.0 Hz, CH), 8.21 (dd, 1H, J= 8.0, 6.4 Hz, ArH), 8.96 (d, 1H, J= 8.0 Hz, ArH), 9.12 (d, 1H, J= 6.4 Hz, ArH), 9.32 (s, 1H, ArH); 13C NMR (100 MHz, D20): δ 14.2, 27.3,
64.6 (d, J = 4.7 Hz), 69.3, 69.7, 70.3, 79.3, 84.6 (d, J = 1.5 Hz), 88.3 (d, J = 9.1 Hz), 95.6, 126.9, 132,3, 141.2, 143.5, 145.1, 165.8.
[0346] General procedure for the synthesis of (NAD+ 3): To a stirred solution of Adenosine 5 '-monophosphate (5' -AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) were added 1, 1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μΐ^, 0.16 mmol. 1.6 eq). The reaction mixture was stirred at room temperature for 14 h, and then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum and the residue was coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'-AMP was dissolved in dried DMF (1 mL) and compound (3-9) (0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H20 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC. Fractions containing the desired product were concentrated and lyophilized to yield corresponding NAD+ 3 .
[0347] NAD+ 3. A colorless solid, 45% yield; 1H NMR (400 MHz, D20): δ 1.57-1.66 (m, 2H, CH2), 1.95-2.12 (m, 2H, CH2), 2.29 (t, 1H, J= 2.4 Hz, CH), 3.63-3.76 (m, 2H, CH2), 4.13-4.16 (m, 1H, CH2), 4.24-4.39 (m, 3H, CH2+CH2), 4.40 (d, 1H, J= 2.0 Hz, CH), 4.52 (t, 1H, J= 4.4, CH), 4.60 (dd, 1H, J= 4.4, 1.6 Hz, CH), 4.71 (t, 1H, J= 5.6 Hz, CH), 4.76 (dd, 1H, J= 5.6 Hz, CH), 4.92 (br, 1H, CH), 6.10 (d, 1H, J= 6.6 Hz, CH), 6.63 (d, 1H, J= 6.0 Hz, CH), 8.17 (dd, 1H, J= 8.0, 6.0 Hz, ArH), 8.40 (s, 1H, ArH), 8.61 (s, 1H, ArH), 8.92 (d, 1H, J= 8.0 Hz, ArH), 9.08 (d, 1H, J= 6.0 Hz, ArH), 9.25 (s, 1H, ArH); HRMS (ESI) Calcd. For C26H34N2Oi4P2 + (M+H)+ requires 730.1633, Found: 730.1639.
2bb
[0348] General procedure for the synthesis of (2R,3S,4R,5R)-2-(((tert- butyldiphenylsilyl)oxy)methyl)-5-methoxytetrahydrofuran-3,4-diol (2bb): To a stirred
solution of Methyl β-D-ribofuranoside (SMI) (1.0 eq) in DMF (24 mL) was added the Imidazole (2 eq) and TBDPSC1 (1.1 eq) at 0 °C. The reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 24 hours, the reaction mixture was diluted with EtOAc (100 mL), and the organic phase was washed with water (5X50 mL), dried over anhydrous Na2S04, filtered and concentrated to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the compound 2bb.
RO~ 'OH
3bb
[0349] General procedure for the synthesis of compound 3bb: To a stirred solution of compound 2bb (1 eq) in anhydrous THF (25 mL) was added NaH (1.1 eq, 60% dispersion in mineral oil) at 0 °C followed by the addition of corresponding RBr or ROTf (1.5 eq) (R may be -(CH2)nC≡CH wherein n is 1, 2, or 3) at the same temperature. Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 6 hours, the reaction mixture was quenched with saturated aqueous H4C1 (20 mL) and extracted with EtOAc (3X50 mL). The combined organic layers were washed water (3X50 mL), dried over anhydrous Na2S04, filtered and concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 3bb.
4bb
[0350] General procedure for the synthesis of compound 4bb: To a 0 °C solution of compound 3bb (1.0 eq) in anhydrous THF (25 mL) was added AcOH (1.5 eq) followed by the addition of TBAF (1.5 eq). Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 14 hours, the reaction mixture was concentrated under reduced pressure to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the corresponding compound 4bb.
[0351] General procedure for the synthesis of compound 5bb: To a solution of compound 4bb (1.0 eq) in a mixture of anhydrous DCM (10 mL) and anhydrous pyridine (10 mL) was added BzCl (3 eq) at 0 °C. Then the reaction mixture was allowed to warm to room
temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 5bb.
6bb
[0352] General procedure for the synthesis of compound 6bb: Compound 5bb (1.0 eq) was dissolved in a mixture of TFA/H20 (9/1, 15 mL) and the resulting mixture was stirred at room temperature until the reaction complete (monitoring by TLC). Then the reaction was diluted with DCM (60 mL) and the solution was added dropwise to a stirred mixture of ice and saturated aqueous NaHC03. Solid NaHC03 was added during the addition to maintain a PH of 7. The mixture was extracted with DCM (3X50 mL), and the combined organic extracts was washed with H20 (50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. Ac20 (0.5 mL) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 6bb.
[0353] General procedure for the synthesis of compound 7bb: Compound 6bb (1.0 eq) was dissolved in toluene (10 mL) and cooled to 0 °C. HBr (33wt% in acetic acid) (1.5 eq) was added dropwise and the reaction was stirred at 0 °C for 5 hours. After the starting material was consumed, the reaction was concentrated under reduced pressure to give a residue. The residue was azeotroped with toluene (3X20 mL) to remove remaining acetic acid and dried in
vacuo. The crude product and nicotinamide (103 mg, 0.84 mmol, 1.2 eq) was dissolved in CH3CN (20 mL). The reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) and purified by a flash column chromatography on silica gel to afford the corresponding compound 7bb.
[0354] General procedure for the synthesis of compound 8bb: Compound 7bb (0.45 mmol) was dissolved in ammonia (18 mL, 7 N in MeOH) and the reaction was stirred at -10 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 8bb.
[0355] General procedure for the synthesis of compound 9bb: To a stirred solution of compound 8bb (0.27 mmol) in trimethylphosphate (2 mL) was added P(0)C13 (175 μL, 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. A few drops H20 was then added to quench the reaction. Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 9bb.
NAD+ 7-9
[0356] General procedure for the synthesis of NAD+ 7 and NAD+ 9: To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) were added 1, 1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23
μΐ., 0.16 mmol. 1.6 eq). The reaction mixture was stirred at room temperature for 14 hours, and then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum and the residue was coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'- AMP was dissolved in dried DMF (1 mL) and compound 9bb (0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H20 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative FIPLC. Fractions containing the desired product were concentrated and lyophilized to yield the corresponding NAD+ 7 and NAD+ 9.
[0357] The following Schemes 3 and 4 and reaction procedures provide additional conditions by which NAD+ 7 and NAD+ 9 may be prepared.
Scheme 3 : Synthesis of NAD+ 7
NAD+ analogue 9
Scheme 4: Synthesis of NAD+ 9
[0358] General procedure for the synthesis of compound 7-2 and 9-2: To a stirred solution of compound 3-2 (3.62 g, 9.0 mmol) in anhydrous THF (30 mL) was added NaH (432 mg, 10.8 mmol, 1.2 eq, 60% dispersion in mineral oil) at 0 °C followed by the addition of propargyl bromide (1.61 g, 13.5 mmol, 1.5 eq) or pent-4-yn-l-yl trifluoromethanesulfonate (2.92 g, 13.5 mmol, 1.5 eq) at the same temperature. Then the reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 6-8 hours, the reaction mixture was quenched with saturated aqueous NH4C1 (20 mL) and extracted with EtOAc (3X50 mL). The combined organic layers were washed water (3X50 mL), dried over anhydrous Na2S04, filtered and concentrated and purified by a flash column chromatography on silica gel to afford the corresponding product 7-2 and 7-2.
[0359] (2R,3R,45',5R)-5-(((tert-butyldiphenylsilyl)oxy)methyl)-2-methoxy-4-(prop-2-yn-l- yloxy)tet-rahydrofuran-3-ol (7-2). A colorless oil, 1.67 g, 42% yield; 1H NMR (400 MHz, CDC13): δ 1.07 (s, 9H, 3CH3), 2.45 (t, 1H, J= 2.4 Hz, CH), 2.59 (d, 1H, J = 3.2 Hz, OH), 3.31 (s, 3H, OCH3), 3.75 (dd, 1H, J= 10.8, 4.4 Hz, CH2), 3.80 (dd, 1H, J= 10.8, 5.2 Hz,
CH2), 4.09-4.13 (m, 1H, CH), 4.14-4.19 (m, 2H, CH+CH2), 4.24-4.29 (m, 2H, CH+CH2), 4.87 (s, 1H, CH), 7.36-7.45 (m, 6H, ArH), 7.68-7.71 (m, 4H, ArH); 13C NMR (100 MHz, CDC13): δ 19.4, 26.9, 55.3, 58.3, 64.6, 73.8, 75.6, 79.3, 79.7, 81.8, 108.4, 127.85, 127.87, 129.87, 129.91, 133.4, 135.76, 135.79.
[0360] (2R,3R,45',5R)-5-(((tert-butyldiphenylsilyl)oxy)methyl)-2-methoxy-4-(pent-4-yn-l- yloxy)tet-rahydrofuran-3-ol (9-2). A colorless solid, 1.27 g, 30% yield; 1H NMR (400 MHz, CD3CI): δ 1.07 (s, 9H, 3CH3), 1.75-1.83 (m, 2H, CH2), 1.95 (t, 2H, J= 2.4 Hz, CH), 2.21- 2.35 (m, 2H, CH2), 3.31 (s, 3H, OCH3), 3.57-3.65 (m, 2H, CH2), 3.70-3.80 (m, 2H, CH2), 4.07-4.09 (m, 3H, 3CH), 4.86 (s, 1H, CH), 7.36-7.45 (m, 6H, ArH), 7.68-7.70 (m, 4H, ArH); 13C NMR (100 MHz, CD3C1): δ 15.1, 19.3, 26.8, 28.1, 55.1, 64.6, 68.9, 69.1, 73.5, 79.5, 81.9, 83.3, 108.3, 127.68, 127.70, 129.70, 129.74, 133.3, 135.59, 135.61.
[0361] General procedure for the synthesis of compound 7-3 and 9-3: To a 0 °C solution of compound 7-2 (1.10 g, 2.5 mmol) or 9-2 (1.17 g, 2.5 mmol) in anhydrous THF (25 mL) was added AcOH (225 mg, 3.75 mmol, 1.5 eq) followed by the addition of TBAF (3.75 mL, 3.75 mmol, 1.0 M in THF, 1.5 eq). Then the reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 14 hours, the reaction mixture was concentrated under reduced pressure to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the corresponding compound 7-3 and 9-3.
[0362] (2R,3R,4^,5R)-5-(hydroxymethyl)-2-methoxy-4-(prop-2-yn- 1 -yloxy)tetrahydrof-uran- 3-ol (7-3). A colorless oil, 430 mg, 85% yield; 1H NMR (400 MHz, CDC13): δ 2.53 (t, 1H, J = 2.4 Hz, CH), 3.40 (s, 3H, OCH3), 3.63 (dd, 1H, J= 12.0, 4.0 Hz, CH2), 3.81 (dd, 1H, J = 12.0 3.2 Hz, CH2), 4.14-4.19 (m, 2H, 2CH), 4.19-4.30 (m, 3H, CH+CH2), 4.87 (s, 1H, CH); 13C NMR (100 MHz, CDC13): δ 55.7, 58.4, 62.7, 73.6, 75.7, 78.4, 79.0,82.3, 108.8.
[0363] (2R,3R,4^,5R)-5-(hydroxymethyl)-2-methoxy-4-(pent-4-yn- 1 -yloxy)tetrahydrofuran- 3-ol (9-3). A colorless oil, 461 mg, 80% yield; 1H NMR (400 MHz, CD3C1): δ 1.74-1.86 (m,
2H, CH2), 1.98 (t, 2H, J= 2.8 Hz, CH), 2.27-2.34 (m, 2H, CH2), 3.40 (s, 3H, OCH3), 3.58- 3.70 (m, 3H, CH2+CH2), 3.81 (dd, 1H, J= 11.6, 2.4 Hz, CH2), 4.07-4.14 (m, 3H, 3CH), 4.86 (s, 1H, CH); 13C MR (100 MHz, CD3C1): δ 15.0, 28.0, 55.7, 63.0, 69.1, 69.2, 73.5, 78.4, 82.5, 83.1, 108.9.
[0364] General procedure for the synthesis of compound 7-4 and 9-4: To a solution of 7-3 (404 mg, 2.0 mmol) or 9-3 (460 mg, 2.0 mmol) in a mixture of anhydrous DCM (10 mL) and anhydrous pyridine (10 mL) was added BzCl (691 μΐ., 6.0 mmol, 3 eq) at 0 °C. Then the reaction mixture was allowed to warm to room temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 7-4 and 9-4.
OBz
- -OMe
O OBz
7-4
[0365] ((2R,3R,4R,5R)-4-(benzoyloxy)-5-methoxy-3-(prop-2-yn-l-yloxy)tetrahydrofura-n-2- yl)met-hyl benzoate (7-4). A colorless oil, 591 mg, 72% yield; 1H MR (400 MHz, CDC13): δ 2.35 (t, 1H, J= 2.4 Hz, CH), 3.36 (s, 3H, OCH3), 4.22-4.23 (m, 2H, CH2), 4.42-4.48 (m, 2H, CH+CH2), 4.62-4.69 (m, 2H, CH+CH2), 5.05 (s, 1H, CH), 5.49 (d, 1H, J= 4.4 Hz, CH), 7.44-7.48 (m, 4H, ArH), 7.56-7.61 (m, 2H, ArH), 8.07-8.13 (m, 4H, ArH); 13C MR (100 MHz, CDC13): δ 55.1, 58.3, 64.2, 73.9, 75.3, 76.8, 128.3, 128.4, 129.4, 129.7, 129.87, 129.93, 133.1, 133.4, 165.6, 166.39.
[0366] ((2R,3R,4R,5R)-4-(benzoyloxy)-5-methoxy-3-(pent-4-yn-l-yloxy)tetrahydrofuran-2- yl)met-hyl benzoate (9-4). A colorless solid, 658 mg, 75% yield; 1H MR (400 MHz, CD3C1): δ 1.63-1.70 (m, 2H, CH2), 1.82 (t, 2H, J= 2.4 Hz, CH), 2.12-2.17 (m, 2H, CH2), 3.36 (s, 3H, OCH3), 3.54-3.59 (m, 1H, CH2), 3.65-3.71 (m, 1H, CH2), 4.30 (dd, 1H, J= 7.2, 4.0 Hz, CH), 4.43 (m, 2H, CH2+CH), 4.65 (dd, 1H, J= 13.2, 5.2 Hz, CH2), 5.02 (s, 1H, CH),
5.49 (d, 1H, J= 4.0 Hz, CH), 7.44-7.48 (m, 4H, ArH), 7.56-7.61 (m, 2H, ArH), 8.08 (d, 2H, J = 7.6 Hz, ArH), 8.12 (d, 2H, J= 7.2 Hz, ArH); 13C NMR (100 MHz, CD3C1): δ 15.0, 28.5, 55.2, 64.7, 68.6, 69.6, 74.1, 78.5, 79.1, 83.4, 106.3, 128.4, 128.5, 129.5, 129.7, 129.8, 129.9, 133.1, 133.4, 165.5, 166.4.
[0367] General procedure for the synthesis of compound 7-5 and 9-5: Compound 7-4 (533 mg, 1.3 mmol) or 9-4 (570 mg, 1.3 mmol) was dissolved in a mixture of TFA/H2O (9/1, 15 mL) and the resulting mixture was stirred at room temperature until the reaction complete (monitoring by TLC). Then the reaction was diluted with DCM (60 mL) and the solution was added dropwise to a stirred mixture of ice and saturated aqueous NaHC03. Solid NaHC03 was added during the addition to maintain a PH of 7. The mixture was extracted with DCM (3X50 mL), and the combined organic extracts was washed with H20 (50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. Ac20 (0.5 mL) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 7-5 and 9-5.
[0368] ((2R,3R,4R)-5-acetoxy-4-(benzoyloxy)-3-(prop-2-yn-l-yloxy)tetrahydrofuran-2- yl)methyl benzoate (7-5). A colorless oil, 456 mg, 80% yield; 1H NMR (400 MHz, CDC13): δ 1.95 (s, 3H, CH3), 2.38 (t, 1H, J= 2.4 Hz, CH), 4.25 (d, 2H, J= 2.4 Hz, CH2), 4.43-4.49 (m, 2H, CH2), 4.66 (dd, 1H, J= 8.0, 4.4 Hz, CH), 4.72-4.76 (m, 1H, CH), 5.56 (d, 1H, J= 4.4 Hz, CH), 6.32 (s, 1H, CH), 7.43-7.48 (m, 4H, ArH), 7.56-7.60 (m, 2H, ArH), 8.06-8.12 (m, 4H, ArH); 13C NMR (100 MHz, CDC13): δ 20.9, 58.5, 63.1, 73.6, 75.6, 75.7, 78.8, 79.9, 98.5, 128.4, 128.5, 129.1, 129.7, 129.85, 129.93, 133.2, 133.6, 165.4, 166.0, 169.0.
[0369] ((2R,3R,4R)-5-acetoxy-4-(benzoyloxy)-3-(pent-4-yn-l-yloxy)tetrahydrofuran-2- yl)methyl benzoate (9-5). A colorless oil, 497 mg, 82% yield; 1H NMR (400 MHz, CD3C1): δ 1.63-1.70 (m, 2H, CH2), 1.83 (t, 2H, J= 2.8 Hz, CH), 1.96 (s, 3H, CH3), 2.12-2.17 (m, 2H, CH2), 3.60 (dt, 1H, J= 9.2, 6.0 Hz, CH2), 3.72 (dt, 1H, J= 9.2, 5.5 Hz, CH2), 4.30 (dd, 1H, J = 8.4, 4.4 Hz, CH), 4.42-4.48 (m, 2H, CH2+CH), 4.70 (dt, 1H, J= 13.2, 2.4 Hz, CH2), 5.57 (d, 1H, J= 4.4 Hz, CH), 6.31 (s, 1H, CH), 7.43-7.48 (m, 4H, ArH), 7.56-7.62 (m, 2H, ArH), 8.06-8.12 (m, 4H, ArH); 13C NMR (100 MHz, CD3C1): δ 14.9, 20.9, 28.4, 63.7, 68.6, 69.8, 73.7, 77.6, 78.0, 83.3, 98.4, 128.4, 128.5, 129.1, 129.68, 129.73, 129.8, 133.2, 133.5, 165.2, 166.1, 168.9.
[0370] General procedure for the synthesis of 7-6 and 9-6: Compound 9-5 (307 mg, 0.70 mmol) or 9-5 (327 mg, 0.70 mmol) was dissolved in toluene (10 mL) and cooled to 0 °C. HBr (33wt% in acetic acid) (257 mg, 1.05 mmol, 1.5 eq) was added dropwise and the reaction was stirred at 0 °C for 5 hours. After the starting material was consumed, the reaction was concentrated under reduced pressure to give a residue. The residue was azeotroped with toluene (3X20 mL) to remove remaining acetic acid and dried in vacuo. The crude product and nicotinamide (103 mg, 0.84 mmol, 1.2 eq) was dissolved in CH3CN (20 mL). The reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) and purified by a flash column chromatography on silica gel to afford the corresponding compound 7-6 and 9-6.
[0371] l-((2R,3R,4R,5R)-3-(benzoyloxy)-5-((benzoyloxy)methyl)-4-(prop-2-yn-l- yloxy)tetrahydrof-uran-2-yl)-3 -carbarn oylpyridin-l-ium bromide (7-6). A colorless solid, 260 mg, 64% yield; 1H NMR (400 MHz, CDC13): δ 2.34 (t, 1H, J= 2.8 Hz, CH), 4.35 (dd, 1H, J = 16.0, 2.0 Hz, CH2), 4.43 (dd, 1H, J= 16.0, 2.0 Hz, CH2), 4.80-4.84 (m, 1H, CH), 4.91 (d, 2H, J= 2.8 Hz, CH2), 5.13 (dd, 1H, J= 8.4, 4.8 Hz, CH), 6.33 (d, 1H, J= 5.6 Hz, CH), 6.50
(br, 1H, NH), 6.70 (s, 1H, CH), 7.44-7.52 (m, 4H, ArH), 7.59-7.63 (m, 2H, ArH), 7.93-7.97 (m, 1H, ArH), 8.07-8.13 (m, 4H, ArH), 9.08 (d, 1H, J= 7.2 Hz, ArH), 9.16 (br, 1H, NH), 9.25 (d, 1H, J = 6.0 Hz, ArH), 10.07 (s, 1H, ArH); 13C NMR (100 MHz, CDC13): δ 59.2, 62.7, 74.4, 75.8, 76.3, 79.2, 82.5, 98.5, 128.4, 128.6, 128.8, 128.9, 129.3, 130.0, 130.3, 133.9, 134.2, 134.6, 141.5, 142.0, 146.8, 163.6, 166.3, 171.3.
[0372] l-((2R,3R,4R,5R)-3-(benzoyloxy)-5-((benzoyloxy)methyl)-4-(pent-4-yn-l- yloxy)tetrahydro-furan-2-yl)-3 -carbarn oylpyridin-l-ium bromide (9-6). A colorless solid, 303 mg, 71% yield; 1H NMR (400 MHz, CD3OD): δ 1.67-1.74 (m, 2H, CH2), 2.08 (t, 1H, J= 2.4 Hz, CH), 2.19 (td, 2H, J= 6.8, 2.4 Hz, CH2), 3.70 (t, 2H, J= 6.0 Hz, CH2), 4.54-4.55 (m, 1H, CH), 4.87-4.95 (m, 3H, CH2+CH), 5.91-5.94 (m, 1H, CH), 6.76 (s, 1H, CH), 7.51 (t, 2H, J = 8.0 Hz, ArH), 7.57 (t, 2H, J= 8.0 Hz, ArH), 7.63-7.67 (m, 1H, ArH), 7.69-7.73 (m, 1H, ArH), 8.06-8.08 (m, 2H, ArH), 8.18-8.20 (m, 2H, ArH), 8.24 (dd, 1H, J= 8.0, 6.4 Hz, ArH), 9.04 (d, 1H, J= 8.0 HZ, ArH), 9.40 (d, 1H, J= 6.4 HZ, ArH), 9.66 (s, 1H, ArH); 13C NMR (100 MHz, CD3OD): δ 15.6, 29.7, 64.1, 70.0, 70.7, 76.8, 78.2, 84.0, 84.5, 99.7, 129.9, 130.65, 130.68, 130.7, 131.1, 134.8, 135.3, 136.0, 142.1, 143.8, 146.8, 164.9, 167.3, 167.5.
[0373] General procedure for the synthesis of 7-7 and 9-7: Compound 9-6 (233 mg, 0.40 mmol) or 9-6 (244 mg, 0.40 mmol) was dissolved in ammonia (20 mL, 7 N in MeOH) and the reaction was stirred at 0 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the corresponding desired product 7-7 and 9-7.
[0374] 3-carbamoyl-l-((2R,3R,4^,5R)-3-hydroxy-5-(hydroxymethyl)-4-(prop-2-yn-l- yloxy)tetrahy-drofuran-2-yl)pyridin-l-ium bromide (7-7). A colorless solid, 97 mg, 65%
yield; 1H NMR (400 MHz, D20): δ 2.91 (t, 1H, J= 2.4 Hz, CH), 4.15 (ddd, 1H, J= 12.0, 5.2, 2.0 Hz, CH2), 4.31 (ddd, 1H, J= 12.0, 4.4, 2.4 Hz, CH2), 4.10-4.34 (m, 3H, CH+CH2), 4.66 (t, 1H, J= 5.2 Hz, CH), 6.19 (d, 1H, J= 5.6 Hz, CH), 8.28 (dd, 1H, J= 8.0, 6.0 Hz, ArH), 8.97 (dt, 1H, J= 8.0, 1.6 Hz, ArH), 9.26 (d, 1H, J= 6.0 Hz, ArH), 9.44 (s, 1H, ArH); 13C NMR (100 MHz, D20): δ 57.96, 57.99, 60.0, 76.1, 76.4, 76.5, 85.8, 99.9, 128.3, 133.9, 140.3, 142.6, 145.7, 165.7.
[0375] 3-carbamoyl-l-((2R,3R,4R,5R)-4-hydroxy-5-(hydroxymethyl)-3-(pent-4-yn-l- yloxy)tetrah-ydrofuran-2-yl)pyridin-l-ium bromide (9-7). A colorless solid, 106 mg, 66% yield; 1H NMR (400 MHz, D20): δ 1.79-1.86 (m, 2H, CH2), 2.32-2.36 (m, 3H, CH+CH2), 3.72-3.81 (m, 2H, CH2), 3.91 (dd, 1H, J= 12.8, 3.6 Hz, CH2), 4.08 (dd, 1H, J= 12.8, 2.8 Hz, CH2), 4.16 (t, 1H, J= 4.8 Hz, CH), 4.55-4.58 (m, 1H, CH), 4.66 (t, 1H, J= 4.8 Hz, CH), 6.28 (d, 1H, J= 4.8 Hz, CH), 8.29 (dd, 1H, J= 8.4, 6.8 Hz, ArH), 8.99 (d, 1H, J= 8.4 Hz, ArH), 9.27 (d, 1H, J= 6.8 Hz, ArH), 9.62 (s, 1H, ArH); 13C NMR (100 MHz, D20): δ 14.3, 27.4, 60.1, 69.3, 69.5, 76.1, 76.9, 84.8, 85.7, 100.1, 128.3, 133.9, 140.3, 142.6, 145.6, 165.7.
[0376] General procedure for the synthesis of 7-8 and 9-8: To a stirred solution of compound 7-7 (82 mg, 0.22 mmol) or 9-7 (88 mg, 0.22 mmol) in trimethylphosphate (2 mL) was added P(0)C13 ( 143 μΐ., 1.54 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. A few drops H20 was then added to quench the reaction. Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the corresponding desired product 7-8 and 9-8.
[0377] ((2R,3S,4R,5R)-5-(3 -carbamoylpyridin- 1 -ium- 1 -yl)-4-hydroxy-3 -(prop-2-yn- 1 - yloxy)tetrah-ydrofuran-2-yl)methyl hydrogen phosphate (7-8). A colorless solid, 57 mg, 69% yield; 1H NMR (400 MHz, D20): δ 1.52 (t, 1H, J= 2.8 Hz, CH), 3.90 (dd, 1H, J= 12.8, 2.8 Hz, CH2), 4.06 (dd, 1H, J= 12.8, 2.8 Hz, CH2), 4.33-4.39 (m, 3H, CH+CH2), 4.59-4.61 (m, 1H, CH), 4.67 (t, 1H, J= 4.4 Hz, CH), 6.25 (d, 1H, J= 4.0 Hz, CH), 8.25-8.29 (m, 1H, ArH), 8.97 (d, 1H, J= 8.4 Hz, ArH), 9.26 (d, 1H, J= 6.0 Hz, ArH), 9.59 (s, 1H, ArH); 13C NMR (100 MHz, D20): δ 58.1, 64.2 (d, J= 4.9 Hz), 76.5, 76.7, 77.8, 78.9, 85.2 (d, J= 9.3 Hz), 99.8, 128.5, 133.9, 139.8, 142.4, 146.0, 165.7.
[0378] ((2R, 3R,4R, 5R)-5 -(3 -carbamoylpyridin- 1 -ium- 1 -yl)-3 -hy droxy-4-(pent-4-yn- 1 - yloxy)tetrah-ydrofuran-2-yl)methyl hydrogen phosphate (9-8). A colorless solid, 59 mg, 67% yield; 1H NMR (400 MHz, D20): δ 1.79-1.86 (m, 2H, CH2), 2.30-2.34 (m, 3H, CH+CH2), 3.78 (t, 2H, J= 6.4 Hz, CH2), 4.12-4.17 (m, 1H, J= 12.8, CH2), 4.22 (dd, 1H, J= 4.8, 2.4 Hz, CH), 4.30-4.35 (m, 1H, CH2), 4.63 (t, 1H, J= 4.8 Hz, CH), 4.73 (t, 1H, J= 2.4 Hz, CH), 6.20 (d, 1H, J= 4.8 Hz, CH), 8.28 (dd, 1H, J= 8.0, 6.4 Hz, ArH), 8.97 (d, 1H, J= 8.0 Hz, ArH), 9.25 (d, 1H, J= 6.4 Hz, ArH), 9.43 (s, 1H, ArH); 13C NMR (100 MHz, D20, TMS): δ 14.3, 27.4, 64.4 (d, J= 4.5 Hz), 69.3, 69.5, 76.8, 78.2, 85.3 (d, J= 9.8 Hz), 100.0, 128.4, 133.9, 139.8, 142.4, 145.9, 165.7.
NAD* analogue 7
[0379] General procedure for the synthesis of NAD+ analogue 7 and 9: To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) were added 1, 1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μΐ., 0.16 mmol. 1.6 eq). The reaction mixture was stirred at room temperature for 14 hours, and then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum
and the residue was coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'- AMP was dissolved in dried DMF (1 mL) and compound (7-8) or 9-8 (0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H20 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC. Fractions containing the desired product were concentrated and lyophilized to yield the corresponding NAD+ 7 and NAD+ 9.
[0380] NAD+ analogue 7. A colorless solid, 40% yield; 1H NMR (400 MHz, D20): δ 2.91 (t, 1H, J= 2.0 Hz, CH), 4.25 (br, 3H, CH2+CH2), 4.35-4.44 (m, 5H, 2CH2+CH), 4.51 (br, 1H, CH), 4.64 (t, 1H, J= 5.2, CH), 4.73-4.77 (m, 2H, 2CH), ,6.11-6.13 (m, 2H, 2CH), 8.24-8.28 (m, 1H, ArH), 8.32 (br, 1H, ArH), 8.65 (br, 1H, ArH), 8.90 (d, 1H, J= 7.6 Hz, ArH), 9.22 (d, 1H, J= 5.6 Hz, ArH), 9.39 (s, 1H, ArH); HRMS (ESI) Calcd. For C24H28N7Na2Oi4P2 + (M+2Na-2H)+ requires 746.0965, Found: 746.0958.
[0381] NAD+ analogue 9. A colorless solid, 47% yield; 1H NMR (400 MHz, D20): δ 1.76- 1.87 (m, 2H, CH2), 2.29-2.34 (m, 2H, CH2), 3.76 (t, 1H, J= 2.4 Hz, CH), 4.18-4.28 (m, 4H, 2CH2), 4.38-4.42 (m, 2H, CH2), 4.51 (t, 1H, J= 4.0 Hz, CH), 4.63 (t, 1H, J= 5.6, CH), 4.71- 4.74 (m, 2H, 2CH), , 6.13 (d, 1H, J= 5.2 Hz, CH), 6.16 (d, 1H, J= 6.0 Hz, CH), 8.29 (dd, 1H, J= 8.4, 6.0 Hz, ArH), 8.40 (s, 1H, ArH), 8.60 (s, 1H, ArH), 8.94 (d, 1H, J= 8.4 Hz, ArH), 9.26 (d, 1H, J= 6.0 Hz, ArH), 9.42 (s, 1H, ArH); HRMS (ESI) Calcd. For
C26H34N2Oi4P2 + (M+H)+ requires 730.1633, Found: 730.1631.
[0382] NAD+ 8 is prepared following the procedure as described above with the necessary modifications well-understood by the skilled artisan.
2cc
[0383] General procedure for the synthesis of compound 2cc: To a stirred solution of
(2R,3S,4R,5R)-2-(((tert-butyldiphenylsilyl)oxy)methyl)-5-methoxytetrahydrofuran-3,4-diol
(1 eq) in anhydrous THF (25 mL) was added NaH (1.1 eq, 60% dispersion in mineral oil) at 0
°C followed by the addition of R500Br (1.5 eq) at the same temperature. If the target compound is, for example, NAD+ 14, R500 is propargyl. Other compounds NAD+ 10-13 and
15-18 may use the corresponding alkyl bromide. Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 6 hours, the reaction mixture was
quenched with saturated aqueous H4C1 (20 mL) and extracted with EtOAc (3X50 mL). The combined organic layers were washed water (3X50 mL), dried over anhydrous Na2S04, filtered and concentrated and purified by a flash column chromatography on silica gel to afford the compound 2cc.
3cc
[0384] General procedure for the synthesis of compound 3cc: To a stirred solution of compound 2bb (1 eq) in anhydrous THF (25 mL) was added NaH (1.1 eq, 60% dispersion in mineral oil) at 0 °C followed by the addition of corresponding R520Br or R520OTf (1.5 eq) at the same temperature. If the target compound is, for example, NAD+ 14, R520 is -CH2-Chx, wherein Chx is cyclohexyl. Other compounds NAD+ 10-13 and 15-18 may use the corresponding alkyl bromide or alkyl triflate. Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 6 hours, the reaction mixture was quenched with saturated aqueous H4CI (20 mL) and extracted with EtOAc (3X50 mL). The combined organic layers were washed water (3X50 mL), dried over anhydrous Na2S04, filtered and concentrated and purified by a flash column chromatography on silica gel to afford the compound 3cc.
4cc
[0385] General procedure for the synthesis of compound 4cc: To a 0 °C solution of compound 3cc (2.1 mmol) in anhydrous THF (25 mL) was added AcOH (180 μΐ^, 3.2 mmol, 1.5 eq) followed by the addition of TBAF (3.2 mL, 3.2 mmol, 1.0 M in THF, 1.5 eq). Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 14 hours, the reaction mixture was concentrated under reduced pressure to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the corresponding compound 4cc.
[0386] ((2R,3R,4R,5R)-3-(cyclohexylmethoxy)-5-methoxy-4-(prop-2-yn-l- yloxy)tetrahydrofuran-2-yl)methanol (4cc). A colorless oil; XH NMR (400 MHz, CDC13): δ 0.87-0.97 (m, 2H, CH2), 1.12-1.29 (m, 3H, CH2), 1.57-1.79 (m, 6H, CH2), 2.47 (t, 1H, J= 2.4 Hz, CH), 3.24 (dd, 1H, J= 8.8, 6.4 Hz, CH2), 3.38-3.42 (m, 4H, OCH3+CH2), 3.60 (dd, 1H, J = 12.0, 3.2 Hz, CH2), 3.83 (dd, 1H, J= 12.0, 3.2 Hz, CH2), 4.03 (dd, 1H, J= 6.8, 4.4 Hz, CH), 4.09 (d, 1H, J= 5.2 Hz, CH), 4.13-4.17 (m, 1H, CH), 4.34-4.35 (m, 1H, CH), 4.92 (s, 1H, CH).
5cc
[0387] General procedure for the synthesis of compound 5cc: To a solution of compound 4cc (1.7 mmol) in a mixture of anhydrous DCM (10 mL) and anhydrous pyridine (10 mL) was added BzCl (588 μΐ., 5.1 mmol, 3 eq) at 0 °C. Then the reaction mixture was allowed to warm to room temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed
successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 5cc.
[0388] ((2R,3R,4R,5R)-3-(cyclohexylmethoxy)-5-methoxy-4-(prop-2-yn-l- yloxy)tetrahydrofuran-2-yl)methyl benzoate (5cc). A colorless oil; 1H NMR (400 MHz, CDCI3): δ 0.84-0.96 (m, 2H, CH2), 1.10-1.25 (m, 3H, CH2), 1.57-1.77 (m, 6H, CH2), 2.46 (t, 1H, J= 2.4 Hz, CH), 3.23 (dd, 1H, J= 8.8, 6.8 Hz, CH2), 3.31 (s, 3H, OCH3), 3.42 (dd, 1H, J = 8.8, 6.0 Hz, CH2), 4.07-4.10 (m, 1H, CH), 4.14 (d, 1H, J= 4.4 Hz, CH), 44.31-4.42 (m, 4H, CH+2CH2),4.54-4.59 (m, 1H, CH2), 4.93 (s, 1H, CH), 7.44 (t, 2H, J= 7.6 Hz, ArH), 7.56 (t, 1H, J= 7.6 Hz, ArH), 8.08 (dd, 2H, J= 7.6, 0.8 Hz, ArH).
6cc
[0389] General procedure for the synthesis of compound 6cc: Compound 5cc (1.3 mmol) was dissolved in a mixture of TFA/H20 (9/1, 15 mL) and the resulting mixture was stirred at room temperature until the reaction complete (monitoring by TLC). Then the reaction was diluted with DCM (60 mL) and the solution was added dropwise to a stirred mixture of ice and saturated aqueous NaHC03. Solid NaHC03 was added during the addition to maintain a PH of 7. The mixture was extracted with DCM (3X50 mL), and the combined organic extracts was washed with H20 (50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. Ac20 (0.5 mL) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 6cc.
[0390] ((2R,3R,4R)-5-acetoxy-3-(cyclohexylmethoxy)-4-(prop-2-yn-l- yloxy)tetrahydrofuran-2-yl)methyl benzoate (6cc). A colorless oil; XH MR (400 MHz, CDC13): δ 0.86-0.98 (m, 2H, CH2), 1.11-1.27 (m, 3H, CH2), 1.57-1.78 (m, 6H, CH2), 1.94 (s, 3H, CH3), 2.47 (t, 1H, J= 2.4 Hz, CH), 3.26 (dd, 1H, J= 8.8, 6.4 Hz, CH2), 3.46 (dd, 1H, J = 8.8, 6.4 Hz, CH2), 4.07 (dd, 1H, J= 7.6, 4.4 Hz, CH), 4.21 (d, 1H, J= 4.4 Hz, CH), 4.34-4.45 (m, 4H, CH+2CH2),4.64 (dd, 1H, J= 13.6, 4.8 Hz, CH2), 6.21 (s, 1H, CH), 7.44 (t, 2H, J = 7.6 Hz, ArH), 7.57 (t, 1H, J= 7.6 Hz, ArH), 8.08 (d, 2H, J= 7.6 Hz, ArH).
[0391] General procedure for the synthesis of compound 7cc: Compound 6cc (0.70 mmol) was dissolved in toluene (10 mL) and cooled to 0 °C. HBr (33wt% in acetic acid) (257 mg, 1.05 mmol, 1.5 eq) was added dropwise and the reaction was stirred at 0 °C for 5 hours. After
the starting material was consumed, the reaction was concentrated under reduced pressure to give a residue. The residue was azeotroped with toluene (3X20 mL) to remove remaining acetic acid and dried in vacuo. The crude product and nicotinamide (103 mg, 0.84 mmol, 1.2 eq) was dissolved in CH3CN (20 mL). The reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) and purified by a flash column chromatography on silica gel to afford the corresponding compound 7cc.
[0392] l-((2R,3R,4R,5R)-5-((benzoyloxy)methyl)-4-(cyclohexylmethoxy)-3-(prop-2-yn-l- yloxy)tetrahydrofuran-2-yl)-3 -carbarn oylpyri din- 1-ium bromide. A colorless solid; 1H MR (400 MHz, CDC13): δ 0.69-0.82 (m, 2H, CH2), 1.04-1.18 (m, 3H, CH2), 1.30-1.66 (m, 6H, CH2), 2.39 (t, 1H, J= 2.8 Hz, CH), 3.28 (dd, 1H, J= 8.8, 6.4 Hz, CH2), 3.35 (dd, 1H, J= 8.8, 6.4 Hz, CH2), 4.16 (dd, 1H, J= 4.0, 2.4 Hz, CH), 4.24 (dd, 1H, J= 16.0, 2.4 Hz, CH2), 4.51 (dd, 1H, J= 16.0, 2.4 HZ, CH2), 4.55 (d, 1H, J= 2.8 Hz, CH2), 5.0 (t, 1H, J= 4.8 Hz, CH), 5.07 (dd, 1H, J= 6.8, 3.6 Hz, CH), 6.21 (s, 1H, CH), 7.12 (d, 1H, J = 5.6 Hz, CH), 7.52 (t, 2H, J= 7.6 Hz, ArH), 7.62 (t, 1H, J= 7.6 Hz, ArH), 7.98-8.02 (m, 1H, ArH), 8.08 (d, 2H, J = 7.6 Hz, ArH), 8.99 (d, 1H, J= 6.0 Hz, ArH), 9.14 (d, J = 8.0 Hz, ArH), 9.22 (s, 1H, H), 10.69 (s, 1H, ArH).
[0393] General procedure for the synthesis of compound 8cc: Compound 7cc (0.45 mmol) was dissolved in ammonia (18 mL, 7 N in MeOH) and the reaction was stirred at -10 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired corresponding product 8cc.
[0394] 3-carbamoyl-l-((2R,3R,4R,5R)-4-(cyclohexylmethoxy)-5-(hydroxymethyl)-3-(prop-2- yn-l-yloxy)tetrahydrofuran-2-yl)pyridin-l-ium bromide. A colorless solid; 1H MR (400 MHz, D20): δ 0.54-0.64 (m, 2H, CH2), 0.86-1.01 (m, 3H, CH2), 1.12-1.29 (m, 3H, CH2), 1.34-1.49 (m, 3H, CH2), 2.97 (t, 1H, J= 2.4 Hz, CH), 3.28 (dd, 1H, J= 8.8, 5.2 Hz, CH2), 3.33-3.37 (m, 1H, CH2), 3.76 (dd, 1H, J= 12.8, 4.4 Hz, CH2), 3.87 (dd, 1H, J= 12.8, 3.2 HZ, CH2), 4.26 (d, 1H, J= 4.8 Hz, CH), 4.31-4.41 (m, 2H, CH2), 4.93 (t, 1H, J= 5.6 Hz, CH), 5.0 (t, 1H, J= 3.2 Hz, CH), 6.62 (d, 1H, J= 5.6 Hz, CH), 8.17-8.21 (m, 1H, ArH), 8.96 (d, 1H, J = 8.0 Hz, ArH), 9.04 (d, J= 6.4 Hz, ArH), 9.28 (s, 1H, ArH).
[0395] General procedure for the synthesis of compound 9cc: To a stirred solution of compound 8cc (0.27 mmol) in trimethylphosphate (2 mL) was added P(0)C13 ( 175 μΐ., 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. A few drops H20 was then added to quench the reaction. Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired
corresponding product 9cc.
[0396] ((2R,3R,4R,5R)-5-(3-carbamoylpyridin-l-ium-l-yl)-3-(cyclohexylmethoxy)-4-(prop- 2-yn-l-yloxy)tetrahydrofuran-2-yl)methyl hydrogen phosphate. A colorless solid; 1H MR (400 MHz, D20): δ 0.69-0.80 (m, 2H, CH2), 1.02-1.16 (m, 3H, CH2), 1.27-1.44 (m, 3H,
CH2), 1.51-1.61 (m, 3H, CH2), 2.94 (t, 1H, J= 2.4 Hz, CH), 3.27 (dd, 1H, J= 9.2, 5.2 Hz, CH2), 3.31-3.37 (m, 1H, CH2), 4.01-4.06 (m, 1H, CH2), 4.11-4.16 (m, 1H, CH2), 4.31-4.40 (m, 3H, CH+CH2), 4.95 (t, 1H, J= 5.6 Hz, CH), 5.11 (br, 1H, CH), 6.63 (d, 1H, J= 5.6 Hz, CH), 8.14-8.18 (m, 1H, ArH), 8.92 (d, 1H, J= 7.6 Hz, ArH), 9.02 (d, J= 6.0 Hz, ArH), 9.27 (s, 1H, ArH).
NAD+ 10-18
[0397] General procedure for the synthesis of NAD+ 10-18: To a stirred solution of
Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) were added 1, 1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μΐ., 0.16 mmol. 1.6 eq). The reaction mixture was stirred at room temperature for 14 hours, and then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum and the residue was coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'- AMP was dissolved in dried DMF (1 mL) and compound 9cc (0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H20 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC. Fractions containing the desired product were concentrated and lyophilized to yield NAD+
10-18.
NAD* 14
[0398] NAD+ 14. A colorless solid; 1H MR (400 MHz, D20): δ 0.58-0.69 (m, 2H, CH2), 0.95-1.09 (m, 3H, CH2), 1.17-1.35 (m, 3H, CH2), 1.47-1.60 (m, 3H, CH2), 2.92 (t, 1H, J= 2.4 Hz, CH), 3.12 (dd, 1H, J= 8.8, 5.6 Hz, CH2), 3.21-3.25 (m, 1H, CH2), 4.05-4.13 (m, 2H, CH2), 4.23-4.29 (m, 5H, CH2+CH2+CH), 4.37-4.41 (m, 1H, CH2), 4.49-4.52 (m, 1H, CH), 4.68 (t, 1H, J= 5.6 Hz, CH), 4.91 (t, 1H, J= 5.6 Hz, CH), 5.01 (br, lH, CH), 6.00 (d, 1H, J =
6.0 Hz, CH), 6.49 (d, 1H, J= 6.8 Hz, CH), 8.04 (dd, 1H, J= 8.0, 6.0 Hz, ArH), 8.50 (s, 1H, ArH), 8.80 (d, 1H, J= 8.0 Hz, ArH), 8.85 (d, J= 6.0 Hz, ArH), 9.04 (s, 1H, ArH)
[0399] General procedure for the synthesis of compound 2dd: To a solution of
((3aR,5S,6R,6aR)-6-azido-2,2-dimethyltetrahydrofuro[2,3-d][l,3]dioxol-5-yl)methyl benzoate (prepared according to the reported method by Nucleosides, Nucleotides and Nucleic Acids, 2013, 32, 646-659) (1.7 mmol) in a mixture of anhydrous MeOH was added AcCl (2.0 eq) at r.t. to offer an intermediate compound A. Then the intermediate compound A was dissolved in DCM (10 mL) and anhydrous pyridine (10 mL) followed by the addition of BzCl (5.1 mmol, 3 eq) at 0 °C. Then the reaction mixture was allowed to warm to room temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the compound 2dd.
[0400] ((2,S',3R,4R)-3-azido-4-(benzoyloxy)-5-methoxytetrahydrofuran-2-yl)methyl benzoate (2dd). A colorless solid, 56% yield for two steps; 1H NMR (400 MHz, CDC13): δ 3.36 (s, 3H, OCH3), 4.34 (dd, 1H, J= 7.2, 4.4 Hz, CH), 4.46-4.50 (m, 2H, CH2+CH), 4.66 (dd, 1H, J = 13.2, 5.2 Hz, CH2), 5.05 (s, 1H, CH), 5.51 (d, 1H, J= 4.4 Hz, CH), 7.45-7.50 (m, 4H, ArH), 7.57-7.64 (m, 2H, ArH), 8.08-8.13 (m, 4H, ArH); 13C NMR (100 MHz, CDC13): δ 55.3, 61.2, 64.2, 76.7, 78.9, 106.1, 128.5, 128.6, 128.9, 129.6, 129.8, 130.0, 133.3, 133.7, 165.4, 166.2.
[0401] General procedure for the synthesis of compound 3dd: Compound 2dd (1.3 mmol) was dissolved in a mixture of TFA/H20 (9/1, 15 mL) and the resulting mixture was stirred at room temperature until the reaction complete (monitoring by TLC). Then the reaction was diluted with DCM (60 mL) and the solution was added dropwise to a stirred mixture of ice and saturated aqueous NaHC03. Solid NaHC03 was added during the addition to maintain a
PH of 7. The mixture was extracted with DCM (3X50 mL), and the combined organic extracts was washed with H20 (50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. Ac20 (0.5 mL) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the compound 3dd.
((2S,3R,4R)-5-acetoxy-3-azido-4-(benzoyloxy)tetrahydrofuran-2-yl)methyl benzoate (3dd).
A corless oil, 88% yield. 1H MR (400 MHz, CDC13): δ 1.95 (s, 3H, CH3), 4.37 (dd, 1H, J = 8.4, 4.4 Hz, CH), 4.47-4.52 (m, 2H, CH+CH2), 4.73 (dd, 1H, J= 13.2, 4.4 Hz, CH2), 5.62 (d, 1H, J= 4.4 Hz, CH), 6.32 (s, 1H, CH), 7.44-7.51 (m, 4H, ArH), 7.58-7.65 (m, 2H, ArH), 8.07-8.12 (m, 4H, ArH); 13C MR (100 MHz, CDC13): 5 20.8, 60.5, 63.2, 76.2, 80.0, 98.2, 128.5, 128.6, 129.5, 129.7, 129.8, 130.0, 133.5, 133.9, 165.2, 166.0, 168.8.
[0402] General procedure for the synthesis of compound 4dd: Compound 3dd (0.70 mmol) was dissolved in toluene (10 mL) and cooled to 0 °C. HBr (33wt% in acetic acid) (257 mg, 1.05 mmol, 1.5 eq) was added dropwise and the reaction was stirred at 0 °C for 5 hours. After the starting material was consumed, the reaction was concentrated under reduced pressure to give a residue. The residue was azeotroped with toluene (3X20 mL) to remove remaining acetic acid and dried in vacuo. The crude product and nicotinamide (103 mg, 0.84 mmol, 1.2 eq) was dissolved in CH3CN (20 mL). The reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) and purified by a flash column chromatography on silica gel to afford the compound 4dd (279 mg, 70%) as a colorless solid.
[0403] l-((2R,3R,4R,5S)-4-azido-3-(benzoyloxy)-5-((benzoyloxy)methyl)tetrahydrofuran-2- yl)-3-carbamoylpyridin-l-ium bromide (4dd). 1H MR (400 MHz, CD3OD): δ 4.77 (m, 1H, CH), 4.89-4.95 (m, 3H, CH+CH2), 6.03-6.04 (m, 1H, CH), 6.69 (d, 1H, J= 1.6 Hz, CH),
7.49-7.53 (m, 2H, ArH), 7.56-7.60 (m, 2H, ArH), 7.63-7.68 (m, 1H, ArH), 7.70-7.75 (m, 1H,
ArH), 8.06-8.09 (m, 2H, ArH), 8.19-8.21 (m, 2H, ArH), 8.24 (dd, 1H, J= 8.0, 6.4 Hz, ArH), 9.03-9.06 (m, 1H, ArH), 9.41 (d, 1H, J= 6.4 Hz, ArH), 9.66 (s, 1H, ArH); 13C NMR (100 MHz, CD3OD): δ 60.3, 63.8, 79.9, 84.3, 99.3, 129.56, 129.60, 129.9, 130.0, 130.5, 130.8, 131.2, 134.9, 135.5, 136.0, 142.3, 143.9, 147.0, 164.8, 167.3, 167.5.
5dd
[0404] General procedure for the synthesis of compound 5dd: Compound 4dd (0.45 mmol) was dissolved in ammonia (18 mL, 7 N in MeOH) and the reaction was stirred at -10 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 5dd (91 mg, 63%) as a colorless solid.
[0405] l-((2R,3R,4^,55)-4-azido-3-hydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-3- carbamoyl-pyridin- 1 -ium bromide (5dd). A colorless solid, 63% yield; 1H NMR (400 MHz, D20): δ 3.91 (dd, 1H, J= 13.2, 2.8 Hz, CH2), 4.08 (dd, 1H, J= 13.2, 2.8 Hz, CH2), 4.35 (t, 1H, J= 5.2 Hz, CH), 4.50-4.52 (m, 1H, CH), 4.79 (m, 1H, CH, overlap with solvent residue peak), 6.27 (d, 1H, J= 4.0 Hz, CH), 8.28 (dd, 1H, J= 8.0, 6.8 Hz, ArH), 8.98 (d, 1H, J= 8.0 Hz, ArH), 9.27 (d, 1H, J= 6.8 Hz, ArH), 9.61 (s, 1H, ArH); 13C NMR (100 MHz, D20): δ 60.0, 60.7, 77.6, 85.5, 99.5, 128.3, 133.9, 140.3, 142.6, 145.7, 165.7.
[0406] General procedure for the synthesis of compound 6dd: To a stirred solution of compound 5dd (0.27 mmol) in tnmethylphosphate (2 mL) was added P(0)C13 ( 175 μL, 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. A few drops H20 was then added to quench the reaction. Tnmethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining tnmethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 6dd (52 mg, 72%)) as a colorless solid.
[0407] ((2^3^4R,5R)-3-azido-5-(3-carbamoylpyridin-l-ium-l-yl)-4- hydroxytetrahydrofuran-2-yl)methyl hydrogen phosphate (6dd). A colorless solid, 72% yield; 1H NMR (400 MHz, D20): δ 4.15 (ddd, 1H, J= 12.0, 4.8, 2.4 Hz, CH2), 4.32 (ddd, 1H, J = 12.0, 4.4, 2.4 Hz, CH2), 4.49 (dd, 1H, J= 5.6, 2.8 Hz, CH), 4.64 (t, 1H, J= 2.4 Hz, CH), 4.83 (t, 1H, J= 5.6 Hz, CH, overlap with solvent residue peak), 6.22 (d, 1H, J= 5.6 Hz, CH), 8.29 (dd, 1H, J= 8.0, 6.0 Hz, ArH), 8.98 (d, 1H, J= 8.0 Hz, ArH), 9.26 (d, 1H, J= 6.0 Hz, ArH), 9.44 (s, 1H, ArH); 13C NMR (100 MHz, D20): δ 62.3, 64.3 (d, J= 4.7 Hz), 77.8, 85.1 (d, J = 8.7 Hz), 99.3, 128.5, 133.9, 139.8, 142.4, 146.0, 165.7.
[0408] General procedure for the synthesis of NAD+ 19: To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) were added 1, 1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μΐ^, 0.16 mmol. 1.6 eq). The reaction mixture was stirred at room temperature for 14 hours, and then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum and the residue was coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'-AMP was dissolved in dried DMF (1 mL) and compound 6dd (0.10 mmol, 1.0 eq) was added.
After stirring at room temperature for 4 days, H20 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC. Fractions containing the desired product were concentrated and lyophilized to yield NAD+ 19.
[0409] NAD+ 19. A colorless solid, 45% yield; 1H NMR (400 MHz, D20): δ 4.18-4.25 (m, 2H, CH2), 4.38-4.41 (m, 2H, CH2), 4.49-4.53 (m, 2H, 2CH), 4.59 (br, 1H, CH), 4.71 (t, 1H, J = 5.6 Hz, CH), 4.68-4.80 (1H, CH, overlapped with solvent residue peak), 4.83 (t, 1H, J= 5.6 Hz, CH), 6.12 (d, 1H, J= 5.2 Hz, CH), 6.16 (d, 1H, J= 5.2 Hz, CH), 8.27-8.30 (m, 1H, ArH), 8.39 (s, 1H, ArH), 8.58 (s, 1H, ArH), 8.94 (d, 1H, J= 8.0 Hz, ArH), 9.25 (d, 1H, J = 6.4 Hz, ArH), 9.40 (s, 1H, ArH); 13C NMR (100 MHz, D20): δ 62.3, 65.02 (d, J= 5.3 Hz), 65.06 (d, J= 3.6 Hz), 70.1, 74.5, 77.7, 84.0 (d, J= 8.3 Hz), 84.9 (d, J= 8.9 Hz), 87.7, 99.3, 118.3, 128.6, 133.8, 139.8, 142.2, 142.5, 145.0, 146.1, 148.2, 149.9, 165.4, 165.8; HRMS (ESI) Calcd. For C2iH27Ni0Oi3P2 + (M+H)+ requires 689.1234, Found: 689.1226.
Exam le 5. Synthesis of NAD+ 20 and NAD+ 26
[0410] General procedure for the synthesis of (6aR,8R,9R,9aR)-2,2,4,4-tetraisopropyl-8- methoxytetrahydro-6H-furo[3,2-f][l,3,5,2,4]triox-adisilocin-9-yl trifluoromethanesulfonate (20-3): The compond 20-2 (1.21 g, 3.0 mmol) was dissolved in DCM followed by the addition of pyridine (71 1 mg, 9.0 mmol, 3 eq) and Tf20 (1.3 g, 4.5 mmol, 1.5 eq) at 0 °C. The reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 4 hours, the reaction mixture was diluted with EtOAc (100 mL) and quenched with water (2 mL), and the organic phase was washed with water (5X50 mL), dried over anhydrous Na2SC filtered and concentrated to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the corresponding (6aR,8R,9R,9aR)-2,2,4,4- tetraisopropyl-8-methoxytetrahydro-6H-furo[3,2- J[l,3,5,2,4]triox-adisilocin-9-yl
trifluoromethanesulfonate (20-3) (1.29 g, 80%) as a colorless oil.
[0411] (6aR,8R,9R,9aR)-2,2,4,4-tetraisopropyl-8-methoxytetrahydro-6H-furo[3,2- J[l,3,5,2,4]triox-adisilocin-9-yl trifluoromethanesulfonate (20-3). A colorless oil, 80% yield; 1H MR (400 MHz, CDC13): δ 0.98-1.10 (m, 28H, 8CH3+4CH), 3.36 (s, 3H, OCH3), 3.87 (dd, 1H, J= 12.8, 7.2 Hz, CH2), 3.99-4.05 (m, 2H, CH2+CH), 4.63 (dd, 1H, J= 7.2, 4.4 Hz, CH), 4.93 (s, 1H, CH), 4.98 (d, 1H, J= 4.4 Hz, CH); 13C MR (100 MHz, CDC13): δ 12.68,
12.72, 13.1, 13.2, 16.68, 16.71, 16.87, 16.90, 17.27, 17.32, 17.4, 55.2, 63.8, 71.7, 81.3, 88.9, 103.8, 118.6 (q, 7= 317.0 Hz).
[0412] General procedure for the synthesis of (6aR,8R,9S,9aS)-2,2,4,4-tetraisopropyl-8- methoxytetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-ol (20-4): The compond 20-3 (1.24 g, 2.3 mmol) was dissolved in DMF (20 mL) and NaN02 ( 793 mg, 11.5 mmol, 5 eq) was added to the mixture at r.t. Then the resulting mixture was heated to 35 °C. After stirring at this temperature for 12 hours, the reaction mixture was diluted with EtOAc (100 mL), and the organic phase was washed with water (5X50 mL), dried over anhydrous Na2S04, filtered and concentrated to give a residue. The residue was purified by a flash column
chromatography on silica gel to afford the corresponding compound (6aR,8R,9,S',9a)S)-2,2,4,4- tetraisopropyl-8-methoxytetrahydro-6H-furo[3,2- J[l,3,5,2,4]trioxadisilocin-9-ol. (20-4) (440 mg, 47%) as a colorless oil..
[0413] (6aR,8R,9^,9a,S)-2,2,4,4-tetraisopropyl-8-methoxytetrahydro-6H-furo[3,2- J[l,3,5,2,4]triox-adisilocin-9-ol (20-4). A colorless oil, 47% yield; 1H MR (400 MHz, CDC13): δ 0.99-1.11 (m, 28H, 8CH3+4CH), 2.25 (d, 1H, 7= 9.6 Hz, OH), 3.40 (s, 3H, OCH3), 3.76 (dd, 1H, 7= 10.8, 8.8 Hz, CH2), 3.83-3.87 (m, 1H, CH), 3.96 (dd, 1H, 7= 10.8, 3.2 Hz, CH2), 4.10-4.15 (m, 1H, CH), 4.21 (dd, 1H, 7= 7.6, 6.0 Hz, CH), 4.74 (d, 1H, 7= 4.0 Hz, CH); 13C MR (100 MHz, CDC13): δ 12.5, 12.8, 13.3, 13.4, 16.97, 16.99, 17.05, 17.38, 17.40, 17.44, 17.53, 55.2, 66.0, 78.7, 79.6, 82.1, 101.3.
[0414] General procedure for the synthesis of (6aR,8R,9S,9aR)-2,2,4,4-tetraisopropyl-8- methoxytetrahydro-6H-furo[3,2-f][l,3,5,2,4]trioxadisilocin-9-yl trifluoromethanesulfonate (20-5): To a stirred solution of compound 20-4 (407 mg, 1.0 mmol) in DCM (15 mL) were added pyridine (237 mg, 3.0 mmol, 3 eq) and Tf20 (433 mg, 1.5 mmol, 1.5 eq) at 0 °C. The reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 4 hours, the reaction mixture was diluted with EtOAc (100 mL), and the organic phase was washed with water (5X50 mL), dried over anhydrous Na2S04, filtered and concentrated
to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the corresponding compound (6aR,8R,9,S',9aR)-2,2,4,4-tetraisopropyl-8- methoxytetrahydro-6H-furo[3,2- J[l,3,5,2,4]trioxadisilocin-9-yl trifluoromethanesulfonate (20-5) (442 mg, 82%) as a colorless oil.
[0415] (6aR,8R,9^,9aR)-2,2,4,4-tetraisopropyl-8-methoxytetrahydro-6H-furo[3,2- J[l,3,5,2,4]trio-xadisilocin-9-yl trifluoromethanesulfonate (20-5). A colorless oil, 82% yield; 1H MR (400 MHz, CDC13): δ 0.99-1.11 (m, 28H, 8CH3+4CH), 3.40 (s, 3H, OCH3), 3.81 (dd, 1H, J= 10.8, 9.2 Hz, CH2), 3.90-3.95 (m, 1H, CH), 3.98 (dd, 1H, J= 10.8, 3.2 Hz, CH2), 4.70 (dd, 1H, J= 7.6, 5.6 Hz, CH), 4.92 (d, 1H, J= 4.4 Hz, CH), 4.97 (dd, 1H, J= 7.6, 4.4 Hz, CH); 13C MR (100 MHz, CDC13): δ 12.4, 12.8, 13.18, 13.24, 16.69, 16.72, 16.76, 16.77, 17.31, 17.33, 17.37, 17.48, 55.4, 66.0, 76.0, 81.3, 88.9, 99.3, 118.5 (q, J= 317.9);
[0416] General procedure for the synthesis of 3ee: If n is, for example, 0, the compound 20-5 or ((6aR,8R,9R,9a,S)-2,2,4,4-tetraisopropyl-8-methoxytetrahydro-6H-furo[3,2- f][l,3,5,2,4]trioxadisilocin-9-yl)methyl trifluoromethanesulfonate (808 mg, 1.5 mmol) was dissolved in DMF (20 mL) and NaN3 (488 mg, 7.5 mmol, 5 eq) was added to the mixture at room temperature. After stirring at 100 °C for 18 hours, the reaction mixture was diluted with EtOAc (100 mL), and the organic phase was washed with water (5X50 mL), dried over anhydrous Na2S04, filtered and concentrated to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the corresponding compound 3ee.
[0417] (6aR,8R,9R,9a,S)-9-azido-2,2,4,4-tetraisopropyl-8-methoxytetrahydro-6H-furo[3,2- J[l,3,5,2,4]trioxadisilocine (20-6). A colorless oil, 376 mg, 58% yield; 1H NMR (400 MHz, CDC13): δ 1.01-1.11 (m, 28H, 8CH3+4CH), 3.29 (s, 3H, OCH3), 3.79 (dd, 1H, J= 12.0, 8.4 Hz, CH2), 3.88 (d, 1H, J= 5.2 Hz, CH), 3.99-4.04 (m, 2H, CH+CH2), 4.61 (s, 1H, CH), 4.74 (dd, 1H, J= 7.2, 5.2 Hz, CH); 13C MR (100 MHz, CDC13): δ 12.7, 13.2, 13.3, 16.84, 16.85, 17.1, 17.27, 17.30, 17.34, 17.36, 17.45, 54.8, 65.0, 67.0, 75.8, 81.7, 105.2.
BzO
4ee
[0418] General procedure for the synthesis of 4ee: To a 0 °C solution of compound 3ee (0.8 mmol) in anhydrous THF (1 mL) was added AcOH (72 mg, 1.2 mmol, 1.5 eq) followed by the addition of TBAF (1.2 mL, 1.2 mmol, 1.0 M in THF, 1.5 eq). Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 10 hours, the reaction mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in a mixture of anhydrous DCM (10 mL) and anhydrous pyridine (10 mL) was added BzCl (277 μL, 2.4 mmol, 3 eq) at 0 °C. Then the reaction mixture was allowed to warm to room temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed
successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 4ee.
20-7
[0419] (2R,3^,4R,5R)-4-azido-2-((benzoyloxy)methyl)-5-methoxytetrahydrofuran-3-yl benzoate. A colorless oil, 229 mg, 72% yield; 1H NMR (400 MHz, CDC13): δ 3.36 (s, 3H, OCH3), 4.32 (d, 1H, J= 5.2 Hz, CH), 4.48 (dd, 1H, J= 13.2, 6.4 Hz, CH2), 4.60-4.65 (m, 2H, CH+CH2), 4.95 (s, 1H, CH), 5.72 (t, 1H, J= 7.2, 5.2 Hz, CH), 7.38 (t, 2H, J= 8.0 Hz, ArH), 7.46 (t, 2H, J= 7.6 Hz, ArH), 7.51-7.55 (m, 1H, ArH), 7.58-7.62 (m, 1H, ArH), 8.05 (d, 2H, J= 8.0 Hz, ArH), 8.08 (d, 2H, J= 7.6 Hz, ArH); 13C NMR (100 MHz, CDC13): δ 55.3, 64.6, 65.3, 74.2, 78.6, 106.7, 128.3, 128.51, 128.54, 129.58, 129.63, 129.9, 133.1, 133.7.
5ee
[0420] General procedure for the synthesis of 5ee: To a stirred solution of compound 4ee (0.5 mmol) in a mixture of AcOH (4 mL) and Ac20 (1.0 mL) was add cone. H2S04 (40 \L) at 0 °C. The resulting mixture was stirred at the same temperature until the reaction complete (monitoring by TLC, about 20 min). Then the reaction was diluted with DCM (60 mL) and
the solution was added dropwise to a stirred mixture of ice and saturated aqueous NaHC03. Solid NaHC03 was added during the addition to maintain a PH of 7. The mixture was extracted with DCM (3X50 mL), and the combined organic extracts was washed with H20 (50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated to give a residue. The residue was used directly for next step without further purification.
6ee
[0421] General procedure for the synthesis of 6ee: The residue 5ee from last step was dissolved in toluene (10 mL) and cooled to 0 °C. HBr (33wt% in acetic acid) (183 mg, 0.75 mmol, 1.5 eq) was added dropwise and the reaction was stirred at 0 °C for 5 hours. After the starting material was consumed, the reaction was concentrated under reduced pressure to give a residue. The residue was azeotroped with toluene (3X20 mL) to remove remaining acetic acid and dried in vacuo. The crude product and nicotinamide (73 mg, 0.6 mmol, 1.2 eq) was dissolved in CH3CN (10 mL). The reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) and purified by a flash column chromatography on silica gel to afford the compound 6ee.
[0422] l-((2R,3R,4^,5R)-3-azido-4-(benzoyloxy)-5-((benzoyloxy)methyl)tetrahydrofuran-2- yl)-3 -carbarn oylpyri din- 1-ium bromide. A colorless solid, 158 mg, 56% yield for 3 steps; 1H NMR (400 MHz, CD3OD): δ 4.72 (dd, 1H, J= 12.4, 4.8 Hz, CH2), 4.78 (dd, 1H, J= 12.4, 4.8 Hz, CH2), 5.57-5.62 (m, 2H, 2CH), 6.09 (dd, 1H, J= 5.2, 2.0 Hz, CH), 7.09 (d, 1H, J= 6.4 Hz, CH), 7.42 (t, 2H, J= 8.0 Hz, ArH), 7.48 (t, 2H, J= 8.0 Hz, ArH), 7.57-7.62 (m, 2H, ArH), 7.76-7.78 (m, 2H, ArH), 8.08-8.10 (m, 2H, ArH), 8.31 (dd, 1H, J= 8.0, 6.4 Hz, ArH), 9.09 (d, 1H, J= 8.0 Hz, ArH), 9.40 (d, 1H, J= 6.4 Hz, ArH), 9.59 (s, 1H, ArH); 13C NMR (100 MHz, CD3OD): δ 64.7, 65.2, 74.4, 86.3, 97.0, 128.4, 129.6, 129.81, 129.85, 130.7, 130.8, 134.70, 134.78, 135.1, 142.2, 145.2, 146.9, 164.8, 166.3, 167.4.
7ee
[0423] General procedure for the synthesis of 7ee: Compound 6ee (0.22 mmol) was dissolved in ammonia (15 mL, 7 N in MeOH) and the reaction was stirred at 0 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 7ee.
20-10
[0424] l-((2R,3R,4S,5R)-3-azido-4-hydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-3- carbamo-ylpyridin-l-ium bromide. A colorless solid, 52 mg, 65% yield; 1H NMR (400 MHz, D20): δ 3.78 (dd, 1H, J= 12.8, 4.4 Hz, CH2), 3.91 (dd, 1H, J= 12.8, 3.2 Hz, CH2), 4.66 (t, 1H, J= 4.0 Hz, CH), 4.79-4.82 (m, 1H, CH, overlap with water), 5.03 (m, 1H, CH), 6.68 (d, 1H, J= 6.4 Hz, CH), 8.21-8.24 (m, 1H, ArH), 8.97 (d, 1H, J= 8.4 Hz, ArH), 9.10 (d, 1H, J = 6.0 Hz, ArH), 9.31 (s, 1H, ArH); 13C NMR (100 MHz, D20): 5 60.6, 64.4, 70.8, 88.8, 95.5, 127.2, 132.7, 141.0, 143.5, 145.5, 165.7.
8ee
[0425] General procedure for the synthesis of 8ee: To a stirred solution of compound 7ee (0.12 mmol) in trimethylphosphate (1.5 mL) was added P(0)C13 ( 78 μL, 0.84 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. A few drops H20 was then added to quench the reaction. Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 8ee.
20-11
[0426] l-((2R,3R,4S,5R)-3-azido-4-hydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-3- carbamoy-lpyridin-l-ium bromide (20-11). A colorless oil, 30 mg, 69% yield; 1H NMR (400 MHz, D20): δ 4.08 (ddd, 1H, J= 12.0, 5.6, 2.8 Hz, CH2), 4.17 (ddd, 1H, J= 12.0, 5.6, 2.8 Hz, CH2), 4.72 (dd, 1H, J= 4.8, 2.4 Hz, CH), 4.90-4.95 (m, 1H, CH), 5.07 (t, 1H, J = 5.6 Hz, CH), 6.67 (d, 1H, J= 5.6 Hz, CH), 8.17-8.21 (m, 1H, ArH), 8.94 (d, 1H, J= 8.4 Hz, ArH), 9.08 (d, 1H, J= 6.0 Hz, ArH), 9.31 (s, 1H, ArH); 13C NMR (100 MHz, D20): δ 64.3, 64.5 (d, J= 5.0 Hz), 70.9, 87.8 (d, J= 7.9 Hz), 95.8, 127.1, 132.7, 141.1, 143.5, 145.5, 165.7.
NAD* 20 and 26
[0427] General procedure for the synthesis of ( NAD+ analogue 20 and 26): To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) were added 1,1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μΐ., 0.16 mmol. 1.6 eq). The reaction mixture was stirred at room temperature for 14 hours, and then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum and the residue was coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'-AMP was dissolved in dried DMF (1 mL) and compound 8ee (0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H20 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC. Fractions containing the desired product were concentrated and lyophilized to yield the NAD+ 20 and 26.
[0428] NAD+ 20. A colorless oil, 69% yield; 1H NMR (400 MHz, D20): δ 4.15-4.19 (m, 1H, CH), 4.24-4.30 (m, 3H, CH2+CH2), 4.40-4.41 (m, 1H, CH), 4.53 (dd, 1H, J= 5.2, 4.0 Hz, CH), 4.73-4.77 (m, 2H, 2CH), 4.92 (br, 1H, CH), 5.14 (dd, 1H, J= 6.4, 5.2 Hz, CH), 6.11 (d, 1H, J= 5.6 Hz, CH), 6.68 (d, 1H, J= 6.0 Hz, CH), 8.18 (dd, 1H, J= 8.0, 6.4 Hz, ArH), 8.40 (s, 1H, ArH), 8.62 (s, 1H, ArH), 8.92-8.94 (m, 1H, ArH), 9.08 (d, 1H, J= 6.4 Hz, ArH), 9.27
(s, 1H, ArH); HRMS (ESI) Calcd. For C2iH27NioOi3P2 + (M+H)+ requires 689.1234, Found: 689.1250.
Example 6. Synthesis of NAD+ 22-23
2ff
[0429] Compound 2ff was prepared according to the reported method (Synlett 2007, No. 20, 3149-3154). If the target compound is, for example NAD+ 22, then R66 is -C Π ; If the target compound is, for example NAD+ 23, then R66 is (Ί LCI LC Π Ι
3ff
[0430] General procedure for the synthesis of compound 3ff: To a solution of compound 2ff (2.0 mmol) in a mixture of anhydrous Et20 (15 ml) was added HCOOH (15 mL) at 0 °C. Then the resulting mixture was allowed to warm to r.t. and stirred overnight. Removing the solvent under reduced pressure to offer an intermediate compound A. Then the compound A was dissolved in DCM (10 mL) and anhydrous pyridine (10 mL) followed by the addition of BzCl (6.0 mmol, 3 eq) at 0 °C. Then the reaction mixture was allowed to warm to room temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 3ff.
[0431] ((3a,S',4R,6aR)-6-acetoxy-4-ethynyl-2,2-dimethyltetrahydrofuro[3,4-d][l,3]dioxol-4- yl)methyl benzoate. 1H NMR (400 MHz, CDC13): δ 1.40 (s, 3H, CH3), 1.61 (s, 3H, CH3),
1.98 (s, 3H, CH3), 2.77 (s, 1H, CH), 4.44 (d, 1H, J= 11.2 Hz, CH), 4.52 (d, 1H, J= 11.2 Hz, CH2), 4.86 (s, 2H, 2CH), 6.31 (s, 1H, CH), 7.46 (t, 2H, J= 7.6 Hz, ArH), 7.58-7.62 (m, 1H, ArH), 8.09 (dd, 2H, J= 7.6, 1.2 Hz, ArH).
4ff
[0432] General procedure for the synthesis of compound 4ff: Compound 3ff (1.3 mmol) was dissolved in a mixture of TFA/H20 (9/1, 15 mL) and the resulting mixture was stirred 0 °C until the reaction complete (monitoring by TLC). Then the reaction was diluted with DCM (60 mL) and the solution was added dropwise to a stirred mixture of ice and saturated aqueous NaHC03. Solid NaHC03 was added during the addition to maintain a PH of 7. The mixture was extracted with DCM (3X50 mL), and the combined organic extracts was washed with H20 (50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. BzCl (3.9 mmol, 3 eq) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 4ff.
OBz
BzO OBz
[0433] (2R,3^,4R)-5-acetoxy-2-((benzoyloxy)methyl)-2-ethynyltetrahydrofuran-3,4-diyl dibenzoate. 1H MR (400 MHz, CDC13): δ 1.88 (s, 3H, CH3), 2.79 (s, 1H, CH), 4.54 (d, 1H, J= 12.0 Hz, CH), 4.87 (d, 1H, J= 12.0 Hz, CH2), 5.83 (d, 1H, J= 8.8 Hz, CH), 6.04 (d, 1H, J= 8.8 Hz, CH) 6.48 (s, 1H, CH), 7.32-7.36 (m, 2H, ArH), 7.39-7.47 (m, 4H, ArH), 7.51- 7.63 (m, 3H, ArH), 7.94 (dd, 2H, J= 8.0, 1.2 Hz, ArH), 8.09-8.13 (m, 4H, ArH).
[0434] General procedure for the synthesis of compound 5ff: TMSOTf (0.55 mmol, 5.5 eq) was added to a solution of nicotinamide (0.30 mmol, 3 eq) in CH3CN (3 mL) at 0 °C. Then the reaction was allowed to warm to room temperature and stirred until all of the
nicotinamide had dissolved. Then a solution of compound 4ff (0.10 mmol) was added to the solution of nicotinamide with TMSOTf at 0 °CThen the reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) and purified by a flash column chromatography on silica gel to afford the compound 5ff.
[0435] General procedure for the synthesis of compound 6ff: Compound 5ff (0.45 mmol) was dissolved in ammonia (18 mL, 7 N in MeOH) and the reaction was stirred at -10 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 6ff.
[0436] 3-carbamoyl-l-((2R,3R,4S,5R)-5-ethynyl-3,4-dihydroxy-5- (hydroxymethyl)tetrahydrofuran-2-yl)pyridin-l-ium trifluoromethanesulfonate. 1H MR (400 MHz, D20): δ 3.28 (s, 1H, CH), 3.95 (d, 1H, J= 12.8 Hz, CH), 4.03 (d, 1H, J= 12.8 Hz, CH2), 4.43 (d, 1H, J= 5.6 Hz, CH), 4.61 (t, 1H, J= 5.6 Hz, CH) 6.33 (d, 1H, J = 4.4 Hz, CH), 8.28 (dd, 1H, J= 8.0, 6.4 Hz, ArH), 8.98-9.01 (m, 1H, ArH), 9.25 (d, 1H, J= 6.4 Hz, ArH), 9.56 (s, 1H, ArH).
[0437] General procedure for the synthesis of compound 7ff: To a stirred solution of compound 6ff (0.27 mmol) in trimethylphosphate (2 mL) was added P(0)C13 ( 175 μΐ., 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. A few drops H20 was then added to quench the reaction. Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 7ff.
NAD+ 22-23
[0438] General procedure for the synthesis of NAD+ 23: To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) were added 1, 1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μL, 0.16 mmol. 1.6 eq). The reaction mixture was stirred at room temperature for 14 hours, and then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum and the residue was coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'-AMP was dissolved in dried DMF (1 mL) and compound 7ff (37 mg, 0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H20 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative FIPLC. Fractions containing the desired product were concentrated and lyophilized to yield the corresponding NAD+ 23.
[0439] NAD+ 22 is prepared following the procedure as described above with the necessary modifications well-understood by the skilled artisan.
[0440] General procedure for the synthesis of compound 2f: To a stirred solution of
(3aR,5R,6S,6aR)-5-(hydroxymethyl)-2,2-dimethyltetrahydrofuro[2,3-d][l,3]dioxol-6-ol (prepared according to the reported method in Nucleosides, Nucleotides and Nucleic Acids, 2013, 32, 646-659 )(1.0 eq) in DMF (24 mL) was added the Imidazole (2 eq) and TBDPSC1 (1.1 eq) at 0 °C. The reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 24 hours, the reaction mixture was diluted with EtOAc (100 mL), and the organic phase was washed with water (5X50 mL), dried over anhydrous Na2S04, filtered and concentrated to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the desired product. The product was oxidized by Swern-Oxidation according to the standard procedure to offer the compound 2f.
[0441] General procedure for the synthesis of compound 3gg: To a stirred solution of compound 2f (1.0 eq) in THF (24 mL) was added the corresponding R77MgBr (3.0 eq) at 0 °C. If the target compound is, for example NAD+ 24 then R77 is -C CH. If the target compound is, for example NAD+ 24 then R77 is -CH2C≡≡=CH. The reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 24 hours, the reaction mixture was diluted with EtOAc (100 mL), and the organic phase was washed with water (5X50 mL), dried over anhydrous Na2S04, filtered and concentrated to give a residue. The residue was purified by a flash column chromatography on silica gel to afford the corresponding compound 3gg.
[0442] (3aR,5R,6R,6aR)-5-(((tert-butyldiphenylsilyl)oxy)methyl)-6-ethynyl-2,2- dimethyltetrahydrofuro[2,3-ii][l,3]dioxol-6-ol. 1H NMR (400 MHz, CDC13): δ 1.07 (s, 9H, 3CH3), 1.37 (s, 3H, CH3), 1.59 (s, 3H, CH3), 2.51 (s, 1H, CH), 3.97-4.02 (m, 2H, CH+CH2),
4.07 (dd, 1H, J= 12.0, 6.0 Hz, CH2), 4.58 (d, 1H, J= 3.6 Hz, CH), 5.85 (d, 1H, J= 3.6 Hz, CH), 7.36-7.45 (m, 6H, ArH), 7.67-7.72 (m, 4H, ArH).
[0443] General procedure for the synthesis of compound 4gg: To a 0 °C solution of compound 3gg (2.1 mmol) in anhydrous THF (25 mL) was added AcOH (180 μΐ., 3.2 mmol, 1.5 eq) followed by the addition of TBAF (3.2 mL, 3.2 mmol, 1.0 M in THF, 1.5 eq). Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 14 hours, the reaction mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in a mixture of anhydrous DCM (10 mL) and anhydrous pyridine (10 mL) followed by the addition of BzCl (588 μL, 5.1 mmol, 3 eq) at 0 °C. Then the reaction mixture was allowed to warm to room temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 4gg.
[0444] ((3aR, 5R,6R,6aR)-6-(benzoyloxy)-6-ethynyl-2,2-dimethyltetrahydrofuro[2,3- ii][l,3]dioxol-5-yl)methyl benzoate. 1H MR (400 MHz, CDC13): δ 1.34 (s, 3H, CH3), 1.51 (s, 3H, CH3), 2.74 (s, 1H, CH), 4.66 (dd, 1H, J= 6.8, 5.2 Hz, CH), 4.73 (dd, 1H, J= 11.6, 6.8 Hz, CH2), 4.82 (dd, 1H, J= 11.6, 5.2 Hz, CH2), 5.32 (d, 1H, J= 3.6 Hz, CH), 6.02 (d, 1H, J = 3.6 Hz, CH), 7.38-7.42 (m, 4H, ArH), 7.54-7.59 (m, 2H, ArH), 8.02 (dd, 2H, J= 8.0, 1.2 Hz, ArH), 8.10 (dd, 2H, J= 8.4, 1.2 Hz, ArH).
[0445] General procedure for the synthesis of compound 5gg: To a solution of compound 4gg (1.7 mmol) in a mixture of anhydrous MeOH was added AcCl (2.0 eq) at r.t. to offer an intermediate compound A. Then the compound A was dissolved in anhydrous pyridine (10
mL) followed by the addition of AcCl (5.1 mmol, 3 eq) at 0 °C. Then the reaction mixture was allowed to warm to room temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the the corresponding compound 5gg.
[0446] General procedure for the synthesis of compound 6gg: Compound 5gg (1.3 mmol) was dissolved in a mixture of TFA/H20 (9/1, 15 mL) and the resulting mixture was stirred at room temperature until the reaction complete (monitoring by TLC). Then the reaction was diluted with DCM (60 mL) and the solution was added dropwise to a stirred mixture of ice and saturated aqueous NaHC03. Solid NaHC03 was added during the addition to maintain a PH of 7. The mixture was extracted with DCM (3X50 mL), and the combined organic extracts was washed with H20 (50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. Ac20 (0.5 mL) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 6gg.
[0447] (3R,4R,5R)-4-(benzoyloxy)-5-((benzoyloxy)methyl)-4-ethynyltetrahydrofuran-2,3- diyl diacetate. 1H MR (400 MHz, CDC13): δ 2.04 (s, 4.5H, CH3), 2.08 (s, 3H, CH3), 2.09 (s, 4.5H, CH3), 2.10 (s, 3H, CH3), 2.76 (s, 1H, CH), 2.83 (s, 1.5 H, CH), 4.72-4.78 (m, 3H, CH+CH2), 4.82-4.96 (m, 4.5H, CH+CH2), 5.89 (d, 1H, J = 4.4 Hz, CH), 5.98 (d, 1.5 H, J =
1.2 Hz, CH), 6.21 (d, 1.5H, J= 1.2 Hz, CH), 6.60 (d, 1H, J= 4.4 Hz, CH), 7.41-7.47 (m, 10.0H, ArH), 7.55-7.62 (m, 5.0 H, ArH), 8.00-8.13 (m, 10.0H, ArH).
[0448] General procedure for the synthesis of compound 7gg: Compound 6gg (0.70 mmol) was dissolved in toluene (10 mL) and cooled to 0 °C. HBr (33wt% in acetic acid) (257 mg, 1.05 mmol, 1.5 eq) was added dropwise and the reaction was stirred at 0 °C for 5 hours. After the starting material was consumed, the reaction was concentrated under reduced pressure to give a residue. The residue was azeotroped with toluene (3X20 mL) to remove remaining acetic acid and dried in vacuo. The crude product and nicotinamide (103 mg, 0.84 mmol, 1.2 eq) was dissolved in CH3CN (20 mL). The reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) and purified by a flash column chromatography on silica gel to afford the corresponding compound 7gg.
[0449] General procedure for the synthesis of compound 8gg: Compound 7gg (0.45 mmol) was dissolved in ammonia (18 mL, 7 N in MeOH) and the reaction was stirred at -10 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the corresponding desired product 8gg
[0450] 3-carbamoyl-l-((2R,3R,4S,5R)-4-ethynyl-3,4-dihydroxy-5- (hydroxymethyl)tetrahydrofuran-2-yl)pyridin-l-ium bromide. MS (ESI) (ESI) Calcd. For Ci3Hi4N205+1 (M)+ requires 279.1, Found: 280.7.
[0451] General procedure for the synthesis of compound 9gg: To a stirred solution of compound 8gg (0.27 mmol) in trimethylphosphate (2 mL) was added P(0)C13 ( 175 μΐ., 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. A few drops H20 was then added to quench the reaction. Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with TUF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the corresponding desired products 9gg.
[0452] ((2R,3^,4R,5R)-5-(3-carbamoylpyridin-l-ium-l-yl)-3-ethynyl-3,4- dihydroxytetrahydrofuran-2-yl)methyl hydrogen phosphate. MS (ESI) Calcd. For
Ci3Hi6N208P+1 (M)+ requires 359.1, Found: 360.5.
NAD+ 24-25
[0453] General procedure for the synthesis of NAD+ 24: To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) were added 1, 1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μΕ, 0.16 mmol. 1.6 eq). The reaction mixture was stirred at room temperature for 14 hours, and then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum and the
residue was coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'-AMP was dissolved in dried DMF (1 mL) and compound 9gg (37 mg, 0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H20 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC. Fractions containing the desired product were concentrated and lyophilized to yield the corresponding NAD+ 24-25.
[0454] NAD+ 25 is prepared following the procedure as described above with the necessary modifications well-understood by the skilled artisan.
Example 9. Synthesis of NAD+ 27
[0455] General procedure for the synthesis of compound (2ii): To a stirred solution of 3- carbamoyl-l-((2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)pyridin- 1-ium bromide (0.27 mmol) in trimethylphosphate (2 mL) was added P(0)C13 ( 175 μΐ^, 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. But-3-yn-l-ol (14 eq) was then added to quench the reaction. Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with TFIF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 2ii.
[0456] but-3-yn-l-yl (((2R,3^,4R,5R)-5-(3-carbamoylpyridin-l-ium-l-yl)-3,4- dihydroxytetrahydrofuran-2-yl)methyl) phosphate. MS (ESI) Calcd. For Ci5H20N2O8P+1 (M)+ requires 387.1, Found: 387.1.
NAD+ 27
[0457] General procedure for the synthesis of NAD+ 27: To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) is added 1, 1- carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μΐ^, 0.16 mmol. 1.6 eq). The reaction mixture is stirred at room temperature for 14 hours, and is then quenched with 0.100 ml dried methanol. The solvent is removed under vacuum and the residue is coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'-AMP is dissolved in dried DMF (1 mL) and compound 2ii (0.10 mmol, 1.0 eq) is added. After stirring at room temperature for 4 days, H20 is added to quench the reaction at 0 °C. The resulting mixture is continued stirring at room temperature for 24 hours. The reaction is then concentrated in vacuo and the crude product is purified via preparative FIPLC. Fractions containing the desired product are concentrated and are lyophilized to yield NAD 27. FIG. 8 shows the MS (ESI) analysis of the reaction the synthesize NAD+ 27.
Example 9. Synthesis of NAD+ 28
[0458] General procedure for the synthesis of compound 2jj : To a stirred solution of 3- carbamoyl-l-((2R,3R,4R,5R)-4-hydroxy-5-(hydroxymethyl)-3-(prop-2-yn-l- yloxy)tetrahydrofuran-2-yl)pyridin-l-ium bromide (0.27 mmol) in trimethylphosphate (2 mL) was added P(0)C13 ( 175 μΕ, 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. MeOH (14 eq) was then added to quench the reaction.
Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with TUF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 2jj.((2R,3R,4R,5R)-5-(3-carbamoylpyridin-l-ium-l- yl)-3 -hydroxy -4-(prop-2-yn-l-yloxy)tetrahydrofuran-2-yl)m ethyl methyl phosphate. MS (ESI) Calcd. For Ci5H2oN208P+1 (M)+ requires 387.1, Found: 387.8
[0459] General procedure for the synthesis of NAD+ 28: To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) is added 1, 1- carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μΐ^, 0.16 mmol. 1.6 eq). The reaction mixture is stirred at room temperature for 14 hours, and is then quenched with 0.100 ml dried methanol. The solvent is removed under vacuum and the residue is coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'-AMP is dissolved in dried DMF (1 mL) and compound 2jj (0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H20 is added to quench the reaction at 0 °C. The resulting mixture is continued stirring at room temperature for 24 hours. The reaction is then concentrated in vacuo and the crude product is purified via preparative FIPLC (C18-A column, 150X4.6 mm, 5 μπι) (mobile phase A: 0.1% formic acid (aq), mobile B: 0.1% formic acid in acetonitrile; flow rate = 1.0 ml/min; 0-16 min: 0-6.7% B, 16-18 min: 6.7-0% B). Fractions containing the desired product are concentrated and are lyophilized to yield NAD+
28.
Example 10. Synthesis of NAD+ 29
[0460] General procedure for the synthesis of NAD+ 29: To a stirred solution of 3- carbamoyl-l-((2R,3R,4R,5R)-4-hydroxy-5-(hydroxymethyl)-3-(prop-2-yn-l- yloxy)tetrahydrofuran-2-yl)pyridin-l-ium bromide (0.27 mmol) in trimethylphosphate (2 mL) is added P(0)C13 ( 175 μL, 1.89 mmol, 7 eq) at 0 °C and the resulting mixture is stirred at 0 °C for 6 hours. Adenine (30 eq) is then added to quench the reaction. The reaction is then concentrated in vacuo and the crude product is purified via preparative FIPLC (C18-A column, 150X4.6 mm, 5 μπι) (mobile phase A: 0.1% formic acid (aq), mobile B: 0.1% formic acid in acetonitrile; flow rate = 1.0 ml/min; 0-16 min: 0-6.7% B, 16-18 min: 6.7-0% B).
Fractions containing the desired product are concentrated and are lyophilized to yield NAD" 29.
Example 11. Synthesis of NAD+ 30
[0461] General procedure for the synthesis of compound 3kk' : To a stirred solution of compound 2kk (preparaed as described below, 3.7 mmol) in anhydrous DMF (25 mL) was added NaH (180 mg, 4.5 mmol, 1.2 eq, 60% dispersion in mineral oil) at 0 °C followed by the addition of N 1 -(3 -aminopropyl)-N4-(3 -((2-(4-(bromomethyl)-3 - nitrophenoxy)ethyl)amino)propyl)-Nl,N4-dimethylbutane-l,4-diamine (5.6 mmol, 1.5 eq) at the same temperature. Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 6 hours, t he reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC (C18-A column, 150X4.6 mm, 5 μπι) (mobile phase A: 0.1% formic acid (aq), mobile B: 0.1% formic acid in acetonitrile; flow rate = 1.0 ml/min; 0-16 min: 0-6.7% B, 16-18 min: 6.7-0% B). Fractions containing the desired product were concentrated and lyophilized to yield the compound 3kk'.
[0462] General procedure for the synthesis of (2R,3R,4R,5S)-5-acetoxy-2- ((benzoyloxy)methyl)-4-(prop-2-yn-l-yloxy)tetrahyd-rofuran-3-yl benzoate (4kk'):
Compound 3kk' (534 mg, 1.3 mmol) was dissolved in a mixture of TFA/H20 (9/1, 15 mL) and the resulting mixture was stirred at room temperature until the reaction complete
(monitoring by TLC). Then the reaction was concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. Ac20 (0.5 mL) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6
hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was was purified via preparative HPLC (C18-A column, 150X4.6 mm, 5 μπι) (mobile phase A: 0.1% formic acid (aq), mobile B: 0.1% formic acid in acetonitrile; flow rate = 1.0 ml/min; 0-16 min: 0-6.7% B, 16-18 min: 6.7- 0% B). Fractions containing the desired product were concentrated and lyophilized to yield the compound 4kk' .
[0463] General procedure for the synthesis of l-((2R,3R,4R,5R)-4-(benzoyloxy)-5- ((benzoyloxy)methyl)-3-(prop-2-yn-l-yloxy)t-etrahydrofuran-2-yl)-3-carbamoyl-pyridin-l- ium bromide (5kk'): Compound 4kk' (307 mg, 0.70 mmol) was dissolved in toluene (10 mL) and cooled to 0 °C. FIBr (33wt% in acetic acid) (257 mg, 1.05 mmol, 1.5 eq) was added dropwise and the reaction was stirred at 0 °C for 5 hours. After the starting material was consumed, the reaction was concentrated under reduced pressure to give a residue. The residue was azeotroped with toluene (3X20 mL) to remove remaining acetic acid and dried in vacuo. The crude product and nicotinamide (103 mg, 0.84 mmol, 1.2 eq) was dissolved in CH3CN (20 mL). The reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) to give a residue. The residue was dissolved in ammonia (18 mL, 7 N in MeOH) and the reaction was stirred at -10 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 5kk' .
[0464] General procedure for the synthesis of compound 6kk' : To a stirred solution of compound 5kk' (0.27 mmol) in trimethylphosphate (2 mL) was added P(0)C13 ( 175 μΐ., 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. A few drops H20 was then added to quench the reaction. Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 6kk' .
[0465] General procedure for the synthesis of NAD+ 30: To a stirred solution of Adenosine 5 '-monophosphate (5'-AMP) (52 mg, 0.15 mmol, 1.5 eq) in dried DMF (2 mL) is added 1, 1- carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μL, 0.16 mmol. 1.6 eq). The reaction mixture is stirred at room temperature for 14 hours, and is then quenched with 0.100 ml dried methanol. The solvent is removed under vacuum and the residue is coevaporated 3 times each with 1.00 ml of dried DMF. The activated 5'-AMP is dissolved in dried DMF (1 mL) and compound 6kk' (37 mg, 0.10 mmol, 1.0 eq) is added. After stirring at room temperature for 4 days, H20 is added to quench the reaction at 0 °C. The resulting mixture is continued stirring at room temperature for 24 hours. The reaction is
then concentrated in vacuo and the crude product is purified via preparative HPLC (C18-A column, 150X4.6 mm, 5 μπι) (mobile phase A: 0.1% formic acid (aq), mobile B: 0.1% formic acid in acetonitrile; flow rate = 1.0 ml/min; 0-16 min: 0-6.7% B, 16-18 min: 6.7-0% B). Fractions containing the desired product are concentrated and are lyophilized to yield NAD+ 30.
Example 12. Synthesis of NAD+ 31
u i r
R3 OH
2kk
[0466] General procedure for the synthesis of compound 2kk: To a solution of
(2R,3R,4S,5S)-4-azido-5-(hydroxymethyl)-2-methoxytetrahydrofuran-3-ol (1.7 mmol) in anhydrous DMF (10 mL) were added DAMP (0.1 eq) , EtN3 (3 eq) and TrCl (2 eq) at 0 °C. Then the reaction mixture was allowed to warm to room temperature. After stirring for 24 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated and purified by a flash column chromatography on silica gel to afford the compound 2kk.
[0467] (2R,3R,45',55)-4-azido-2-methoxy-5-((trityloxy)methyl)tetrahydrofuran-3-ol. 1H NMR (400 MHz, CDC13): δ 2.18 (d, 1H, J= 2.4 Hz, OH), 3.21 (dd, 1H, J= 9.6, 4.0 Hz, CH2), 3.37- 3.40 (m, 4H, CH+CH2), 4.15-4.22 (m, 3H, 3CH), 4.87 (s, 1H, CH), 7.22-7.26 (m, 3H, ArH), 7.29-7.33 (m, 6 H, ArH), 7.48-7.50 (m, 6H, ArH).
[0468] General procedure for the synthesis of compound 3kk: To a stirred solution of compound 2kk (3.7 mmol) in anhydrous DCM (25 mL) was added Bu4NI (1.85 mmol, 0.5 eq) and NaOH (8 mL, 40% aq) at 0 °C followed by the addition of 4-(4-bromobutoxy)-2- (brom om ethyl)- 1 -nitrobenzene (5.6 mmol, 1.5 eq) at the same temperature. Then reaction mixture was allowed to warm to room temperature. After stirring at this temperature for 6
hours, the reaction was then concentrated in vacuo and to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the corresponding compound 3kk.
[0469] (2^,3R,4R,5R)-3-azido-4-((4-(4-bromobutoxy)-2-nitrobenzyl)oxy)-5-methoxy-2- ((trityloxy)methyl)tetrahydrofuran. 1H NMR (400 MHz, CDC13): δ 1.96-2.10 (m, 4H, 2CH2), 3.24 (dd, 1H, J= 10.4, 4.0 Hz, CH2), 3.38-3.42 (m, 4H, CH+CH3), 3.47 (t, 2H, J= 6.4 Hz, CH2), 4.02 (dd, 1H, J= 8.0, 4.8 Hz, CH), 4.08-4.13 (m, 3H, CH+CH2), 4.33-4.37 (m, 1H, CH), 5.04 (s, 1H, CH), 5.09 (d, 1H, J= 15.6 Hz, CH2), 5.16 (d, 1H, J= 15.6 Hz, CH2), 6.87 (dd, 1H, J= 9.2, 2.8 Hz, ArH), 7.23-7.26 (m, 3H, ArH), 7.30-7.33 (m, 6H, ArH), 7.37 (d, 1H, J= 2.8 Hz, ArH), 7.48-7.51 (m, 6H, ArH), 8.19 (d, 1H, J= 9.2 Hz, ArH).
[0470] General procedure for the synthesis of compound (4kk): To a stirred solution of compound 3kk (2.3 mmol) in a MeOH (20 mL) was added cocn.HCl (2 mL) at 0 °C. Then the resulting mixture was stirred at room temperature until the reaction complete (monitoring by TLC). Then the reaction was concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. BzCl (3.5 mmol, 1.5 eq) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was purified by a flash column
chromatography on silica gel to afford the corresponding compound 4kk.
[0471] ((2^,3R,4R,5R)-3-azido-4-((4-(4-bromobutoxy)-2-nitrobenzyl)oxy)-5- methoxytetrahydrofuran-2-yl)methyl benzoate. 1H NMR (400 MHz, CDC13): δ 1.97-2.11 (m, 4H, 2CH2), 3.35 (s, 3H, CH3), 3.48 (t, 2H, J= 6.4 Hz, CH2), 4.03 (dd, 1H, J= 7.2, 4.4 Hz, CH), 4.10-4.16 (m, 3H, CH2+CH), 4.46 (dd, 1H, J= 11.6, 4.8 Hz, CH2), 4.54-4.58 (m, 1H, CH), 4.63 (dd, 1H, J= 11.6, 4.4 Hz, CH), 5.04 (s, 1H, CH), 5.12 (d, 1H, J= 15.6 Hz, CH2), 5.19 (d, 1H, J= 15.6 Hz, CH2), 6.88 (dd, 1H, J= 9.2, 2.8 Hz, ArH), 7.37 (d, 1H, J= 2.8 Hz,
ArH), 7.46 (t, 2H, J= 7.6 Hz, ArH), 7.57-7.61 (m, 1H, ArH), 8.08-8.10 (m, 2H, ArH), 8.19 (d, lH, J= 9.2 Hz, ArH).
[0472] General procedure for the synthesis of compound 5kk: Compound 4kk (1.3 mmol) was dissolved in a mixture of TFA/H20 (9/1, 15 mL) and the resulting mixture was stirred at room temperature until the reaction complete (monitoring by TLC). Then the reaction was diluted with DCM (60 mL) and the solution was added dropwise to a stirred mixture of ice and saturated aqueous NaHC03. Solid NaHC03 was added during the addition to maintain a PH of 7. The mixture was extracted with DCM (3X50 mL), and the combined organic extracts was washed with H20 (50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered, concentrated to give a residue. The residue was dissolved in pyridine (15 mL) and cooled to 0 °C. Ac20 (0.5 mL) was added dropwise and then the resulting mixture was allowed to warm to room temperature. After stirring for 6 hours, the reaction was quenched with MeOH (10 mL) and the mixture was concentrated under reduced pressure to give a residue. The residue was dissolved in EtOAc (50 mL), and the organic phase was washed successively with saturated aqueous CuS04 (3X50 mL), brine (50 mL), dried over anhydrous Na2S04, filtered , concentrated and purified by a flash column chromatography on silica gel to afford the compound 5kk.
[0473] ((2S,3R,4R)-5-acetoxy-3-azido-4-((4-(4-bromobutoxy)-2- nitrobenzyl)oxy)tetrahydrofuran-2-yl)methyl benzoate. 1H MR (400 MHz, CDC13): δ 1.93 (s, 3H, CH3), 1.98-2.10 (m, 4H, 2CH2), 3.49 (t, 2H, J= 6.4 Hz, CH2), 4.04 (dd, 1H, J= 8.4, 4.8 Hz, CH), 4.12 (t, 2H, J= 6.0 Hz, CH2), 4.25 (d, 1H, J= 4.8 Hz, CH), 4.49 (dd, 1H, J = 12.0, 4.4 Hz, CH2), 4.59-4.63 (m, 1H, CH), 4.72 (dd, 1H, J= 12.0, 4.0 Hz, CH), 5.20 (s, 2H, CH2), 6.28 (s, 1H, CH), 6.89 (dd, 1H, J= 9.2, 2.8 Hz, ArH), 7.32 (d, 1H, J= 2.8 Hz, ArH), 7.46 (t, 2H, J= 8.0 Hz, ArH), 7.57-7.62 (m, 1H, ArH), 8.09 (dd, 2H, J= 8.0, 1.2 Hz, ArH), 8.20 (d, 1H, J= 9.2 Hz, ArH).
[0474] General procedure for the synthesis of compound (6kk): Compound 5kk (0.70 mmol) was dissolved in toluene (10 mL) and cooled to 0 °C. HBr (33wt% in acetic acid) (257 mg, 1.05 mmol, 1.5 eq) was added dropwise and the reaction was stirred at 0 °C for 5 hours. After the starting material was consumed, the reaction was concentrated under reduced pressure to give a residue. The residue was azeotroped with toluene (3X20 mL) to remove remaining acetic acid and dried in vacuo. The crude product and nicotinamide (103 mg, 0.84 mmol, 1.2 eq) was dissolved in CH3CN (20 mL). The reaction was stirred under Ar gas at room temperature for 24 hours. The reaction was concentrated in vacuo (the temperature was kept below 35 °C) to give a residue. The residue was dissolved in ammonia (18 mL, 7 N in
MeOH) and the reaction was stirred at -10 °C for 48 hours. The reaction was concentrated under reduced pressure and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 6kk.
[0475] l-((2R,3R,4R,5S)-4-azido-3-((4-(4-bromobutoxy)-2-nitrobenzyl)oxy)-5- (hydroxymethyl)tetrahydrofuran-2-yl)-3-carbamoylpyridin-l-ium bromide. 1H MR (400 MHz, CD3OD): δ 1.94-2.07 (m, 4H, 2CH2), 3.55 (t, 2H, J= 6.4 Hz, CH2), 3.80 (dd, 1H, J = 12.4, 2.4 Hz, CH2), 3.88 (dd, 1H, J= 12.4, 2.4 Hz, CH2), 4.05 (t, 1H, J= 5.2 Hz, CH), 4.73 (dd, 1H, J= 5.2, 1.6 Hz, CH), 4.82-4.83 (m, 1H, CH), 5.18 (d, 1H, J= 13.6 Hz, CH2), 5.23- 5.28 (m, 2H, CH2+CH), 6.72-6.75 (m, 2H, CH+ArH), 7.01 (dd, 1H, J= 9.2, 2.8 Hz, ArH), 8.15 (d, 1H, J= 9.2 Hz, ArH), 8.22-8.25 (m, 1H, ArH), 9.06 (d, 1H, J= 7.6 Hz, ArH), 9.21 (d, 1H, J= 6.0 Hz, ArH), 9.41 (s, 1H, ArH .
[0476] General procedure for the synthesis of compound 7kk: To a stirred solution of compound 6kk (0.27 mmol) in trimethylphosphate (2 mL) was added P(0)C13 ( 175 μΐ., 1.89 mmol, 7 eq) at 0 °C and the resulting mixture was stirred at 0 °C for 6 hours. A few drops H20 was then added to quench the reaction. Trimethylphosphate was removed by extraction with ethyl ether (3X20 ml). The remaining trimethylphosphate was removed by a second extraction with THF (5 ml). The aqueous layer was concentrated in vacuo and the crude product was dissolved in MeOH (0.5 mL). Addition of ethyl ether (10 mL) resulted in ppt of the desired product. The procedure was repeated three times to yield the desired product 7kk.
[0477] ((2^,3R,4R,5R)-3-azido-4-((4-(4-bromobutoxy)-2-nitrobenzyl)oxy)-5-(3- carbamoylpyridin-l-ium-l-yl)tetrahydrofuran-2-yl)m ethyl hydrogen phosphate. 1H MR (400 MHz, CD3OD): δ 1.92-2.07 (m, 4H, 2CH2), 3.54 (t, 2H, J= 6.4 Hz, CH2), 3.99-4.18 (m, 4H, 2CH2), 4.85-4.92 (2H, 2CH, overlap with the solvent residue peak), 5.17 (d, 1H, J= 13.6 Hz, CH2), 5.32 (d, 1H, J= 13.6 Hz, CH2), 5.42 (br, 1H, CH), 6.67 (d, 1H, J= 2.4 Hz, ArH), 6.75 (d, 1H, J= 3.6 Hz, CH), 6.98 (dd, 1H, J= 9.2, 2.4 Hz, ArH), 8.12 (d, 1H, J= 9.2 Hz, ArH), 8.21-8.25 (m, 1H, ArH), 9.05 (d, 1H, J= 8.0 Hz, ArH), 9.22 (d, 1H, J= 6.4 Hz, ArH), 9.45 (s, 1H, ArH).
[0478] General procedure for the synthesis of compound 8kk: To a stirred solution of compound 7kk (0.2 mmol) in H20 or MeOH (4 mL) was added RNH2 or RSK (0.4-1.0 mmol, 2-5 eq) at 0 °C. Then the resulting mixture was allowed to warm to room temperature and stirred at the same temperature until the reaction was complete (monitored by HPLC). The reaction was then concentrated in vacuo and the crude product is purified via preparative HPLC. Fractions containing the desired product are concentrated and are lyophilized to yield 8kk.
[0479] ((2^,3R,4R,5R)-4-((4-(4-(acetylthio)butoxy)-2-nitrobenzyl)oxy)-3-azido-5-(3- carbamoylpyridin-l-ium-l-yl)tetrahydrofuran-2-yl)m ethyl hydrogen phosphate. 1H MR (400 MHz, CD3OD): δ 1.71-1.78 (m, 2H, CH2), 1.83-1.90 (m, 2H, CH2), 2.34 (s, 3H, CH3), 2.96 (t, 2H, J= 7.2 Hz, CH2), 4.96-4.04 (m, 2H, CH2), 4.06-4.10 (m, 1H, CH2), 4.13-4.18 (m, 1H, CH2), 4.85 (d, 1H, J= 4.8 Hz, CH), 4.87-4.94 (1H, CH, overlap with the water peak), 5.19 (d, 1H, J= 13.6 Hz, CH2), 5.32 (d, 1H, J= 13.6 Hz, CH2), 5.42 (t, 1H,J= 5.6 Hz, CH), 6.65 (d, 1H, J= 2.8 Hz, ArH), 6.74 (d, 1H, J= 6.4 Hz, CH), 6.97 (dd, 1H, J= 9.2, 2.8 Hz, ArH), 8.13 (d, 1H, J= 9.2 Hz, ArH), 8.24 (dd, 1H, J= 7.6, 6.4 Hz, ArH), 9.05-9.08 (m, 1H, ArH), 9.22 (d, 1H, J= 6.4 Hz, ArH), 9.44 (s, 1H, ArH).
[0480] General procedure for the synthesis of NAD+ 31: To a stirred solution of 8kk (0.15 mmol, 1.5 eq) in dried DMF (2 mL) was added 1, 1-carbonyldiimidazole (CDI) (63 mg, 0.50 mmol, 5 eq) and triethylamine (23 μΐ., 0.16 mmol. 1.6 eq). The reaction mixture was stirred at room temperature for 8 hours, and was then quenched with 0.100 ml dried methanol. The solvent was removed under vacuum and the residue was coevaporated 3 times each with 1.00 ml of dried DMF. The activated 8kk was dissolved in dried DMF (1 mL) and compound Adenosine 5 '-monophosphate (5'-AMP) (0.10 mmol, 1.0 eq) was added. After stirring at room temperature for 4 days, H20 was added to quench the reaction at 0 °C. The resulting mixture was continued stirring at room temperature for 24 hours. The reaction was then concentrated in vacuo and the crude product was purified via preparative HPLC (CI 8- A column, 150X4.6 mm, 5 μπι) Fractions containing the desired product were concentrated and were lyophilized to yield corresponding NAD+ 30 (X = NH) and intermediate A (X = S). The
intermediate A was then dissolved in MeOH (2 mL) and DIPEA (0.2 mmol, 2.0 eq) and N- (3 -((4-((4-((3 -aminopropyl)amino)butyl)amino)butyl)amino)propyl)-3 -(2, 5 -dioxo-2, 5 - dihydro-lH-pyrrol-l-yl)propanamide (0.3 mmol. 3 eq) at 0 °C. Then the resulting mixture was allowed to warm to room temperature and stirred at the same temperature until the reaction was complete (monitored by HPLC). The reaction was then concentrated in vacuo and the crude product is purified via preparative HPLC. Fractions containing the desired product are concentrated and were lyophilized to yield NAD+ 31.
[0481] l-((2R,3R,4R,55)-5-((((((((2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4- dihydroxytetrahydrofuran-2- yl)methoxy)(hy droxy)phosphory l)oxy)oxidophosphory l)oxy)methyl)-3 -((5 -(4-(( 1 -(3 -((3 -((4- ((3-aminopropyl)amino)butyl)amino)propyl)amino)-3-oxopropyl)-2,5-dioxopyrrolidin-3- yl)thio)butoxy)-2-nitrobenzyl)oxy)-4-azidotetrahydrofuran-2-yl)-3 -carbarn oylpyridin-l-ium (NAD+ 31). MS (ESI) Calcd. For C49H7iNi6Oi9P2S+1 (M)+ requires 1281.4, Found: 1281.6.
Example 12: Effect of Topotecan on Cellular ADP-Ribosylation
[0482] HeLa cells grown in DMEM with 10% FBS were treated with R1 at indicated concentrations (0.1 and 1 mM) for 48 hours, followed by fixation, permeabilization, and fluorescent staining through Cu(I)-catalyzed click chemistry using Azide-fluor 545. The stained cells were imaged by confocal microscope (see FIG. 2).
[0483] To evaluate the effect of topotecan on cellular ADP-ribosylation, HeLa cells grown in DMEM with 10% FBS were treated with R1 at indicated concentrations (2 mM) for 6-12 hours in the absence or presence of topotecan and 6-(5H)-phenanthridinone at indicated concentrations (5 um), followed by fixation, permeabilization, and fluorescent staining through Cu(I)-catalyzed click chemistry using Azide-fluor 545. The stained cells were imaged by confocal microscope. To examine the sensitivity of fiuorescently labeled ADP- ribosylation to hydroxylamine (HA), cells were first incubated with R1 (1 mM) for 6 hours, followed by fixation and permeabilization. HA (3.5 M) was used to treat the fixed cells on
slides for 60 min. After extensive washing with PBS, the Cu(I)-catalyzed click chemistry was performed using Azide-fluor 545. The stained cells were imaged by confocal microscope (see FIG. 3).
Example 13 : Effect of Topotecan on Cellular ADP-Ribosylation
[0484] Expi293 cells were treated with NR or NRl at indicated concentrations in the absence or presence of topotecan (10-100 uM) for 6 hours. The cells were collected by centrifugation, followed by lysis using RIPA buffer. The soluble cell lysates were subjected Cu(I)-catalyzed click chemistry using Azide-biotin. After click reations, cell lysates were loaded onto SDS- PAGE gel for western blot analysis using streptavidin-URP conjugate for imaging (see FIG. 4).
Example 14: In Vitro Synthesis of NAD+1
[0485] Human NRKl and NMNAT1 were cloned into the pET28(A) bacterial expression vector. The constructs encoding human NRKl and NMNAT1 that were confirmed by DNA sequencing were then transformed with E. coli BL21 (DE3) cells for overnight expression at 37 degree. Expressed NRKl and NMNAT1 were purified by Ni-NTA affinity
chromatography and analyzed by SDS-PAGE gel (see FIG. 5A). To examine the in vitro biosynthesis of NAD1 from NRl, reactions were set up by adding 1.25 mM ATP, 1 mM NRl, 200 ug/mL purified NRKl and NMNAT1 into a solution with 50 mM Tris pH 8, 100 mM NaCl, 20 mM MgCl, and 1 mM DTT for incubation of 1-6 hours. The reactions were analyzed by HPLC using CI 8 reverse phase column (see FIG. 5B).
Example 15: LC-MS Analysis of NRl
[0486] Human Expi293 cells were treated with 1 mM NRl for 24 hours. The cells were collected and lysed with pre-chilled 10% perchloric acid. The supernatant was collected and neutralized with one-third volum of 3M K2C03. The supernatant was then subjected analysis by liquid chromatography and mass spectrometry. FIG. 6A shows the reverse-phase liquid chromatography for separation of the cellular extracts. FIG. 6B shows the mass spectrometry of the selected fraction for detection of cellular NRl analogue.
Example 16: LC-MS Analysis of NAD+1
[0487] Human Expi293 cells were treated with 1 mm NAD 1 for 24 hours. The cells were collected and lysed with pre-chilled 10% perchloric acid. The supernatant was collected and neutralized with one-third volum of 3M K2C03. The supernatant was then subjected analysis by liquid chromatography and mass spectrometry. FIG. 7A shows the reverse-phase liquid
chromatography for separation of the cellular extracts. FIG. 7B shows the mass spectrometry of the selected fraction for detection of cellular NR1 analogue.
[0488] Equivalents
[0489] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
[0490] The inventions illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms "comprising," "including," "containing," etc. Shall be read expansively and without limitation. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed.
[0491] Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification, improvement and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications, improvements and variations are considered to be within the scope of this invention. The materials, methods, and examples provided here are representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention.
[0492] The invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
[0493] All publications, patent applications, patents, and other references mentioned herein are expressly incorporated by reference in their entirety, including all formulas and figures, to the same extent as if each were incorporated by reference individually. In case of conflict, the present specification, including definitions, will control.
[0494] Other embodiments are set forth within the following claims.
Claims
1. A compound of Formula (I-A):
(I-A)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein:
each of R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C2-Ci0 alkynyl, an optionally substituted Ci-Cio alkoxy, -SR30, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z;
X5 is -S-, -0-, or -NR20-;
each R20 and R30 is independently a hydrogen or an optionally substituted Ci-Ci0 alkyl;
Z is
each Y15 is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy;
each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
P is a cationic polypeptide of about 5-30 amino acid residues;
Y40 is a hydrogen, an optionally substituted Ci-C6 alkyl, an optionally substituted C2- Cio alkenyl, an optionally substituted C2-Ci0 alkynyl, an optionally substituted C6-Ci0 aryl, an optionally substituted 5-15 membered heteroaryl, or -I^Y35;
L1 is -PO2-, -PO3-PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-;
each R100 is independently -O ® , an optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy; and
Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy.
(I-AA)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing.
3. The compound of claim 1 or 2, wherein R7, R9 and R11 are each hydrogen.
4. A compound of Formula (I-B):
(I-B)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein:
each of R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted Ci-Cio alkyl, an optionally substituted C2-C10 alkynyl, an optionally substituted C1-C10 alkoxy, -SR30, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z;
X5 is -S-, -0-, or -NR20-;
each R20 and R30 is independently a hydrogen or an optionally substituted C1-C10 alkyl;
Z is
each Y15 is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy;
each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
P is a cationic polypeptide of about 5 to 30 amino acid residues in length;
L5 is a hydrogen, an optionally substituted Ci-C6 alkyl, or -I^Y35;
L1 is -PO2-, -PO3-PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-;
each R100 is independently -O ® , an optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy; and
Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy.
(I-BB)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing.
6. The compound of claim 4 or 5, wherein R7, R9 and R11 are each hydi
7. A compound of Formula (I-C):
(I-C)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein
each R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted Ci-C6 alkyl or Z;
X is -S-, -0-, or -NR -;
R is a hydrogen or an optionally substituted Ci-Ci0 alkyl;
Z is
each Y15 is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy;
each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
P is a cationic polypeptide of about 5-30 amino acid residues in length;
Y30 is a hydrogen, an optionally substituted Ci-C6 alkyl, an optionally substituted C2- Cio alkenyl, an optionally substituted C2-Ci0 alkynyl, an optionally substituted C6-Ci0 aryl, an optionally substituted 5-15 membered heteroaryl, or -I^Y35;
L1 is -PO2-, -PO3-PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-;
each R100 is independently -O ® , an optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy; and
Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy.
(I-CC)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing.
9. A compound of Formula (I-D):
(I-D)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein
each of R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted Ci-C6 alkyl or Z;
X is -S-, -0-, or - R20-;
R20 is a hydrogen or an optionally substituted Ci-Cio alkyl;
L10 is a hydrogen, an optionally substituted Ci-C6 alkyl, or -I^Y35;
L1 is -PO2-, -PO3-PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-;
each R100 is independently -O ® , an optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy;
Y35 is a hydroxyl or an optionally substituted Ci-C6 alkoxy;
Z is
each Y15 is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy;
each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
P is a cationic polypeptide of about 9-30 amino acid residues in length.
(I-DD)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing.
11. A compound of Formula (I):
(I)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing, wherein
each R1, R2, R3, and R4 independently is a hydrogen or an optionally substituted Ci-C6 alkyl or Z;
X is -S-, -0-, or -NR -;
X5 is -S-, -0-, or -NR20-;
L1 is -PO2-, -PO3-PO2-, -PO3-PO3-PO2-, -P(=0)(R100)-, -P(=O)(R100)OP(=O)(R100)-, or -P(=O)(R100)OP(=O)(R100)OP(=O)(R100)-;
R100 is -0 ®, an optionally substituted C1-C10 alkyl group, or an optionally substituted C1-C10 alkoxy;
each R5, R6, R7, R8, R9, R10, and R11 independently is a hydrogen, -N3, a hydroxyl, an optionally substituted C1-C10 alkyl, an optionally substituted C2-Ci0 alkynyl, an optionally substituted C1-C10 alkoxy, -SR30, an optionally substituted C6-Cio aryl, an optionally substituted 5-15 membered heteroaryl, or Z;
Z is
each Y15 is independently a hydrogen, -N02, a halo, a cyano, a hydroxyl, an optionally substituted Ci-C6 alkyl, or an optionally substituted Ci-C6 alkoxy;
each Y25 is independently a hydrogen or an optionally substituted Ci-C6 alkyl, and each Y20 is independently selected from the group consisting of:
P is a cationic polypeptide of about 9-30 amino acid residues in length; and each R20 and R30 is independently a hydrogen or an optionally substituted Ci-Cio alkyl.
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing.
13. The compound of claim 11, having the structure:
(III)
or a tautomer thereof, or an N-oxide of each thereof, or a pharmaceutically acceptable salt of each of the aforementioned, or a pharmaceutically acceptable solvate of each of the foregoing.
14. The compound of any one of claims 7-13, wherein R3 and R4 are H or at least one of them is Z.
15. The compound of any one of claims 7-14, wherein R1 and R2 are H.
16. The compound of any one of claims 7-15, wherein X is O.
17. The compound of any one of claims 1-5 and 11-13, wherein X5 is O.
18. The compound of any one of claims 1, 2, 4, 5, and 7-13 wherein L1 is -P02- or -PO3-
19. The compound of any one of claims 1, 2, 4, 5, and 7-13, wherein L1 is -PO3-PO2-.
20. The compound of any one of claims 1, 2, 4, 5 and 11-13, wherein R6 and R8 is independently selected from -N3, a hydroxyl, an optionally substituted C2-C10 alkynyl, an optionally substituted C1-C10 alkoxy, -SR30, an optionally substituted 5-15 membered heteroaryl, or Z.
21. The compound of any one of claims 1, 2, 4, 5 and 11-13, wherein R6 and R8 is independently selected from -N3, a hydroxyl, an optionally substituted C2-C10 alkoxy, or an optionally substituted 5-15 membered heteroaryl.
22. The compound of any one of claims 1-2, 4-5, 11-13 wherein each of R5, R6, R7, R8, R9, R10, and R11 independently is selected from a group consisting of:
23. The compound of any one of claims 1, 2, 4, 5 and 11-13, wherein at least one of R6 and R8 is Z.
24. The compound of any one of claims 1, 2, 4, 5 and 11-13, wherein R6 and R8 are hydroxyl.
25. The compound of any one of claims 1, 2, 4, 5, 7, 8 and 11-13, wherein the optionally substituted 5-15 membered heteroaryl is an optionally substituted 6-10 membered heteroaryl.
26. The compound of any one of claims 1, 2, 4, 5, 7, 8 and 11-13, wherein the optionally substituted 5-15 membered heteroaryl is an optionally substituted 6 membered heteroaryl.
27. The compound of any one of claims 1, 2, 4, 5, 7, 8 and 11-13, wherein the optionally
substituted 5-15 membered heteroaryl is an optionally substituted pyridyl.
28. The compound of any one of claims 1 2, 4, 5, and 11-13, wherein R10 is:
R15 is -C(O)NR60R61, -OC(O) R60R61, -C(S) R60R61, or -OC(S) R60R61; and each R60 and R61 is independently an optionally substituted Ci-C6 alkyl or H.
29. The compound of any one of claims 1, 2, 4, 5, and 11-13, wherein R10 is:
30. The compound of claim 29, wherein R60 and R61 are H.
31. A compound selected from Table 1, Table 2, Table 3 or Table 4.
32. A compound of any preceding claim further comprising a detectable and/or affinity label.
33. A compound of any preceding claim further comprising a substrate protein.
34. A pharmaceutical composition comprising a compound of any preceding claim and a carrier, optionally a pharmaceutically acceptable excipient.
35. A method of monitoring and/or tracking ADP-ribosylation in a cell or sample comprising a PARP enzyme, the method comprising: contacting the cell or sample with a compound of any one of claims 1-31; labeling a PARP catalyzed reaction product; and detecting the product of the PARP catalyzed reaction, thereby monitoring and/or tracking ADP-ribosylation.
36. The method of claim 33, wherein the cell is a live cell.
37. The method of claim 35, wherein the contacting is in vitro or in vivo.
38. A method of purifying a PARP substrate protein, the method comprising: contacting a cell or sample comprising a PARP with a compound of any one of claims 1-31; labeling a PARP catalyzed reaction product with an affinity label, and purifying the product of the PARP catalyzed reaction.
39. A method of identifying a protein as a substrate for PARP, the method comprising contacting a cell or sample comprising the PARP with a compound of any one of claims 1- 31; labeling a PARP catalyzed reaction product with an affinity label; and purifying and characterizing the product of the PARP catalyzed reaction.
40. The method of claim 39, wherein the product of the PARP catalyzed reaction is characterized by mass spectrometry.
41. The method of claim 38 or 39, wherein the affinity label comprises biotin.
42. A method of labeling a PARP substrate protein, the method comprising contacting a cell or sample comprising PARP with a compound of any one of claims 1-31; and labeling a product of a PARP catalyzed reaction.
43. The method of claim 42, wherein the contacting is in vitro or in vivo.
44. A kit comprising a compound of any one of claims 1-33, and instructions for use.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/615,223 US20200157138A1 (en) | 2017-06-09 | 2018-06-08 | Nicotinamide adenine dinucleotide analogues |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762517784P | 2017-06-09 | 2017-06-09 | |
| US62/517,784 | 2017-06-09 | ||
| US201762529989P | 2017-07-07 | 2017-07-07 | |
| US62/529,989 | 2017-07-07 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018227168A1 true WO2018227168A1 (en) | 2018-12-13 |
Family
ID=64566803
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/036778 Ceased WO2018227168A1 (en) | 2017-06-09 | 2018-06-08 | Nicotinamide adenine dinucleotide analogues |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US20200157138A1 (en) |
| WO (1) | WO2018227168A1 (en) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110054658A (en) * | 2019-04-24 | 2019-07-26 | 鲁东大学 | A kind of synthetic method of niacinamide ribose |
| WO2020073026A1 (en) * | 2018-10-05 | 2020-04-09 | University Of Southern California | 4-thioribose nad analogues and methods of synthesizing and using the same |
| JPWO2020204022A1 (en) * | 2019-04-05 | 2020-10-08 | ||
| WO2021142059A1 (en) * | 2020-01-08 | 2021-07-15 | Microvascular Therapeutics, Llc | Alkylated nucleosides, and compositions and methods thereof for nucleic acid delivery |
| WO2021226584A1 (en) * | 2020-05-08 | 2021-11-11 | University Of Southern California | Site-specific antibody-drug conjugates by adp-ribosyl cyclases |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160185805A1 (en) * | 2014-12-24 | 2016-06-30 | The Board Of Trustees Of The Leland Stanford Junior University | Probe for imaging parp-1 activity |
| US20160299141A1 (en) * | 2015-04-08 | 2016-10-13 | The Board Of Regents Of The University Of Texas System | Nad analogs and methods of using said nad analogs in determining ribosylation of proteins with parp mutants |
| WO2017083659A1 (en) * | 2015-11-12 | 2017-05-18 | New York University | Biodegradable polymeric nanoparticle conjugates and use thereof |
-
2018
- 2018-06-08 US US16/615,223 patent/US20200157138A1/en not_active Abandoned
- 2018-06-08 WO PCT/US2018/036778 patent/WO2018227168A1/en not_active Ceased
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160185805A1 (en) * | 2014-12-24 | 2016-06-30 | The Board Of Trustees Of The Leland Stanford Junior University | Probe for imaging parp-1 activity |
| US20160299141A1 (en) * | 2015-04-08 | 2016-10-13 | The Board Of Regents Of The University Of Texas System | Nad analogs and methods of using said nad analogs in determining ribosylation of proteins with parp mutants |
| WO2017083659A1 (en) * | 2015-11-12 | 2017-05-18 | New York University | Biodegradable polymeric nanoparticle conjugates and use thereof |
Non-Patent Citations (2)
| Title |
|---|
| GRZYWA: "Clickable chain terminator NAD+ analogs for labeling substrate proteins of poly(ADP-ribose) polymerases", DISSERTATION, UNIVERSITY OF KONSTANZ, August 2014 (2014-08-01), pages 1 - 146, XP055558289 * |
| JIANG ET AL.: "Clickable NAD Analogues for Labeling Substrate Proteins of Poly(ADP-ribose) Polymerases", J AM CHEM SOC., vol. 132, no. 27, 2010, pages 9363 - 9372, XP055558446 * |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020073026A1 (en) * | 2018-10-05 | 2020-04-09 | University Of Southern California | 4-thioribose nad analogues and methods of synthesizing and using the same |
| US11834470B2 (en) | 2018-10-05 | 2023-12-05 | University Of Southern California | 4-thioribose NAD analogues and methods of synthesizing and using the same |
| JPWO2020204022A1 (en) * | 2019-04-05 | 2020-10-08 | ||
| WO2020204022A1 (en) * | 2019-04-05 | 2020-10-08 | 株式会社日本触媒 | Manufacturing of bridged artificial nucleoside |
| JP7233660B2 (en) | 2019-04-05 | 2023-03-07 | 株式会社日本触媒 | Production of crosslinked artificial nucleosides |
| JP2023053262A (en) * | 2019-04-05 | 2023-04-12 | 株式会社日本触媒 | Production of crosslinked artificial nucleosides |
| JP7531871B2 (en) | 2019-04-05 | 2024-08-13 | 株式会社日本触媒 | Preparation of bridged artificial nucleosides |
| CN110054658A (en) * | 2019-04-24 | 2019-07-26 | 鲁东大学 | A kind of synthetic method of niacinamide ribose |
| WO2021142059A1 (en) * | 2020-01-08 | 2021-07-15 | Microvascular Therapeutics, Llc | Alkylated nucleosides, and compositions and methods thereof for nucleic acid delivery |
| JP2023510253A (en) * | 2020-01-08 | 2023-03-13 | マイクロヴァスキュラー ゼラピューティクス エルエルシー | Alkylated Nucleosides, and Their Compositions and Methods for Nucleic Acid Delivery |
| WO2021226584A1 (en) * | 2020-05-08 | 2021-11-11 | University Of Southern California | Site-specific antibody-drug conjugates by adp-ribosyl cyclases |
| US11684676B2 (en) | 2020-05-08 | 2023-06-27 | University Of Southern California | Site-specific antibody-drug conjugates by ADP-ribosyl cyclases |
Also Published As
| Publication number | Publication date |
|---|---|
| US20200157138A1 (en) | 2020-05-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20200157138A1 (en) | Nicotinamide adenine dinucleotide analogues | |
| CN114728938B (en) | Tetrahydroisoquinoline spiro compounds as PRMT5 inhibitors | |
| KR101758046B1 (en) | Isoindolinone inhibitors of phosphatidylinositol 3-kinase | |
| JP5721275B2 (en) | Novel 7-deazapurine nucleosides for therapeutic use | |
| WO2021168074A1 (en) | Macrocyclic compounds and uses thereof | |
| ES2818231T3 (en) | Glycosylated indolecarbazoles, procedure of obtaining and uses of the same | |
| CN114315834A (en) | Imidazolidinone derivatives and their use in medicaments | |
| KR20080081177A (en) | Sulfonamidoaniline Derivatives, Janus Kinase Inhibitors | |
| TW202332442A (en) | Pol theta inhibitors | |
| US20090118220A1 (en) | Substituted adenines and the uses thereof | |
| WO2008117047A1 (en) | Pyrazolo[3, 4-d]pyrimidine derivatives as antibacterial compounds | |
| TWI890016B (en) | A five-membered and six-membered compound, preparation method, pharmaceutical composition and application | |
| WO2018220365A1 (en) | Antibiotic resistance breakers | |
| EP4232450A1 (en) | Bicyclic compounds | |
| WO2018133854A1 (en) | Adenosine analog and its use in regulating the circadian clock | |
| TWI795706B (en) | Polycyclic compounds as kinase inhibitors | |
| AU2219599A (en) | Platelet adp receptor inhibitors | |
| US20040063716A1 (en) | Cholesterol biosynthesis inhibitors containing as the active ingredient tricyclic spiro compounds | |
| EP1191028B1 (en) | Tricyclic compounds having spiro union | |
| Korn et al. | ENZYMATIC SYNTHESIS OF 4-AMINO-5-IMIDAZ-OLECARBOXAMIDE RIBOSIDE FROM 4-AMINO-5-IMIDAZOLECARBOXAMIDE AND RIBOSIDE-1-PHOSPHATE1 | |
| CN106167486B (en) | Monocycle class gyrase and topoisomerase I V inhibitor | |
| US6858599B2 (en) | Tricyclic compound having spiro union | |
| US11834470B2 (en) | 4-thioribose NAD analogues and methods of synthesizing and using the same | |
| Andy | Approach for identification of binding proteins of calcium mobilizing second messengers: NAADP and cADPR | |
| BR122025025229A2 (en) | IMIDAZOLIDINONE DERIVATIVES, THEIR USES, AND PHARMACEUTICAL COMPOSITION |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18813509 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 18813509 Country of ref document: EP Kind code of ref document: A1 |








































































































































































































































































