WO2018209125A1 - Epstein barr virus antibodies, vaccines, and uses of the same - Google Patents

Epstein barr virus antibodies, vaccines, and uses of the same Download PDF

Info

Publication number
WO2018209125A1
WO2018209125A1 PCT/US2018/032127 US2018032127W WO2018209125A1 WO 2018209125 A1 WO2018209125 A1 WO 2018209125A1 US 2018032127 W US2018032127 W US 2018032127W WO 2018209125 A1 WO2018209125 A1 WO 2018209125A1
Authority
WO
WIPO (PCT)
Prior art keywords
ebv
seq
cells
antibody
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/032127
Other languages
French (fr)
Inventor
Andrew MCGUIRE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Fred Hutchinson Cancer Center
Original Assignee
Fred Hutchinson Cancer Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Fred Hutchinson Cancer Center filed Critical Fred Hutchinson Cancer Center
Priority to US16/612,265 priority Critical patent/US11116835B2/en
Publication of WO2018209125A1 publication Critical patent/WO2018209125A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/245Herpetoviridae, e.g. herpes simplex virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/081DNA viruses
    • C07K16/085Orthoherpesviridae (F), e.g. pseudorabies virus or Epstein-Barr virus
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1131Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against viruses
    • C12N15/1133Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against viruses against herpetoviridae, e.g. HSV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5156Animal cells expressing foreign proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16211Lymphocryptovirus, e.g. human herpesvirus 4, Epstein-Barr Virus

Definitions

  • Anti-Epstein Barr Virus (EBV) antibodies, vaccines, and uses of the same are described.
  • the antibodies and vaccines can be used to treat and/or reduce the risk of EBV infection and also to treat and/or reduce the risk of complications associated with EBV infection, such as infectious mononucleosis, lymphoproliferative disorders, carcinomas, and smooth muscle tumors.
  • Cells can be genetically engineered to express the antibodies, vaccines, or fragments thereof, for example, in vivo.
  • Epstein Barr virus is an orally transmitted gamma herpesvirus that infects B cells and epithelial cells in the majority of adults worldwide. Most primary infections are asymptomatic, however, EBV is a causative agent of infectious mononucleosis (IM) in children and young adults. Following primary infection, infected individuals become lifelong carriers of EBV, which can lie dormant (i.e., latent) in cells. However, in certain individuals the latent virus can begin to express genes that alter cellular replication, leading to cancer or cancer-like diseases.
  • IM infectious mononucleosis
  • EBV is also associated with nasopharyngeal carcinoma and lymphoproliferative disorders in immunocompromised patients such as those with HIV/AIDS or in patients undergoing immune suppression for organ transplantation.
  • antibodies or vaccines that treat, reduce, or prevent EBV infection of cells or treat EBV-associated diseases would be a major benefit to public health.
  • a primary goal of most vaccine design strategies is to elicit production of neutralizing antibodies, which are a type of antibody that can inhibit the biological function of its target.
  • Neutralizing antibodies are also useful as protein therapeutics to treat viral infection.
  • Neutralizing antibodies against viruses such as EBV typically function by blocking a virus from entering a cell.
  • EBV To enter a cell, EBV, like other herpesviruses, first attaches to the cell surface through an interaction between a protein on the surface of the virus and a receptor binding site of a cell surface protein. Following this attachment, the virus membrane can fuse with the cell membrane, allowing the contents of the virus to be inserted into the cell. Viral fusion also occurs through interaction of a viral protein with an epitope on an antigen of a cell protein. The interactions resulting in viral attachment to a cell and the interactions resulting in viral fusion to a cell are distinct, each involving different viral proteins and different cellular proteins. Thus, neutralizing antibodies could block EBV entry into cells by preventing virus/cell protein interactions leading to attachment and/or fusion.
  • the current disclosure provides anti-Epstein Barr virus (EBV) antibodies, EBV vaccines, and uses of the same.
  • the anti-EBV antibodies are effective human neutralizing antibodies.
  • the anti-EBV antibodies neutralize EBV infection of B cells and epithelial cells.
  • the disclosed anti-EBV antibodies are referred to herein as AMM01 , AMM02, AMM03, AMM04 and AMM05.
  • the anti-EBV antibodies bind the EBV core fusion machinery: heterodimer envelope glycoprotein H/envelope glycoprotein L (gH/gL) and/or glycoprotein B (gB).
  • the anti-EBV antibodies bind across the D-l/D-ll groove of the gH/gL heterodimer complex.
  • the anti-EBV antibodies bind at least one of residues 60, 70-81 , 21 1-216, and 234-239 of gH; and/or at least one of residues 123-128 of gL.
  • the anti-EBV antibodies bind residues 60, 70-81 , 21 1-216, and 234- 239 of gH; and residues 123-128 of gL.
  • the anti-EBV antibodies bind residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine.
  • the anti-EBV antibodies include a human antibody, or an antigen-binding portion thereof (including scFv) that dissociates from EBV gH/gL with a K D of 1X10 "10 or less and a k 0ff rate constant of 3X10 "5 s"1 or less, both determined by surface plasmon resonance or biolayer interferometry.
  • the anti-EBV antibodies neutralize EBV infection of B cells and/or epithelial cells with an IC5 0 of 3X10 "9 M or less.
  • the anti-EBV antibodies include SEQ ID NO: 41 and SEQ ID NO: 42 with mutations selected from one or more heavy chain mutations selected from D10E; G76S; S83R; T84S; F91Y; V107T; and P1 13S and/or one or more light chain mutations selected from E3V; Q17K; R18T; T20R; Q49Y; S69N; and G100T.
  • the anti-EBV antibodies include SEQ ID NO: 41 and SEQ ID NO: 42.
  • the anti-EBV antibodies include SEQ ID NO: 1 and SEQ ID NO: 2
  • SEQ ID NO: 1 includes mutation Q1 N.
  • the anti-EBV antibodies include SEQ ID NO: 3 and SEQ ID NO:
  • SEQ ID NO: 3 includes mutation Q1 N.
  • the anti-EBV antibodies include SEQ ID NO: 5 and SEQ ID NO: 5
  • SEQ ID NO: 6 includes mutation E1 N. In particular embodiments, SEQ ID NO: 6 includes mutation Q1 N. In particular embodiments, SEQ ID NO: 5 includes mutation E1 N and SEQ ID NO: 6 includes mutation Q1 N.
  • the anti-EBV antibodies include SEQ ID NO: 7 and SEQ ID NO: 8.
  • SEQ ID NO: 7 includes mutation Q1 N.
  • the anti-EBV antibodies include SEQ ID NO: 9 and SEQ ID NO: 10.
  • SEQ ID NO: 9 includes mutation E1 N.
  • SEQ ID NO: 10 includes mutation E1 N.
  • SEQ ID NO: 9 includes mutation E1 N and SEQ ID NO: 10 includes mutation E1 N.
  • the anti-EBV antibodies include the complementary determining regions (CDRs): SEQ ID NO: 11 , SEQ ID NO: 12, SEQ I D NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16; SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , and SEQ ID NO: 22; SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28; SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, and SEQ ID NO: 34; or SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, and SEQ ID NO: 40.
  • CDRs complementary determining regions
  • the EBV antibodies and/or vaccine antigen epitopes can be formulated to treat an EBV-infected subject or a subject at risk of EBV infection.
  • cells such as B cells, can be genetically modified to express one or more EBV antibodies and/or vaccine antigen epitopes described herein. Genetic modification can be in vivo or in vitro. Treating EBV can reduce EBV infection and/or treat a condition associated with EBV infection, such as infectious mononucleosis or lymphoproliferative disorder. Moreover, high levels of antibodies that neutralize EBV B-cell infection are associated with lowered risks for nasopharyngeal carcinoma. BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
  • FIG. 1 X-ray data collection and refinement statistics.
  • FIG. 2 CryoEM data collection and refinement statistics.
  • FIGs. 3A-3C Biochemical and antigenic characterization of EBV glycoprotein ectodomains.
  • FIG. 3A Purified EBV ectodomain proteins were separated by reducing and non- reducing SDS-PAGE and stained with Coomassie Brilliant Blue as indicated. gH/gL formed a heterodimer. Under non-reducing conditions, gB ran as a single band of 120 kDa. Under reducing conditions, the majority of gB runs as 2 bands corresponding to 80 and 40 kDa, consistent with efficient furin- mediated proteolytic cleavage and disulfide bond formation. (FIG.
  • FIG. 3B Anti-EBV antibodies were captured from hybridoma supernatants using anti-mouse Fc capture biosensors and binding to a 0.5 ⁇ solution of purified EBV ectodomain proteins was evaluated as indicated. The antibody is indicated at the top of each panel and its antigenic target is included in parentheses.
  • FIG. 3C EC 50 of serum binding responses to gp42, gH/gL, gp350 and gp42 from 16 donors were measured by ELISA. Symbols and error bars present the mean and standard deviation of two independent measurements performed in duplicate. Symbols on the dashed line represent a seropositive response that did not saturate at the highest concentration tested. Symbols on the abscissa represent undetectable serum responses at the highest concentration tested.
  • FIGs. 4A-4C Isolation of anti-EBV antibodies from antigen specific B cells.
  • Class switched B cells live, single, CD14-, CD16-, CD3-, CD19+, CD20+, IgM-, IgD-) were stained with streptavidin-PE, or streptavidin-PE conjugated to gH/gL, gB, gp350, or gp42 as indicated.
  • Peripheral blood mononuclear cells were stained with a decoy protein conjugated to streptavidin-PE-DL650 and streptavidin-PE alone, or streptavidin-PE conjugated to gH/gL or gB as indicated.
  • FIG. 4A A positive magnetic enrichment using anti-PE microbeads was performed and then cells were stained as in FIG. (4A).
  • PE-DL-650- / PE+ B cells live, single, CD14-, CD16-, CD3-, CD19+, CD20+, IgM-, IgD-) are shown. Numbers indicate the % of PE+ class switched B cells in each panel in FIGs. 4A and 4B.
  • FIG. 4C AMM01 , AMM02, AMM03, AMM04, and AMM05, antibodies cloned from B cells sorted using the approach in (FIG. 4B) were loaded onto anti- human Fc capture biosensors.
  • FIGs. 5A-5C Example of gating strategy for sorting antigen positive B cells.
  • FIG. 5A PBMC from an EBV-seropositive donor were stained with gH/gL conjugated to streptavidin- PE, viability dye, and antibodies specific for CD3, CD14, CD16, CD19, CD20, IgM, and IgD.
  • FIG. 5A PBMC from an EBV-seropositive donor were stained with gH/gL conjugated to streptavidin- PE, viability dye, and antibodies specific for CD3, CD14, CD16, CD19, CD20, IgM, and IgD.
  • PBMC peripheral blood mononuclear cells
  • PE+ and PE- DL650+ cells were enriched using magnetic beads conjugated to an anti-PE antibody.
  • the cells were stained as in (FIG. 5A). Cells in the pink gate on the right-most panel were sorted using FACS.
  • FIG. 6 Summary of antigen-specific B cell sorting and VH/VL recovery.
  • FIG. 7 Sequences of isolated anti-EBV MAbs.
  • the amino acid sequence of the isolated antibodies is shown as an alignment to the closest chromosomally encoded V- D- and J-gene segments shown in underlining, bold italics, and bold underlining, respectively.
  • " ⁇ indicates identity to chromosomally encoded amino acid.
  • the complementary determining regions (Kabat definition) are highlighted in gray.
  • the percentage of VH or VL mutation based on the nucleotide sequence is provided for each antibody chain, and the Genbank accession number is provided in brackets. The gene usage, and mutation percentages were determined using the IMGT/V-Quest tool (Brochet et al., 2008, Nucleic Acids Research doi: 10.1093/nar/gkn316. PubMed PMID: 18503082).
  • FIGs. 8A, 8B Neutralization of EBV infection in epithelial cells and B cells by newly isolated MAbs. Serial dilutions of the indicated antibodies were evaluated for their ability to neutralize (FIG. 8A) AKTA-GFP EBV infection of epithelial (SVKCR2) cells or (FIG. 8B) B95.8/F EBV infection of B (Raji) cells.
  • Anti-gH/gL antibodies are AMM01 , CL40, CL59, AND E1 D1
  • anti-gB antibodies are AMM02, AMM03, AMM04, and AMM05
  • the anti-gp350 antibody is 72A1.
  • the human or murine origins of the antibodies are indicated in the legend.
  • FIG. 9 Kinetic analysis of antibodies, or gp42 binding to gH/gL measured by BLI.
  • FIG. 10 E1 D1 binding to gH/gL is pH-dependent. Biotinylated E1 D1 was immobilized on streptavidin biosensors. After obtaining a baseline reading in KB, the biosensors were immersed into 50 nM solutions of gH/gL in KB at the indicated pH for 250 s, and then immersed into kinetics buffer at the indicated pH for 750 s.
  • FIG. 11 Crystal structure of the free AMM01 Fab.
  • FIGs. 12A, 12B AMM01 forms a 1 : 1 : 1 complex with gH/gL and gp42.
  • (12B) Fractions corresponding to the peak in (12A) were collected, concentrated and separated by reducing SDS-PAGE, and stained with Coomassie Brilliant Blue.
  • FIGs. 13A-13G CryoEM reconstruction of gH/gL-gp42-AMM01 complex at 4.8 A resolution.
  • FIG. 13B 90° rotation from (FIG. 13A): AMM01 heavy chain is marked, AMM01 light chain is marked, gL is marked, gH D-l is marked, gH D-ll is marked, gH D-lll is marked, gH D-IV is marked, and gp42 is marked.
  • FIGs. 13C, 13D Ribbon diagram of the gH/gl_/gp42- AMM01 atomic model rendered with the same colors as panels FIG. 13A and FIG. 13B.
  • FIG. 13E Zoomed-in view of the AMM01 epitope with regions of interest labeled.
  • FIG. 13F AMM01 footprint on the gH/gl_/gp42 complex. For clarity, only the AMM01 CDR loops are shown interacting with gH/gl_/gp42 rendered in surface representation. Residues that have been identified as being important for AMM01 binding (K73 and Y76) are marked with an asterisk.
  • FIG. 13G The gH N60 glycan is shown in stick representation in the corresponding region of cryoEM density to highlight the putative contacts made with AMM01. The black dot shows the position of the gH KGD motif
  • FIGs. 14A— 14H Overview of cryo electron microscopy and glycan analysis of gH/gL- gp42-AMM01 complex
  • FIG. 14A Representative micrograph of frozen-hydrated gH/gL-gp42- AMM01 complex. Scale bar: 200 nm.
  • FIG. 14B Selected 2D class averages.
  • FIG. 14C Schematic workflow for 3D reconstruction of gH/gL- gp42-AMM01 complex in RELION 2.0.
  • FIG. 14E Angular distribution of particle images in the final reconstruction.
  • FIG. 14F ResMap-based estimate of local resolution (in A) of the final reconstruction.
  • FIG. 14G FSC curve for final reconstruction of gH/gl_/gp42 complex in which the gp42 C terminal domain is displaced.
  • FIG. 14H Characterization of the gH/gl_/gp42 glycans by mass spectrometry. The predominant type of identified N-linked glycan is represented at each site. Glycans are shown with parentheses to highlight their variability and the unresolved branching structure.
  • FIGs. 15A-15E Binding of AMM01 to cell-surface expressed gH/gL mutants. gH/gL with the indicated mutations were expressed on the surface of 293F cells and stained with the CL59 MAb followed by an anti-mouse PE secondary Ab and serially-diluted AMM01 conjugated directly to DL650. Cells expressing gH/gL variants were identified by PE (CL59) staining.
  • FIG. 15A Mean-fluorescence intensity (MFI) of PE positive cells expressing WT gH/gL or gH with mutated gL variants. The PE-MFI of mock transfected cells is shown as a control.
  • FIG. 15A Mean-fluorescence intensity (MFI) of PE positive cells expressing WT gH/gL or gH with mutated gL variants. The PE-MFI of mock transfected cells is shown as a control.
  • FIG. 15A Mean-fluorescence intensity (MFI) of PE positive cells expressing
  • FIG. 15B The DL650 MFI for each gH/gL variant was normalized to the PE-MFI of the gH/gLN127A mutant (shown in A) and plotted as a function of AMM01 concentration.
  • FIG. 15C The mean-fluorescence intensity (MFI) of PE positive cells expressing WT gH/gL or mutant gH variants paired with WT gL. The PE-MFI of mock transfected cells is shown as a control.
  • FIGs. 15D, 15E The DL650 MFI for each gH/gL variant was normalized to the PE-MFI of the gHS79R/gL mutant (shown in FIG. 15C) and plotted as a function of AMM01 concentration.
  • gH/gL variants with mutations in the 2a1 and 2a4 helices of gH along with WT gH/gL are shown in 15D and 15E respectively.
  • FIG. 16 A heavy chain Q1 N mutation does not affect AMM01 neutralization potency.
  • Serial dilutions of wildtype AMM01 (WT AMM01) or AMM01 containing a Q1 N heavy chain mutation (AMM01 Q1 NHC) antibodies were evaluated for their ability to neutralize AKTA-GFP EBV infection of epithelial (SVKCR2) cells or B95.8/F EBV infection of B (Raji) cells as indicated.
  • FIGs. 17A-17G AMM01 and CL40 share partially overlapping epitopes. Ribbon diagrams of the gH/gL/gp42-AMM01 (FIG. 17A) and gH/gL/gp42-CL40 complexes (FIG. 17B, PDB 5W0K). AMM01 heavy chain, AMM01 light chain, CL40, gL, gH D-l, gH D-ll, gH D-lll and gH D-IV are indicated. gp42 is omitted from FIG. 17A and FIG. 17B for clarity. (FIG.
  • FIG. 17C gH/gL residues experiencing a change in accessible surface area upon antibody binding are indicated and colored medium grey (AMM01) and dark grey (CL40). Areas that experience a change in accessible surface area upon binding of either AMM01 or CL40 are shown in dark pink.
  • Biotinylated AMM01 (FIG. 17D), CL40 (FIG. 17E), CL59 (FIG. 17F), or E1 D1 (FIG. 17G) were immobilized on a streptavidin biosensor and used to measure binding a 250 nM solution of gH/gL alone, or pre-complexed with 500 nM of non-biotinylated antibody by BLI as indicated.
  • the unrelated anti-influenza hemagglutinin glFI6 MAb was used as a negative control.
  • FIGs. 18A-18F An AMM01-gp42 N173 glycan clash displaces the gp42 CTD.
  • FIG. 18A gH/gL residues that experience a change in accessible surface area upon AMM01 binding are colored medium grey (indicated by arrows), those that experience a change in accessible surface area upon gp42 binding are colored dark grey (indicated by arrows.
  • Asn 240 (circled) experiences a change in accessible surface area upon binding to AMM01 and to gp42.
  • FIG. 18B Zoomed- in view of the region around gH Asn 240. Ribbons are rendered with the same shading as in FIGs. 13A-13G.
  • FIG. 18C CryoEM reconstructions of the gH/gl_/gp42-AMM01 complex show that most particle images harbor the gp42 C-domain bound on top of gH D-ll.
  • FIG. 18D A small fraction of particle images are characterized by a displacement of the gp42 C-domain. The map is shown at high contour (isosurface) and at low contour (mesh) level to demonstrate that the gp42 CTD is much less well ordered than the rest of the complex. The orientation of the gp42- CTD is approximate due to the limited resolution of this reconstruction.
  • FIG. 18E The 4.8 A resolution reconstruction shown in (FIG.
  • FIG. 18C Biolayer interferometry traces showing that gp42 partially competes for gH/gL binding to immobilized AMM01. The competition is abrogated when the gp42 N173 glycan is removed by introduction of a T175A mutation disrupting the glycosylation sequon.
  • FIGs. 19A-19D Selected 2D class averages of negatively stained gH/gL/gp42 (FIG. 19A) and gH/gL/gp42/AMM01 (FIGs. 19B, 19C) and gH/gl_/CL40 (FIG. 19D) along with the corresponding density assignments in cartoon form (right).
  • the AMM01 or CL40-mediated displacement of gp42 is emphasized with a dashed outline surrounding gp42.
  • the box size of the 2D class averages is 29.4 nm.
  • FIGs. 20A-20F AMM01 interferes with cell fusion.
  • FIG. 20A Biotinylated gH/gL/gp42, or gH/gl_/gp42/AMM01 complexes were assembled on immobilized on streptavidin biosensors and used to measure binding to a 500 nM solution of HLA-DR using BLI as indicated.
  • FIG. 20B B cell surface staining with streptavidin-PE alone, or streptavidin-PE conjugated to biotinylated gH/gL, biotinylated gB, or biotinylated gH/gL bound to gp42 +/- an excess of the indicated MAbs.
  • FIG. 20D Biotinylated gH/gL was immobilized on streptavidin biosensors, and then used to measure binding to a 1 ⁇ solution of ⁇ , ⁇ , ⁇ , gp42, or an HIV-1 Envelope protein as indicated.
  • FIG. 20E Biotinylated gH/gL or gH/gL/AMM01 was immobilized on streptavidin biosensors, and used to measure binding to a 3.5 ⁇ solution of EphA2 by BLI as indicated.
  • FIG. 20E Biotinylated gH/gL or gH/gL/AMM01 was immobilized on streptavidin biosensors, and used to measure binding to a 3.5 ⁇ solution of EphA2 by BLI as indicated.
  • FIGs. 21A-21 D Possible mechanisms of AM M01 -mediated neutralization.
  • FIG. 21A Direct inhibition of gB binding.
  • AMM01 heavy chain, AMM01 light chain, gl_, gH D-l, gH D-ll, gH D- III, and gH D-IV are shown.
  • Residues in the linker helix which have been previously shown to affect cell fusion (L65, L69 and L74) when mutated are shown in black.
  • AMM01 binding to gH/gL could prevent subsequent interaction with gB and fusion activation.
  • FIG. 21 B Molecular clamp preventing gB triggering.
  • gH, gl_ and AMM01 are colored as in (FIG. 21A).
  • Residues within the D-l/D-ll groove (L55, L207, R152, H154, T174, K94) that have been shown to affect membrane fusion when mutated are shown in black.
  • AMM01 By binding across D-l and D-ll, AMM01 could restrict movements across the D-l/D-ll groove that are required for gB interaction and/or triggering.
  • FIG. 21 C Restriction of B cell receptor interactions. Although AMM01 binds away from the HLA-II binding site on the gH/gl_/gp42 complex, it could restrain access to membrane anchored receptors through the second FAb arm or the Fc region (modelled using PDB ID 1 HZH) of the antibody.
  • gH, gl_ and AMM01 are as in (FIG. 21A) and gp42 is aslo indicated. HLA-DR1 is indicated and positioned to bind its predicted binding site of gp42 (PDB ID 1 KG0).
  • FIG. 21 D Restriction of epithelial cell receptor interactions. AMM01 could inhibit binding to one or more epithelial cell receptors by directly restricting access to the interacting site (e.g. reduction of KGD motif accessibility) or by indirect steric hindrance mediated through the second FAb arm or the Fc region of the antibody.
  • the KGD motif which has been implicated in gH/gL binding to integrins is shown in red. The gray rectangle could represent ⁇ , ⁇ , ⁇ , integrins, EphA2 or another unidentified receptor.
  • FIGs. 22A, 22B Comparison of (FIG. 22A) the AMM01 epitope on EBV gH/GI and (FIG. 22B) the epitope of Fab 94 on varicella zoster virus (VZV) gH/GI (PDB ID: 4X15).
  • VZV varicella zoster virus
  • Fab RC PBD ID: 4XHJ
  • Fab RC binds to a similar epitope on VZV gH/GI (not shown).
  • Both antibodies bridge D-l/D-ll (H1A/H1 B in VZV gH/gL) and bind to the gH/gL interface, suggesting a common mechanism of neutralization of these two herpes viruses.
  • FIGs. 23A-23C B cells were harvested from mice and challenged with a low-dose EBV reporter virus that induces GFP expression upon infection. The absence of antibody could readily be detected (FIG. 23A, left), yet there was no evidence of infection in the presence of AMM01 (FIG. 23A, right).
  • 0.5mgAMMO or an irrelevant anti-HIV MAb was administered to humanized mice 2 days prior to a high dose (5X IC5 0 ) intravenous EBV challenge. 6 weeks later, nearly all of the human B cells (hCD45+,hCD19+) in the blood had died in mice that received the control antibody (FIG. 23B), while B cells survived in mice that received AMM01 (FIG. 23B). Similar results were observed in the spleen at week 7 (FIG. 23C).
  • FIG. 24 Sequences supporting the disclosure. DETAILED DESCRIPTION
  • Epstein Barr virus is an orally transmitted gamma herpesvirus that infects B cells and epithelial cells. Most primary infections are asymptomatic, however, EBV is a causative agent of infectious mononucleosis (IM) in children and young adults. Following primary infection, infected individuals become lifelong carriers of EBV, which can lie dormant (i.e., latent) in cells. However, in certain individuals the latent virus can begin to express genes that alter cellular replication, leading to cancer or cancer-like diseases. EBV is also associated with nasopharyngeal carcinoma and lymphoproliferative disorders in immunocompromised patients such as those with HIV/AIDS or in patients undergoing immune suppression for organ transplantation. Thus, antibodies or vaccines that treat, reduce, or prevent EBV infection of cells or treat EBV-associated diseases would be a major benefit to public health.
  • IM infectious mononucleosis
  • a primary goal of most vaccine design strategies is to elicit production of neutralizing antibodies, which are a type of antibody that can inhibit the biological function of its target.
  • Neutralizing antibodies are also useful as protein therapeutics to treat viral infection.
  • Neutralizing antibodies against viruses such as EBV typically function by blocking a virus from entering a cell.
  • EBV therapeutics which can be formulated to treat an EBV-infected subject or a subject at risk of EBV infection.
  • EBV therapeutics refer to agents that treat EBV infection, reduce the risk or severity of EBV infection, and/or induce an immune response against EBV. Treating EBV can reduce EBV infection and/or treat a condition associated with EBV infection, such as infectious mononucleosis or lymphoproliferative disorder.
  • use of EBV therapeutics disclosed herein lower the risk for nasopharyngeal carcinoma in a subject.
  • EBV therapeutics can be used to reduce the risk of infection when, for example, an EBV positive person donates solid organ or tissue to an EBV negative person who is immunosuppressed.
  • the antibody can be transferred to prevent or reduce the risk of infection.
  • EBV therapeutics can also be used to recognize tumor cells expressing EBV antigens for diagnosis or treatment (such as antibody-drug conjugates).
  • cells such as B cells, can be genetically modified to express one or more EBV antibodies and/or vaccine antigen epitopes described herein. Genetic modification can be in vivo or in vitro.
  • EBV therapeutics include anti-EBV antibodies, EBV vaccines, and cells genetically modified to express anti-EBV antibodies, EBV vaccines, and/or fragments thereof.
  • the EBV therapeutics include anti-gH/gL or anti-gB antibodies, and/or EBV vaccines designed to elicit anti-gH/gL or anti-gB antibodies.
  • anti-EBV antibodies are effective human neutralizing antibodies.
  • the anti-EBV antibodies neutralize EBV infection of B cells and epithelial cells.
  • the anti-EBV antibodies neutralize EBV infection of B cells and/or epithelial cells with an IC5 0 of 3X10 "9 M or less.
  • AMM01 anti-gH/gL antibody.
  • AMM01 is uniquely able to potently neutralize infection of B cells and epithelial cells, the two major cell types that EBV infects.
  • Cryo-electron microscopy reconstructions of the gH/gl_/gp42/AMM01 complex demonstrated that AMM01 binds to a discontinuous epitope formed by both gH and gL at the Domain-l/Domain-ll interface.
  • the anti-EBV antibodies bind at least one of residues 60, 70- 81 , 211-216, and 234-239 of gH; and/or at least one of residues 123-128 of gL. In particular embodiments, the anti-EBV antibodies bind at least one of residues 60, 70-81 , 21 1-216, and 234- 239 of gH; and at least one of residues 123-128 of gL. In particular embodiments, the anti-EBV antibodies bind residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine. These epitopes bound by the antibodies of the disclosure can be used as vaccine antigen epitopes to produce EBV vaccines.
  • binding refers to an interaction between a molecule (e.g., antibody) and its binding partner (e.g., antigen and/or target epitope) with a binding affinity represented by a dissociation constant (K D ) of 10 "8 M or less, in particular embodiments of from 10 "5 M to 10 "13 M, in particular embodiments of from 10 "5 M to 10 "10 M, in particular embodiments of from 10 "5 M to 10 "7 M, in particular embodiments of from 10 "8 M to 10 "13 M, or in particular embodiments of from 10 "9 M to 10 "13 M.
  • K D dissociation constant
  • the term can be further used to indicate that the binding domain does not bind to other biomolecules present, (e.g., it binds to other biomolecules with a dissociation constant (KD) of 10 "4 M or more, in particular embodiments of from 10 "4 M to 1 M).
  • KD dissociation constant
  • the anti-EBV antibodies include a human antibody, or an antigen-binding portion thereof (including scFv) that dissociates from EBV gH/gL with a KD of 1X10 "10 or less and a k 0ff rate constant of 3X10 "5 s_ or less, both determined by surface plasmon resonance or biolayer interferometry.
  • AMM01 inhibits fusion of the viral and cellular membranes. This work delineates a critical epitope for the design of next-generation subunit vaccines against this major public health burden.
  • Naturally occurring antibody structural units include a tetramer. Each tetramer includes two pairs of polypeptide chains, each pair having one light chain and one heavy chain.
  • each chain includes a variable region that is responsible for antigen recognition and epitope binding.
  • the variable regions exhibit the same general structure of relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions (CDRs).
  • FR relatively conserved framework regions
  • CDRs complementarity determining regions
  • the CDRs from the two chains of each pair are aligned by the framework regions, which enables binding to a specific epitope.
  • both light and heavy chain variable regions include the domains FR1 , CDR1 , FR2, CDR2, FR3, CDR3 and FR4.
  • each chain defines a constant region that can be responsible for effector function.
  • effector functions include: C1 q binding and complement dependent cytotoxicity (CDC); antibody-dependent cell-mediated cytotoxicity (ADCC); antibody-dependent phagocytosis (ADCP); down regulation of cell surface receptors (e.g. B cell receptors); and B cell activation.
  • variable and constant regions are joined by a "J" region of amino acids, with the heavy chain also including a "D” region of amino acids. See, e.g., Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).
  • Human light chains are classified as kappa and lambda light chains. Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • IgG has several subclasses, including, lgG1 , lgG2, lgG3, and lgG4.
  • IgM has subclasses including lgM1 and lgM2.
  • IgA is similarly subdivided into subclasses including lgA1 and lgA2.
  • antibody includes, in addition to antibodies including two full-length heavy chains and two full-length light chains as described above, variants, derivatives, and fragments thereof, examples of which are described below.
  • antibodies can include monoclonal antibodies, human antibodies, bispecific antibodies, polyclonal antibodies, linear antibodies, minibodies, domain antibodies, synthetic antibodies, chimeric antibodies, antibody fusions, and fragments thereof, respectively.
  • antibodies e.g., full length antibodies
  • monoclonal antibodies refer to antibodies produced by a clone of B cells or hybridoma cells.
  • monoclonal antibodies are identical to each other and/or bind the same epitope, except for possible antibodies containing naturally occurring mutations or mutations arising during production of a monoclonal antibody.
  • polyclonal antibody preparations which include different antibodies directed against different epitopes, each monoclonal antibody of a monoclonal antibody preparation is directed against a single epitope on an antigen.
  • a "human antibody” is one which includes an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences.
  • a "human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
  • the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroup of sequences can be a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91- 3242, Bethesda Md. (1991), vols. 1-3.
  • the subgroup is subgroup kappa I as in Kabat et al., supra.
  • the subgroup is subgroup III as in Kabat et al., supra.
  • an antibody fragment is used.
  • An "antibody fragment” denotes a portion of a complete or full length antibody that retains the ability to bind to an epitope.
  • antibody fragments include Fv, single chain Fv fragments (scFvs), Fab, Fab', Fab'- SH, F(ab')2, diabodies, linear antibodies, Fc, and/or any biologically effective fragments of an immunoglobulin that bind specifically to an epitope described herein.
  • Antibodies or antibody fragments include all or a portion of polyclonal antibodies, monoclonal antibodies, human antibodies, humanized antibodies, synthetic antibodies, chimeric antibodies, bispecific antibodies, mini bodies, and linear antibodies.
  • Binding domains from human origin or humanized antibodies have lowered immunogenicity in humans and have a lower number of non-immunogenic epitopes compared to non-human antibodies. Binding domains will generally be selected to have reduced antigenicity in human subjects. Binding domains can particularly include any peptide that specifically binds a selected epitope.
  • a single chain variable fragment is a fusion protein of the variable regions of the heavy and light chains of immunoglobulins connected with a short linker peptide.
  • Fv fragments include the VL and VH domains of a single arm of an antibody.
  • VL and VH are coded by separate genes, they can be joined, using, for example, recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (single chain Fv (scFv)).
  • a Fab fragment is a monovalent antibody fragment including VL, VH, CL and Cm domains.
  • a F(ab')2 fragment is a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region.
  • Diabodies include two epitope-binding sites that may be bivalent. See, for example, EP 0404097; W01993/01161 ; and Holliger, et al., Proc. Natl. Acad. Sci. USA 90 (1993) 6444-6448.
  • Dual affinity retargeting antibodies (DARTTM; based on the diabody format but featuring a C-terminal disulfide bridge for additional stabilization (Moore et al., Blood 1 17, 4542- 51 (2011)) can also be used.
  • Antibody fragments can also include isolated CDRs. For a review of antibody fragments, see Hudson, et al., Nat. Med. 9 (2003) 129-134.
  • Antibody fragments can be made by various techniques, including proteolytic digestion of an intact antibody as well as production by recombinant host-cells (e.g., human suspension cell lines, E. coli or phage), as described herein. Antibody fragments can be screened for their binding properties in the same manner as intact antibodies.
  • host-cells e.g., human suspension cell lines, E. coli or phage
  • the anti-EBV antibodies are neutralizing antibodies.
  • a neutralizing antibody can refer to an antibody that, upon epitope binding, can reduce biological function of its target antigen.
  • neutralizing antibodies can reduce (i.e., neutralize) EBV infection of cells.
  • neutralizing antibodies can block or neutralize EBV infection of B cells and/or epithelial cells.
  • percent neutralization can refer to a percent decrease in EBV infectivity in the presence of the antibody, as compared to EBV infectivity in the absence of the antibody. For example, if half as many cells in a sample become infected in the presence of an antibody, as compared to in the absence of the antibody, this can be calculated as 50% neutralization.
  • neutralize EBV infection can refer to at least 40% neutralization, at least 50% neutralization, at least 60% neutralization, at least 70% neutralization, at least 80% neutralization, or at least 90% neutralization of EBV infection.
  • the antibodies disclosed herein can block EBV infection (i.e., 100% neutralization).
  • the anti-EBV antibodies can inhibit EBV envelope fusion with target cells (e.g., epithelial cells and/or B cells), which can result in neutralization of EBV infection.
  • Inhibition of EBV envelope fusion to target cells can be at least 40%, inhibition, at least 50%, inhibition, at least 60%, inhibition, at least 70%, inhibition, at least 80%, inhibition, or at least 90%, inhibition, as compared to EBV envelope fusion in the absence of the anti-EBV antibody.
  • the target cells are epithelial cells and/or B cells.
  • the neutralizing antibodies are AMM01 and AMM05.
  • anti-EBV antibodies include CDRs of the light chains and/or heavy chains of one or more of AMM01 , AM M 02, AMM03, AMM04, or AMM05 (see, e.g., FIG. 24 and SEQ ID NOs: 1-10).
  • the anti-EBV antibodies include the CDRs from the light chain and heavy chain of AMM01 (SEQ ID NOs: 1 and 2) or AMM05 (SEQ ID NOs: 9 and 10).
  • an anti-EBV antibody e.g., scFv
  • a variable light chain including an AMM01 CDRL1 sequence including GGHNIGAKNVH (SEQ ID NO: 11), an AMM01 CDRL2 sequence including YDSDRPS (SEQ ID NO: 12), and an AMM01 CDRL3 sequence including CQVWDSGRGHPLYV (SEQ ID NO: 13).
  • an anti-EBV antibody e.g., scFv
  • a variable heavy chain including an AMM01 CDRH1 sequence including YTFIHFGISW (SEQ ID NO: 14), an AMM01 CDRH2 sequence including IDTNNGNTNYAQSLQG (SEQ ID NO: 15), and an AMM01 CDRH3 sequence including RALEMGHRSGFPFDY (SEQ ID NO: 16).
  • an anti-EBV antibody e.g., scFv
  • a variable light chain including an AMM02 CDRL1 sequence including RANLGISDWLA (SEQ ID NO: 17), an AMM02 CDRL2 sequence including AASSLES (SEQ ID NO: 18), and an AMM02 CDRL3 sequence including QQANSFPLS (SEQ ID NO: 19).
  • an anti-EBV antibody e.g., scFv
  • a variable heavy chain including an AMM02 CDRH1 sequence including GPFSTYGIN (SEQ ID NO: 20), an AMM02 CDRH2 sequence including Wl I PVFDTSSFAQ (SEQ ID NO: 21), and an AMM02 CDRH3 sequence including RDRVLGAHGANPLNGHHYGMDV (SEQ ID NO: 22).
  • an anti-EBV antibody e.g., scFv
  • a variable light chain including an AMM03 CDRL1 sequence including SGDKLGEEYVCW (SEQ ID NO: 23), an AMM03 CDRL2 sequence including QDRNRPP (SEQ ID NO: 24), and an AMM03 CDRL3 sequence including QAWDSSTVV (SEQ ID NO: 25).
  • an anti-EBV antibody e.g., scFv
  • a variable heavy chain including an AMM03 CDRH1 sequence including FSLSTSGVGVG (SEQ ID NO: 26), an AMM03 CDRH2 sequence including LIYWHDAARYSPSLRN (SEQ ID NO: 27), and an AMM03 CDRH3 sequence including ADKLYGDSVKFDY (SEQ ID NO: 28).
  • an anti-EBV antibody e.g., scFv
  • a variable light chain including an AMM04 CDRL1 sequence including TSSQSLVNSDGNSFLS (SEQ ID NO: 29), an AMM04 CDRL2 sequence including VSHRDS (SEQ ID NO: 30), and an AMM04 CDRL3 sequence including MQGTYWPPMFTF (SEQ ID NO: 31).
  • an anti-EBV antibody e.g., scFv
  • a variable heavy chain including an AMM04 CDRH1 sequence including ASFSNHGIV (SEQ ID NO: 32), an AMM04 CDRH2 sequence including G!VPIVGGANYAQNFQG (SEQ ID NO: 33), and an AMM04 CDRH3 sequence including DVPGQCTRTTCFNFSSQ (SEQ ID NO: 34).
  • an anti-EBV antibody e.g., scFv
  • a variable light chain including an AMM05 CDRL1 sequence including RASQSVSNNYF (SEQ ID NO: 35), an AMM05 CDRL2 sequence including GISKRATG (SEQ ID NO: 36), and an AMM05 CDRL3 sequence including QQYGNSSPRT (SEQ ID NO: 37).
  • an anti-EBV antibody e.g., scFv
  • a variable heavy chain including an AMM05 CDRH1 sequence including FTFSNYA S (SEQ ID NO: 38), an AMM05 CDRH2 sequence including SISATDGSTYYADSVEG (SEQ ID NO: 39), and an AMM05 CDRH3 sequence including KDGAGDYL (SEQ ID NO: 40).
  • the anti-EBV antibodies include a heavy chain including SEQ ID NO: 1 and a light chain including SEQ ID NO: 2.
  • SEQ ID NO: 1 includes mutation Q1 N.
  • the anti-EBV antibodies include a heavy chain including SEQ ID NO: 3 and a light chain including SEQ ID NO: 4. In particular embodiments, SEQ ID NO: 3 includes mutation Q1 N. [0081] In particular embodiments, the anti-EBV antibodies include a heavy chain including SEQ ID NO: 5 and a light chain including SEQ ID NO: 6. In particular embodiments, SEQ ID NO: 5 includes mutation E1 N. In particular embodiments, SEQ ID NO: 6 includes mutation Q1 N. In particular embodiments, SEQ ID NO: 5 includes mutation E1 N and SEQ ID NO: 6 includes mutation Q1 N.
  • the anti-EBV antibodies include a heavy chain including SEQ ID NO: 7 and a light chain including SEQ ID NO: 8.
  • SEQ ID NO: 7 includes mutation Q1 N.
  • the anti-EBV antibodies include a heavy chain including SEQ ID NO: 9 and a light chain including SEQ ID NO: 10.
  • SEQ ID NO: 9 includes mutation E1 N.
  • SEQ ID NO: 10 includes mutation E1 N.
  • SEQ ID NO: 9 includes mutation E1 N and SEQ ID NO: 10 includes mutation E1 N.
  • the anti-EBV antibodies include a heavy chain including SEQ ID NO: 41 and a light chain including SEQ ID NO: 42 with mutations selected from one or more heavy chain mutations selected from D10E; G76S; S83R; T84S; F91Y; V107T; and P1 13S and/or one or more light chain mutations selected from E3V; Q17K; R18T; T20R; Q49Y; S69N; and G100T.
  • the anti-EBV antibodies include a heavy chain including SEQ ID NO: 41 and a light chain including SEQ ID NO: 42 with heavy chain mutations D10E; G76S; S83R; T84S; F91Y; V107T; and P1 13S and light chain mutations E3V; Q17K; R18T; T20R; Q49Y; S69N; and G100T.
  • a VH region of the present disclosure can be derived from or based on a VH of an AMMO antibody and can include one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions or non-conservative amino acid substitutions), or a combination of the above-noted changes, when compared with the V H of an AMMO antibody.
  • An insertion, deletion or substitution may be anywhere in the V H region, including at the amino- or carboxy-terminus or both ends of this region, provided that each CDR includes zero changes or at most one, two, or three changes and provided a modified VH can still specifically bind its target epitope with an affinity similar to the wild type AMMO V H .
  • a VL region of the present disclosure can be derived from or based on a VL of an AMMO antibody and can include one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions), or a combination of the above-noted changes, when compared with the VL of an AMMO antibody.
  • one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions
  • amino acid substitutions e.g., conservative amino acid substitutions
  • An insertion, deletion or substitution may be anywhere in the VL region, including at the amino- or carboxy- terminus or both ends of this region, provided that each CDR includes zero changes or at most one, two, or three changes and provided a modified VL can still specifically bind its target epitope with an affinity similar to the wild type AMMO VL.
  • an antibody variant includes or is a sequence that has at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to an antibody sequence disclosed herein.
  • an antibody variant includes or is a sequence that has at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to a light chain variable region (VL) and/or to a heavy chain variable region (VH), or both, wherein each CDR includes zero changes or at most one, two, or three changes, from the reference antibody disclosed herein or fragment thereof that binds to a targeted EBV epitope.
  • VL light chain variable region
  • VH heavy chain variable region
  • an antibody variant includes or is a sequence that has at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to the CDRs of an antibody disclosed herein (AMM01-AMM05).
  • antibodies bind epitopes on antigens.
  • An antigen refers to a molecule or a portion of a molecule capable of being bound by an antibody.
  • An epitope is a region of an antigen that is bound by the variable region of an antibody.
  • An epitope includes specific amino acids that contact the variable region of an antibody.
  • Epitope determinants can include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and can have specific three dimensional structural characteristics, and/or specific charge characteristics.
  • An "epitope” includes any determinant capable of being bound by an antigen-binding protein, such as an antibody.
  • An epitope is a region of molecule that is bound by a binding protein that targets that region of molecule, and when that region of molecule is a protein, includes specific residues that directly contact the binding protein.
  • an "epitope” denotes the binding site on a protein target bound by a corresponding binding domain.
  • the binding domain either binds to a linear epitope, (e.g., an epitope including a stretch of 5 to 12 consecutive amino acids), or the binding domain binds to a three-dimensional structure formed by the spatial arrangement of several short stretches of the protein target.
  • Three-dimensional epitopes recognized by a binding domain can be thought of as three-dimensional surface features of an epitope molecule. These features fit precisely (in)to the corresponding binding site of the binding domain and thereby binding between the binding domain and its target protein is facilitated.
  • an epitope can be considered to have two levels: (i) the "covered patch" which can be thought of as the shadow an antibody or binding domain would cast; and (ii) the individual participating side chains and backbone residues. Binding is then due to the aggregate of ionic interactions, hydrogen bonds, and hydrophobic interactions.
  • the EBV epitopes targeted by the antibodies disclosed herein are present on envelope glycoprotein H (gH, see, e.g., SEQ ID NO: 51), envelope glycoprotein L (gl_, see, e.g., SEQ ID NO: 52), and/or glycoprotein B (gB, see, e.g., SEQ ID NO: 53).
  • gH, gl_, and gB are glycoproteins expressed by EBV that can form complexes together and are important for virus entry into cells.
  • the EBV epitope includes gH/gL, which is a heterodimer of gH and gl_ that binds to glycoprotein 42 (gp42, SEQ ID NO: 54) to form a trimer on the surface of EBV virions.
  • the EBV epitope bridges the D-l/D-ll groove, and encompasses the linker helix of the gH/gL complex. Description of the D-l and D-ll domains can be found in Matsuura, et al., Proc. Natl. Acad. Sci. USA 107 (2010) 22641-22646.
  • the EBV antibody binds to an epitope on gH/gL that includes one or more of amino acids 60, 70-81 , 21 1-216, and 234-239 of gH; and/or one or more of amino acids 123-128 of gL.
  • the anti-EBV antibody binds residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine.
  • an antibody disclosed herein binds to a gH/gL epitope, it competes for binding with CL40.
  • CL40 is a neutralizing anti-EBV antibody that binds to an epitope of gH/gL.
  • an anti-EBV antibody e.g., AMM01
  • the EBV therapeutics include EBV vaccines.
  • the EBV vaccines can include an EBV antigen with a vulnerable EBV epitope such as those described herein.
  • the EBV vaccines include an EBV antigen that includes a gH/gL complex, and/or a D-l/D-ll groove and the DI/DII linker helix of a gH/gL complex.
  • the EBV vaccines include an AMM01 epitope.
  • An AMM01 epitope can refer to the gH/gL residues that are bound by the antibody AMM01.
  • Examples of AMM01 epitope residues include: gH residues 60, 70-81 , 21 1-216, and 234-239; and gL residues 123-128.
  • examples of AMM01 epitopes include residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine.
  • the EBV vaccines include an AMM05 epitope.
  • An AMM05 epitope is a region of gB that is capable of binding to AMM05.
  • the EBV vaccine can include a subunit vaccine.
  • a subunit vaccine can refer to a vaccine that does not contain a whole live or killed pathogen, but only a subunit (e.g., a single protein or protein fragment) of the pathogen that stimulates an immune response against the pathogen.
  • the EBV subunits vaccines can include vaccine proteins including (i) gH/gL or a fragment of gH/gL that binds to AMM01 ; and/or (ii) gB or a fragment of gB that binds to AMM05.
  • the EBV therapeutics include immunogenic proteins.
  • An immunogenic protein can, for example, be used to elicit an antibody response in a subject.
  • the immunogenic proteins include one or more AMMO epitopes.
  • An AMMO epitope is an epitope bound by an AMMO antibody described herein.
  • an immunogenic protein includes one or more of: an AMM01 epitope, an AMM02 epitope, an AMM03 epitope, an AMM04 epitope, and/or an AMM05 epitope.
  • EBV therapeutics can include multimerization domains.
  • Multimerization domains can allow for multimerization of the EBV vaccine proteins and/or immunogenic proteins, which can enhance their immunogenicity.
  • the multimerization domain is C4b multimerization domain.
  • C4 binding protein (C4b) is the major inhibitor of the classical complement and lectin pathway. The complement system is a major part of innate immunity and is the first line of defense against invading microorganisms. Orchestrated by more than 60 proteins, its major task is to discriminate between host cells and pathogens and to initiate immune responses when necessary. It also recognizes necrotic or apoptotic cells. Hofmeyer et al., J Mol Biol. 2013 Apr 26;425(8): 1302-17.
  • Full-length native C4b includes seven a-chains linked together by a multimerization (i.e., heptamerization) domain at the C-terminus of the a-chains. Blom et al., (2004) Mol Immunol 40: 1333-1346. One of the ⁇ -chains can be replaced by a ⁇ -chain in humans.
  • the wild-type C4b multimerization domain is 57 amino acid residues in humans and 54 amino acid residues in mice.
  • C4b multimerization domains examples include:
  • the C4b multimerization domain will be a multimerization domain which includes (i) glycine at position 12, (ii) alanine at position 28, (iii) leucines at positions 29, 34, 36, and/or 41 ; (iv) tyrosine at position 32; (v) lysine at position 33; and/or (vi) cysteine at positions 6 and 18.
  • the C4b multimerization domain will be a multimerization domain which includes (i) glycine at position 12, (ii) alanine at position 28, (iii) leucines at positions 29, 34, 36, and 41 ; (iv) tyrosine at position 32; (v) lysine at position 33; and (vi) cysteine at positions 6 and 18.
  • C4b multimerization domains can include any of SEQ ID NOs: 55-59 with an N-terminal deletion of at least 1 consecutive amino acid residues (e.g. at least 2, 3, 4, 5, 6, 7, 8, 9, 10 consecutive amino acid residues) in length. Additional embodiments can include a C-terminal deletion of at least 1 consecutive amino acid residues (e.g. at least 2, 3, 4, 5, 6, 7, 8, 9, 10 consecutive amino acid residues) in length.
  • Particular C4b multimerization domain embodiments will retain or will be modified to include at least 1 of the following residues: A6; E11 ; A13; D21 ; C22; P25; A27; E28; L29; R30; T31 ; L32; L33; E34; I35; K37; L38; L40; E41 ; I42; Q43; K44; L45; E48; L49; or Q50.
  • the anti-EBV antibodies or EBV vaccine proteins are produced from a gene using a protein expression system.
  • Protein expression systems can utilize DNA constructs (e.g., chimeric genes, expression cassettes, expression vectors, recombination vectors) including a nucleic acid sequence encoding the protein or proteins of interest operatively linked to appropriate regulatory sequences.
  • DNA constructs are not naturally-occurring DNA molecules and are useful for introducing DNA into host-cells to express selected proteins of interest.
  • a DNA construct that encodes an anti-EBV antibody or vaccine protein can be inserted into cells (e.g., bacterial, mammalian, insect, etc.), which can produce the anti-EBV antibody or vaccine protein encoded by the DNA construct.
  • Operatively linked refers to the linking of DNA sequences (including the order of the sequences, the orientation of the sequences, and the relative spacing of the various sequences) in such a manner that the encoded protein is expressed. Methods of operatively linking expression control sequences to coding sequences are well known in the art. See, e.g., Maniatis et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor, N. Y., 1982; and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor, N. Y., 1989.
  • Expression control sequences are DNA sequences involved in any way in the control of transcription or translation. Suitable expression control sequences and methods of making and using them are well known in the art. Expression control sequences generally include a promoter.
  • the promoter may be inducible or constitutive. It may be naturally-occurring, may be composed of portions of various naturally-occurring promoters, or may be partially or totally synthetic. Guidance for the design of promoters is provided by studies of promoter structure, such as that of Harley and Reynolds, Nucleic Acids Res., 15, 2343-2361 , 1987. Also, the location of the promoter relative to the transcription start may be optimized. See, e.g., Roberts et al., Proc. Natl. Acad. Sci. USA, 76:760-764, 1979.
  • the promoter may include, or be modified to include, one or more enhancer elements.
  • the promoter will include a plurality of enhancer elements. Promoters including enhancer elements can provide for higher levels of transcription as compared to promoters that do not include them.
  • the coding sequences can be operatively linked to a 3' untranslated sequence.
  • the 3' untranslated sequence can include a transcription termination sequence and a polyadenylation sequence.
  • the 3' untranslated region can be obtained, for example, from the flanking regions of genes.
  • a 5' untranslated leader sequence can also be employed.
  • the 5' untranslated leader sequence is the portion of an mRNA that extends from the 5' CAP site to the translation initiation codon.
  • a "hisavi” tag can be added to the N-terminus or C-terminus of a gene by the addition of nucleotides coding for the Avitag amino acid sequence, "GLNDIFEAQKIEWHE” (SEQ ID NO: 60), as well as the 6xhistidine tag ⁇ " (SEQ ID NO: 61).
  • the Avitag avidity tag can be biotinylated by a biotin ligase to allow for biotin-avidin or biotin- streptavidin based interactions for protein purification, as well as for immunobiology (such as immunoblotting or immunofluorescence) using anti-biotin antibodies.
  • anti-EBV antibodies and/or EBV therapeutics disclosed herein can be produced using, for example, human suspension cells and/or the Daedalus expression system as described in Pechman et al., Am J Physiol 294: R1234-R1239, 2008.
  • the Daedalus system utilizes inclusion of minimized ubiquitous chromatin opening elements in transduction vectors to reduce or prevent genomic silencing and to help maintain the stability of decigram levels of expression. This system can bypass tedious and time-consuming steps of other protein production methods by employing the secretion pathway of serum-free adapted human suspension cell lines, such as 293 Freestyle.
  • the DNA constructs can be introduced by transfection, a technique that involves introduction of foreign DNA into the nucleus of eukaryotic cells.
  • the proteins can be synthesized by transient transfection (DNA does not integrate with the genome of the eukaryotic cells, but the genes are expressed for 24-96 hours).
  • Various methods can be used to introduce the foreign DNA into the host-cells, and transfection can be achieved by chemical-based means including by the calcium phosphate, by dendrimers, by liposomes, and by the use of cationic polymers.
  • Non-chemical methods of transfection include electroporation, sono-poration, optical transfection, protoplast fusion, impalefection, and hydrodynamic delivery.
  • transfection can be achieved by particle-based methods including gene gun where the DNA construct is coupled to a nanoparticle of an inert solid which is then "shot" directly into the target-cell's nucleus.
  • particle-based transfection methods include magnet assisted transfection and impalefection.
  • Nucleic acid sequences encoding proteins disclosed herein can be derived by those of ordinary skill in the art. Nucleic acid sequences can also include one or more of various sequence polymorphisms, mutations, and/or sequence variants (e.g., splice variants or codon optimized variants). In particular embodiments, the sequence polymorphisms, mutations, and/or sequence variants do not affect the function of the encoded protein.
  • variants or proteins disclosed herein can be modified to produce an administration benefit.
  • exemplary administration benefits can include (1) reduced susceptibility to proteolysis, (2) reduced susceptibility to oxidation, (3) altered binding affinity for forming protein complexes, (4) altered binding affinities, (5) reduced immunogenicity; and/or (6) extended half-life.
  • one or more amino acid modifications may be introduced into the Fc region of an antibody, thereby generating an Fc region variant.
  • the Fc region variant may include a human Fc region sequence (e.g., a human lgG1 , lgG2, lgG3 or lgG4 Fc region) including an amino acid modification (e.g. a substitution) at one or more amino acid positions.
  • the antibodies can be mutated to increase their binding to Fc receptors.
  • Antibodies can contain Fc regions that, upon epitope-engagement, can bind to Fc Receptors that are expressed, for example, by phagocytes.
  • an antibody variant includes an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
  • alterations are made in the Fc region that result in altered C1 q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in U.S. Pat. No. 6,194,551 , WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178- 4184 (2000).
  • CDC Complement Dependent Cytotoxicity
  • the anti-EBV antibodies or vaccine proteins can include amino acid mutations that increase the half-life of the antibodies in serum.
  • M428L/N434S is a pair of mutations that increase the half-life of antibodies in serum, as described in Zalevsky et al., Nature Biotechnology 28, 157-159 (2010).
  • anti-EBV antibodies can be mutated to lower the immunogenicity of the antibody.
  • human antibodies can have somatic mutations in the framework region that induce immunogenicity, and these mutations can be reverted back to the germline sequence to decrease the immunogenicity of the antibody.
  • cysteine engineered antibodies e.g., "thioMAbs”
  • one or more residues of an antibody are substituted with cysteine residues.
  • the substituted residues occur at accessible sites of the antibody.
  • reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further below.
  • residue 5400 (EU numbering) of the heavy chain Fc region is selected.
  • Cysteine engineered antibodies may be generated as described, e.g., in U.S. Pat. No. 7,521 ,541.
  • antibody variants having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region.
  • the amount of fucose in such antibody may be from 1 % to 80%, from 1 % to 65%, from 5% to 65% or from 20% to 40%.
  • the amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e.g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example.
  • Asn297 refers to the asparagine residue located at position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located ⁇ 3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function.
  • Examples of cell lines capable of producing defucosylated antibodies include Led 3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986)), and knockout cell lines, such as alpha-1 ,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107).
  • modified anti-EBV antibodies or EBV vaccine proteins include those wherein one or more amino acids have been replaced with a non-amino acid component, or where the amino acid has been conjugated to a functional group or a functional group has been otherwise associated with an amino acid.
  • the modified amino acid may be, e.g., a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, or an amino acid conjugated to an organic derivatizing agent.
  • Amino acid(s) can be modified, for example, co-translationally or post-translationally during recombinant production (e.g., N-linked glycosylation at N-X-S/T motifs during expression in mammalian cells) or modified by synthetic means.
  • the modified amino acid can be within the sequence or at the terminal end of a sequence. Modifications also include nitrited proteins.
  • PEGylation particularly is a process by which polyethylene glycol (PEG) polymer chains are covalently conjugated to other molecules such as proteins. Several methods of PEGylating proteins have been reported in the literature.
  • N-hydroxy succinimide (NHS)-PEG was used to PEGylate the free amine groups of lysine residues and N-terminus of proteins; PEGs bearing aldehyde groups have been used to PEGylate the amino-termini of proteins in the presence of a reducing reagent; PEGs with maleimide functional groups have been used for selectively PEGylating the free thiol groups of cysteine residues in proteins; and site- specific PEGylation of acetyl-phenylalanine residues can be performed.
  • NHS N-hydroxy succinimide
  • PEGylation can also decrease protein aggregation (Suzuki et al., Biochem. Bioph. Acta vol. 788, pg. 248 (1984)), alter protein immunogenicity (Abuchowski et al.; J. Biol. Chem. vol. 252 pg. 3582 (1977)), and increase protein solubility as described, for example, in PCT Publication No. WO 92/16221).
  • PEGs are commercially available (Nektar Advanced PEGylation Catalog 2005-2006; and NOF DDS Catalogue Ver 7.1), which are suitable for producing proteins with targeted circulating half-lives.
  • active PEGs have been used including mPEG succinimidyl succinate, mPEG succinimidyl carbonate, and PEG aldehydes, such as mPEG- propionaldehyde.
  • the anti-EBV antibodies or EBV vaccine proteins can be linked to human serum albumin (HSA).
  • HSA human serum albumin
  • Linkage to HSA can increase the size of the protein and can increase serum half-life.
  • An HSA-linkage can increase antibody or vaccine protein half-life without altering the binding and/or activity of the antibody or vaccine protein.
  • anti-EBV antibodies bind tumor cells expressing EBV antigens for diagnosis (e.g., imaging) or treatment.
  • EBV antibodies can be conjugated to an enzyme label, a colored label, a cytostatic agent, a label that can be photoactivated and which is suitable for use in photodynamic therapy, haptens, digoxigenin, biotin, or a chemotherapeutic agent.
  • Exemplary conjugation partners include enzyme labels such as alkaline phosphatase, horseradish peroxidase, and ⁇ -galactosidase; therapeutically active agents such as radionuclides, toxins, small organic molecules, and therapeutic peptides; toxins such as pertussis- toxin, diphtheria toxin, ricin, saporin, pseudomonas exotoxin, calicheamicin, taxoids, maytansinoids, tubulysins and dolastatin or dolastatin analogues (e.g., auristatin E, monomethylauristatin E, auristatin PYE and auristatin PHE); cytostatic or chemotherapeutic agents such as Abiraterone, Adriamycine, Anthracycline (Doxorubicin), Azacitidine, Azathioprine, Beuacizumab, Bortezomib, Bleomycin, Capecitabine, Camptotecine
  • nucleic acids encoding antibodies disclosed herein can be delivered into cells for therapeutic expression, for example, within a subject. These embodiments may be referred to as "gene editing or vectored immunoprophylaxis”. Nucleic acids can be delivered into, for example, B cells using gene editing systems and/or viral vector systems.
  • Gene editing systems include typically include a targeting molecule for precise targeting of a portion of a genome to be edited and a cutting molecule for cutting the targeted genetic site.
  • Guide RNA is one example of a targeting molecule while various nucleases provide examples of cutting molecules.
  • the systems can also include a homology-directed repair template (which can include homology arms) associated with the nucleic acid encoding the antibody or vaccine antigen (or fragment thereof).
  • a homology-directed repair template which can include homology arms
  • ZFNs zinc finger nucleases
  • ZFNs are a class of site-specific nucleases engineered to bind and cleave DNA at specific positions.
  • ZFNs are used to introduce double strand breaks (DSBs) at a specific site in a DNA sequence which enables the ZFNs to target unique sequences within a genome in a variety of different cells.
  • DSBs double strand breaks
  • HDR homology-directed repair
  • ZFNs are synthesized by fusing a zinc finger DNA-binding domain to a DNA cleavage domain.
  • the DNA-binding domain includes three to six zinc finger proteins which are transcription factors.
  • the DNA cleavage domain includes the catalytic domain of, for example, Fokl endonuclease.
  • the Fokl domain functions as a dimer requiring two constructs with unique DNA binding domains for sites on the target sequence.
  • the Fokl cleavage domain cleaves within a five or six base pair spacer sequence separating the two inverted half-sites.
  • TALENs transcription activator like effector nucleases
  • TALE transcription activator-like effector
  • TALENs are used to edit genes and genomes by inducing DSBs in the DNA, which induce repair mechanisms in cells.
  • two TALENs must bind and flank each side of the target DNA site for the DNA cleavage domain to dimerize and induce a DSB. The DSB can then be repaired in the cell by HDR with an exogenous double-stranded donor DNA fragment.
  • TALENs have been engineered to bind a target sequence of, for example, an endogenous genome, and cut DNA at the location of the target sequence.
  • the TALEs of TALENs are DNA binding proteins secreted by Xanthomonas bacteria.
  • the DNA binding domain of TALEs include a highly conserved 33 or 34 amino acid repeat, with divergent residues at the 12 th and 13 th positions of each repeat. These two positions, referred to as the Repeat Variable Diresidue (RVD), show a strong correlation with specific nucleotide recognition. Accordingly, targeting specificity can be improved by changing the amino acids in the RVD and incorporating nonconventional RVD amino acids.
  • RVD Repeat Variable Diresidue
  • DNA cleavage domains that can be used in TALEN fusions are wild-type and variant Fokl endonucleases.
  • Boch et al. Science 326, 1509-1512 (2009); Moscou, & Bogdanove, Science 326, 1501 (2009); Christian, et al. Genetics 186, 757-761 (2010); and Miller, et al. Nature biotechnology 29, 143-148 (201 1).
  • MegaTALs have a single chain rare-cleaving nuclease structure in which a TALE is fused with the DNA cleavage domain of a meganuclease.
  • Meganucleases also known as homing endonucleases, are single peptide chains that have both DNA recognition and nuclease function in the same domain. In contrast to the TALEN, the megaTAL only requires the delivery of a single peptide chain for functional activity.
  • CRISPR gene editing systems may be used.
  • the CRISPR nuclease system is a prokaryotic immune system that confers resistance to foreign genetic elements such as plasmids and phages and provides a form of acquired immunity.
  • CRISPRs are DNA loci containing short repetitions of base sequences. In the context of a prokaryotic immune system, each repetition is followed by short segments of spacer DNA belonging to foreign genetic elements that the prokaryote was exposed to.
  • This CRISPR array of repeats interspersed with spacers can be transcribed into RNA.
  • the RNA can be processed to a mature form and associate with a cas (CRISPR-associated) nuclease.
  • a CRISPR-Cas system including an RNA having a sequence that can hybridize to the foreign genetic elements and Cas nuclease can then recognize and cut these exogenous genetic elements in the genome.
  • a CRISPR-Cas system does not require the generation of customized proteins to target specific sequences, but rather a single Cas enzyme can be programmed by a short guide RNA molecule to recognize a specific DNA target (crRNA).
  • crRNA DNA target
  • a classification of CRISPR-Cas systems is proposed in which these systems are broadly divided into two classes, Class 1 with multi- subunit effector complexes and Class 2 with single-subunit effector modules exemplified by the Cas9 protein.
  • Class 1 and Class 2 CRISPR-Cas systems more recently a putative Class 2, Type V CRISPR-Cas class exemplified by Cpf1 has been identified.
  • the Cpf1 nuclease particularly can provide added flexibility in target site selection by means of a short, three base pair recognition sequence (TTN), known as the protospacer- adjacent motif or PAM.
  • TTN the protospacer- adjacent motif
  • PAM protospacer- adjacent motif
  • Cpfl's cut site is at least 18bp away from the PAM sequence, thus the enzyme can repeatedly cut a specified locus after indel (insertion and deletion) formation, increasing the efficiency of HDR.
  • staggered DSBs with sticky ends permit orientation- specific donor template insertion, which is advantageous in non-dividing cells.
  • CRISPR-Cas systems and components thereof are described in, US8697359, US8771945, US8795965, US8865406, US8871445, US8889356, US8889418, US8895308, US8906616, US8932814, US8945839, US8993233 and US8999641 and applications related thereto; and WO2014/018423, WO2014/093595, WO2014/093622, WO2014/093635, WO2014/093655, WO2014/093661 , WO2014/093694, WO2014/093701 , WO2014/093709, WO2014/093712, WO2014/093718, WO2014/145599, WO2014/204723, WO2014/204724, WO2014/204725, WO2014/204726, WO2014/204727, WO2014/204728, WO2014/204729, WO2015/065964, WO2015/08
  • Nucleic acids encoding antibodies or vaccine antigens (or fragments thereof) can also be delivered into, for example, B cells using viral vector systems.
  • the use of RNA or DNA viral based systems for the delivery of nucleic acids takes advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus.
  • Viral vectors can be administered directly to patients (in vivo) or they can be used to treat cells in vitro, and the modified cells may optionally be administered to patients (ex vivo).
  • Conventional viral based systems could include retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues.
  • Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system would therefore depend on the target tissue. Retroviral vectors include cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression.
  • Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J. Virol. 66:1635-1640); Sommnerfelt et al., Virol. 176:58-59 (1990); Wilson et al., J. Virol. 63:2374-2378 (1989); Miller et al., J. Virol. 65:2220-2224 (1991); PCT/US94/05700).
  • MiLV murine leukemia virus
  • GaLV gibbon ape leukemia virus
  • SIV Simian Immuno deficiency virus
  • HAV human immuno deficiency virus
  • adenoviral based systems may be used.
  • Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system.
  • Adeno- associated virus (“AAV”) vectors may also be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. No.
  • EBV therapeutics can be formulated alone or in combination into compositions for administration to subjects.
  • the EBV therapeutics e.g., anti-EBV antibodies (whether in single or conjugated form) or EBV vaccines
  • an immunogenic composition refers to an agent that stimulates an innate and/or an adaptive immune response in a subject.
  • Salts and/or pro-drugs of EBV therapeutics can also be used.
  • a pharmaceutically acceptable salt includes any salt that retains the activity of the EBV therapeutic and is acceptable for pharmaceutical use.
  • a pharmaceutically acceptable salt also refers to any salt which may form in vivo as a result of administration of an acid, another salt, or a prodrug which is converted into an acid or salt.
  • Suitable pharmaceutically acceptable acid addition salts can be prepared from an inorganic acid or an organic acid.
  • inorganic acids are hydrochloric, hydrobromic, hydroiodic, nitric, carbonic, sulfuric and phosphoric acid.
  • Appropriate organic acids can be selected from aliphatic, cycloaliphatic, aromatic, arylaliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids.
  • Suitable pharmaceutically acceptable base addition salts include metallic salts made from aluminum, calcium, lithium, magnesium, potassium, sodium and zinc or organic salts made from ⁇ , ⁇ '-dibenzylethylene-diamine, chloroprocaine, choline, diethanolamine, ethylenediamine, N- methylglucamine, lysine, arginine and procaine.
  • compositions disclosed herein include an EBV therapeutic of at least 0.1 % w/v or w/w of the composition; at least 1 % w/v or w/w of composition; at least 10% w/v or w/w of composition; at least 20% w/v or w/w of composition; at least 30% w/v or w/w of composition; at least 40% w/v or w/w of composition; at least 50% w/v or w/w of composition; at least 60% w/v or w/w of composition; at least 70% w/v or w/w of composition; at least 80% w/v or w/w of composition; at least 90% w/v or w/w of composition; at least 95% w/v or w/
  • the amount of genetically modified cells within a composition can be greater than 10 2 cells, greater than 10 3 cells, greater than 10 4 cells, greater than 10 5 cells, greater than 10 6 cells, greater than 10 7 cells, greater than 10 8 cells, greater than 10 9 cells, greater than 10 10 cells, or greater than 10 11 cells.
  • Exemplary carriers for compositions include saline, buffered saline, physiological saline, water, Hanks' solution, Ringer's solution, Nonnosol-R (Abbott Labs), Plasma-Lyte A® (Baxter Laboratories, Inc., Morton Grove, IL), glycerol, ethanol, and combinations thereof.
  • Exemplary generally used pharmaceutically acceptable carriers include any and all absorption delaying agents, antioxidants, binders, buffering agents, bulking agents or fillers, chelating agents, coatings, disintegration agents, dispersion media, gels, isotonic agents, lubricants, preservatives, salts, solvents or co-solvents, stabilizers, surfactants, and/or delivery vehicles.
  • antioxidants include ascorbic acid, methionine, and vitamin E.
  • Exemplary buffering agents include citrate buffers, succinate buffers, tartrate buffers, fumarate buffers, gluconate buffers, oxalate buffers, lactate buffers, acetate buffers, phosphate buffers, histidine buffers, and/or trimethylamine salts.
  • An exemplary chelating agent is EDTA.
  • Exemplary isotonic agents include polyhydric sugar alcohols including trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol, or mannitol.
  • Exemplary preservatives include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben, octadecyldimethylbenzyl ammonium chloride, benzalkonium halides, hexamethonium chloride, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, and 3-pentanol.
  • Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which solubilizes the EBV therapeutic or helps to prevent denaturation or adherence to the container wall.
  • Typical stabilizers can include polyhydric sugar alcohols; amino acids, such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, and threonine; organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol, and cyclitols, such as inositol; PEG; amino acid polymers; sulfur-containing reducing agents, such as urea, glutathione,
  • compositions disclosed herein can be formulated for administration by, for example, injection, inhalation, infusion, perfusion, lavage, or ingestion.
  • the compositions disclosed herein can further be formulated for intravenous, intradermal, intraarterial, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intravesicular, oral and/or subcutaneous administration and more particularly by intravenous, intradermal, intraarterial, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, intrathecal, intratumoral, intramuscular, intravesicular, and/or subcutaneous injection.
  • compositions can be formulated as aqueous solutions, such as in buffers including Hanks' solution, Ringer's solution, or physiological saline.
  • aqueous solutions can include formulatory agents such as suspending, stabilizing, and/or dispersing agents.
  • the formulation can be in lyophilized and/or powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
  • compositions can be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like.
  • suitable excipients include binders (gum tragacanth, acacia, cornstarch, gelatin), fillers such as sugars, e.g., lactose, sucrose, mannitol and sorbitol; dicalcium phosphate, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate; cellulose preparations such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxy-methylcellulose, and/or polyvinylpyrrolidone (PVP); granulating agents; and binding agents.
  • binders gaum tragacanth, acacia, cornstarch, gelatin
  • fillers such as sugars, e.g., lacto
  • disintegrating agents can be added, such as corn starch, potato starch, alginic acid, cross-linked polyvinylpyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
  • solid dosage forms can be sugar-coated or enteric-coated using standard techniques. Flavoring agents, such as peppermint, oil of wintergreen, cherry flavoring, orange flavoring, etc. can also be used.
  • compositions can be formulated as an aerosol.
  • the aerosol is provided as part of an anhydrous, liquid or dry powder inhaler.
  • Aerosol sprays from pressurized packs or nebulizers can also be used with a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
  • a dosage unit may be determined by providing a valve to deliver a metered amount.
  • Capsules and cartridges of gelatin for use in an inhaler or insufflator may also be formulated including a powder mix of EBV therapeutic composition and a suitable powder base such as lactose or starch.
  • compositions can also be formulated as depot preparations.
  • Depot preparations can be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salts.
  • compositions can be formulated as sustained-release systems utilizing semipermeable matrices of solid polymers including at least one EBV therapeutic.
  • sustained-release materials have been established and are well known by those of ordinary skill in the art.
  • Sustained-release systems may, depending on their chemical nature, release one or more EBV therapeutics following administration for a few weeks up to over 100 days.
  • Depot preparations can be administered by injection; parenteral injection; instillation; or implantation into soft tissues, a body cavity, or occasionally into a blood vessel with injection through fine needles.
  • Depot formulations can include a variety of bioerodible polymers including poly(lactide), poly(glycolide), poly(caprolactone) and poly(lactide)-co(glycolide) (PLG) of desirable lactide:glycolide ratios, average molecular weights, polydispersities, and terminal group chemistries. Blending different polymer types in different ratios using various grades can result in characteristics that borrow from each of the contributing polymers.
  • solvents for example, dichloromethane, chloroform, ethyl acetate, triacetin, N-methyl pyrrolidone, tetrahydrofuran, phenol, or combinations thereof
  • Other useful solvents include water, ethanol, dimethyl sulfoxide (DMSO), N-methyl-2-pyrrolidone (NMP), acetone, methanol, isopropyl alcohol (I PA), ethyl benzoate, and benzyl benzoate.
  • Exemplary release modifiers can include surfactants, detergents, internal phase viscosity enhancers, complexing agents, surface active molecules, co-solvents, chelators, stabilizers, derivatives of cellulose, (hydroxypropyl)methyl cellulose (HPMC), HPMC acetate, cellulose acetate, pluronics (e.g., F68/F127), polysorbates, Span® (Croda Americas, Wilmington, Delaware), polyvinyl alcohol) (PVA), Brij® (Croda Americas, Wilmington, Delaware), sucrose acetate isobutyrate (SAIB), salts, and buffers.
  • surfactants e.g., hydroxypropyl)methyl cellulose (HPMC), HPMC acetate, cellulose acetate, pluronics (e.g., F68/F127), polysorbates, Span® (Croda Americas, Wilmington, Delaware), polyvinyl alcohol) (PVA), Brij® (Croda Americas, Wilmington, Delaware), sucrose
  • Excipients that partition into the external phase boundary of micro particles such as surfactants including polysorbates, dioctylsulfosuccinates, poloxamers, PVA, can also alter properties including particle stability and erosion rates, hydration and channel structure, interfacial transport, and kinetics in a favorable manner.
  • Additional processing of the disclosed sustained release depot formulations can utilize stabilizing excipients including mannitol, sucrose, trehalose, and glycine with other components such as polysorbates, PVAs, and dioctylsulfosuccinates in buffers such as Tris, citrate, or histidine.
  • a freeze-dry cycle can also be used to produce very low moisture powders that reconstitute to similar size and performance characteristics of the original suspension.
  • compositions disclosed herein can advantageously include any other pharmaceutically acceptable carriers which include those that do not produce significantly adverse, allergic, or other untoward reactions that outweigh the benefit of administration.
  • exemplary pharmaceutically acceptable carriers and formulations are disclosed in Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990.
  • formulations can be prepared to meet sterility, pyrogenicity, general safety, and purity standards as required by U.S. FDA Office of Biological Standards and/or other relevant foreign regulatory agencies.
  • kits including one or more containers including one or more of the anti-EBV antibodies, EBV vaccines, modified cells, EBV therapeutics, drug and/or imaging conjugates, and/or compositions and/or adjuvants described herein.
  • containers including one or more of the anti-EBV antibodies, EBV vaccines, modified cells, EBV therapeutics, drug and/or imaging conjugates, and/or compositions and/or adjuvants described herein.
  • Associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use, or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use, or sale for human administration.
  • kits include: AMM01 , and/or AMM05; AMM01-5; a vaccine antigen AMM01 epitope; AMM01 and a vaccine antigen AMM01 epitope; a vaccine antigen AMM05 epitope; AMM05 and vaccine antigen AMM05 epitope; and/or AMM01 , AMM05, a vaccine antigen AMM01 epitope and a vaccine antigen AMM05 epitope.
  • kits including a vaccine antigen AMM01 epitope and/or a vaccine antigen AMM05 epitope further include one or more vaccine adjuvants.
  • Methods disclosed herein include treating subjects (e.g., humans, veterinary animals (dogs, cats, reptiles, birds) livestock (e.g., horses, cattle, goats, pigs, chickens) and research animals (e.g., monkeys, rats, mice, fish) with compositions disclosed herein. Treating subjects includes delivering therapeutically effective amounts. Therapeutically effective amounts include those that provide effective amounts, prophylactic treatments and/or therapeutic treatments.
  • an "effective amount” is the amount of a composition necessary to result in a desired physiological change in the subject.
  • an effective amount can provide an immunogenic effect.
  • Effective amounts are often administered for research purposes. Effective amounts disclosed herein can cause a statistically-significant effect in an in vitro assay, an animal model or clinical study relevant to the assessment of an infection's development, progression, and/or resolution, as well as the effects of the infection.
  • An immunogenic composition can be provided in an effective amount, wherein the effective amount stimulates an immune response.
  • a prophylactic treatment includes a treatment administered to a subject who does not display signs or symptoms of an infection or displays only early signs or symptoms of an infection such that treatment is administered for the purpose of diminishing or decreasing the risk of developing the infection further.
  • a prophylactic treatment functions as a preventative treatment against an infection and/or the potential effects of an infection (e.g., IM, a lymphoproliferative disorder (e.g., Hodgkin lymphoma, non-Hodgkin lymphoma, Burkitt lymphoma, T cell lymphoma, lymphoproliferative disease), a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor).
  • an infection e.g., IM, a lymphoproliferative disorder (e.g., Hodgkin lymphoma, non-Hodgkin lymphoma, Burkitt lymphoma, T cell lymphoma, lymphoproliferative disease), a carcinoma
  • a prophylactic treatment can prevent, delay, or reduce the risk of primary infection with a virus.
  • primary infection can refer to when an EBV seronegative individual first becomes infected by EBV and therefore becomes EBV seropositive.
  • seropositive requires a subject's serum to include different antibodies that bind with multiple and different EBV proteins.
  • Primary infection can result in IM.
  • a prophylactic treatment can be given prior to treatment with an immunosuppressant (such as prior to an organ or cell-based transplant or before chemotherapy or ionizing radiation).
  • a prophylactic treatment can prevent or reduce the severity of a lymphoproliferative disorder that may result from EBV primary infection during immunosuppression.
  • prophylactic treatments reduce, delay, or prevent the worsening of an infection.
  • a prophylactic treatment can prevent, delay or reduce the severity of EBV reactivation.
  • a prophylactic treatment can prevent or reduce the severity of a lymphoproliferative disorder that may result from EBV reactivation during immunosuppression.
  • a prophylactic treatment can prevent or reduce the risk of a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor.
  • a carcinoma e.g., nasopharyngeal and/or gastric
  • compositions include use as prophylactic vaccines.
  • Vaccines increase the immunity of a subject against a particular infection. Therefore, "EBV vaccine” can refer to a treatment that increases the immunity of a subject against EBV. Therefore, in particular embodiments, a vaccine may be administered prophylactically, for example to a subject that is immunologically naive (e.g., no prior exposure or experience with EBV). In particular embodiments, a vaccine may be administered therapeutically to a subject who has been exposed to EBV. Thus, a vaccine can be used to ameliorate a symptom associated with EBV, such as a lymphoproliferative disorder. A vaccine can also reduce the risk of a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor.
  • a carcinoma e.g., nasopharyngeal and/or gastric
  • an EBV vaccine is a therapeutically effective composition including one or more EBV antigens including an AMMO epitope disclosed herein that induces an immune response in a subject against EBV.
  • the immune system generally is capable of producing an innate immune response and an adaptive immune response.
  • An innate immune response generally can be characterized as not being substantially antigen specific and/or not generating immune memory.
  • An adaptive immune response can be characterized as being substantially antigen specific, maturing over time (e.g., increasing affinity and/or avidity for antigen), and in general can produce immunologic memory. Even though these and other functional distinctions between innate and adaptive immunity can be discerned, the skilled artisan will appreciate that the innate and adaptive immune systems can be integrated and therefore can act in concert.
  • administration of an EBV vaccine can further include administration of one or more adjuvants.
  • adjuvant refers to material that enhances the immune response to a vaccine antigen and is used herein in the customary use of the term. The precise mode of action is not understood for all adjuvants, but such lack of understanding does not prevent their clinical use for a wide variety of vaccines.
  • Exemplary vaccine adjuvants include any kind of Toll-like receptor ligand or combinations thereof (e.g. CpG, Cpg-28 (a TLR9 agonist), po!yriboinosinic polyribocytidylic acid (Poly(l:C)), a- galactoceramide, MPLA, otoiimod (VTX-2337, a novel TLR8 agonist developed by VentiRx), IMO-2G55 (EMD1201081), TMX-101 (imiquimod), MGN 1703 ⁇ a TLR9 agonist), G 100 (a stabilized emulsion of the TLR4 agonist giucopyranosyl lipid A), Entolimod (a derivative of Salmonella fiage!lin also known as CBLB502), Hiitonoi (a TLR3 agonist), and Imiquimod), and/or inhibitors of heat-shock protein 90 (Hsp90), such as 17-DMAG (17-dimethylamino
  • a squalene-based adjuvant can be used.
  • Squalene is part of the group of molecules known as triterpenes, which are all hydrocarbons with 30 carbon molecules. Squalene can be derived from certain plant sources, such as rice bran, wheat germ, amaranth seeds, and olives, as well as from animal sources, such as shark liver oil.
  • the squalene-based adjuvant is MF59® (Novartis, Basel, Switzerland).
  • An example of a squalene-based adjuvant that is similar to MF59® but is designed for preclinical research use is AddavaxTM (InvivoGen, San Diego, CA).
  • squalene based adjuvants can include 0.1 %-20% (v/v) squalene oil. In particular embodiments, squalene based adjuvants can include 5%(v/v) squalene oil.
  • the adjuvant alum can be used.
  • Alum refers to a family of salts that contain two sulfate groups, a monovalent cation, and a trivalent metal, such as aluminum or chromium.
  • Alum is an FDA approved adjuvant.
  • vaccines can include alum in the amounts of 1-1000 ⁇ g/dose or 0.1 mg-10mg/dose.
  • STING is an abbreviation of "stimulator of interferon genes", which is also known as “endoplasmic reticulum interferon stimulator (ERIS)", “mediator of IRF3 activation (MITA)”, “MPYS” or “transmembrane protein 173 (TM173)”.
  • STING agonists include cyclic molecules with one or two phosphodiester linkages, and/or one or two phosphorothioate diester linkages, between two nucleotides. This includes (3',5')-(3',5') nucleotide linkages (abbreviated as (3',3')); (3',5')-(2',5') nucleotide linkages (abbreviated as (3',2')); (2',5')-(3',5') nucleotide linkages (abbreviated as (2',3')); and (2',5')-(2',5') nucleotide linkages (abbreviated as (2',2')).
  • Nucleotide refers to any nucleoside linked to a phosphate group at the 5', 3' or 2' position of the sugar moiety.
  • STING agonists include c-AIMP; (3',2')c-AIMP; (2',2')c-AIMP; (2',3')c-AIMP; c-AIMP(S); c-(dAMP-dlMP); c-(dAMP-2'FdlMP); c-(2'FdAMP-2'FdlMP); (2',3')c- (AMP-2'FdlMP); c-[2'FdAMP(S)-2'FdlMP(S)]; c-[2'FdAMP(S)-2'FdlMP(S)](POM)2; and DMXAA. Additional examples of STING agonists are described in WO2016/145102.
  • immune stimulants can also be used as vaccine adjuvants.
  • Additional exemplary small molecule immune stimulants include TGF- ⁇ inhibitors, SHP-inhibitors, STAT-3 inhibitors, and/or STAT-5 inhibitors.
  • Exemplary siRNA capable of down-regulating immune-suppressive signals or oncogenic pathways can be used whereas any plasmid DNA (such as minicircle DNA) encoding immune-stimulatory proteins can also be used.
  • the immune stimulant may be a cytokine and or a combination of cytokines, such as IL-2, IL-12 or IL-15 in combination with IFN-a, IFN- ⁇ or IFN- ⁇ , or GM-CSF, or any effective combination thereof, or any other effective combination of cytokines.
  • cytokines such as IL-2, IL-12 or IL-15 in combination with IFN-a, IFN- ⁇ or IFN- ⁇ , or GM-CSF, or any effective combination thereof, or any other effective combination of cytokines.
  • the above- identified cytokines stimulate TH1 responses, but cytokines that stimulate TH2 responses may also be used, such as IL-4, IL-10, IL-1 1 , or any effective combination thereof.
  • combinations of cytokines that stimulate T H 1 responses along with cytokines that stimulate T H 2 responses may be used.
  • an immune response refers to a response of the immune system to an EBV antigen disclosed herein.
  • an immune response to an EBV antigen can be an innate and/or adaptive response.
  • an adaptive immune response can be a "primary immune response” which refers to an immune response occurring on the first exposure of a "naive" subject to an EBV antigen.
  • a primary antibody response after a lag or latent period of from 3 to 14 days depending on, for example, the composition, dose, and subject, antibodies to the EBV antigen can be produced.
  • IgM production lasts for several days followed by IgG production and the IgM response can decrease.
  • an adaptive immune response can be a "secondary immune response", “anamnestic response,” or “booster response” which refer to the immune response occurring on a second and subsequent exposure of a subject to an EBV antigen disclosed herein.
  • secondary immune response memory cells respond to the EBV antigen and therefore the secondary immune response can differ from a primary immune response qualitatively and/or quantitatively.
  • the lag period of a secondary antibody response can be shorter, the peak antibody titer can be higher, higher affinity antibody can be produced, and/or antibody can persist for a greater period of time.
  • an immune response against EBV will include antibody production against: the D-l/D-ll domain of a gH/gL complex, gB, and/or an AMMO epitope.
  • a "therapeutic treatment” includes a treatment administered to a subject who displays symptoms or signs of an infection and is administered to the subject for the purpose of diminishing or eliminating those signs or symptoms of the infection or effects of the infection (e.g. IM, a lymphoproliferative disorder (e.g., Hodgkin lymphoma, non-Hodgkin lymphoma, Burkitt lymphoma, T cell lymphoma, lymphoproliferative disease), a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor).
  • the therapeutic treatment can reduce, control, or eliminate the presence or activity of the infection and/or reduce, control or eliminate side effects of the infection.
  • a therapeutic treatment can reduce, control, or eliminate EBV reactivation.
  • a reduction in EBV reactivation can be determined by measuring expression of EBV latency genes, wherein detection of fewer latency genes or detection of lower expression levels of latency genes can indicate a reduction in EBV reactivation.
  • a therapeutic treatment can reduce, control, or eliminate a primary infection with EBV.
  • a therapeutic treatment can reduce or eliminate the symptoms of IM.
  • a prophylactic and/or therapeutic treatment can reduce the severity of immunosuppression treatment complications resulting from EBV primary infection of an immunosuppressed individual.
  • a therapeutically effective treatment to reduce the severity of immunosuppression treatment complications can be given to a pediatric patient.
  • a pediatric patient can refer to patient who is 18 years of age or younger. Pediatric patients are more likely to be EBV seronegative and therefore are at an increased risk of immunosuppression treatment complications from EBV primary infection, as compared to adult patients.
  • a therapeutic treatment can eliminate or reduce the severity of a lymphoproliferative disorder. Elimination of or reduced severity of a lymphoproliferative disorder can be indicated by a reduction in lymphocyte count in an individual with the lymphoproliferative disorder.
  • a therapeutic treatment can eliminate or reduce the risk or severity of a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor.
  • a carcinoma e.g., nasopharyngeal and/or gastric
  • a smooth muscle tumor e.g., a smooth muscle tumor.
  • prophylactic treatment or therapeutic treatment are not mutually exclusive, and in particular embodiments, administered dosages may accomplish more than one treatment type.
  • therapeutically effective amounts provide anti-infection effects.
  • Anti-infection effects include a decrease in the number of infected cells, a decrease in volume of infected tissue, reduced infection-associated lymphoproliferation, reduced occurrence of infection-associated carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor, and/or reduction or elimination of a symptom associated with the treated infection.
  • infection-associated carcinoma e.g., nasopharyngeal and/or gastric
  • Effects of EBV infection can include infectious mononucleosis (IM), a lymphoproliferative disorder, and/or a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor.
  • IM infectious mononucleosis
  • a lymphoproliferative disorder e.g., a lymphoproliferative disorder
  • a carcinoma e.g., nasopharyngeal and/or gastric
  • IM is an illness caused by primary infection with EBV and symptoms of IM can include fever, swollen lymph nodes, swollen tonsils, loss of appetite, fatigue, abdominal pain, and/or spleen enlargement.
  • therapeutically effective amounts provide anti-IM effects.
  • Anti-IM effects include a reduction or elimination of an IM symptom.
  • Lymphoproliferative disorders can refer to the uncontrolled division of lymphocytes. Subjects with compromised immune systems are at increased risk of developing a lymphoproliferative disorder.
  • lymphoproliferative disorders include Hodgkin lymphoma, non-Hodgkin lymphoma, Burkitt lymphoma, T cell lymphomas, follicular lymphoma, chronic lymphocytic leukemia, acute lymphoblastic leukemia, hairy cell leukemia, B-cell lymphomas, multiple myeloma, Waldenstrom's macroglobulinemia, Wiskott-Aldrich syndrome, lymphocyte-variant hypereosinophilia, post-transplant lymphoproliferative disorder, and autoimmune lymphoproliferative syndrome.
  • lymphoproliferative disorders include lymphoproliferative disease, which is an EBV-related lymphoma that occurs in 1-20% of bone marrow and solid organ transplant recipients.
  • Symptoms of lymphoproliferative disorders can include adenopathy, splenomegaly, and/or an abnormally high lymphocyte count in a subject's blood sample.
  • therapeutically effective amounts provide anti-lymphoproliferative disorder effects.
  • Anti- lymphoproliferative disorder effects include a reduction or elimination of a lymphoproliferative disorder or a symptom of a lymphoproliferative disorder.
  • the term "carcinoma” designates any disease involving unregulated proliferation of epithelial cells, and which may result in unregulated cell growth, lack of differentiation, tumors formation, local tissue invasion, and/or metastasis formation.
  • Nasopharyngeal carcinoma NPC is a malignant tumor arising from the epithelial lining of the nasopharynx, which is located behind the nose and above the back of the throat. NPC differs significantly from other cancers of the head and neck, based on its causes, occurrence, clinical behavior, and treatment options. NPC is consistently associated with EBV and is the third most frequent virus-associated malignancy in humans.
  • Gastric carcinomas include gastric cancer, including intestinal and diffuse gastric adenocarcinoma, gastrointestinal stromal tumor (GIST), gastrointestinal leiomyosarcoma, gastrointestinal carcinoid, gastrointestinal lymphoma, esophagogastric adenocarcinoma (OGA), and colorectal carcinoma.
  • GIST gastrointestinal stromal tumor
  • OAA esophagogastric adenocarcinoma
  • colorectal carcinoma include colorectal carcinoma.
  • Leiomyomas are tumors composed of smooth muscle cells which can range from clearly benign leiomyoma (fibroids) to malignant leiomyosarcoma. Intermediate variants have also been identified and are termed "smooth muscle tumors of uncertain malignant potential". These may include cellular leiomyomas. Leiomyomas and leiomyosarcomas are most prevalent in the uterine smooth muscle, however, they can occur in any organ system which possesses smooth muscle. The second highest incidence of occurrence for these tumor types is in the gastrointestinal tract. Leiomyomas represent one of the most common benign tumors of the stomach, while gastric leiomyosarcomas represent 2% of all malignant tumors that occur in the stomach.
  • therapeutically effective amounts provide anti-carcinoma (e.g., anti-NPC; anti-gastric carcinoma) or anti-smooth muscle tumor effects which can include reducing the risk or occurrence of a carcinoma or smooth muscle tumor, limiting the further development of the carcinoma or smooth muscle tumor (e.g., tumor growth and/or metastasis), reversing the severity of the carcinoma or smooth muscle tumor, or other beneficial clinical outcomes, as understood one of ordinary skill in the art.
  • anti-carcinoma e.g., anti-NPC; anti-gastric carcinoma
  • anti-smooth muscle tumor effects which can include reducing the risk or occurrence of a carcinoma or smooth muscle tumor, limiting the further development of the carcinoma or smooth muscle tumor (e.g., tumor growth and/or metastasis), reversing the severity of the carcinoma or smooth muscle tumor, or other beneficial clinical outcomes, as understood one of ordinary skill in the art.
  • beneficial clinical outcomes include loss of detectable tumor (complete response), decrease in tumor size (partial response, PR), tumor growth or cell number increase arrest (stable disease, SD), enhancement of anti-tumor immune response, and/or relief, to some extent, of one or more symptoms associated with a carcinoma or smooth muscle tumor; increase in the length of survival following treatment; and/or decreased mortality at a given point of time following treatment.
  • therapeutically effective amounts can be initially estimated based on results from in vitro assays and/or animal model studies. Such information can be used to more accurately determine useful doses in subjects of interest.
  • the actual dose amount administered to a particular subject can be determined by a physician, veterinarian or researcher taking into account parameters such as physical and physiological factors including target, body weight, severity of infection, stage of infection, effects of infection (e.g., IM, lymphoproliferative disorders), previous or concurrent therapeutic interventions, idiopathy of the subject and route of administration.
  • Useful doses can range from 0.1 to 5 ⁇ g/kg or from 0.5 to 1 ⁇ g /kg.
  • a dose can include 1 ⁇ g /kg, 15 ⁇ g /kg, 30 ⁇ g /kg, 50 ⁇ g/kg, 55 ⁇ g/kg, 70 ⁇ g/kg, 90 ⁇ g/kg, 150 ⁇ g/kg, 350 ⁇ g/kg, 500 ⁇ g/kg, 750 ⁇ g/kg, 1000 ⁇ g/kg, 0.1 to 5 mg/kg or from 0.5 to 1 mg/kg.
  • a dose can include 1 mg/kg, 10 mg/kg, 30 mg/kg, 50 mg/kg,
  • 70 mg/kg 100 mg/kg, 300 mg/kg, 500 mg/kg, 700 mg/kg, 1000 mg/kg or more.
  • Useful doses can also include greater than 10 2 cells, greater than 10 3 cells, greater than
  • 10 4 cells greater than 10 5 cells, greater than 10 6 cells, greater than 10 7 cells, greater than 10 8 cells, greater than 10 9 cells, greater than 10 10 cells, or greater than 10 11 cells.
  • Therapeutically effective amounts can be achieved by administering single or multiple doses during the course of a treatment regimen (e.g., daily, every other day, every 3 days, every
  • compositions described herein can be administered by, without limitation, injection, inhalation, infusion, perfusion, lavage or ingestion.
  • Routes of administration can include intravenous, intradermal, intraarterial, intraparenteral, intranasal, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intravesicular, oral, subcutaneous, and/or sublingual administration and more particularly by intravenous, intradermal, intraarterial, intraparenteral, intranasal, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intravesicular, oral, subcutaneous, and/or sublingual injection.
  • An anti-EBV antibody including the CDRs:
  • SEQ ID NO: 1 1 SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16;
  • SEQ ID NO: 17 SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , and SEQ ID NO: 22;
  • SEQ ID NO: 23 SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28;
  • SEQ ID NO: 29 SEQ ID NO: 30, SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, and SEQ ID NO: 34; or
  • SEQ ID NO: 35 SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, and SEQ ID NO: 40.
  • An anti-EBV antibody including SEQ ID NO: 41 and SEQ ID NO: 42, but with mutations to SEQ ID NO: 41 selected from one or more of D10E; G76S; S83R; T84S; F91Y; V107T; and P113S and/or mutations to SEQ ID NO: 42 selected from one or more of E3V; Q17K; R18T; T20R; Q49Y; S69N; and G100T.
  • An anti-EBV antibody including SEQ ID NO: 41 and SEQ ID NO: 42, but with mutations to SEQ ID NO: 41 including D10E; G76S; S83R; T84S; F91Y; V107T; and mutations to SEQ ID NO: 42 including E3V; Q17K; R18T; T20R; Q49Y; S69N; and G100T.
  • An anti-EBV antibody including SEQ ID NO: 1 and SEQ ID NO: 2.
  • An anti-EBV antibody including SEQ ID NO: 1 with a Q1 N mutation and SEQ ID NO: 2.
  • An anti-EBV antibody including SEQ ID NO: 3 and SEQ ID NO: 4.
  • An anti-EBV antibody including SEQ ID NO: 3 with a Q1 N mutation and SEQ ID NO: 4.
  • An anti-EBV antibody including SEQ ID NO: 5 and SEQ ID NO: 6.
  • An anti-EBV antibody including SEQ ID NO: 5 with an E1 N mutation and SEQ ID NO: 6.
  • An anti-EBV antibody including SEQ ID NO: 7 and SEQ ID NO: 8.
  • An anti-EBV antibody including SEQ ID NO: 7 with an Q1 N mutation and SEQ ID NO: 8.
  • An anti-EBV antibody including SEQ ID NO: 9 and SEQ ID NO: 10.
  • An anti-EBV antibody including SEQ ID NO: 9 with an E1 N mutation and SEQ ID NO: 10.
  • An anti-EBV antibody that binds the EBV core fusion machinery heterodimer envelope glycoprotein H/envelope glycoprotein L (gH/gL) and/or glycoprotein B (gB).
  • An anti-EBV antibody that binds the D-l/D-ll groove of the EBV gH/gL heterodimer complex.
  • An anti-EBV antibody that binds at least one of residues 60, 70-81 , 21 1-216, and 234-239 of gH; and/or at least one of residues 123-128 of gL.
  • An anti-EBV antibody that binds residues 60, 70-81 , 211-216, and 234-239 of gH; and residues 123-128 of Gl
  • An anti-EBV antibody that binds residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine.
  • a human anti-EBV antibody, or an antigen-binding portion therof e.g., scFv
  • scFv an antigen-binding portion therof that dissociates from EBV gH/gL with a KD of 1X10 "10 or less and a k 0 ff rate constant of 3X10 "5 s"1 or less, both determined by surface plasmon resonance or biolayer interferometry.
  • Epstein Barr Virus EBV gH/gL
  • the antibody (i) binds an epitope on EBV gH/gL including at least one of residues 60, 70-81 , 211-216, and 234-239 of gH; and/or at least one of residues 123-128 of gL, (ii) inhibits EBV envelope fusion with a target cell; and (iii) competes for binding with the antibody CL40.
  • Epstein Barr Virus EBV gH/gL
  • the antibody (i) binds an epitope on EBV gH/gL including residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine; (ii) inhibits EBV envelope fusion with a target cell; and and (iii) competes for binding with the antibody CL40.
  • EBV Epstein Barr Virus
  • An anti-EBV antibody of any of embodiments 1-25 that neutralizes EBV infection of B cells and/or epithelial cells.
  • An anti-EBV antibody of any of embodiments 1-25 that neutralizes EBV infection of B cells and/or epithelial cells.
  • An anti-EBV antibody of any of embodiments 1-25 that neutralizes EBV infection of B cells and/or epithelial cells with an IC50 of 3X10 "9 M or less.
  • An anti-EBV antibody of any of embodiments 1-25 wherein the neutralizing antibody neutralizes EBV infection of epithelial cells and wherein the neutralizing EBV infection includes at least 80% or at least 90% neutralization.
  • An anti-EBV antibody of any of embodiments 1-30 including one or more mutations that increase binding to Fc receptors (e.g., G236A/S239D/A330L/I332E (GASDALIE)) or improve ADCC (e.g., substitutions at positions 298, 333, and/or 334 (EU numbering)).
  • Fc receptors e.g., G236A/S239D/A330L/I332E (GASDALIE)
  • ADCC e.g., substitutions at positions 298, 333, and/or 334 (EU numbering
  • An anti-EBV antibody of any of embodiments 1-31 including one or more mutations that increase protein half-life in serum (e.g., M428L/N434S).
  • PEG polyethylene glycol
  • An anti-EBV antibody of any of embodiments 1-35 including one or more human serum albumin (HSA)-linkages.
  • HSA human serum albumin
  • An anti-EBV antibody of any of embodiments 1-36 wherein the antibody is derived from a monoclonal antibody and the derivation includes at least one mutation of the monoclonal antibody.
  • An EBV vaccine including one or more immunogenic proteins that form (i) an AMM01 epitope or (ii) an AMM05 epitope.
  • An EBV vaccine of embodiment 40 wherein the AMM01 epitope includes (i) gH or a fragment of gH that can bind to gl_, and (ii) gl_ or a fragment of gl_ that can bind to gH; wherein the gH and gl_ form a gH/gL heterodimer complex.
  • An EBV vaccine of embodiment 41 wherein the vaccine further includes gp42 or a fragment of gp42 that can bind to the gH/gL heterodimer complex.
  • a cell of any of embodiments 49-51 wherein the cell is a cell of hematopoeitic origin that differentiates into a B cell.
  • a cell of any of embodiments 49-51 wherein the cell is a CD34+ hematopoeitic stem cell.
  • a composition formulated for administration to a subject including an anti-EBV antibody, an EBV vaccine, or a cell of any of embodiments 1-50, or 52-54.
  • a method of treating a subject for EBV infection including administering to the subject a therapeutically effective amount of a composition of embodiment 55 thereby treating the subject for EBV infection.
  • IM infectious mononucleosis
  • a method of embodiment 56 or 57 wherein the treating (i) reduces or eliminates a lymphoproliferative disorder and/or symptoms of the lymphoproliferative disorder (e.g., Hodgkin lymphoma, non-Hodgkin lymphoma, Burkitt lymphoma, T cell lymphoma, lymphoproliferative disease), (ii) reduces the risk or occurrence of a carcinoma (e.g., nasopharyngeal carcinoma, gastric carcinoma), and/or (iii) reduces the risk or occurrence of a smooth muscle tumor.
  • a method of neutralizing EBV infection including contacting cells or tissue with an antibody of any of embodiments 1-39 or a cell of embodiments 49-54, thereby reducing or inhibiting EBV infection of the cells or the tissue.
  • a method of embodiment 59, wherein the cells are epithelial cells and B cells.
  • tissue is epithelial tissue.
  • a method of stimulating an anti-EBV immune response in a subject including administering to the subject a therapeutically effective amount of an EBV vaccine of any of embodiments 41- 49, thereby stimulating an EBV immune response in the subject.
  • a method of embodiment 64, wherein the subject is an EBV seronegative subject, and wherein the therapeutically effective amount reduces the risk of EBV infection.
  • IM infectious mononucleosis
  • An antibody or vaccine of any of the previous embodiments that is recombinantly produced An antibody of any of the previous embodiments that is recombinantly produced and includes at least one mutation from the sequences depicted in FIG. 24 wherein the at least one mutation is outside of a CDR region.
  • an antibody of any of the preceding embodiments conjugated to an imaging agent or drug e.g., alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase; pertussis-toxin, diphtheria toxin, ricin, saporin, pseudomonas exotoxin, calicheamicin, taxoids, maytansinoids, tubulysins, dolastatin, dolastatin analogues (e.g., auristatin E, monomethylauristatin E, auristatin PYE and auristatin PHE); Abiraterone, Adriamycine, Anthracycline (Doxorubicin), Azacitidine, Azathioprine, Beuacizumab, Bortezomib, Bleomycin, Capecitabine, Camptotecine, Carboplatin, Cetuximab, Chlorambucil, Cisplatin, curacin,
  • variants of the sequences disclosed and referenced herein are included.
  • variants of proteins can include those having one or more conservative amino acid substitutions or one or more non-conservative substitutions that do not adversely affect the function of the protein in a measure described in for example, FIGs. 8A, 8B.
  • a “conservative substitution” involves a substitution found in one of the following conservative substitutions groups: Group 1 : Alanine (Ala), Glycine (Gly), Serine (Ser), Threonine (Thr); Group 2: Aspartic acid (Asp), Glutamic acid (Glu); Group 3: Asparagine (Asn), Glutamine (Gin); Group 4: Arginine (Arg), Lysine (Lys), Histidine (His); Group 5: Isoleucine (lie), Leucine (Leu), Methionine (Met), Valine (Val); and Group 6: Phenylalanine (Phe), Tyrosine (Tyr), Tryptophan (Trp).
  • amino acids can be grouped into conservative substitution groups by similar function or chemical structure or composition (e.g., acidic, basic, aliphatic, aromatic, sulfur- containing).
  • an aliphatic grouping may include, for purposes of substitution, Gly, Ala, Val, Leu, and lie.
  • Other groups containing amino acids that are considered conservative substitutions for one another include: sulfur-containing: Met and Cysteine (Cys); acidic: Asp, Glu, Asn, and Gin; small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro, and Gly; polar, negatively charged residues and their amides: Asp, Asn, Glu, and Gin; polar, positively charged residues: His, Arg, and Lys; large aliphatic, nonpolar residues: Met, Leu, lie, Val, and Cys; and large aromatic residues: Phe, Tyr, and Trp. Additional information is found in Creighton (1984) Proteins, W.H. Freeman and Company.
  • variants of the protein sequences include sequences with at least 70% sequence identity, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the protein sequences described or disclosed herein.
  • % sequence identity refers to a relationship between two or more sequences, as determined by comparing the sequences.
  • identity also means the degree of sequence relatedness between protein sequences or nucleic acid sequences as determined by the match between strings of such sequences.
  • Identity (often referred to as “similarity") can be readily calculated by known methods, including (but not limited to) those described in: Computational Molecular Biology (Lesk, A. M., ed.) Oxford University Press, NY (1988); Biocomputing: Informatics and Genome Projects (Smith, D. W., ed.) Academic Press, NY (1994); Computer Analysis of Sequence Data, Part I (Griffin, A. M., and Griffin, H.
  • the anti-EBV antibodies have one or more of the following characteristics:
  • A) bind to recombinant and/or wild-type gH/gL;
  • G dissociate from EBV gH/gL with a K D of 1X10 "10 or less and a k 0ff rate constant of 3X10 " 5 s"1 or less, both determined by surface plasmon resonance or biolayer interferometry;
  • H bind to wild-type gH/gL with a K A of more than 1 X10 7 M " ⁇ more than 100 X10 7 M " ⁇ more than 200 X10 7 M “1 or more than 500 X10 7 M "1 ;
  • J bind to endogenous gB on the surface of an EBV virion; K) reduce EBV fusion with a target cell;
  • R include CDRs that include the amino acid sequences SEQ ID NOs: 11-16, SEQ ID NO: 17-22, SEQ ID NOs: 23-28, SEQ ID NOs: 29-34, or SEQ ID NOs: 35-40; and/or
  • Example 2 An anti-gH/gL antibody that neutralizes dual-tropic infection defines a site of vulnerability on Epstein-Barr virus.
  • Epstein-Barr virus (EBV) infects the majority of adults worldwide. Although most primary infections are asymptomatic, EBV is a causative agent of infectious mononucleosis in children and young adults, and is associated with numerous hematopoietic and epithelial cell cancers (Cohen et al., 201 1 ; Young and Rickinson, 2004). EBV also causes lymphoproliferative disorders in immunocompromised patients such as those with HIV/AIDS or in patients undergoing immune suppression for organ transplantation (Taylor et al., 2015).
  • EBV targets B cells and epithelial cells during primary infection. Host cell entry is a complex process mediated by several viral glycoproteins that define tropism and mediate membrane fusion at the plasma membrane during epithelial cell infection or following endocytosis during B-cell infection (Miller and Hutt-Fletcher, 1992). Three virally encoded surface glycoproteins
  • gH, gl_ and gB share a conserved function among herpesviruses and are required for EBV infection of both B cells and epithelial cells (Connolly et al., 201 1).
  • gB is a type III transmembrane fusion protein that promotes the merger of the viral and host membranes (Backovic et al., 2009). gB activity is dependent upon the heterodimeric gH/gL complex, which acts as an adaptor that triggers gB-mediated fusion upon binding a cell-surface receptor on target host cells (Mohl et al., 2016; Stampfer and Heldwein, 2013). The gH/gL complex is anchored to the cell membrane through a C-terminal trans-membrane domain on gH.
  • gH/gL assumes an elongated structure including four distinct domains designated D-l to D-IV.
  • D-l is formed by gL and the N-terminus of gH whereas the rest of gH includesD-ll through D-IV (Matsuura et al., 2010).
  • D-l and D-l I are separated by a prominent groove and connected by a linker helix (Matsuura et al., 2010).
  • gH/gL is required for efficient binding to epithelial cells (Molesworth et al., 2000; Oda et al., 2000).
  • ⁇ , ⁇ 6, or ⁇ integrins (Chesnokova and Hutt-Fletcher, 201 1 ; Chesnokova et al., 2009), and the ephrin receptor A2 (EphA2) (Chen et al., 2018; Zhang et al., 2018) have been identified as epithelial cell surface receptors that interact directly with gH/gL to trigger gB- mediated fusion.
  • B cell infection requires an additional viral glycoprotein, gp42, which forms a 1 :1 complex with gH/gL (Kirschner et al., 2006).
  • the N-terminus of gp42 mediates high-affinity interactions with gH/gL and the C-terminus binds to the B chain of human leukocyte antigen (HLA) class II which leads to triggering of gB-mediated fusion through the gH/gl_/gp42 complex (Haan et al., 2000; Sathiyamoorthy et al., 2014; Spriggs et al., 1996).
  • HLA human leukocyte antigen
  • gp42 is necessary for B cell infection, it inhibits epithelial cell infection (Kirschner et al., 2007; Kirschner et al., 2006; Wang et al., 1998) through a mechanism that is not entirely clear. Residues connecting the N- and C- terminal domains of gp42 make contact with the gH/gL KGD motif suggesting that gp42 could prevent integrin attachment by competing for the same binding site (Sathiyamoorthy et al., 2016).
  • an N-terminal peptide of gp42 that binds distal to the KGD motif is sufficient to inhibit epithelial cell infection (Kirschner et al., 2007; Sathiyamoorthy et al., 2016).
  • Virions produced in B cells contain lower levels of gp42 than virions produced in epithelial cells. Thus, virions that shed from one cell type preferentially infect the other (Borza and Hutt- Fletcher, 2002).
  • gp350 is the most abundant glycoprotein on the surface of EBV virions (Edson and Thorley-Lawson, 1981) and it promotes viral attachment to target cells through a high affinity interaction with CD21 (Tanner et al., 1987) or CD35 (Ogembo et al., 2013) without mediating fusion.
  • anti-gp350 antibodies can inhibit B cell infection in vitro, some can enhance infection of CD21-negative epithelial cells (Turk et al., 2006).
  • the 72A1 MAb binds to the CD21/CD35 binding site on gp350 (Ogembo et al., 2013; Tanner et al., 1987) and potently neutralizes B cell infection (Hoffman et al., 1980; Sashihara et al., 2009), but has no effect on infection of CD21 -negative epithelial cells (Molesworth et al., 2000; Tugizov et al., 2003).
  • the C1 MAb binds to an unknown epitope on gp350 and inhibits B cell infection but promotes infection of epithelial cells (Thorley-Lawson and Geilinger, 1980; Turk et al., 2006).
  • F-2-1 targets gp42 and inhibits B cell but not epithelial cell infection (Chesnokova and Hutt-Fletcher, 201 1 ; Li et al., 1995; Molesworth et al., 2000; Strnad et al., 1982).
  • CL55 is the only known EBV gB- specific MAb and it is non-neutralizing in both B-cell and epithelial cell infection assays (Chesnokova and Hutt-Fletcher, 201 1 ; Wu et al., 2005).
  • E1 D1 , CL59, and CL40 are murine MAbs which bind to gH/gL and neutralize epithelial cell infection but fail to efficiently block infection of B cells (Balachandran et al., 1987; Chesnokova and Hutt-Fletcher, 2011 ; Li et al., 1995; Molesworth et al., 2000).
  • AMM01 that potently neutralizes both epithelial and B cell infection in vitro (and thus defines an important site of EBV vulnerability) was obtained.
  • cyroEM cryo-electron microscopy
  • X-ray crystallography the structure of the gH/gl_/gp42/AMM01 complex was determined. This analysis demonstrated that AMM01 binds to a discontinuous epitope on gH/gL at the interface between D-l and D-ll, which is implicated in triggering of gB- mediated fusion of the viral and cellular membranes.
  • AMM01 The isolation and characterization of AMM01 described herein paves the way for the design of a gH/gL-based subunit vaccine.
  • the dual-tropic inhibition of EBV entry by AMM01 indicates that this MAb could also have therapeutic potential in blocking EBV infection, reactivation, and amplification in immunocompromised individuals and transplant recipients.
  • PBMC Peripheral blood mononuclear cells
  • serum serum were collected from seven HIV-uninfected, and eight HIV-infected adults recruited at the Seattle HIV Vaccine Trials Unit (Seattle, Washington, USA) as part of the study "Establishing Immunologic Assays for Determining HIV-1 Prevention and Control", also referred to as Seattle Assay Control or SAC. All participants signed informed consent, and the following institutional human subjects review committee approved the protocol prior to study initiation: Fred Hutchinson Cancer Research Center IRB (Seattle, Washington, USA). Donors were selected randomly and no considerations were made for age, or sex.
  • gl_ (AA 24-137 Genbank: AFY97944.1), was synthesized with an N- terminal TPA leader peptide (SEQ ID NO: 62) without a C terminal tag and cloned into the EcoRI and Notl sites of the pTT3 plasmid.
  • Site directed mutagenesis was used to introduce stop codons into gH and gp42 between the HIS and Avi tags to produce expression plasmids without the Avi- Tag, and to introduce the T62A and T175A mutations into gH and gp42, respectively.
  • the murine CD40L sequence flanked by an Xbal-Kozak sequence on the 5' end and a Not I site on the 3' end was synthesized by Genscript and cloned into the Xbal and Notl sites of pCDH-EF-MCS- IRES-RFP vector (Systembio) to create pCDH-muCD40L-RFP.
  • pCAGGS expression plasmids for gH, gl_, gB, and pT7EMCLuc (which carries a luciferase-containing reporter plasmid under the control of the T7 promoter) were kindly provided by Dr. R. Longnecker (Haan et al., 2001 ; Okuma et al., 1999; Plate et al., 201 1). Plasmids for the expression of humanized, recombinant 72A1 were provided by Dr. F. Wang (Herrman et al., 2015). p509, an expression plasmid encoding BZLF1 , was provided by Dr. W. Hammerschmidt (Delecluse et al., 1998). p2670, an expression plasmid encoding BALF4, was provided by Dr. H. Delecluse (Neuhierl et al., 2002).
  • Raji cells as well as the 72A1 (ATCC: HB-168), CL55 (Wu et al., 2005), F-2-1 (Strnad et al., 1982), CL40, CL59 (Molesworth et al., 2000), and E1 D1 (Balachandran et al., 1987) hybridomas, were maintained in RMPI + 10% FBS, 2 mM L-glutamine, 100 U/ml penicillin, and 100 ⁇ g/ml streptomycin (cRPMI). 293-2089 cells (Delecluse et al., 1998) were grown in cRPMI containing 100 ⁇ g/ml hygromycin.
  • cRPMI streptomycin
  • AKATA B cells harboring EBV in which the thymidine kinase gene has been replaced with a neomycin and GFP cassette virus (AKTA-GFP) (Molesworth et al., 2000), were grown in cRMPI containing 350 ⁇ g/ml G418.
  • SVKCR2 cells (Li et al., 1992) were grown in DMEM containing 10% cosmic calf serum, 2 mM L-glutamine, 100 U/ml penicillin, and 100 ⁇ g/ml streptomycin, 10 ng/ml cholera toxin and 400 ⁇ g/ml G418.
  • 293-T7 cells (Omerovic et al., 2005) were maintained in cDMEM containing 100 ⁇ g/ml Zeocin.
  • 293F cells (ThermoFisher) were maintained in Freestyle 293 media with gentle shaking.
  • Plasmids encoding EBV proteins, or antibody heavy and light chains were transfected into 293F cells at a density of 10 6 cells/ml in Freestyle 293 media (ThermoFisher) using the 293Free transfection reagent (EMD Millipore) according to the manufacturer's instructions. Expression was carried out in Freestyle 293 media for 6 days after which cells and cellular debris were removed by centrifugation at 4,000 ⁇ g followed by filtration through a 0.22 ⁇ filter.
  • Clarified cell supernatant containing EBV proteins was passed over Ni- NTA resin (Qiagen), pre-equilibrated with Ni-NTA binding buffer (0.3 M NaCI, 20 mM Tris, 10mM imidazole, pH 8.0), followed by extensive washing with Ni-NTA binding buffer, and then eluted with 250 mM imidazole, 0.3 M NaCI, 20 mM Tris, pH 8.0 (Ni-NTA elution buffer). Purified proteins were then dialyzed overnight into PBS. AVI-tagged gB, gp350, and gp42 were biotinylated in vitro using the In Vitro Biotin Ligase Kit (Avidity) according to the manufacturer's instructions.
  • Proteins were further purified by SEC using a 10/300 S 200 column (GE Healthcare) equilibrated into HBSE (10 mM HEPES, 150 mM NaCI, 2 mM EDTA pH 7.4), which also served to remove un-ligated biotin and BirA enzyme. Biotinylated proteins were flash frozen and stored at -20°C until use.
  • Clarified cell supernatant containing recombinant antibodies was passed over Protein A Agarose (Pierce, cat # 20333), followed by extensive washing with PBS, and then eluted with 1 ml of Pierce IgG Elution Buffer, pH 2.0 (cat. # 21028) into 0.1 ml of Tris HCI, pH 8.0. Purified antibodies were then dialyzed overnight into PBS.
  • Recombinant monomeric DRB1*01 1 complexed with the Human CLIP peptide was obtained from the NIH Tetramer Core Facility, ⁇ (Cat# 2528-AV-050), ⁇ 6 (Cat# 3817-AV- 050) and ⁇ (Cat# 4135-AV-050) integrins, and the Ephrin receptor A2 (Cat# 3035-A2-100) were purchased from R&D systems.
  • AMM01 Fab was produced by digesting AMM01 IgG with Endoproteinase Lys-C (Roche) overnight at 37°C (10Mg IgG: 1 ng Lys C). Fab fragments were separated from Fc fragments with protein A agarose (Pierce), then further purified with SEC (Superdex 200).
  • CL40 Fab was produced by digesting CL40 IgG with activated immobilized ficin (Thermo Fisher) at 37°C for 48 hrs. Fab fragments were separated from Fc fragments with protein A agarose (Pierce), then further purified with SEC (Superdex 200).
  • 3T3-CD40L cell line generation Lentiviruses were produced by co-transfecting the pCDH- muCD40L-RFP, psPAX2 (Addgene#12260) and pMD2.G (Addgene#12259) plasmids at a 4:2:1 ratio (6, 3, and 1.5 ⁇ g, respectively) into 293T cells using the GeneJuice Transfection reagent according to the manufacturer's instructions. 48 hours later the supernatant was collected and passed through a 0.22 ⁇ filter. Supernatant was then transferred to 3T3 cells followed by the addition of 4 ⁇ g/ml polybrene (ATCC # CRL-1658) and incubated overnight in cDMEM.
  • 4 ⁇ g/ml polybrene ATCC # CRL-1658
  • CD40L-expressing cells were identified with a PE-labeled CD154 antibody (Biolegend Cat # 106505) and sorted by FACS on a Beckman FACS Ariall. Sorted cells were expanded and cultured indefinitely.
  • BLI assays were performed on the Octet Red instrument (ForteBio, Inc.) at 30°C with shaking at 1 ,000 RPM.
  • Anti-EBV antibodies were captured using Anti-Mouse IgG Fc capture (AMC) biosensors (Fortebio) by immersing sensors directly into hybridoma culture supernatants for 600s.
  • a baseline signal (nm shift) was recorded for 1 min in kinetics buffer (KB: 1X PBS, 0.01 % BSA, 0.02% Tween 20, and 0.005% NaN3,) at pH 7.4 or pH 5.0 as indicated.
  • Sensors were then immersed into solutions containing a 0.5 ⁇ concentration of each EBV glycoprotein for 250 s to measure association, followed by immersion in KB for 500 s to measure dissociation. All measurements of antibody binding were corrected by subtracting the signal obtained from simultaneous traces performed with the corresponding envelopes in the absence of antibody, using PBS only.
  • AHC Anti-Human IgG Fc capture
  • AMC for murine antibodies
  • streptavidin sensors for biotinylated antibodies or biotinylated gH/gL or gH T62A/gl_
  • the sensors were immersed into wells containing serial dilutions of purified recombinant gH/gL or gH-T62A/gL in KB for 250s (association phase), followed by immersion in KB for an additional 750s (dissociation phase).
  • the background signal from each analyte-containing well was measured using empty reference sensors, and subtracted from the signal obtained with each corresponding ligand-coupled sensor.
  • the background signal of ligand-coupled sensors in KB was subtracted from each sensor at each time-point using the data analysis software (ForteBio). Kinetic analyses were performed at least twice with an independently prepared analyte dilution series.
  • Curve fitting was performed using a 1 :1 binding model and the data analysis software (ForteBio). Mean kon, koff values were determined by averaging all binding curves that matched the theoretical fit with an R 2 value of ⁇ 0.99. Binding analyses at pH 5.0 were carried out as above using biotinylated antibodies and Streptavidin sensors.
  • Antibody competition binding assays Biotinylated antibodies were diluted to 10 ⁇ g/ml and captured onto streptavidin sensors for 120s. The baseline interference was then read for 60s in KB buffer, followed by immersion for 250s (association phase) in a 250 nM solution of gH/gL alone, or gH/gL that had been pre-incubated with 500 nM of non-biotinylated Abs for 20 min in KB. Sensors were then immersed in KB for 750 s (dissociation phase).
  • gH/gl_/gp42-HLA-DR binding assays Biotinylated gH/gL was immobilized on streptavidin biosensors, and then immersed into KB buffer for 60 seconds followed by into a 1 ⁇ solution of gp42 for 200 seconds. One biosensor was then immersed into a 1 ⁇ solution of the AMM01 Fab, while the other was immersed in KB for 200 seconds. The biosensors were then immersed into a 500 nM solution of HLA-DR for 300 seconds (association phase) and then into KB for 300 seconds (dissociation phase). One gH/gl_-gp42 loaded sensor was immersed in buffer as a reference during the association and dissociation steps and used to subtract the background signal.
  • gH/gL-integrin binding assays Biotinylated gH/gL was diluted to 10 ⁇ g/ml and captured onto streptavidin sensors for 120s. The baseline interference was then read for 60s in KB buffer containing followed by immersion for 200s (association phase) into KB buffer containing 1 ⁇ of 8 ⁇ 5, 8 ⁇ 6, 8 ⁇ 8, gp42, or an HIV-1 Envelope protein (426c TM4 AV1-3(McGuire et al., 2016)). Sensors were then immersed in KB containing for 400s (dissociation phase).
  • gH/gL EphA2 binding assays Biotinylated gH/gL was diluted to 30 ⁇ g/ml and immobilized on streptavidin biosensors for 120s, and then immersed in KB buffer for 60 seconds.
  • Biosensors were then immersed into either KB buffer or into a 1.5 ⁇ solution of AMM01 for 60 seconds. The biosensors were then immersed into a 3.5 ⁇ solution of EphA2 for 250 seconds (association phase) and then into KB for 250 seconds (dissociation phase). To control for non-specific binding due to the high analyte concentration, the binding signal to biotinylated gp42 immobilized on biosensors assayed under identical conditions was subtracted.
  • Serum ELISA 50 ng/well of gp350, gp42 or gB, were adsorbed onto 96 well Immulon 2HB ELISA plates at either 37°C for 1 hour or room temperature overnight in a solution of 0.1 M NaHCOs pH 9.4-9.6. Plates were then washed 4 times with ELISA washing buffer (1 * PBS, 0.02% Tween 20) prior to blocking at 37°C for 1 hour or 4°C overnight with 250 ⁇ per well of PBS containing 10% Non-Fat Milk and 0.02% Tween 20 (blocking buffer). After blocking, plates were washed 4* with ELISA washing buffer.
  • Serum was diluted in blocking buffer and three-fold serial dilutions were performed in duplicate followed by a 1 hour incubation at 37°C. Following 4 additional washes with ELISA washing buffer, a 1 :3000 dilution of goat anti-human Ig HRP (Southern Biotech 2010-05) in blocking buffer was added to each well and incubated at 37°C for 1 hour followed by 4 washes with wash buffer. 50 ⁇ /well of SureBlue Reserve TMB Microwell Peroxidase substrate (KPL 53-00-00) was added. After 3 min, 50 ⁇ /well of 1 N Sulfuric Acid was added and the A450 of each well was read on a Molecular Devices SpectraMax M2.
  • Antigen (gB, gH/gL, gp42, or gp350) conjugated to streptavidin-phycoerythrin (SA-PE) was then added to a final concentration of 10nM and incubated for 20 min at 4°C.
  • 25 ⁇ of Anti- PE MicroBeads (Miltenyi Biotech) were added and incubated for an additional 30 min at 4°C.
  • the cell/bead mixture was then passed over a LS MACS separation column (Miltenyi Biotec # 130-042-401) on a MACS separator and washed with 6 ml of FACS buffer (PBS + 1 % FBS).
  • the column was removed from the MACS separator and eluted two times with 5 ml of FACS buffer. PE-enriched PBMC were then pelleted by centrifugation at 300 ⁇ g for 5 min, and then re- suspended in 100 ⁇ of FACS buffer.
  • Enriched PBMC were then stained with the following antibodies: IgM-FITC (BD #555782) at a 1 :20 dilution, lgD-PerCP-Cy5.5 (BD # 561316) at a 1 : 100 dilution, CD27-PE-Cy7 (eBioscience #25-0271-82) at a 1 :200 dilution, CD20-eF450 (eBioscience 48-0209-42) at a 1 : 100 dilution, CD3-BV711 (BD #563725) at a 1 : 100 dilution, CD14-BV711 (BD #563372) at a 1 : 100 dilution, CD16-BV71 1 (BD 563127) at a 1 : 100 dilution, CD19-BV786 (BD 563325) at a 1 :100 dilution, and a fixable viability dye eFluor 506 (eBioscience # 65-0866-14) at a 1
  • Stained cells were diluted to 5 ml with FACS buffer, pelleted by centrifugation at 300 ⁇ g for 5 min and then suspended in 0.5 ml of FACS buffer and subjected to FACS on a BD FACS Aria II.
  • Live, antigen-positive class-switched B cells (Live/dead-, CD3-, CD14-, CD16-, CD19+ CD20+ IgM-, IgD-, PE-DL650-, PE+) were sorted individually into 96 well plates containing 2.86x 10 4 irradiated 3T3-CD40L cells in ⁇ ⁇ /well IMDM containing 10% FBS, I x glutamax, 100 U/ml penicillin, 100 g/ml streptomycin, 100 U/ml IL2 (Roche, cat. no. 11 147528001) and 50 ng/ml IL21 (Invitrogen, cat. no. PHC0215) (Huang et al., 2013).
  • RT was carried out at 42°C for 10 min, 25°C for 10 min, 50°C for 60 min, and 94°C for 5 min, followed by a hold at 4°C.
  • VH and VL amplicons were Sanger sequenced and then cloned into recombinant expression vectors and expressed as recombinant IgGl proteins.
  • B-cell tropic GFP reporter viruses (B95-8/F) 9* 10 6 293-2089 cells were seeded on a 15 cm tissue culture plate in cRPMI containing 100 ⁇ g/ml hygromycin. 24 hours later the cells were washed 2* with PBS, media was replaced with cRMPI without hygromycin, and the cells were and transfected with 15 ⁇ g of each of p509 (Delecluse et al., 1998) and p2670 (Neuhierl et al., 2002) expressing BZLF1 and BALF4, respectively, using GeneJuice transfection reagent (EMD Millipore Cat# 70967) according to the manufacturer's instructions.
  • EMD Millipore Cat# 70967 GeneJuice transfection reagent
  • B cells harboring AKATA-GFP EBV were suspended at 4* 10 6 cells/ml in RPMI containing 1 % FBS.
  • Anti- human IgG was added to a final concentration 100 ⁇ g/ml and incubated at 37°C for 4 hours.
  • Cells were then diluted to 2*10 6 cells/ml in RPMI containing 1 % FBS and incubated for 72 hours.
  • Cells were pelleted by centrifugation at 300 ⁇ g for 10 min and then the supernatant was passed through a 0.8 ⁇ filter.
  • Bacitracin was added to a final concentration of 100 ⁇ g/ml.
  • Virions were concentrated 25* by centrifugation at 25000 ⁇ g for 2 hours and re-suspended in RPMI containing 100 ⁇ g/ml bacitracin. Virus was stored at 4°C for up to 2 weeks.
  • B cell Neutralization Assay B cell neutralization assays were carried out in Raji cells essentially as described (Sashihara et al., 2009). Monoclonal antibodies were serially diluted in duplicate wells of 96 well round-bottom plates containing 25 ⁇ of cRPMI in duplicate. 12.5 ⁇ of B95-8/F virus (diluted to achieve an infection frequency of 1-5% at the final dilution) was added and incubated at 37°C for 1 hour. 12.5 ⁇ of cRMPI containing 4* 10 6 Raji cells/ml was added to each well and incubated for another hour at 37°C. The cells were then pelleted, washed once with cRPMI, and re-suspended in cRMPI. Antibody concentration is reported relative to the final infection volume (50 ⁇ ). After 3 days at 37°C, cells were fixed in 2% paraformaldehyde. The percentage of GFP+ Raji cells as determined on a BD LSRII cytometer.
  • %GFP+ cells in negative control wells were subtracted from each well.
  • the % neutralization for each well was plotted as a function of the logio of the MAb concentration.
  • the neutralization curve was fit using the log(inhibitor) vs response-variable slope (four parameters) analysis in Graphpad Prism 6 software.
  • Epithelial Cell Neutralization Assay 1.5* 10 4 SVKCR2 cells per well were seeded into a 96 well tissue culture plate. The following day antibodies were serially diluted in duplicate wells containing 20 ⁇ of media in a 96 well round bottom plate followed by the addition of 20 ⁇ of 25* concentrated epithelial cell-tropic virus and incubated for 15 min. Media was aspirated from the SVKCR2 cells and replaced by the antibody-virus mixture followed by a 3 hour incubation at 37°C. The antibody-virus mixture was then aspirated and replaced with media. 48 hours later the cells were trypsinized and the percentage of GFP positive cells were determined on an BD LSRII cytometer. Percent neutralization was determined as in the B cell neutralization assay.
  • Streptavidin-PE conjugated to 0.5 ⁇ g of gH/gL biotin (gH/gL- PE), or to 0.5 ⁇ g of gB (gB-PE) was diluted in 10 ⁇ of PBS to individual wells of a 96 well plate.
  • An equimolar amount of gp42 was added to select wells containing gH/gL-PE.
  • 7 ⁇ g of monoclonal antibodies, AMM01 , AMM04, or CL40 were added to select wells containing gH/gL ⁇ gp42 and incubated for 1.5 hours at room temperature.
  • adherent AGS cells were trypsinized, washed with cF-12 and then allowed to recover at 37°C 5% CO2 for 30 min. The cells were gently agitated and then returned to 37°C 5% CO2 for an additional 30 min. Recovered AGS, and Raji cells were pelleted by centrifugation at 300 x g for 3 min and then resuspended at a density of 1 x10 6 cells/ml in ice-cold 0.5% bovine serum albumin (BSA) in PBS.
  • BSA bovine serum albumin
  • CHO-K1 cells were seeded onto six-well plates at a density of 3* 10 5 cells/well. 24 hours later, the cells were transfected with 0.5 ⁇ g each of pCAGGS-gH, pCAGGS-gL, pCAGGS-gB (Haan et al., 2001) and 0.8 ⁇ g of pT7EMCLuc, which carries a luciferase-containing reporter plasmid under the control of the T7 promoter (Okuma et al., 1999), using GeneJuice, according to the manufacturer's instructions.
  • Crystallization of the AMM01 FAb and data collection Crystals of AMM01 Fab were obtained using a NT8 dispensing robot and screening was done with Rigaku Wizard Precipitant Synergy block#2, Molecular Dimensions Proplex screen HT-96, Hampton Research Crystal Screen HT by the vapor diffusion method. Crystals used for diffraction data were grown in 16.75% PEG 400, 13.4% PEG 3350, 0.1 M MgCI2, 0.1 M Tris pH 8.5. Crystals were cryo-protected in solutions containing 30% molar excess of their original reagents and 20% Glycerol. Crystal diffracted to 1.6 A (FIG. 1). Data was collected at ALS 5.1 and 5.2 and processed using HKL2000 (Otwinowski and Minor, 1997).
  • CTF parameters were estimated using GCTF(Zhang, 2016). Particles were picked using DoG Picker(Voss et al., 2009). Particle images were extracted using a box size of 192 pixels binned by a factor of 2 to an effective pixel size of 3.2 A/pixel and analyzed using RELION 2.0 (Kimanius et al., 2016).
  • CryoEM data processing Movie frames were aligned with MotionCor2 (Zheng et al., 2017), with the use of dose weighting. CTF parameters were estimated from the aligned micrographs without applied dose weighting, using GCTF (Zhang, 2016). Particles were picked from aligned dose-weighted micrographs using DoG Picker (Voss et al., 2009). Particle images were extracted using a box size of 224 pixels binned by a factor of 2 to an effective pixel size of 2.72 A/pixel and analyzed with RELION 2.0 (Kimanius et al., 2016).
  • Deviations from the input structures were allowed only if supported by density or to resolve stereochemical issues. Glycans were initially docked into the density and their geometry was then refined using Rosetta, optimizing the fit-to-density as well as the energetics of protein/glycan contacts.
  • the model of the gH/gl_/gp/42/AMM01 complex showing the displacement of gp42 was obtained by rigid-body docking the gp42 C-terminal domain into the corresponding density. The quality of the final model was validated using Molprobity (Chen et al., 2010) and Privateer (Agirre et al., 2015). Structure analysis was assisted by the PISA server (Krissinel and Henrick, 2007).
  • gH/gL mutant binding analysis Targeted mutations were introduced into pCAGGS-gH or pCAGGS-gL using the Quickchange XL site-directed mutagenesis kit (Agilent Genomics) using the manufacturer's instructions. All mutations were confirmed by Sanger sequencing. Wildtype and mutant gH or gl_ plasmids were co-transfected into 4ml of 293F cells at a density of 10 6 cells/ml in Freestyle 293 media (ThermoFisher) using the 293Free transfection reagent (EMD Millipore) according to the manufacturer's instructions.
  • ThermoFisher Freestyle 293 media
  • EMD Millipore 293Free transfection reagent
  • gH/gL positive cells were determined by PE (CL59) staining, using mock-transfected cells as a reference.
  • the level of AMM01 binding to gH/gL was determined by measuring the mean fluorescence intensity (MFI) of DL650 staining of PE+ cells. To account for differences in gH/gL expression the MFI of PE staining for each gH/gL variant (16 wells total) was averaged and used to normalize the DL650 staining of each well.
  • the normalized MFI of DL650 was plotted against the concentration of AMM01 for each well and fit to a sigmoidal dose response curve using GraphPad Prism software.
  • Mass spectrometry to identify glycopeptides 250 pmol of gH/gL and gp42 were separately prepared for mass spectrometry analysis of glycopeptides. Stock solutions were denatured, reduced and alkylated by dilution to 5 ⁇ in 50 ⁇ of buffer containing 100 mM Tris pH 8.5, 10 mM TCEP, 40 mM iodoacetamide and 2% (w/v) sodium deoxycholate. Samples were first heated to 95°C for 10 min and then incubated for an additional 20-30 min at room temperature in the dark.
  • the samples were split in two for digestion with trypsin and chymotrypsin (Sigma Aldrich) in parallel, by diluting 20 ⁇ of sample for each protease in a total volume of 100 ⁇ 50 mM ammonium bicarbonate pH 8.5. Protease was added to the samples in a ratio of 1 :75 by weight and left to incubate at 37°C overnight. After digestion, 2 ⁇ of formic acid was added to the samples to precipitate the sodium deoxycholate from solution. After centrifugation for 20 min at maximum speed in a bench top centrifuge, 80 ⁇ _ of the supernatant was collected. For each sample 8 ⁇ _ was injected on a Thermo Scientific Orbitrap Fusion Tribrid mass spectrometer.
  • Nanospray LC- MS/MS was used to separate peptides over a 110-min gradient from 5% to 30% acetonitrile with 0.1 % formic acid.
  • a positive spray voltage of 2 100 V was used with an ion-transfer-tube temperature of 350°C.
  • An electron-transfer/higher-energy collision dissociation ion-fragmentation scheme (Frese et al., 2013) was used with calibrated charge-dependent ETD parameters and supplemental higher-energy collision dissociation energy of 0.15.
  • a resolution setting of 120,000 with an AGC target of 2 ⁇ 10 5 was used for MS1
  • a resolution setting of 30,000 with an AGC target of 1 ⁇ 10 5 was used for MS2.
  • Data was searched with Protein Metrics Byonic software (Bern et al., 2012), using a small custom database of recombinant protein sequences including gH, gl_, gp42, other viral glycoproteins and the proteases used to prepare the glycopeptides. Reverse decoy sequences were also included in the search.
  • EBV glycoproteins conjugated to streptavidin-PE were used to identify antigen-specific class-switched B cells.
  • the majority of B cells stained positive with gp350 or gp42 (FIG. 4A) due to their ability to bind CD21 (Tanner et al., 1987) and CD35 (Ogembo et al., 2013) or MHCII (Haan et al., 2000; Spriggs et al., 1996), respectively.
  • Attempts to completely block gp350 and gp42 binding to these cellular receptors with commercially available antibodies were unsuccessful and efforts to sort these B cells were not pursued further.
  • FIG. 5 Based on the number of cells that were excluded using this approach, it was estimated that a 2.5 fold enrichment of antigen specific B cells was achieved (FIG. 5). Sorting was carried out starting with a total of 8*10 8 cryopreserved peripheral blood mononuclear cells from three separate donors using PE-conjugated gH/gL, gB, or gH/gL and gB concurrently (FIG. 6). B cells were individually sorted into irradiated feeder cell cultures in the presence of recombinant cytokines. To verify isolation of antigen-specific B cells, the supernatants were screened for antigen reactivity by ELISA.
  • VH variable heavy
  • VL variable light
  • VH/VL sequences were cloned into recombinant expression vectors and that AMM01 specifically bound to gH/gL, and that AMM02-AMM05 specifically bound to gB using biolayer interferometry (BLI, FIG. 4C) was verified.
  • AMM01 inhibits EBV infection of both epithelial cells and B cells.
  • the ability of AMM01- AMM05 to neutralize EBV infection of epithelial cells (FIG. 8A) and B cells (FIG. 8B) was assessed.
  • the murine anti-gH/gL MAbs CL40, CL59 and E1 D1 which have been reported to completely block epithelial cell infection but poorly inhibit B-cell infection (Chesnokova and Hutt- Fletcher, 2011 ; Wu et al., 2005) were also included.
  • the anti-gH/gL MAbs AMM01 , CL40 and CL59 had comparable potency.
  • the anti-gH/gL E1 D1 antibody displayed incomplete neutralization at the highest concentration tested.
  • the other anti-gB MAbs (AM M 02-AM M 04) were non-neutralizing (FIG. 8A).
  • CL40, CL59 and E1 D1 failed to completely neutralize EBV infection of B cells, (Chesnokova and Hutt-Fletcher, 2011 ; Molesworth et al., 2000) (FIG. 8B).
  • a reconstruction of the complex at a resolution of 4.8A, which resolves secondary structural elements and several amino acid side chains as well as densities corresponding to N-linked glycans on gH, gL and gp42 was determined.
  • the local resolution varies between 4A in the region of the map corresponding to the gH core and 4.5-6.0A for gL, gp42 and AMM01 (FIG. 14).
  • AMM01 binds to a discontinuous epitope spanning gH/gL D-l and D-ll, which includes residues of both gH and gl_, and burying a surface area of 1160 A 2 on gH/gL and on AMM01 (FIGs. 13E, 13F).
  • CDRL2 contacts the 2a-4 helix (FIGs. 13E, 13F).
  • CDRH3 also binds the short helix between the 2 ⁇ -7 and 2 ⁇ -8 strands, and the loop between 2a-1 and 2 ⁇ -1.
  • CDRL1 binds to the gH/gL interface, contacting the gH 2a-1 linker helix between D-l/D-ll, and the gL C- terminal La-3 helix (FIGs. 13E, 13F).
  • N-linked glycan on gH-N60 is oriented such that it appears to form interactions with the AMM01 framework region and could putatively contact the CDRL2 (FIG. 13G).
  • N-linked glycosylation in gH, gL and gp42 was profiled by on-line reversed-phase liquid chromatography with electron transfer/high-energy collision-dissociation tandem mass-spectrometry which verified the presence of several high-mannose and hybrid glycans at the gH-N60 position (FIGs. 14H, 6).
  • the cryoEM structure indicates that the AMM01 epitope is distinct from that of E1 D1 and CL59, which bind exclusively to gL and to D-IV, respectively (Sathiyamoorthy et al., 2016; Sathiyamoorthy et al., 2017).
  • Comparison of the gH/gl_/gp42/AMM01 cryoEM structure with the recently described gH/gL/gp42 N-terminal domain/CL40 crystal structure (Sathiyamoorthy et al., 2017), showed not only that the epitopes of the two antibodies overlap at the 2a-4 helix, but also that their FAb fragments would clash with each other upon binding to gH/gL (FIGs.
  • FIG. 19A Two-dimensional classification of negatively stained gH/gL/gp42 (FIG. 19A) and gH/gl_/gp42/AMM01 complexes (FIGs. 19B, 19C) also unambiguously showed that a small fraction of AMM01 -bound complexes had a displaced gp42 CTD (FIG. 19C). In contrast, gp42 was displaced from all gH/gL/gp42/CL40 complexes under the same conditions (FIG. 19D).
  • AMM01 Neutralization Mechanism Since AMM01 can alter the conformation of gp42 in the complex, it was assessed whether it also affected the ability of gH/gl_/gp42 to bind to HLA class II and did not observe difference in the binding irrespective of the presence of the AMM01 FAb (FIG. 20A). It was also assessed whether AMM01 binding to gH/gL/gp42 could affect the ability of the complex to bind to B cells. As expected, PE-labeled gH/gL bound to Raji cells in the presence, but not in the absence of gp42 (FIG. 20B).
  • gH/gL is thought to interact directly with ⁇ , ⁇ , or ⁇ integrins present at the surface of epithelial cells through the KGD motif on gH D-ll (Chen et al., 2012; Chesnokova and Hutt-Fletcher, 201 1 ; Chesnokova et al., 2009).
  • the results suggest that AMM01 binding could restrict integrin access to the KGD motif due to the proximity of its epitope (FIG. 13G). Binding of gH/gL to ⁇ , ⁇ or ⁇ integrins was not detected (FIG. 20D).
  • AMM01 potently neutralizes EBV infection of both B cells and epithelial cells points to a common mechanism of viral inhibition. Since AMM01 fails to completely block binding of gH/gL to epithelial cells, or gH/gL/gp42 to B cells it was hypothesized that AMM01 is likely interfering with gB activation and membrane fusion. Using a virus-free cell fusion assay (McShane and Longnecker, 2005), it was observed that the anti-gH/gL MAbs AMM01 and CL40, and the anti-gB MAb AMM05 significantly reduced cell fusion whereas the non-neutralizing MAb AMM03 had no effect (FIG. 20E).
  • EBV Orally transmitted EBV establishes lytic infection in permissive cells in the oral mucosa such as epithelial cells or infiltrating B cells (Rickinson et al., 2014; Taylor et al., 2015). EBV has tropism for both cell types and it is not clear which one is preferentially infected during primary infection (Tangye et al., 2017). The virus could first infect epithelial cells and lytic viral replication would subsequently seed B cell infections.
  • the virus may initially infect infiltrating B cells, which would lead to subsequent targeting of epithelial cells.
  • B cells may be mutually exclusive, thus a combination of epithelial and B cell neutralizing antibodies may be required to mosteffectively block incoming virus at the oral mucosa (Herrman et al., 2015).
  • Serum antibodies from natural infection can neutralize EBV entry in both B cells and epithelial cells in vitro but the epitopes targeted by these MAbs are unknown.
  • Previously isolated anti-gp350 MAbs can inhibit infection of B cells but not CD21 negative epithelial cells.
  • known anti-gH/gL antibodies are effective at preventing epithelial cell infection but fail to prevent B cell infection.
  • AMM01 has utility as a therapeutic agent as well. Passive administration of the 72A1 MAb demonstrated capacity to prevent EBV infection during the early post- transplant period in high- risk EBV-seronegative transplant recipients. However, administration of 72A1 led to the production of anti-drug antibodies, which were attributed to its murine origin (Haque et al., 2006). Since AMM01 can neutralize infection of the two main cell types targeted by EBV, and is human- derived, this antibody presents a more effective and safer alternative than 72A1.
  • EBV infection of B cells and epithelial cells requires gH/gL to engage distinct cell- surface receptors, which lead to triggering of gB-mediated fusion.
  • the unique ability of AMM01 among anti-gH/gL MAbs to neutralize both epithelial and B cell infection points to a common mechanism of neutralization, without being bound by theory, most likely by interfering with gB triggering. This is supported by the observation that AMM01 blocks cell-cell fusion in a virus-free assay. Mutagenesis data identified that the D-l/D-ll linker region is key for activation of membrane fusion during B cell and epithelial cell infection (Matsuura et al., 2010; Omerovic et al., 2005).
  • AMM01 binds to elements of D-l (including gL), D-ll, and the linker helix bridging D-l and D-ll, it could also inhibit gB activation by acting as a molecular clamp which prevents movements within and across D-l and D-ll that are necessary for gB triggering (Fig. 7B).
  • CMVgH/gL resembles that of EBVgH/gL, including a groovebetween D-l and D-ll that is connected by a linker helix (Chandramouli and Malito, 2017). It has been proposed that binding of the CMVgH/gl_/UL128/UL130/UL131 pentamer to a cell surface receptor induces a D-l rearrangement around the linker helix which leads to a widening of the D-l/D-ll groove and gB triggering (Chandramouli and Malito, 2017). Thus, antibodies that target the linker helix are important for CMV vaccine design as well. In line with this notion, the human MAb 13H1 1 , which neutralizes CMV infection of both epithelial cells and fibroblasts binds in proximity of the linker helix of CMVgH/gL.
  • AMM01 The fusion inhibition activity of AMM01 is further supported by studies of neutralizing MAbs against gH/gL from other herpesviruses.
  • MAbs that inhibit gB- mediated fusion of varicella zoster virus (VZV) bind to epitopes bridging the first two domains of VZVgH/gL (FIG. 22A, 22B) (Xing et al., 2015).
  • Escape mutations from the LP11 antibody which blocks the herpes simplex virus (HSV) gH/gL-gB interaction, also map to a similar epitope region on HSVgH/gL (Chowdary et al., 2010).
  • CL40 weakly neutralizes B-cell infection compared to AMM01 , and binds exclusively to gH D-ll/D-lll.
  • Previous studies suggested that displacement of the gp42 CTD by CL40 prohibits a conformation of the gH/gL/gp42/HLA class II complex necessary for triggering gB-mediated fusion during B cell infection (Sathiyamoorthy et al., 2017).
  • CL40 more readily displaces gp42 than AMM01 but fails to potently neutralize B-cell infection, suggests that this is not the primary mechanism of B-cell neutralization by AMM01.
  • AMM01 could contribute to neutralization by restricting access of gH/gL or gH/gL/gp42 to cell surface receptors during epithelial and B cell infection, respectively (Fig. 7 C-D).
  • AMM01 reduced binding of gH/gl_/gp42 to the surface of B cells.
  • CL40 which binds to gH near the AMM01 epitope has no effect on the binding of gH/gl_/gp42 to B cells. This result could explain the difference in B cell neutralization potency between these two MAbs.
  • AMM01 also reduced binding of gH/gL to the surface of epithelial cells, ⁇ ⁇ 6, and ⁇ integrins (Chesnokova and Hutt- Fletcher, 2011 ; Chesnokova et al., 2009), and EphA2 (Chen et al., 2018; Zhang et al., 2018) have been implicated as cell surface EBV receptors during epithelial cell infection. Since a weak interaction between gH/gL and EphA2 was detected, which was unaffected by AMM01 , it is unlikely that AMM01 inhibits EBV infection of epithelial cells by blocking this interaction.
  • the KGD motif on D-ll of gH/gL is believed to mediate direct binding to integrins (Chesnokova and Hutt-Fletcher, 2011 ; Chesnokova et al., 2009; Sathiyamoorthy et al., 2016; Sathiyamoorthy et al., 2017). Although the KGD motif remains exposed when AMM01 is bound (Fig. 3G), its presence would greatly reduce accessibility to integrin. An interaction between gH/gL and soluble ⁇ ⁇ or ⁇ integrins was not detected by BLI (Fig.
  • AMM05 Mab was also characterized.
  • AMM05 is the first reported anti-gB antibody with neutralizing activity against EBV, although it only inhibits entry into epithelial cells.
  • the observed potency of AMM01 towards EBV infection of epithelial cells and B cells suggests that the mechanism of gB activation by gH/gL is similar in both cases.
  • the inability of AMM05 to antagonize B cell infection points to putative differences in gB triggering and/or fusion during EBV entry into the two cell types.
  • AMM01 is currently the only known anti-gH/gL antibody that potently neutralizes both epithelial and B-cell infections.
  • the near-atomic resolution cryoEM structure of the gH/gl_/gp42/AMM01 complex presented here defines a key site of EBV vulnerability and paves the way for the design of next-generation subunit vaccines.
  • the moderate level of somatic mutation in AMM01 is within the range that could be elicited with current human vaccine regimens implemented for influenza or HIV (Easterhoff and Moody, 2017; Joyce et al., 2016; Moody et al., 2011 ; Wrammert et al., 2008).
  • AMM01 can be used to treat and/or prevent EBV-related complications such as lymphoproliferative diseases in organ transplant recipients and immunocompromised individuals.
  • Example 3 Human hematopoietic progenitor stem cells engrafted in immunocompromised mice develop into human B cells that can be infected with EBV. A low EBV dose results in persistent latent infection that mimics natural human infection, while a higher dose results in a lymphoproliferative disease state.
  • B cells were harvested from these mice and challenged with a low-dose EBV reporter virus that induces GFP expression upon infection. The absence of antibody could readily be detected (FIG. 23A, left), yet there was no evidence of infection in the presence of AMM01 (FIG. 233A, right).
  • each embodiment disclosed herein can comprise, consist essentially of or consist of its particular stated element, step, ingredient or component.
  • the terms “include” or “including” should be interpreted to recite: “comprise, consist of, or consist essentially of.”
  • the transition term “comprise” or “comprises” means includes, but is not limited to, and allows for the inclusion of unspecified elements, steps, ingredients, or components, even in major amounts.
  • the transition phrase “consisting essentially of” limits the scope of the embodiment to the specified elements, steps, ingredients or components and to those that do not materially affect the embodiment.
  • a material effect would cause a statistically-significant reduction in the ability of an anti-EBV antibody to neutralize EBV in the assay described in relation to FIGs. 8A, 8B. In particular embodiments, a material effect would cause a statistically-significant reduction in a primary antibody response to an EBV vaccine.
  • the term "about” has the meaning reasonably ascribed to it by a person skilled in the art when used in conjunction with a stated numerical value or range, i.e. denoting somewhat more or somewhat less than the stated value or range, to within a range of ⁇ 20% of the stated value; ⁇ 19% of the stated value; ⁇ 18% of the stated value; ⁇ 17% of the stated value; ⁇ 16% of the stated value; ⁇ 15% of the stated value; ⁇ 14% of the stated value; ⁇ 13% of the stated value; ⁇ 12% of the stated value; ⁇ 1 1 % of the stated value; ⁇ 10% of the stated value; ⁇ 9% of the stated value; ⁇ 8% of the stated value; ⁇ 7% of the stated value; ⁇ 6% of the stated value; ⁇ 5% of the stated value; ⁇ 4% of the stated value; ⁇ 3% of the stated value; ⁇ 2% of the stated value; or ⁇ 1 % of the stated value.
  • Ephrin receptor A2 is a functional entry receptor for Epstein-Barr virus.
  • Ephrin receptor A2 is an epithelial cell receptor for Epstein-Barr virus entry. Nature Microbiology.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Mycology (AREA)
  • Wood Science & Technology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

Anti-Epstein Barr Virus (EBV) antibodies and vaccines are described herein. The antibodies and vaccines can be used to treat and/or reduce the risk of EBV infection and to treat and/or reduce the risk of complications associated with EBV infection, such as infectious mononucleosis, lymphoproliferative disorders, carcinomas, and smooth muscle tumors.

Description

EPSTEIN BARR VIRUS ANTIBODIES, VACCINES, AND USES OF THE SAME
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional Patent Application No. 62/504,447 filed May 10, 2017 and to U.S. Provisional Patent Application No. 62/560,061 filed September 18, 2017, the entire contents of both of which are incorporated by reference herein in their entirety.
FIELD OF THE DISCLOSURE
[0002] Anti-Epstein Barr Virus (EBV) antibodies, vaccines, and uses of the same are described. The antibodies and vaccines can be used to treat and/or reduce the risk of EBV infection and also to treat and/or reduce the risk of complications associated with EBV infection, such as infectious mononucleosis, lymphoproliferative disorders, carcinomas, and smooth muscle tumors. Cells can be genetically engineered to express the antibodies, vaccines, or fragments thereof, for example, in vivo.
BACKGROUND OF THE DISCLOSURE
[0003] Epstein Barr virus (EBV) is an orally transmitted gamma herpesvirus that infects B cells and epithelial cells in the majority of adults worldwide. Most primary infections are asymptomatic, however, EBV is a causative agent of infectious mononucleosis (IM) in children and young adults. Following primary infection, infected individuals become lifelong carriers of EBV, which can lie dormant (i.e., latent) in cells. However, in certain individuals the latent virus can begin to express genes that alter cellular replication, leading to cancer or cancer-like diseases. EBV is also associated with nasopharyngeal carcinoma and lymphoproliferative disorders in immunocompromised patients such as those with HIV/AIDS or in patients undergoing immune suppression for organ transplantation. Thus, antibodies or vaccines that treat, reduce, or prevent EBV infection of cells or treat EBV-associated diseases would be a major benefit to public health.
[0004] A primary goal of most vaccine design strategies is to elicit production of neutralizing antibodies, which are a type of antibody that can inhibit the biological function of its target. Neutralizing antibodies are also useful as protein therapeutics to treat viral infection. Neutralizing antibodies against viruses such as EBV typically function by blocking a virus from entering a cell.
[0005] To enter a cell, EBV, like other herpesviruses, first attaches to the cell surface through an interaction between a protein on the surface of the virus and a receptor binding site of a cell surface protein. Following this attachment, the virus membrane can fuse with the cell membrane, allowing the contents of the virus to be inserted into the cell. Viral fusion also occurs through interaction of a viral protein with an epitope on an antigen of a cell protein. The interactions resulting in viral attachment to a cell and the interactions resulting in viral fusion to a cell are distinct, each involving different viral proteins and different cellular proteins. Thus, neutralizing antibodies could block EBV entry into cells by preventing virus/cell protein interactions leading to attachment and/or fusion.
[0006] Previous efforts to design EBV vaccines have included vaccines that target the EBV protein gp350, which is involved in EBV attachment to cells. However, while a phase 2 trial showed that the vaccine could reduce the incidence of IM, it did not protect from EBV infection. Furthermore, EBV vaccine research to-date has not led to the development of an effective human neutralizing antibody against EBV.
SUMMARY OF THE DISCLOSURE
[0007] The current disclosure provides anti-Epstein Barr virus (EBV) antibodies, EBV vaccines, and uses of the same. In particular embodiments, the anti-EBV antibodies are effective human neutralizing antibodies. In particular embodiments the anti-EBV antibodies neutralize EBV infection of B cells and epithelial cells. In particular embodiments, the disclosed anti-EBV antibodies are referred to herein as AMM01 , AMM02, AMM03, AMM04 and AMM05.
[0008] In particular embodiments the anti-EBV antibodies bind the EBV core fusion machinery: heterodimer envelope glycoprotein H/envelope glycoprotein L (gH/gL) and/or glycoprotein B (gB). In particular embodiments, the anti-EBV antibodies bind across the D-l/D-ll groove of the gH/gL heterodimer complex. In particular embodiments, the anti-EBV antibodies bind at least one of residues 60, 70-81 , 21 1-216, and 234-239 of gH; and/or at least one of residues 123-128 of gL. In particular embodiments, the anti-EBV antibodies bind residues 60, 70-81 , 21 1-216, and 234- 239 of gH; and residues 123-128 of gL. In particular embodiments, the anti-EBV antibodies bind residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine. These epitopes bound by the antibodies of the disclosure can be used as vaccine antigen epitopes to produce EBV vaccines.
[0009] In particular embodiments the anti-EBV antibodies include a human antibody, or an antigen-binding portion thereof (including scFv) that dissociates from EBV gH/gL with a KD of 1X10"10 or less and a k0ff rate constant of 3X10"5 s"1 or less, both determined by surface plasmon resonance or biolayer interferometry. In particular embodiments, the anti-EBV antibodies neutralize EBV infection of B cells and/or epithelial cells with an IC50 of 3X10"9M or less.
[0010] In particular embodiments, the anti-EBV antibodies include SEQ ID NO: 41 and SEQ ID NO: 42 with mutations selected from one or more heavy chain mutations selected from D10E; G76S; S83R; T84S; F91Y; V107T; and P1 13S and/or one or more light chain mutations selected from E3V; Q17K; R18T; T20R; Q49Y; S69N; and G100T.
[0011] In particular embodiments, the anti-EBV antibodies include SEQ ID NO: 41 and SEQ ID
NO: 42 with heavy chain mutations D10E; G76S; S83R; T84S; F91Y; V107T; and P1 13S and light chain mutations E3V; Q17K; R18T; T20R; Q49Y; S69N; and G100T.
[0012] In particular embodiments, the anti-EBV antibodies include SEQ ID NO: 1 and SEQ ID
NO: 2. In particular embodiments, SEQ ID NO: 1 includes mutation Q1 N.
[0013] In particular embodiments, the anti-EBV antibodies include SEQ ID NO: 3 and SEQ ID
NO: 4. In particular embodiments, SEQ ID NO: 3 includes mutation Q1 N.
[0014] In particular embodiments, the anti-EBV antibodies include SEQ ID NO: 5 and SEQ ID
NO: 6. In particular embodiments, SEQ ID NO: 5 includes mutation E1 N. In particular embodiments, SEQ ID NO: 6 includes mutation Q1 N. In particular embodiments, SEQ ID NO: 5 includes mutation E1 N and SEQ ID NO: 6 includes mutation Q1 N.
[0015] In particular embodiments, the anti-EBV antibodies include SEQ ID NO: 7 and SEQ ID NO: 8. In particular embodiments, SEQ ID NO: 7 includes mutation Q1 N.
[0016] In particular embodiments, the anti-EBV antibodies include SEQ ID NO: 9 and SEQ ID NO: 10. In particular embodiments, SEQ ID NO: 9 includes mutation E1 N. In particular embodiments, SEQ ID NO: 10 includes mutation E1 N. In particular embodiments, SEQ ID NO: 9 includes mutation E1 N and SEQ ID NO: 10 includes mutation E1 N.
[0017] In particular embodiments, the anti-EBV antibodies include the complementary determining regions (CDRs): SEQ ID NO: 11 , SEQ ID NO: 12, SEQ I D NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16; SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , and SEQ ID NO: 22; SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28; SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, and SEQ ID NO: 34; or SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, and SEQ ID NO: 40.
[0018] In particular embodiments the EBV antibodies and/or vaccine antigen epitopes can be formulated to treat an EBV-infected subject or a subject at risk of EBV infection. In particular embodiments, cells, such as B cells, can be genetically modified to express one or more EBV antibodies and/or vaccine antigen epitopes described herein. Genetic modification can be in vivo or in vitro. Treating EBV can reduce EBV infection and/or treat a condition associated with EBV infection, such as infectious mononucleosis or lymphoproliferative disorder. Moreover, high levels of antibodies that neutralize EBV B-cell infection are associated with lowered risks for nasopharyngeal carcinoma. BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
[0019] Some of the drawings submitted herein are described in color. Applicant considers the color versions of the drawings as part of the original submission and reserves the right to present color images of the drawings in later proceedings.
[0020] FIG. 1. X-ray data collection and refinement statistics.
[0021] FIG. 2. CryoEM data collection and refinement statistics.
[0022] FIGs. 3A-3C. Biochemical and antigenic characterization of EBV glycoprotein ectodomains. (FIG. 3A) Purified EBV ectodomain proteins were separated by reducing and non- reducing SDS-PAGE and stained with Coomassie Brilliant Blue as indicated. gH/gL formed a heterodimer. Under non-reducing conditions, gB ran as a single band of 120 kDa. Under reducing conditions, the majority of gB runs as 2 bands corresponding to 80 and 40 kDa, consistent with efficient furin- mediated proteolytic cleavage and disulfide bond formation. (FIG. 3B) Anti-EBV antibodies were captured from hybridoma supernatants using anti-mouse Fc capture biosensors and binding to a 0.5 μΜ solution of purified EBV ectodomain proteins was evaluated as indicated. The antibody is indicated at the top of each panel and its antigenic target is included in parentheses. (FIG. 3C) EC50 of serum binding responses to gp42, gH/gL, gp350 and gp42 from 16 donors were measured by ELISA. Symbols and error bars present the mean and standard deviation of two independent measurements performed in duplicate. Symbols on the dashed line represent a seropositive response that did not saturate at the highest concentration tested. Symbols on the abscissa represent undetectable serum responses at the highest concentration tested.
[0023] FIGs. 4A-4C. Isolation of anti-EBV antibodies from antigen specific B cells. (FIG. 4A) Class switched B cells (live, single, CD14-, CD16-, CD3-, CD19+, CD20+, IgM-, IgD-) were stained with streptavidin-PE, or streptavidin-PE conjugated to gH/gL, gB, gp350, or gp42 as indicated. (FIG. 4B) Peripheral blood mononuclear cells were stained with a decoy protein conjugated to streptavidin-PE-DL650 and streptavidin-PE alone, or streptavidin-PE conjugated to gH/gL or gB as indicated. A positive magnetic enrichment using anti-PE microbeads was performed and then cells were stained as in FIG. (4A). PE-DL-650- / PE+ B cells (live, single, CD14-, CD16-, CD3-, CD19+, CD20+, IgM-, IgD-) are shown. Numbers indicate the % of PE+ class switched B cells in each panel in FIGs. 4A and 4B. (FIG. 4C) AMM01 , AMM02, AMM03, AMM04, and AMM05, antibodies cloned from B cells sorted using the approach in (FIG. 4B) were loaded onto anti- human Fc capture biosensors. Binding to 0.5μΜ solutions of gB, gp42, gp350 and gH/gL was measured by BLI as indicated. PE: phycoerythrin SSA: side-scatter area in (FIG. 4A) and (FIG. [0024] FIGs. 5A-5C. Example of gating strategy for sorting antigen positive B cells. (FIG. 5A) PBMC from an EBV-seropositive donor were stained with gH/gL conjugated to streptavidin- PE, viability dye, and antibodies specific for CD3, CD14, CD16, CD19, CD20, IgM, and IgD. (FIG. 5B) PBMC were stained with gH/gL-PE and a decoy protein conjugated to PE-DL650. PE+ and PE- DL650+ cells were enriched using magnetic beads conjugated to an anti-PE antibody. The cells were stained as in (FIG. 5A). Cells in the pink gate on the right-most panel were sorted using FACS. (FIG. 5C) The bottom right panel in (FIG. 5B) is shown in black. There are 45 cells PE+/PE- DL650 (black cells) in the gate, with cells excluded from previous gate (PE-DL650+) overlaid in gray (n=70). 4.2*106 events are shown in (5 FIG. A) and 3.2*105 events are shown in (FIG. 5B) and FIG. (5C).
[0025] FIG. 6. Summary of antigen-specific B cell sorting and VH/VL recovery.
[0026] FIG. 7. Sequences of isolated anti-EBV MAbs. The amino acid sequence of the isolated antibodies is shown as an alignment to the closest chromosomally encoded V- D- and J-gene segments shown in underlining, bold italics, and bold underlining, respectively. "" indicates identity to chromosomally encoded amino acid. The complementary determining regions (Kabat definition) are highlighted in gray. The percentage of VH or VL mutation based on the nucleotide sequence is provided for each antibody chain, and the Genbank accession number is provided in brackets. The gene usage, and mutation percentages were determined using the IMGT/V-Quest tool (Brochet et al., 2008, Nucleic Acids Research doi: 10.1093/nar/gkn316. PubMed PMID: 18503082).
[0027] FIGs. 8A, 8B. Neutralization of EBV infection in epithelial cells and B cells by newly isolated MAbs. Serial dilutions of the indicated antibodies were evaluated for their ability to neutralize (FIG. 8A) AKTA-GFP EBV infection of epithelial (SVKCR2) cells or (FIG. 8B) B95.8/F EBV infection of B (Raji) cells. Anti-gH/gL antibodies are AMM01 , CL40, CL59, AND E1 D1 , anti-gB antibodies are AMM02, AMM03, AMM04, and AMM05, and the anti-gp350 antibody is 72A1. The human or murine origins of the antibodies are indicated in the legend.
[0028] FIG. 9. Kinetic analysis of antibodies, or gp42 binding to gH/gL measured by BLI.
[0029] FIG. 10. E1 D1 binding to gH/gL is pH-dependent. Biotinylated E1 D1 was immobilized on streptavidin biosensors. After obtaining a baseline reading in KB, the biosensors were immersed into 50 nM solutions of gH/gL in KB at the indicated pH for 250 s, and then immersed into kinetics buffer at the indicated pH for 750 s.
[0030] FIG. 11. Crystal structure of the free AMM01 Fab. (Left) AMM01 Fab shown as ribbon representation with light chain shown in light and heavy chain in dark. CDRs are marked. (Middle) Surface representation of AMM01 Fab with Arg100A of heavy chain protruding towards the solvent. No clear electron density was observed for Arg100A and the most favorable rotamer was chosen. However, Argl OOA appears to interact with DM of gH in the cryo-EM model. (Right) 90° rotation, view down the combining site with CDRs labeled.
[0031] FIGs. 12A, 12B. AMM01 forms a 1 : 1 : 1 complex with gH/gL and gp42. (12A) Equimolar amounts of gH/gL, gp42, and the AMM01 FAb were passed over a 10/300 S200 superdex column alone, or pre-incubated together as indicated. The absorbance was measured at 280 nM and the peaks from each run were overlaid. (12B) Fractions corresponding to the peak in (12A) were collected, concentrated and separated by reducing SDS-PAGE, and stained with Coomassie Brilliant Blue.
[0032] FIGs. 13A-13G. (FIG. 13A) CryoEM reconstruction of gH/gL-gp42-AMM01 complex at 4.8 A resolution. (FIG. 13B) 90° rotation from (FIG. 13A): AMM01 heavy chain is marked, AMM01 light chain is marked, gL is marked, gH D-l is marked, gH D-ll is marked, gH D-lll is marked, gH D-IV is marked, and gp42 is marked. (FIGs. 13C, 13D) Ribbon diagram of the gH/gl_/gp42- AMM01 atomic model rendered with the same colors as panels FIG. 13A and FIG. 13B. (FIG. 13E) Zoomed-in view of the AMM01 epitope with regions of interest labeled. (FIG. 13F) AMM01 footprint on the gH/gl_/gp42 complex. For clarity, only the AMM01 CDR loops are shown interacting with gH/gl_/gp42 rendered in surface representation. Residues that have been identified as being important for AMM01 binding (K73 and Y76) are marked with an asterisk. (FIG. 13G) The gH N60 glycan is shown in stick representation in the corresponding region of cryoEM density to highlight the putative contacts made with AMM01. The black dot shows the position of the gH KGD motif
[0033] FIGs. 14A— 14H. Overview of cryo electron microscopy and glycan analysis of gH/gL- gp42-AMM01 complex (FIG. 14A) Representative micrograph of frozen-hydrated gH/gL-gp42- AMM01 complex. Scale bar: 200 nm. (FIG. 14B) Selected 2D class averages. (FIG. 14C) Schematic workflow for 3D reconstruction of gH/gL- gp42-AMM01 complex in RELION 2.0. (FIG. 14D) FSC curve for final reconstruction of gH/gl_/gp42 complex. Resolution at FSC=0.143 is 4.8 A. (FIG. 14E) Angular distribution of particle images in the final reconstruction. (FIG. 14F) ResMap-based estimate of local resolution (in A) of the final reconstruction. (FIG. 14G) FSC curve for final reconstruction of gH/gl_/gp42 complex in which the gp42 C terminal domain is displaced. (FIG. 14H) Characterization of the gH/gl_/gp42 glycans by mass spectrometry. The predominant type of identified N-linked glycan is represented at each site. Glycans are shown with parentheses to highlight their variability and the unresolved branching structure.
[0034] FIGs. 15A-15E. Binding of AMM01 to cell-surface expressed gH/gL mutants. gH/gL with the indicated mutations were expressed on the surface of 293F cells and stained with the CL59 MAb followed by an anti-mouse PE secondary Ab and serially-diluted AMM01 conjugated directly to DL650. Cells expressing gH/gL variants were identified by PE (CL59) staining. (FIG. 15A) Mean-fluorescence intensity (MFI) of PE positive cells expressing WT gH/gL or gH with mutated gL variants. The PE-MFI of mock transfected cells is shown as a control. (FIG. 15B) The DL650 MFI for each gH/gL variant was normalized to the PE-MFI of the gH/gLN127A mutant (shown in A) and plotted as a function of AMM01 concentration. (FIG. 15C) The mean-fluorescence intensity (MFI) of PE positive cells expressing WT gH/gL or mutant gH variants paired with WT gL. The PE-MFI of mock transfected cells is shown as a control. (FIGs. 15D, 15E) The DL650 MFI for each gH/gL variant was normalized to the PE-MFI of the gHS79R/gL mutant (shown in FIG. 15C) and plotted as a function of AMM01 concentration. gH/gL variants with mutations in the 2a1 and 2a4 helices of gH along with WT gH/gL are shown in 15D and 15E respectively.
[0035] FIG. 16. A heavy chain Q1 N mutation does not affect AMM01 neutralization potency. Serial dilutions of wildtype AMM01 (WT AMM01) or AMM01 containing a Q1 N heavy chain mutation (AMM01 Q1 NHC) antibodies were evaluated for their ability to neutralize AKTA-GFP EBV infection of epithelial (SVKCR2) cells or B95.8/F EBV infection of B (Raji) cells as indicated.
[0036] FIGs. 17A-17G. AMM01 and CL40 share partially overlapping epitopes. Ribbon diagrams of the gH/gL/gp42-AMM01 (FIG. 17A) and gH/gL/gp42-CL40 complexes (FIG. 17B, PDB 5W0K). AMM01 heavy chain, AMM01 light chain, CL40, gL, gH D-l, gH D-ll, gH D-lll and gH D-IV are indicated. gp42 is omitted from FIG. 17A and FIG. 17B for clarity. (FIG. 17C) gH/gL residues experiencing a change in accessible surface area upon antibody binding are indicated and colored medium grey (AMM01) and dark grey (CL40). Areas that experience a change in accessible surface area upon binding of either AMM01 or CL40 are shown in dark pink. Biotinylated AMM01 (FIG. 17D), CL40 (FIG. 17E), CL59 (FIG. 17F), or E1 D1 (FIG. 17G) were immobilized on a streptavidin biosensor and used to measure binding a 250 nM solution of gH/gL alone, or pre-complexed with 500 nM of non-biotinylated antibody by BLI as indicated. The unrelated anti-influenza hemagglutinin glFI6 MAb was used as a negative control.
[0037] FIGs. 18A-18F. An AMM01-gp42 N173 glycan clash displaces the gp42 CTD. (FIG. 18A) gH/gL residues that experience a change in accessible surface area upon AMM01 binding are colored medium grey (indicated by arrows), those that experience a change in accessible surface area upon gp42 binding are colored dark grey (indicated by arrows. Asn 240 (circled) experiences a change in accessible surface area upon binding to AMM01 and to gp42. (FIG. 18B) Zoomed- in view of the region around gH Asn 240. Ribbons are rendered with the same shading as in FIGs. 13A-13G. (FIG. 18C) CryoEM reconstructions of the gH/gl_/gp42-AMM01 complex show that most particle images harbor the gp42 C-domain bound on top of gH D-ll. (FIG. 18D) A small fraction of particle images are characterized by a displacement of the gp42 C-domain. The map is shown at high contour (isosurface) and at low contour (mesh) level to demonstrate that the gp42 CTD is much less well ordered than the rest of the complex. The orientation of the gp42- CTD is approximate due to the limited resolution of this reconstruction. (FIG. 18E) The 4.8 A resolution reconstruction shown in (FIG. 18C) reveals that the gp42 N173 glycan points toward the AMM01 framework region. The glycan is rendered in stick representation with the corresponding region of cryoEM density (bracket). (FIG. 18F) Biolayer interferometry traces showing that gp42 partially competes for gH/gL binding to immobilized AMM01. The competition is abrogated when the gp42 N173 glycan is removed by introduction of a T175A mutation disrupting the glycosylation sequon.
[0038] FIGs. 19A-19D. Selected 2D class averages of negatively stained gH/gL/gp42 (FIG. 19A) and gH/gL/gp42/AMM01 (FIGs. 19B, 19C) and gH/gl_/CL40 (FIG. 19D) along with the corresponding density assignments in cartoon form (right). The AMM01 or CL40-mediated displacement of gp42 is emphasized with a dashed outline surrounding gp42. The box size of the 2D class averages is 29.4 nm.
[0039] FIGs. 20A-20F. AMM01 interferes with cell fusion. (FIG. 20A) Biotinylated gH/gL/gp42, or gH/gl_/gp42/AMM01 complexes were assembled on immobilized on streptavidin biosensors and used to measure binding to a 500 nM solution of HLA-DR using BLI as indicated. (FIG. 20B) B cell surface staining with streptavidin-PE alone, or streptavidin-PE conjugated to biotinylated gH/gL, biotinylated gB, or biotinylated gH/gL bound to gp42 +/- an excess of the indicated MAbs. * indicates that the mean fluorescence intensity (MFI) of PE of n=4 wells is significantly different (p<0.05) from the gH/gl_/gp42 only control using a two-tailed, unpaired t-test. (FIG. 20C) Epithelial cell surface staining with streptavidin-PE alone, or streptavidin-PE conjugated to biotinylated gH/gL +/- an excess of the indicated MAbs. * indicates that the mean fluorescence intensity (MFI) of PE of n=4 wells is significantly different (p<0.05) from the gH/gL only control using a two-tailed, unpaired t-test. (FIG. 20D) Biotinylated gH/gL was immobilized on streptavidin biosensors, and then used to measure binding to a 1 μΜ solution of ανβδ, ανβθ, ανβδ, gp42, or an HIV-1 Envelope protein as indicated. (FIG. 20E) Biotinylated gH/gL or gH/gL/AMM01 was immobilized on streptavidin biosensors, and used to measure binding to a 3.5 μΜ solution of EphA2 by BLI as indicated. (FIG. 20F) CHO-K1 cells were transfected with expression plasmids encoding gH, gL, gB and luciferase under the control of a T7 promoter, and then overlaid on HEK293 cells stably expressing T7 polymerase, +/- the indicated MAbs. As a control, CHO Kl cells were transfected as above except the gL plasmid was omitted. * indicates that the mean RLU of n=5 wells are significantly different (p<0.05) from the No Ab control using a two-tailed, unpaired t-test. [0040] FIGs. 21A-21 D. Possible mechanisms of AM M01 -mediated neutralization. (FIG. 21A) Direct inhibition of gB binding. AMM01 heavy chain, AMM01 light chain, gl_, gH D-l, gH D-ll, gH D- III, and gH D-IV are shown. Residues in the linker helix which have been previously shown to affect cell fusion (L65, L69 and L74) when mutated are shown in black. AMM01 binding to gH/gL could prevent subsequent interaction with gB and fusion activation. (FIG. 21 B) Molecular clamp preventing gB triggering. gH, gl_ and AMM01 are colored as in (FIG. 21A). Residues within the D-l/D-ll groove (L55, L207, R152, H154, T174, K94) that have been shown to affect membrane fusion when mutated are shown in black. By binding across D-l and D-ll, AMM01 could restrict movements across the D-l/D-ll groove that are required for gB interaction and/or triggering. (FIG. 21 C) Restriction of B cell receptor interactions. Although AMM01 binds away from the HLA-II binding site on the gH/gl_/gp42 complex, it could restrain access to membrane anchored receptors through the second FAb arm or the Fc region (modelled using PDB ID 1 HZH) of the antibody. gH, gl_ and AMM01 are as in (FIG. 21A) and gp42 is aslo indicated. HLA-DR1 is indicated and positioned to bind its predicted binding site of gp42 (PDB ID 1 KG0). (FIG. 21 D) Restriction of epithelial cell receptor interactions. AMM01 could inhibit binding to one or more epithelial cell receptors by directly restricting access to the interacting site (e.g. reduction of KGD motif accessibility) or by indirect steric hindrance mediated through the second FAb arm or the Fc region of the antibody. The KGD motif which has been implicated in gH/gL binding to integrins is shown in red. The gray rectangle could represent ανβδ, ανβθ, ανβδ, integrins, EphA2 or another unidentified receptor.
[0041] FIGs. 22A, 22B. Comparison of (FIG. 22A) the AMM01 epitope on EBV gH/GI and (FIG. 22B) the epitope of Fab 94 on varicella zoster virus (VZV) gH/GI (PDB ID: 4X15). Fab RC (PBD ID: 4XHJ) binds to a similar epitope on VZV gH/GI (not shown). Both antibodies bridge D-l/D-ll (H1A/H1 B in VZV gH/gL) and bind to the gH/gL interface, suggesting a common mechanism of neutralization of these two herpes viruses.
[0042] FIGs. 23A-23C. B cells were harvested from mice and challenged with a low-dose EBV reporter virus that induces GFP expression upon infection. The absence of antibody could readily be detected (FIG. 23A, left), yet there was no evidence of infection in the presence of AMM01 (FIG. 23A, right). 0.5mgAMMO or an irrelevant anti-HIV MAb was administered to humanized mice 2 days prior to a high dose (5X IC50) intravenous EBV challenge. 6 weeks later, nearly all of the human B cells (hCD45+,hCD19+) in the blood had died in mice that received the control antibody (FIG. 23B), while B cells survived in mice that received AMM01 (FIG. 23B). Similar results were observed in the spleen at week 7 (FIG. 23C).
[0043] FIG. 24. Sequences supporting the disclosure. DETAILED DESCRIPTION
[0044] Epstein Barr virus (EBV) is an orally transmitted gamma herpesvirus that infects B cells and epithelial cells. Most primary infections are asymptomatic, however, EBV is a causative agent of infectious mononucleosis (IM) in children and young adults. Following primary infection, infected individuals become lifelong carriers of EBV, which can lie dormant (i.e., latent) in cells. However, in certain individuals the latent virus can begin to express genes that alter cellular replication, leading to cancer or cancer-like diseases. EBV is also associated with nasopharyngeal carcinoma and lymphoproliferative disorders in immunocompromised patients such as those with HIV/AIDS or in patients undergoing immune suppression for organ transplantation. Thus, antibodies or vaccines that treat, reduce, or prevent EBV infection of cells or treat EBV-associated diseases would be a major benefit to public health.
[0045] A primary goal of most vaccine design strategies is to elicit production of neutralizing antibodies, which are a type of antibody that can inhibit the biological function of its target. Neutralizing antibodies are also useful as protein therapeutics to treat viral infection. Neutralizing antibodies against viruses such as EBV typically function by blocking a virus from entering a cell.
[0046] Previous efforts to design EBV vaccines have included vaccines that target the EBV protein gp350, which is involved in EBV attachment to cells. However, while a phase 2 trial showed that the vaccine could reduce the incidence of IM, it did not protect from EBV infection. Furthermore, EBV vaccine research to-date has not led to the development of an effective human neutralizing antibody against EBV.
[0047] In particular embodiments the current disclosure provides EBV therapeutics, which can be formulated to treat an EBV-infected subject or a subject at risk of EBV infection. In particular embodiments, EBV therapeutics refer to agents that treat EBV infection, reduce the risk or severity of EBV infection, and/or induce an immune response against EBV. Treating EBV can reduce EBV infection and/or treat a condition associated with EBV infection, such as infectious mononucleosis or lymphoproliferative disorder. In particular embodiments, use of EBV therapeutics disclosed herein lower the risk for nasopharyngeal carcinoma in a subject.
[0048] In particular embodiments, EBV therapeutics can be used to reduce the risk of infection when, for example, an EBV positive person donates solid organ or tissue to an EBV negative person who is immunosuppressed. In this context, the antibody can be transferred to prevent or reduce the risk of infection. EBV therapeutics can also be used to recognize tumor cells expressing EBV antigens for diagnosis or treatment (such as antibody-drug conjugates). [0049] In particular embodiments, cells, such as B cells, can be genetically modified to express one or more EBV antibodies and/or vaccine antigen epitopes described herein. Genetic modification can be in vivo or in vitro.
[0050] Examples of EBV therapeutics include anti-EBV antibodies, EBV vaccines, and cells genetically modified to express anti-EBV antibodies, EBV vaccines, and/or fragments thereof. In particular embodiments, the EBV therapeutics include anti-gH/gL or anti-gB antibodies, and/or EBV vaccines designed to elicit anti-gH/gL or anti-gB antibodies.
[0051] In particular embodiments, anti-EBV antibodies are effective human neutralizing antibodies. In particular embodiments the anti-EBV antibodies neutralize EBV infection of B cells and epithelial cells. In particular embodiments, the anti-EBV antibodies neutralize EBV infection of B cells and/or epithelial cells with an IC50 of 3X10"9M or less.
[0052] Particular antibodies disclosed herein do not bind to gp350, but instead bind the EBV fusion machinery (gH/gL and gB). One antibody disclosed herein, referred to as AMM01 , is an anti-gH/gL antibody. AMM01 , is uniquely able to potently neutralize infection of B cells and epithelial cells, the two major cell types that EBV infects. Cryo-electron microscopy reconstructions of the gH/gl_/gp42/AMM01 complex demonstrated that AMM01 binds to a discontinuous epitope formed by both gH and gL at the Domain-l/Domain-ll interface.
[0053] In particular embodiments, the anti-EBV antibodies bind at least one of residues 60, 70- 81 , 211-216, and 234-239 of gH; and/or at least one of residues 123-128 of gL. In particular embodiments, the anti-EBV antibodies bind at least one of residues 60, 70-81 , 21 1-216, and 234- 239 of gH; and at least one of residues 123-128 of gL. In particular embodiments, the anti-EBV antibodies bind residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine. These epitopes bound by the antibodies of the disclosure can be used as vaccine antigen epitopes to produce EBV vaccines.
[0054] In particular embodiments, "bind" refers to an interaction between a molecule (e.g., antibody) and its binding partner (e.g., antigen and/or target epitope) with a binding affinity represented by a dissociation constant (KD) of 10"8 M or less, in particular embodiments of from 10"5 M to 10"13 M, in particular embodiments of from 10"5 M to 10"10 M, in particular embodiments of from 10"5 M to 10"7 M, in particular embodiments of from 10"8 M to 10"13 M, or in particular embodiments of from 10"9 M to 10"13 M. The term can be further used to indicate that the binding domain does not bind to other biomolecules present, (e.g., it binds to other biomolecules with a dissociation constant (KD) of 10"4 M or more, in particular embodiments of from 10"4 M to 1 M).
[0055] In particular embodiments the anti-EBV antibodies include a human antibody, or an antigen-binding portion thereof (including scFv) that dissociates from EBV gH/gL with a KD of 1X10"10 or less and a k0ff rate constant of 3X10"5 s_ or less, both determined by surface plasmon resonance or biolayer interferometry.
[0056] Without being bound by theory, and integrating structural, biochemical and infectivity data, AMM01 inhibits fusion of the viral and cellular membranes. This work delineates a critical epitope for the design of next-generation subunit vaccines against this major public health burden.
[0057] The following sections describe in additional supporting detail: (I) Antibody Structures; (II) Antibody Epitopes; (III) Vaccines; (IV) Recombinant Production; (V) Modifications to Produce Administration Benefits; (VI) Genetically-Modified Therapeutic Cells; (VII) Therapeutic Compositions; (IX) Kits; (IX) Methods of Use; (X) Exemplary Embodiments; and (XI) Examples.
[0058] (I) Antibody Structures. Naturally occurring antibody structural units include a tetramer. Each tetramer includes two pairs of polypeptide chains, each pair having one light chain and one heavy chain.
[0059] The amino-terminal portion of each chain includes a variable region that is responsible for antigen recognition and epitope binding. The variable regions exhibit the same general structure of relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions (CDRs). The CDRs from the two chains of each pair are aligned by the framework regions, which enables binding to a specific epitope. From N-terminal to C-terminal, both light and heavy chain variable regions include the domains FR1 , CDR1 , FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is typically in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), or Chothia & Lesk, J. Mol. Biol., 196:901-917 (1987); Chothia et al., Nature, 342:878-883 (1989). Kabat numbering is used herein unless specifically noted otherwise.
[0060] The carboxy-terminal portion of each chain defines a constant region that can be responsible for effector function. Examples of effector functions include: C1 q binding and complement dependent cytotoxicity (CDC); antibody-dependent cell-mediated cytotoxicity (ADCC); antibody-dependent phagocytosis (ADCP); down regulation of cell surface receptors (e.g. B cell receptors); and B cell activation.
[0061] Within full-length light and heavy chains, the variable and constant regions are joined by a "J" region of amino acids, with the heavy chain also including a "D" region of amino acids. See, e.g., Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).
[0062] Human light chains are classified as kappa and lambda light chains. Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. IgG has several subclasses, including, lgG1 , lgG2, lgG3, and lgG4. IgM has subclasses including lgM1 and lgM2. IgA is similarly subdivided into subclasses including lgA1 and lgA2.
[0063] Unless otherwise indicated, the term "antibody" includes, in addition to antibodies including two full-length heavy chains and two full-length light chains as described above, variants, derivatives, and fragments thereof, examples of which are described below. Furthermore, unless explicitly excluded, antibodies can include monoclonal antibodies, human antibodies, bispecific antibodies, polyclonal antibodies, linear antibodies, minibodies, domain antibodies, synthetic antibodies, chimeric antibodies, antibody fusions, and fragments thereof, respectively. In particular embodiments, antibodies (e.g., full length antibodies) can be produced in human suspension cells.
[0064] In particular embodiments, monoclonal antibodies refer to antibodies produced by a clone of B cells or hybridoma cells. In particular embodiments, monoclonal antibodies are identical to each other and/or bind the same epitope, except for possible antibodies containing naturally occurring mutations or mutations arising during production of a monoclonal antibody. In particular embodiments, in contrast to polyclonal antibody preparations, which include different antibodies directed against different epitopes, each monoclonal antibody of a monoclonal antibody preparation is directed against a single epitope on an antigen.
[0065] A "human antibody" is one which includes an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences.
[0066] A "human consensus framework" is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences. The subgroup of sequences can be a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91- 3242, Bethesda Md. (1991), vols. 1-3. In particular embodiments, for the VL, the subgroup is subgroup kappa I as in Kabat et al., supra. In particular embodiments, for the VH, the subgroup is subgroup III as in Kabat et al., supra.
[0067] In particular embodiments, an antibody fragment is used. An "antibody fragment" denotes a portion of a complete or full length antibody that retains the ability to bind to an epitope. Examples of antibody fragments include Fv, single chain Fv fragments (scFvs), Fab, Fab', Fab'- SH, F(ab')2, diabodies, linear antibodies, Fc, and/or any biologically effective fragments of an immunoglobulin that bind specifically to an epitope described herein. Antibodies or antibody fragments include all or a portion of polyclonal antibodies, monoclonal antibodies, human antibodies, humanized antibodies, synthetic antibodies, chimeric antibodies, bispecific antibodies, mini bodies, and linear antibodies.
[0068] Binding domains from human origin or humanized antibodies have lowered immunogenicity in humans and have a lower number of non-immunogenic epitopes compared to non-human antibodies. Binding domains will generally be selected to have reduced antigenicity in human subjects. Binding domains can particularly include any peptide that specifically binds a selected epitope.
[0069] A single chain variable fragment (scFv) is a fusion protein of the variable regions of the heavy and light chains of immunoglobulins connected with a short linker peptide. Fv fragments include the VL and VH domains of a single arm of an antibody. Although the two domains of the Fv fragment, VL and VH, are coded by separate genes, they can be joined, using, for example, recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (single chain Fv (scFv)). For additional information regarding Fv and scFv, see e.g., Bird, et al., Science 242 (1988) 423- 426; Huston, et al., Proc. Natl. Acad. Sci. USA 85 (1988) 5879-5883; Plueckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore (eds.), Springer- Verlag, New York), (1994) 269-315; W01993/16185; U.S. Patent No. 5,571 ,894; and U.S. Patent No. 5,587,458.
[0070] A Fab fragment is a monovalent antibody fragment including VL, VH, CL and Cm domains. A F(ab')2 fragment is a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region. For discussion of Fab and F(ab')2 fragments having increased in vivo half-life, see U.S. Patent 5,869,046. Diabodies include two epitope-binding sites that may be bivalent. See, for example, EP 0404097; W01993/01161 ; and Holliger, et al., Proc. Natl. Acad. Sci. USA 90 (1993) 6444-6448. Dual affinity retargeting antibodies (DART™; based on the diabody format but featuring a C-terminal disulfide bridge for additional stabilization (Moore et al., Blood 1 17, 4542- 51 (2011)) can also be used. Antibody fragments can also include isolated CDRs. For a review of antibody fragments, see Hudson, et al., Nat. Med. 9 (2003) 129-134.
[0071] Antibody fragments can be made by various techniques, including proteolytic digestion of an intact antibody as well as production by recombinant host-cells (e.g., human suspension cell lines, E. coli or phage), as described herein. Antibody fragments can be screened for their binding properties in the same manner as intact antibodies.
[0072] In particular embodiments, the anti-EBV antibodies are neutralizing antibodies. A neutralizing antibody can refer to an antibody that, upon epitope binding, can reduce biological function of its target antigen. In particular embodiments neutralizing antibodies can reduce (i.e., neutralize) EBV infection of cells. In particular embodiments, neutralizing antibodies can block or neutralize EBV infection of B cells and/or epithelial cells. In particular embodiments percent neutralization can refer to a percent decrease in EBV infectivity in the presence of the antibody, as compared to EBV infectivity in the absence of the antibody. For example, if half as many cells in a sample become infected in the presence of an antibody, as compared to in the absence of the antibody, this can be calculated as 50% neutralization. In particular embodiments "neutralize EBV infection" can refer to at least 40% neutralization, at least 50% neutralization, at least 60% neutralization, at least 70% neutralization, at least 80% neutralization, or at least 90% neutralization of EBV infection. In particular embodiments, the antibodies disclosed herein can block EBV infection (i.e., 100% neutralization). In particular embodiments, the anti-EBV antibodies can inhibit EBV envelope fusion with target cells (e.g., epithelial cells and/or B cells), which can result in neutralization of EBV infection. Inhibition of EBV envelope fusion to target cells can be at least 40%, inhibition, at least 50%, inhibition, at least 60%, inhibition, at least 70%, inhibition, at least 80%, inhibition, or at least 90%, inhibition, as compared to EBV envelope fusion in the absence of the anti-EBV antibody. In particular embodiments, the target cells are epithelial cells and/or B cells. In particular embodiments, the neutralizing antibodies are AMM01 and AMM05.
[0073] In particular embodiments, anti-EBV antibodies include CDRs of the light chains and/or heavy chains of one or more of AMM01 , AM M 02, AMM03, AMM04, or AMM05 (see, e.g., FIG. 24 and SEQ ID NOs: 1-10). In particular embodiments the anti-EBV antibodies include the CDRs from the light chain and heavy chain of AMM01 (SEQ ID NOs: 1 and 2) or AMM05 (SEQ ID NOs: 9 and 10).
[0074] In particular embodiments, an anti-EBV antibody (e.g., scFv) includes a variable light chain including an AMM01 CDRL1 sequence including GGHNIGAKNVH (SEQ ID NO: 11), an AMM01 CDRL2 sequence including YDSDRPS (SEQ ID NO: 12), and an AMM01 CDRL3 sequence including CQVWDSGRGHPLYV (SEQ ID NO: 13). In particular embodiments an anti-EBV antibody (e.g., scFv) includes a variable heavy chain including an AMM01 CDRH1 sequence including YTFIHFGISW (SEQ ID NO: 14), an AMM01 CDRH2 sequence including IDTNNGNTNYAQSLQG (SEQ ID NO: 15), and an AMM01 CDRH3 sequence including RALEMGHRSGFPFDY (SEQ ID NO: 16).
[0075] In particular embodiments, an anti-EBV antibody (e.g., scFv) includes a variable light chain including an AMM02 CDRL1 sequence including RANLGISDWLA (SEQ ID NO: 17), an AMM02 CDRL2 sequence including AASSLES (SEQ ID NO: 18), and an AMM02 CDRL3 sequence including QQANSFPLS (SEQ ID NO: 19). In particular embodiments an anti-EBV antibody (e.g., scFv) includes a variable heavy chain including an AMM02 CDRH1 sequence including GPFSTYGIN (SEQ ID NO: 20), an AMM02 CDRH2 sequence including Wl I PVFDTSSFAQ (SEQ ID NO: 21), and an AMM02 CDRH3 sequence including RDRVLGAHGANPLNGHHYGMDV (SEQ ID NO: 22).
[0076] In particular embodiments, an anti-EBV antibody (e.g., scFv) includes a variable light chain including an AMM03 CDRL1 sequence including SGDKLGEEYVCW (SEQ ID NO: 23), an AMM03 CDRL2 sequence including QDRNRPP (SEQ ID NO: 24), and an AMM03 CDRL3 sequence including QAWDSSTVV (SEQ ID NO: 25). In particular embodiments an anti-EBV antibody (e.g., scFv) includes a variable heavy chain including an AMM03 CDRH1 sequence including FSLSTSGVGVG (SEQ ID NO: 26), an AMM03 CDRH2 sequence including LIYWHDAARYSPSLRN (SEQ ID NO: 27), and an AMM03 CDRH3 sequence including ADKLYGDSVKFDY (SEQ ID NO: 28).
[0077] In particular embodiments, an anti-EBV antibody (e.g., scFv) includes a variable light chain including an AMM04 CDRL1 sequence including TSSQSLVNSDGNSFLS (SEQ ID NO: 29), an AMM04 CDRL2 sequence including VSHRDS (SEQ ID NO: 30), and an AMM04 CDRL3 sequence including MQGTYWPPMFTF (SEQ ID NO: 31). In particular embodiments an anti-EBV antibody (e.g., scFv) includes a variable heavy chain including an AMM04 CDRH1 sequence including ASFSNHGIV (SEQ ID NO: 32), an AMM04 CDRH2 sequence including G!VPIVGGANYAQNFQG (SEQ ID NO: 33), and an AMM04 CDRH3 sequence including DVPGQCTRTTCFNFSSQ (SEQ ID NO: 34).
[0078] In particular embodiments, an anti-EBV antibody (e.g., scFv) includes a variable light chain including an AMM05 CDRL1 sequence including RASQSVSNNYF (SEQ ID NO: 35), an AMM05 CDRL2 sequence including GISKRATG (SEQ ID NO: 36), and an AMM05 CDRL3 sequence including QQYGNSSPRT (SEQ ID NO: 37). In particular embodiments an anti-EBV antibody (e.g., scFv) includes a variable heavy chain including an AMM05 CDRH1 sequence including FTFSNYA S (SEQ ID NO: 38), an AMM05 CDRH2 sequence including SISATDGSTYYADSVEG (SEQ ID NO: 39), and an AMM05 CDRH3 sequence including KDGAGDYL (SEQ ID NO: 40).
[0079] In particular embodiments, the anti-EBV antibodies include a heavy chain including SEQ ID NO: 1 and a light chain including SEQ ID NO: 2. In particular embodiments, SEQ ID NO: 1 includes mutation Q1 N.
[0080] In particular embodiments, the anti-EBV antibodies include a heavy chain including SEQ ID NO: 3 and a light chain including SEQ ID NO: 4. In particular embodiments, SEQ ID NO: 3 includes mutation Q1 N. [0081] In particular embodiments, the anti-EBV antibodies include a heavy chain including SEQ ID NO: 5 and a light chain including SEQ ID NO: 6. In particular embodiments, SEQ ID NO: 5 includes mutation E1 N. In particular embodiments, SEQ ID NO: 6 includes mutation Q1 N. In particular embodiments, SEQ ID NO: 5 includes mutation E1 N and SEQ ID NO: 6 includes mutation Q1 N.
[0082] In particular embodiments, the anti-EBV antibodies include a heavy chain including SEQ ID NO: 7 and a light chain including SEQ ID NO: 8. In particular embodiments, SEQ ID NO: 7 includes mutation Q1 N.
[0083] In particular embodiments, the anti-EBV antibodies include a heavy chain including SEQ ID NO: 9 and a light chain including SEQ ID NO: 10. In particular embodiments, SEQ ID NO: 9 includes mutation E1 N. In particular embodiments, SEQ ID NO: 10 includes mutation E1 N. In particular embodiments, SEQ ID NO: 9 includes mutation E1 N and SEQ ID NO: 10 includes mutation E1 N.
[0084] In particular embodiments, the anti-EBV antibodies include a heavy chain including SEQ ID NO: 41 and a light chain including SEQ ID NO: 42 with mutations selected from one or more heavy chain mutations selected from D10E; G76S; S83R; T84S; F91Y; V107T; and P1 13S and/or one or more light chain mutations selected from E3V; Q17K; R18T; T20R; Q49Y; S69N; and G100T.
[0085] In particular embodiments, the anti-EBV antibodies include a heavy chain including SEQ ID NO: 41 and a light chain including SEQ ID NO: 42 with heavy chain mutations D10E; G76S; S83R; T84S; F91Y; V107T; and P1 13S and light chain mutations E3V; Q17K; R18T; T20R; Q49Y; S69N; and G100T.
[0086] As indicated, in particular embodiments, a VH region of the present disclosure can be derived from or based on a VH of an AMMO antibody and can include one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions or non-conservative amino acid substitutions), or a combination of the above-noted changes, when compared with the VH of an AMMO antibody. An insertion, deletion or substitution may be anywhere in the VH region, including at the amino- or carboxy-terminus or both ends of this region, provided that each CDR includes zero changes or at most one, two, or three changes and provided a modified VH can still specifically bind its target epitope with an affinity similar to the wild type AMMO VH.
[0087] In particular embodiments, a VL region of the present disclosure can be derived from or based on a VL of an AMMO antibody and can include one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) insertions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) deletions, one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10) amino acid substitutions (e.g., conservative amino acid substitutions), or a combination of the above-noted changes, when compared with the VL of an AMMO antibody. An insertion, deletion or substitution may be anywhere in the VL region, including at the amino- or carboxy- terminus or both ends of this region, provided that each CDR includes zero changes or at most one, two, or three changes and provided a modified VL can still specifically bind its target epitope with an affinity similar to the wild type AMMO VL.
[0088] In particular embodiments, an antibody variant includes or is a sequence that has at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to an antibody sequence disclosed herein. In particular embodiments, an antibody variant includes or is a sequence that has at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to a light chain variable region (VL) and/or to a heavy chain variable region (VH), or both, wherein each CDR includes zero changes or at most one, two, or three changes, from the reference antibody disclosed herein or fragment thereof that binds to a targeted EBV epitope. In particular embodiments, an antibody variant includes or is a sequence that has at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to the CDRs of an antibody disclosed herein (AMM01-AMM05).
[0089] (II) Antibody Epitopes. As indicated, antibodies bind epitopes on antigens. An antigen refers to a molecule or a portion of a molecule capable of being bound by an antibody. An epitope is a region of an antigen that is bound by the variable region of an antibody. An epitope includes specific amino acids that contact the variable region of an antibody. Epitope determinants can include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and can have specific three dimensional structural characteristics, and/or specific charge characteristics.
[0090] An "epitope" includes any determinant capable of being bound by an antigen-binding protein, such as an antibody. An epitope is a region of molecule that is bound by a binding protein that targets that region of molecule, and when that region of molecule is a protein, includes specific residues that directly contact the binding protein. In particular embodiments, an "epitope" denotes the binding site on a protein target bound by a corresponding binding domain. The binding domain either binds to a linear epitope, (e.g., an epitope including a stretch of 5 to 12 consecutive amino acids), or the binding domain binds to a three-dimensional structure formed by the spatial arrangement of several short stretches of the protein target. Three-dimensional epitopes recognized by a binding domain, e.g., by the epitope recognition site or paratope of an antibody or antibody fragment, can be thought of as three-dimensional surface features of an epitope molecule. These features fit precisely (in)to the corresponding binding site of the binding domain and thereby binding between the binding domain and its target protein is facilitated. In particular embodiments, an epitope can be considered to have two levels: (i) the "covered patch" which can be thought of as the shadow an antibody or binding domain would cast; and (ii) the individual participating side chains and backbone residues. Binding is then due to the aggregate of ionic interactions, hydrogen bonds, and hydrophobic interactions.
[0091] In particular embodiments, the EBV epitopes targeted by the antibodies disclosed herein are present on envelope glycoprotein H (gH, see, e.g., SEQ ID NO: 51), envelope glycoprotein L (gl_, see, e.g., SEQ ID NO: 52), and/or glycoprotein B (gB, see, e.g., SEQ ID NO: 53). gH, gl_, and gB are glycoproteins expressed by EBV that can form complexes together and are important for virus entry into cells. In particular embodiments, the EBV epitope includes gH/gL, which is a heterodimer of gH and gl_ that binds to glycoprotein 42 (gp42, SEQ ID NO: 54) to form a trimer on the surface of EBV virions. In particular embodiments the EBV epitope bridges the D-l/D-ll groove, and encompasses the linker helix of the gH/gL complex. Description of the D-l and D-ll domains can be found in Matsuura, et al., Proc. Natl. Acad. Sci. USA 107 (2010) 22641-22646. In particular embodiments, the EBV antibody binds to an epitope on gH/gL that includes one or more of amino acids 60, 70-81 , 21 1-216, and 234-239 of gH; and/or one or more of amino acids 123-128 of gL. In particular embodiments, the anti-EBV antibody binds residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine.
[0092] When an antibody disclosed herein binds to a gH/gL epitope, it competes for binding with CL40. CL40 is a neutralizing anti-EBV antibody that binds to an epitope of gH/gL. In particular embodiments, an anti-EBV antibody (e.g., AMM01) can reduce CL40 binding to EBV or a gH/gL complex (see FIG. 17E).
[0093] (III) Vaccines. In particular embodiments the EBV therapeutics include EBV vaccines. The EBV vaccines can include an EBV antigen with a vulnerable EBV epitope such as those described herein. In particular embodiments, the EBV vaccines include an EBV antigen that includes a gH/gL complex, and/or a D-l/D-ll groove and the DI/DII linker helix of a gH/gL complex. In particular embodiments, the EBV vaccines include an AMM01 epitope. An AMM01 epitope can refer to the gH/gL residues that are bound by the antibody AMM01. Examples of AMM01 epitope residues include: gH residues 60, 70-81 , 21 1-216, and 234-239; and gL residues 123-128. In particular embodiments, examples of AMM01 epitopes include residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine. In particular embodiments, the EBV vaccines include an AMM05 epitope. An AMM05 epitope is a region of gB that is capable of binding to AMM05.
[0094] In particular embodiments, the EBV vaccine can include a subunit vaccine. A subunit vaccine can refer to a vaccine that does not contain a whole live or killed pathogen, but only a subunit (e.g., a single protein or protein fragment) of the pathogen that stimulates an immune response against the pathogen. In particular embodiments, the EBV subunits vaccines can include vaccine proteins including (i) gH/gL or a fragment of gH/gL that binds to AMM01 ; and/or (ii) gB or a fragment of gB that binds to AMM05.
[0095] In particular embodiments, the EBV therapeutics include immunogenic proteins. An immunogenic protein can, for example, be used to elicit an antibody response in a subject. In particular embodiments, the immunogenic proteins include one or more AMMO epitopes. An AMMO epitope is an epitope bound by an AMMO antibody described herein. In particular embodiments, an immunogenic protein includes one or more of: an AMM01 epitope, an AMM02 epitope, an AMM03 epitope, an AMM04 epitope, and/or an AMM05 epitope.
[0096] In particular embodiments, EBV therapeutics (e.g., EBV vaccines, immunogenic proteins) can include multimerization domains. Multimerization domains can allow for multimerization of the EBV vaccine proteins and/or immunogenic proteins, which can enhance their immunogenicity. In particular embodiments, the multimerization domain is C4b multimerization domain. C4 binding protein (C4b) is the major inhibitor of the classical complement and lectin pathway. The complement system is a major part of innate immunity and is the first line of defense against invading microorganisms. Orchestrated by more than 60 proteins, its major task is to discriminate between host cells and pathogens and to initiate immune responses when necessary. It also recognizes necrotic or apoptotic cells. Hofmeyer et al., J Mol Biol. 2013 Apr 26;425(8): 1302-17.
[0097] Full-length native C4b includes seven a-chains linked together by a multimerization (i.e., heptamerization) domain at the C-terminus of the a-chains. Blom et al., (2004) Mol Immunol 40: 1333-1346. One of the α-chains can be replaced by a β-chain in humans. The wild-type C4b multimerization domain is 57 amino acid residues in humans and 54 amino acid residues in mice. Forbes et al., PLoS One. 2012; 7(9): e44943. It contains an amphipathic a-helix region, which is necessary and sufficient for heptamerization, as well as two cysteine residues which stabilize the structure. Kask et al., (2002) Biochemistry 41 : 9349-9357.
[0098] Examples of C4b multimerization domains that can be used include:
SEQ ID NO: Sequence
55 SGRAHAGWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLEL
QRDSARQSTLDKELVPR 56 KKQGDADVCGEVAYIQSVVSDCHVPTAELRTLLEIRKLFLEIQKLKVELQGLS KE
57 ETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQS
TLDKEL
58 WETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQ
STLDKEL
59 CEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
[0099] In particular embodiments, the C4b multimerization domain will be a multimerization domain which includes (i) glycine at position 12, (ii) alanine at position 28, (iii) leucines at positions 29, 34, 36, and/or 41 ; (iv) tyrosine at position 32; (v) lysine at position 33; and/or (vi) cysteine at positions 6 and 18. In particular embodiments, the C4b multimerization domain will be a multimerization domain which includes (i) glycine at position 12, (ii) alanine at position 28, (iii) leucines at positions 29, 34, 36, and 41 ; (iv) tyrosine at position 32; (v) lysine at position 33; and (vi) cysteine at positions 6 and 18.
[0100] C4b multimerization domains can include any of SEQ ID NOs: 55-59 with an N-terminal deletion of at least 1 consecutive amino acid residues (e.g. at least 2, 3, 4, 5, 6, 7, 8, 9, 10 consecutive amino acid residues) in length. Additional embodiments can include a C-terminal deletion of at least 1 consecutive amino acid residues (e.g. at least 2, 3, 4, 5, 6, 7, 8, 9, 10 consecutive amino acid residues) in length.
[0101] Particular C4b multimerization domain embodiments will retain or will be modified to include at least 1 of the following residues: A6; E11 ; A13; D21 ; C22; P25; A27; E28; L29; R30; T31 ; L32; L33; E34; I35; K37; L38; L40; E41 ; I42; Q43; K44; L45; E48; L49; or Q50. Further embodiments will retain or will be modified to include A6; E1 1 ; A13; D21 ; C22; P25; A27; E28; L29; R30; T31 ; L32; L33; E34; I35; K37; L38; L40; E41 ; I42; Q43; K44; L45; E48; L49; and Q50. Particular C4b multimerization domain embodiments will include the amino acid sequence "AELR".
[0102] (IV) Recombinant Production. In particular embodiments, the anti-EBV antibodies or EBV vaccine proteins are produced from a gene using a protein expression system. Protein expression systems can utilize DNA constructs (e.g., chimeric genes, expression cassettes, expression vectors, recombination vectors) including a nucleic acid sequence encoding the protein or proteins of interest operatively linked to appropriate regulatory sequences. In particular embodiments, such DNA constructs are not naturally-occurring DNA molecules and are useful for introducing DNA into host-cells to express selected proteins of interest. In particular embodiments, a DNA construct that encodes an anti-EBV antibody or vaccine protein can be inserted into cells (e.g., bacterial, mammalian, insect, etc.), which can produce the anti-EBV antibody or vaccine protein encoded by the DNA construct. [0103] Operatively linked refers to the linking of DNA sequences (including the order of the sequences, the orientation of the sequences, and the relative spacing of the various sequences) in such a manner that the encoded protein is expressed. Methods of operatively linking expression control sequences to coding sequences are well known in the art. See, e.g., Maniatis et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor, N. Y., 1982; and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor, N. Y., 1989.
[0104] Expression control sequences are DNA sequences involved in any way in the control of transcription or translation. Suitable expression control sequences and methods of making and using them are well known in the art. Expression control sequences generally include a promoter. The promoter may be inducible or constitutive. It may be naturally-occurring, may be composed of portions of various naturally-occurring promoters, or may be partially or totally synthetic. Guidance for the design of promoters is provided by studies of promoter structure, such as that of Harley and Reynolds, Nucleic Acids Res., 15, 2343-2361 , 1987. Also, the location of the promoter relative to the transcription start may be optimized. See, e.g., Roberts et al., Proc. Natl. Acad. Sci. USA, 76:760-764, 1979.
[0105] The promoter may include, or be modified to include, one or more enhancer elements. In particular embodiments, the promoter will include a plurality of enhancer elements. Promoters including enhancer elements can provide for higher levels of transcription as compared to promoters that do not include them.
[0106] For efficient expression, the coding sequences can be operatively linked to a 3' untranslated sequence. In particular embodiments, the 3' untranslated sequence can include a transcription termination sequence and a polyadenylation sequence. The 3' untranslated region can be obtained, for example, from the flanking regions of genes.
[0107] In particular embodiments, a 5' untranslated leader sequence can also be employed. The 5' untranslated leader sequence is the portion of an mRNA that extends from the 5' CAP site to the translation initiation codon.
[0108] In particular embodiments, a "hisavi" tag can be added to the N-terminus or C-terminus of a gene by the addition of nucleotides coding for the Avitag amino acid sequence, "GLNDIFEAQKIEWHE" (SEQ ID NO: 60), as well as the 6xhistidine tag ΉΗΗΗΗΗ" (SEQ ID NO: 61). The Avitag avidity tag can be biotinylated by a biotin ligase to allow for biotin-avidin or biotin- streptavidin based interactions for protein purification, as well as for immunobiology (such as immunoblotting or immunofluorescence) using anti-biotin antibodies. The 6xhistidine tag allows for protein purification using Ni-2+ affinity chromatography. [0109] In particular embodiments, anti-EBV antibodies and/or EBV therapeutics disclosed herein can be produced using, for example, human suspension cells and/or the Daedalus expression system as described in Pechman et al., Am J Physiol 294: R1234-R1239, 2008. The Daedalus system utilizes inclusion of minimized ubiquitous chromatin opening elements in transduction vectors to reduce or prevent genomic silencing and to help maintain the stability of decigram levels of expression. This system can bypass tedious and time-consuming steps of other protein production methods by employing the secretion pathway of serum-free adapted human suspension cell lines, such as 293 Freestyle. Using optimized lentiviral vectors, yields of 20-100 mg/l of correctly folded and post-translationally modified, endotoxin-free protein of up to 70 kDa in size, can be achieved in conventional, small-scale (100 ml) culture. At these yields, most proteins can be purified using a single size-exclusion chromatography step, immediately appropriate for use in structural, biophysical or therapeutic applications. Bandaranayake et al., Nucleic Acids Res., 201 1 (Nov); 39(21). In some instances, purification by chromatography may not be needed due to the purity of manufacture according the methods described herein.
[0110] In particular embodiments, the DNA constructs can be introduced by transfection, a technique that involves introduction of foreign DNA into the nucleus of eukaryotic cells. In particular embodiments, the proteins can be synthesized by transient transfection (DNA does not integrate with the genome of the eukaryotic cells, but the genes are expressed for 24-96 hours). Various methods can be used to introduce the foreign DNA into the host-cells, and transfection can be achieved by chemical-based means including by the calcium phosphate, by dendrimers, by liposomes, and by the use of cationic polymers. Non-chemical methods of transfection include electroporation, sono-poration, optical transfection, protoplast fusion, impalefection, and hydrodynamic delivery. In particular embodiments, transfection can be achieved by particle-based methods including gene gun where the DNA construct is coupled to a nanoparticle of an inert solid which is then "shot" directly into the target-cell's nucleus. Other particle-based transfection methods include magnet assisted transfection and impalefection.
[0111] Nucleic acid sequences encoding proteins disclosed herein can be derived by those of ordinary skill in the art. Nucleic acid sequences can also include one or more of various sequence polymorphisms, mutations, and/or sequence variants (e.g., splice variants or codon optimized variants). In particular embodiments, the sequence polymorphisms, mutations, and/or sequence variants do not affect the function of the encoded protein.
[0112] Sequence information provided by public databases can be used to identify additional gene and protein sequences that can be used with the systems and methods disclosed. [0113] (V) Modifications to Produce Administration Benefits. In particular embodiments, variants or proteins disclosed herein can be modified to produce an administration benefit. Exemplary administration benefits can include (1) reduced susceptibility to proteolysis, (2) reduced susceptibility to oxidation, (3) altered binding affinity for forming protein complexes, (4) altered binding affinities, (5) reduced immunogenicity; and/or (6) extended half-life.
[0114] In particular embodiments, one or more amino acid modifications may be introduced into the Fc region of an antibody, thereby generating an Fc region variant. The Fc region variant may include a human Fc region sequence (e.g., a human lgG1 , lgG2, lgG3 or lgG4 Fc region) including an amino acid modification (e.g. a substitution) at one or more amino acid positions. In particular embodiments the antibodies can be mutated to increase their binding to Fc receptors. Antibodies can contain Fc regions that, upon epitope-engagement, can bind to Fc Receptors that are expressed, for example, by phagocytes. Exemplary mutations that increase the binding to Fc receptors include: G236A/S239D/A330L/I332E (GASDALIE). Smith et al., Proceedings of the National Academy of Sciences of the United States of America, 109(16), 6181-6186 (2012). In particular embodiments, an antibody variant includes an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues). In particular embodiments, alterations are made in the Fc region that result in altered C1 q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in U.S. Pat. No. 6,194,551 , WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178- 4184 (2000).
[0115] In particular embodiments the anti-EBV antibodies or vaccine proteins can include amino acid mutations that increase the half-life of the antibodies in serum. M428L/N434S is a pair of mutations that increase the half-life of antibodies in serum, as described in Zalevsky et al., Nature Biotechnology 28, 157-159 (2010).
[0116] In particular embodiments, anti-EBV antibodies can be mutated to lower the immunogenicity of the antibody. For example, human antibodies can have somatic mutations in the framework region that induce immunogenicity, and these mutations can be reverted back to the germline sequence to decrease the immunogenicity of the antibody.
[0117] In particular embodiments, it may be desirable to create cysteine engineered antibodies, e.g., "thioMAbs," in which one or more residues of an antibody are substituted with cysteine residues. In particular embodiments, the substituted residues occur at accessible sites of the antibody. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further below. In particular embodiments, residue 5400 (EU numbering) of the heavy chain Fc region is selected. Cysteine engineered antibodies may be generated as described, e.g., in U.S. Pat. No. 7,521 ,541.
[0118] In particular embodiments, antibody variants are provided having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region. For example, the amount of fucose in such antibody may be from 1 % to 80%, from 1 % to 65%, from 5% to 65% or from 20% to 40%. The amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e.g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example. Asn297 refers to the asparagine residue located at position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located ±3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., WO2000/61739; WO 2001/29246; WO2002/031140; US2002/0164328; WO2003/0851 19; WO2003/084570; US2003/01 15614; US2003/0157108; US2004/0093621 ; US2004/0110704; US2004/0132140; US2004/0110282; US2004/0109865; WO2005/035586; WO2005/035778; WO2005/053742; Okazaki et al. J. Mol. Biol. 336: 1239-1249 (2004); and Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Examples of cell lines capable of producing defucosylated antibodies include Led 3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986)), and knockout cell lines, such as alpha-1 ,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107).
[0119] In particular embodiments, modified anti-EBV antibodies or EBV vaccine proteins include those wherein one or more amino acids have been replaced with a non-amino acid component, or where the amino acid has been conjugated to a functional group or a functional group has been otherwise associated with an amino acid. The modified amino acid may be, e.g., a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, or an amino acid conjugated to an organic derivatizing agent. Amino acid(s) can be modified, for example, co-translationally or post-translationally during recombinant production (e.g., N-linked glycosylation at N-X-S/T motifs during expression in mammalian cells) or modified by synthetic means. The modified amino acid can be within the sequence or at the terminal end of a sequence. Modifications also include nitrited proteins. [0120] PEGylation particularly is a process by which polyethylene glycol (PEG) polymer chains are covalently conjugated to other molecules such as proteins. Several methods of PEGylating proteins have been reported in the literature. For example, N-hydroxy succinimide (NHS)-PEG was used to PEGylate the free amine groups of lysine residues and N-terminus of proteins; PEGs bearing aldehyde groups have been used to PEGylate the amino-termini of proteins in the presence of a reducing reagent; PEGs with maleimide functional groups have been used for selectively PEGylating the free thiol groups of cysteine residues in proteins; and site- specific PEGylation of acetyl-phenylalanine residues can be performed.
[0121] Covalent attachment of proteins to PEG has proven to be a useful method to increase the half-lives of proteins in the body (Abuchowski, A. et al., Cancer Biochem. Biophys., 1984, 7: 175- 186; Hershfield, M. S. et al., N. Engl. J. Medicine, 1987, 316:589-596; and Meyers, F. J. et al., Clin. Pharmacol. Ther., 1991 , 49:307-313). The attachment of PEG to proteins not only protects the molecules against enzymatic degradation, but also reduces their clearance rate from the body. The size of PEG attached to a protein has significant impact on the half-life of the protein. The ability of PEGylation to decrease clearance is generally not a function of how many PEG groups are attached to the protein, but the overall molecular weight of the altered protein. Usually the larger the PEG is, the longer the in vivo half-life of the attached protein. In addition, PEGylation can also decrease protein aggregation (Suzuki et al., Biochem. Bioph. Acta vol. 788, pg. 248 (1984)), alter protein immunogenicity (Abuchowski et al.; J. Biol. Chem. vol. 252 pg. 3582 (1977)), and increase protein solubility as described, for example, in PCT Publication No. WO 92/16221).
[0122] Several sizes of PEGs are commercially available (Nektar Advanced PEGylation Catalog 2005-2006; and NOF DDS Catalogue Ver 7.1), which are suitable for producing proteins with targeted circulating half-lives. A variety of active PEGs have been used including mPEG succinimidyl succinate, mPEG succinimidyl carbonate, and PEG aldehydes, such as mPEG- propionaldehyde.
[0123] In particular embodiments, the anti-EBV antibodies or EBV vaccine proteins can be linked to human serum albumin (HSA). Linkage to HSA can increase the size of the protein and can increase serum half-life. An HSA-linkage can increase antibody or vaccine protein half-life without altering the binding and/or activity of the antibody or vaccine protein.
[0124] In particular embodiments, anti-EBV antibodies bind tumor cells expressing EBV antigens for diagnosis (e.g., imaging) or treatment. For example, EBV antibodies can be conjugated to an enzyme label, a colored label, a cytostatic agent, a label that can be photoactivated and which is suitable for use in photodynamic therapy, haptens, digoxigenin, biotin, or a chemotherapeutic agent. Exemplary conjugation partners include enzyme labels such as alkaline phosphatase, horseradish peroxidase, and β-galactosidase; therapeutically active agents such as radionuclides, toxins, small organic molecules, and therapeutic peptides; toxins such as pertussis- toxin, diphtheria toxin, ricin, saporin, pseudomonas exotoxin, calicheamicin, taxoids, maytansinoids, tubulysins and dolastatin or dolastatin analogues (e.g., auristatin E, monomethylauristatin E, auristatin PYE and auristatin PHE); cytostatic or chemotherapeutic agents such as Abiraterone, Adriamycine, Anthracycline (Doxorubicin), Azacitidine, Azathioprine, Beuacizumab, Bortezomib, Bleomycin, Capecitabine, Camptotecine, Carboplatin, Cetuximab, Chlorambucil, Cisplatin, curacin, Cyclophosphamide, Cyclophosphoramide, Cytarabine, Dacarbazine, Daunorubicin, Doxifluridine, Epirubicin, Epothilone, Etoposide, 5-Fluorouracil, Gemeitabine, hydroxyurea, Idarubicin, Irinotecan, Imatinib, Lenalidomide, Leucovorin, Leuprorelin, Mechlorethamine, Mercaptopurine, Methotrexate, Mitoxantrone, oxadiazolines, Oxaliplatin, Paclitaxel, Pemetrexed, retinoic acid, Rituximab, sulfonamides, Taxotere (Docetaxel), Teniposide, Tioguanine, Topotecan, Trastuzumab, Valrubicin, Vinblastin, Vincristine, Vindesine, and Vinorelbine; and therapeutically active nucleic acids such as antisense nucleic acid molecules, small interfering RNAs, micro RNAs and ribozymes. Such conjugations can be carried out using any conventional coupling method known in the art. Depending on intended use to visualize tumor cells or target cancer cells for destruction, compounds within this paragraph can be referred to as "imaging agents" or "drugs".
[0125] (VI) Genetically-Modified Therapeutic Cells. In particular embodiments, nucleic acids encoding antibodies disclosed herein can be delivered into cells for therapeutic expression, for example, within a subject. These embodiments may be referred to as "gene editing or vectored immunoprophylaxis". Nucleic acids can be delivered into, for example, B cells using gene editing systems and/or viral vector systems.
[0126] Gene editing systems include typically include a targeting molecule for precise targeting of a portion of a genome to be edited and a cutting molecule for cutting the targeted genetic site. Guide RNA is one example of a targeting molecule while various nucleases provide examples of cutting molecules. When insertion of a nucleic acid encoding an antibody or vaccine antigen (or fragment thereof) is intended, the systems can also include a homology-directed repair template (which can include homology arms) associated with the nucleic acid encoding the antibody or vaccine antigen (or fragment thereof). As detailed further below, however, different gene editing systems can adopt different components and configurations while maintaining the ability to precisely target, cut, and modify selected genomic sites. [0127] Particular embodiments utilize zinc finger nucleases (ZFNs) as gene editing agents. ZFNs are a class of site-specific nucleases engineered to bind and cleave DNA at specific positions. ZFNs are used to introduce double strand breaks (DSBs) at a specific site in a DNA sequence which enables the ZFNs to target unique sequences within a genome in a variety of different cells. Moreover, subsequent to double-stranded breakage, homology-directed repair (HDR) can take place to repair the DSB, thus enabling genome editing.
[0128] ZFNs are synthesized by fusing a zinc finger DNA-binding domain to a DNA cleavage domain. The DNA-binding domain includes three to six zinc finger proteins which are transcription factors. The DNA cleavage domain includes the catalytic domain of, for example, Fokl endonuclease. The Fokl domain functions as a dimer requiring two constructs with unique DNA binding domains for sites on the target sequence. The Fokl cleavage domain cleaves within a five or six base pair spacer sequence separating the two inverted half-sites.
[0129] For additional information regarding ZFNs, see Kim, et al. Proceedings of the National Academy of Sciences of the United States of America 93, 1156-1160 (1996); Wolfe, et al. Annual review of biophysics and biomolecular structure 29, 183-212 (2000); Bibikova, et al. Science 300, 764 (2003); Bibikova, et al. Genetics 161 , 1 169-1 175 (2002); Miller, et al. The EMBO journal 4, 1609-1614 (1985); and Miller, et al. Nature biotechnology 25, 778-785 (2007)].
[0130] Particular embodiments can use transcription activator like effector nucleases (TALENs) as gene editing agents. TALENs refer to fusion proteins including a transcription activator-like effector (TALE) DNA binding protein and a DNA cleavage domain. TALENs are used to edit genes and genomes by inducing DSBs in the DNA, which induce repair mechanisms in cells. Generally, two TALENs must bind and flank each side of the target DNA site for the DNA cleavage domain to dimerize and induce a DSB. The DSB can then be repaired in the cell by HDR with an exogenous double-stranded donor DNA fragment.
[0131] As indicated, TALENs have been engineered to bind a target sequence of, for example, an endogenous genome, and cut DNA at the location of the target sequence. The TALEs of TALENs are DNA binding proteins secreted by Xanthomonas bacteria. The DNA binding domain of TALEs include a highly conserved 33 or 34 amino acid repeat, with divergent residues at the 12th and 13th positions of each repeat. These two positions, referred to as the Repeat Variable Diresidue (RVD), show a strong correlation with specific nucleotide recognition. Accordingly, targeting specificity can be improved by changing the amino acids in the RVD and incorporating nonconventional RVD amino acids.
[0132] Examples of DNA cleavage domains that can be used in TALEN fusions are wild-type and variant Fokl endonucleases. For additional information regarding TALENs, see Boch, et al. Science 326, 1509-1512 (2009); Moscou, & Bogdanove, Science 326, 1501 (2009); Christian, et al. Genetics 186, 757-761 (2010); and Miller, et al. Nature biotechnology 29, 143-148 (201 1).
[0133] Particular embodiments utilize MegaTALs as gene editing agents. MegaTALs have a single chain rare-cleaving nuclease structure in which a TALE is fused with the DNA cleavage domain of a meganuclease. Meganucleases, also known as homing endonucleases, are single peptide chains that have both DNA recognition and nuclease function in the same domain. In contrast to the TALEN, the megaTAL only requires the delivery of a single peptide chain for functional activity.
[0134] In particular embodiments, CRISPR gene editing systems may be used. The CRISPR nuclease system is a prokaryotic immune system that confers resistance to foreign genetic elements such as plasmids and phages and provides a form of acquired immunity. CRISPRs are DNA loci containing short repetitions of base sequences. In the context of a prokaryotic immune system, each repetition is followed by short segments of spacer DNA belonging to foreign genetic elements that the prokaryote was exposed to. This CRISPR array of repeats interspersed with spacers can be transcribed into RNA. The RNA can be processed to a mature form and associate with a cas (CRISPR-associated) nuclease. A CRISPR-Cas system including an RNA having a sequence that can hybridize to the foreign genetic elements and Cas nuclease can then recognize and cut these exogenous genetic elements in the genome.
[0135] A CRISPR-Cas system does not require the generation of customized proteins to target specific sequences, but rather a single Cas enzyme can be programmed by a short guide RNA molecule to recognize a specific DNA target (crRNA). A classification of CRISPR-Cas systems is proposed in which these systems are broadly divided into two classes, Class 1 with multi- subunit effector complexes and Class 2 with single-subunit effector modules exemplified by the Cas9 protein. In addition to the Class 1 and Class 2 CRISPR-Cas systems, more recently a putative Class 2, Type V CRISPR-Cas class exemplified by Cpf1 has been identified.
[0136] The Cpf1 nuclease particularly can provide added flexibility in target site selection by means of a short, three base pair recognition sequence (TTN), known as the protospacer- adjacent motif or PAM. Cpfl's cut site is at least 18bp away from the PAM sequence, thus the enzyme can repeatedly cut a specified locus after indel (insertion and deletion) formation, increasing the efficiency of HDR. Moreover, staggered DSBs with sticky ends permit orientation- specific donor template insertion, which is advantageous in non-dividing cells.
[0137] Additional information regarding CRISPR-Cas systems and components thereof are described in, US8697359, US8771945, US8795965, US8865406, US8871445, US8889356, US8889418, US8895308, US8906616, US8932814, US8945839, US8993233 and US8999641 and applications related thereto; and WO2014/018423, WO2014/093595, WO2014/093622, WO2014/093635, WO2014/093655, WO2014/093661 , WO2014/093694, WO2014/093701 , WO2014/093709, WO2014/093712, WO2014/093718, WO2014/145599, WO2014/204723, WO2014/204724, WO2014/204725, WO2014/204726, WO2014/204727, WO2014/204728, WO2014/204729, WO2015/065964, WO2015/089351 , WO2015/089354, WO2015/089364, WO2015/089419, WO2015/089427, WO2015/089462, WO2015/089465, WO2015/089473 and WO2015/089486, WO201620571 1 , WO2017/106657, WO2017/127807 and applications related thereto.
[0138] Nucleic acids encoding antibodies or vaccine antigens (or fragments thereof) can also be delivered into, for example, B cells using viral vector systems. The use of RNA or DNA viral based systems for the delivery of nucleic acids takes advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus. Viral vectors can be administered directly to patients (in vivo) or they can be used to treat cells in vitro, and the modified cells may optionally be administered to patients (ex vivo). Conventional viral based systems could include retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues.
[0139] The tropism of a retrovirus can be altered by incorporating foreign envelope proteins, expanding the potential target population of target cells. Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system would therefore depend on the target tissue. Retroviral vectors include cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression. Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J. Virol. 66:1635-1640); Sommnerfelt et al., Virol. 176:58-59 (1990); Wilson et al., J. Virol. 63:2374-2378 (1989); Miller et al., J. Virol. 65:2220-2224 (1991); PCT/US94/05700).
[0140] In applications where transient expression is preferred, adenoviral based systems may be used. Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system. Adeno- associated virus ("AAV") vectors may also be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368 ; WO 93/24641 ; Kotin, Human Gene Therapy 5:793-801 (1994); Muzyczka, J. Clin. Invest. 94: 1351 (1994). Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No. 5,173,414 ; Tratschin et al., Mol. Cell. Biol. 5:3251-3260 (1985); Tratschin, et al., Mol. Cell. Biol. 4:2072-2081 (1984); Hermonat & Muzyczka, PNAS 81 :6466-6470 (1984); and Samulski et al., J. Virol. 63:03822-3828 (1989).
[0141] (VII) Therapeutic Compositions. EBV therapeutics (antibodies, vaccines, gene editing systems, viral vectors, or cells modified by gene editing system or viral vectors) can be formulated alone or in combination into compositions for administration to subjects. In particular embodiments, the EBV therapeutics (e.g., anti-EBV antibodies (whether in single or conjugated form) or EBV vaccines) include immunogenic compositions. An immunogenic composition refers to an agent that stimulates an innate and/or an adaptive immune response in a subject.
[0142] Salts and/or pro-drugs of EBV therapeutics can also be used.
[0143] A pharmaceutically acceptable salt includes any salt that retains the activity of the EBV therapeutic and is acceptable for pharmaceutical use. A pharmaceutically acceptable salt also refers to any salt which may form in vivo as a result of administration of an acid, another salt, or a prodrug which is converted into an acid or salt.
[0144] Suitable pharmaceutically acceptable acid addition salts can be prepared from an inorganic acid or an organic acid. Examples of such inorganic acids are hydrochloric, hydrobromic, hydroiodic, nitric, carbonic, sulfuric and phosphoric acid. Appropriate organic acids can be selected from aliphatic, cycloaliphatic, aromatic, arylaliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids.
[0145] Suitable pharmaceutically acceptable base addition salts include metallic salts made from aluminum, calcium, lithium, magnesium, potassium, sodium and zinc or organic salts made from Ν,Ν'-dibenzylethylene-diamine, chloroprocaine, choline, diethanolamine, ethylenediamine, N- methylglucamine, lysine, arginine and procaine.
[0146] A prodrug includes an active ingredient which is converted to a therapeutically active compound after administration, such as by cleavage of an EBV therapeutic or by hydrolysis of a biologically labile group. [0147] In particular embodiments, compositions disclosed herein include an EBV therapeutic of at least 0.1 % w/v or w/w of the composition; at least 1 % w/v or w/w of composition; at least 10% w/v or w/w of composition; at least 20% w/v or w/w of composition; at least 30% w/v or w/w of composition; at least 40% w/v or w/w of composition; at least 50% w/v or w/w of composition; at least 60% w/v or w/w of composition; at least 70% w/v or w/w of composition; at least 80% w/v or w/w of composition; at least 90% w/v or w/w of composition; at least 95% w/v or w/w of composition; or at least 99% w/v or w/w of composition.
[0148] The amount of genetically modified cells within a composition can be greater than 102 cells, greater than 103 cells, greater than 104 cells, greater than 105 cells, greater than 106 cells, greater than 107 cells, greater than 108 cells, greater than 109 cells, greater than 1010 cells, or greater than 1011 cells.
[0149] Exemplary carriers for compositions, including cell-based formulations, include saline, buffered saline, physiological saline, water, Hanks' solution, Ringer's solution, Nonnosol-R (Abbott Labs), Plasma-Lyte A® (Baxter Laboratories, Inc., Morton Grove, IL), glycerol, ethanol, and combinations thereof.
[0150] Exemplary generally used pharmaceutically acceptable carriers include any and all absorption delaying agents, antioxidants, binders, buffering agents, bulking agents or fillers, chelating agents, coatings, disintegration agents, dispersion media, gels, isotonic agents, lubricants, preservatives, salts, solvents or co-solvents, stabilizers, surfactants, and/or delivery vehicles.
[0151] Exemplary antioxidants include ascorbic acid, methionine, and vitamin E.
[0152] Exemplary buffering agents include citrate buffers, succinate buffers, tartrate buffers, fumarate buffers, gluconate buffers, oxalate buffers, lactate buffers, acetate buffers, phosphate buffers, histidine buffers, and/or trimethylamine salts.
[0153] An exemplary chelating agent is EDTA.
[0154] Exemplary isotonic agents include polyhydric sugar alcohols including trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol, or mannitol.
[0155] Exemplary preservatives include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben, octadecyldimethylbenzyl ammonium chloride, benzalkonium halides, hexamethonium chloride, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, and 3-pentanol.
[0156] Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which solubilizes the EBV therapeutic or helps to prevent denaturation or adherence to the container wall. Typical stabilizers can include polyhydric sugar alcohols; amino acids, such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, and threonine; organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol, and cyclitols, such as inositol; PEG; amino acid polymers; sulfur-containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, a-monothioglycerol, and sodium thiosulfate; low molecular weight polypeptides (i.e., <10 residues); proteins such as human serum albumin, bovine serum albumin, gelatin or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; monosaccharides such as xylose, mannose, fructose and glucose; disaccharides such as lactose, maltose and sucrose; trisaccharides such as raffinose, and polysaccharides such as dextran. Stabilizers are typically present in the range of from 0.1 to 10,000 parts by weight based on therapeutic weight.
[0157] The compositions disclosed herein can be formulated for administration by, for example, injection, inhalation, infusion, perfusion, lavage, or ingestion. The compositions disclosed herein can further be formulated for intravenous, intradermal, intraarterial, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intravesicular, oral and/or subcutaneous administration and more particularly by intravenous, intradermal, intraarterial, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, intrathecal, intratumoral, intramuscular, intravesicular, and/or subcutaneous injection.
[0158] For injection, compositions can be formulated as aqueous solutions, such as in buffers including Hanks' solution, Ringer's solution, or physiological saline. The aqueous solutions can include formulatory agents such as suspending, stabilizing, and/or dispersing agents. Alternatively, the formulation can be in lyophilized and/or powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
[0159] For oral administration, the compositions can be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like. For oral solid formulations such as powders, capsules and tablets, suitable excipients include binders (gum tragacanth, acacia, cornstarch, gelatin), fillers such as sugars, e.g., lactose, sucrose, mannitol and sorbitol; dicalcium phosphate, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate; cellulose preparations such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxy-methylcellulose, and/or polyvinylpyrrolidone (PVP); granulating agents; and binding agents. If desired, disintegrating agents can be added, such as corn starch, potato starch, alginic acid, cross-linked polyvinylpyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate. If desired, solid dosage forms can be sugar-coated or enteric-coated using standard techniques. Flavoring agents, such as peppermint, oil of wintergreen, cherry flavoring, orange flavoring, etc. can also be used.
[0160] Compositions can be formulated as an aerosol. In particular embodiments, the aerosol is provided as part of an anhydrous, liquid or dry powder inhaler. Aerosol sprays from pressurized packs or nebulizers can also be used with a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol, a dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges of gelatin for use in an inhaler or insufflator may also be formulated including a powder mix of EBV therapeutic composition and a suitable powder base such as lactose or starch.
[0161] Compositions can also be formulated as depot preparations. Depot preparations can be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salts.
[0162] Additionally, compositions can be formulated as sustained-release systems utilizing semipermeable matrices of solid polymers including at least one EBV therapeutic. Various sustained-release materials have been established and are well known by those of ordinary skill in the art. Sustained-release systems may, depending on their chemical nature, release one or more EBV therapeutics following administration for a few weeks up to over 100 days. Depot preparations can be administered by injection; parenteral injection; instillation; or implantation into soft tissues, a body cavity, or occasionally into a blood vessel with injection through fine needles.
[0163] Depot formulations can include a variety of bioerodible polymers including poly(lactide), poly(glycolide), poly(caprolactone) and poly(lactide)-co(glycolide) (PLG) of desirable lactide:glycolide ratios, average molecular weights, polydispersities, and terminal group chemistries. Blending different polymer types in different ratios using various grades can result in characteristics that borrow from each of the contributing polymers.
[0164] The use of different solvents (for example, dichloromethane, chloroform, ethyl acetate, triacetin, N-methyl pyrrolidone, tetrahydrofuran, phenol, or combinations thereof) can alter microparticle size and structure in order to modulate release characteristics. Other useful solvents include water, ethanol, dimethyl sulfoxide (DMSO), N-methyl-2-pyrrolidone (NMP), acetone, methanol, isopropyl alcohol (I PA), ethyl benzoate, and benzyl benzoate.
[0165] Exemplary release modifiers can include surfactants, detergents, internal phase viscosity enhancers, complexing agents, surface active molecules, co-solvents, chelators, stabilizers, derivatives of cellulose, (hydroxypropyl)methyl cellulose (HPMC), HPMC acetate, cellulose acetate, pluronics (e.g., F68/F127), polysorbates, Span® (Croda Americas, Wilmington, Delaware), polyvinyl alcohol) (PVA), Brij® (Croda Americas, Wilmington, Delaware), sucrose acetate isobutyrate (SAIB), salts, and buffers.
[0166] Excipients that partition into the external phase boundary of micro particles such as surfactants including polysorbates, dioctylsulfosuccinates, poloxamers, PVA, can also alter properties including particle stability and erosion rates, hydration and channel structure, interfacial transport, and kinetics in a favorable manner.
[0167] Additional processing of the disclosed sustained release depot formulations can utilize stabilizing excipients including mannitol, sucrose, trehalose, and glycine with other components such as polysorbates, PVAs, and dioctylsulfosuccinates in buffers such as Tris, citrate, or histidine. A freeze-dry cycle can also be used to produce very low moisture powders that reconstitute to similar size and performance characteristics of the original suspension.
[0168] Any composition disclosed herein can advantageously include any other pharmaceutically acceptable carriers which include those that do not produce significantly adverse, allergic, or other untoward reactions that outweigh the benefit of administration. Exemplary pharmaceutically acceptable carriers and formulations are disclosed in Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990. Moreover, formulations can be prepared to meet sterility, pyrogenicity, general safety, and purity standards as required by U.S. FDA Office of Biological Standards and/or other relevant foreign regulatory agencies.
[0169] (VIII) Kits. Also disclosed herein are kits including one or more containers including one or more of the anti-EBV antibodies, EBV vaccines, modified cells, EBV therapeutics, drug and/or imaging conjugates, and/or compositions and/or adjuvants described herein. Associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use, or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use, or sale for human administration. Particular embodiments of kits include: AMM01 , and/or AMM05; AMM01-5; a vaccine antigen AMM01 epitope; AMM01 and a vaccine antigen AMM01 epitope; a vaccine antigen AMM05 epitope; AMM05 and vaccine antigen AMM05 epitope; and/or AMM01 , AMM05, a vaccine antigen AMM01 epitope and a vaccine antigen AMM05 epitope. In particular embodiments, kits including a vaccine antigen AMM01 epitope and/or a vaccine antigen AMM05 epitope further include one or more vaccine adjuvants.
[0170] (IX) Methods of Use. Methods disclosed herein include treating subjects (e.g., humans, veterinary animals (dogs, cats, reptiles, birds) livestock (e.g., horses, cattle, goats, pigs, chickens) and research animals (e.g., monkeys, rats, mice, fish) with compositions disclosed herein. Treating subjects includes delivering therapeutically effective amounts. Therapeutically effective amounts include those that provide effective amounts, prophylactic treatments and/or therapeutic treatments.
[0171] An "effective amount" is the amount of a composition necessary to result in a desired physiological change in the subject. For example, an effective amount can provide an immunogenic effect. Effective amounts are often administered for research purposes. Effective amounts disclosed herein can cause a statistically-significant effect in an in vitro assay, an animal model or clinical study relevant to the assessment of an infection's development, progression, and/or resolution, as well as the effects of the infection. An immunogenic composition can be provided in an effective amount, wherein the effective amount stimulates an immune response.
[0172] A "prophylactic treatment" includes a treatment administered to a subject who does not display signs or symptoms of an infection or displays only early signs or symptoms of an infection such that treatment is administered for the purpose of diminishing or decreasing the risk of developing the infection further. Thus, a prophylactic treatment functions as a preventative treatment against an infection and/or the potential effects of an infection (e.g., IM, a lymphoproliferative disorder (e.g., Hodgkin lymphoma, non-Hodgkin lymphoma, Burkitt lymphoma, T cell lymphoma, lymphoproliferative disease), a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor).
[0173] In particular embodiments, a prophylactic treatment can prevent, delay, or reduce the risk of primary infection with a virus. In particular embodiments, primary infection can refer to when an EBV seronegative individual first becomes infected by EBV and therefore becomes EBV seropositive. In this context, seropositive requires a subject's serum to include different antibodies that bind with multiple and different EBV proteins. Primary infection can result in IM.
[0174] In particular embodiments, a prophylactic treatment can be given prior to treatment with an immunosuppressant (such as prior to an organ or cell-based transplant or before chemotherapy or ionizing radiation). In particular embodiments, a prophylactic treatment can prevent or reduce the severity of a lymphoproliferative disorder that may result from EBV primary infection during immunosuppression.
[0175] In particular embodiments, prophylactic treatments reduce, delay, or prevent the worsening of an infection. In particular embodiments, a prophylactic treatment can prevent, delay or reduce the severity of EBV reactivation. In particular embodiments, a prophylactic treatment can prevent or reduce the severity of a lymphoproliferative disorder that may result from EBV reactivation during immunosuppression. In particular embodiments, a prophylactic treatment can prevent or reduce the risk of a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor.
[0176] Particular uses of the compositions include use as prophylactic vaccines. Vaccines increase the immunity of a subject against a particular infection. Therefore, "EBV vaccine" can refer to a treatment that increases the immunity of a subject against EBV. Therefore, in particular embodiments, a vaccine may be administered prophylactically, for example to a subject that is immunologically naive (e.g., no prior exposure or experience with EBV). In particular embodiments, a vaccine may be administered therapeutically to a subject who has been exposed to EBV. Thus, a vaccine can be used to ameliorate a symptom associated with EBV, such as a lymphoproliferative disorder. A vaccine can also reduce the risk of a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor.
[0177] In particular embodiments, an EBV vaccine is a therapeutically effective composition including one or more EBV antigens including an AMMO epitope disclosed herein that induces an immune response in a subject against EBV. The skilled artisan will appreciate that the immune system generally is capable of producing an innate immune response and an adaptive immune response. An innate immune response generally can be characterized as not being substantially antigen specific and/or not generating immune memory. An adaptive immune response can be characterized as being substantially antigen specific, maturing over time (e.g., increasing affinity and/or avidity for antigen), and in general can produce immunologic memory. Even though these and other functional distinctions between innate and adaptive immunity can be discerned, the skilled artisan will appreciate that the innate and adaptive immune systems can be integrated and therefore can act in concert.
[0178] In particular embodiments, administration of an EBV vaccine can further include administration of one or more adjuvants. The term "adjuvant" refers to material that enhances the immune response to a vaccine antigen and is used herein in the customary use of the term. The precise mode of action is not understood for all adjuvants, but such lack of understanding does not prevent their clinical use for a wide variety of vaccines.
[0179] Exemplary vaccine adjuvants, include any kind of Toll-like receptor ligand or combinations thereof (e.g. CpG, Cpg-28 (a TLR9 agonist), po!yriboinosinic polyribocytidylic acid (Poly(l:C)), a- galactoceramide, MPLA, otoiimod (VTX-2337, a novel TLR8 agonist developed by VentiRx), IMO-2G55 (EMD1201081), TMX-101 (imiquimod), MGN 1703 {a TLR9 agonist), G 100 (a stabilized emulsion of the TLR4 agonist giucopyranosyl lipid A), Entolimod (a derivative of Salmonella fiage!lin also known as CBLB502), Hiitonoi (a TLR3 agonist), and Imiquimod), and/or inhibitors of heat-shock protein 90 (Hsp90), such as 17-DMAG (17-dimethylaminoethylamino-17- demethoxygeldanamycin).
[0180] In particular embodiments a squalene-based adjuvant can be used. Squalene is part of the group of molecules known as triterpenes, which are all hydrocarbons with 30 carbon molecules. Squalene can be derived from certain plant sources, such as rice bran, wheat germ, amaranth seeds, and olives, as well as from animal sources, such as shark liver oil. In particular embodiments, the squalene-based adjuvant is MF59® (Novartis, Basel, Switzerland). An example of a squalene-based adjuvant that is similar to MF59® but is designed for preclinical research use is Addavax™ (InvivoGen, San Diego, CA). MF59 has been FDA approved for use in an influenza vaccine, and studies indicate that it is safe for use during pregnancy (Tsai T, et al. Vaccine. 2010. 17:28(7):1877-80; Heikkinen T, et al. Am J Obstet Gynecol. 2012. 207(3): 177). In particular embodiments, squalene based adjuvants can include 0.1 %-20% (v/v) squalene oil. In particular embodiments, squalene based adjuvants can include 5%(v/v) squalene oil.
[0181] In particular embodiments the adjuvant alum can be used. Alum refers to a family of salts that contain two sulfate groups, a monovalent cation, and a trivalent metal, such as aluminum or chromium. Alum is an FDA approved adjuvant. In particular embodiments, vaccines can include alum in the amounts of 1-1000μg/dose or 0.1 mg-10mg/dose.
[0182] In particular embodiments, one or more STING agonists are used as a vaccine adjuvant. "STING" is an abbreviation of "stimulator of interferon genes", which is also known as "endoplasmic reticulum interferon stimulator (ERIS)", "mediator of IRF3 activation (MITA)", "MPYS" or "transmembrane protein 173 (TM173)".
[0183] In particular embodiments, STING agonists include cyclic molecules with one or two phosphodiester linkages, and/or one or two phosphorothioate diester linkages, between two nucleotides. This includes (3',5')-(3',5') nucleotide linkages (abbreviated as (3',3')); (3',5')-(2',5') nucleotide linkages (abbreviated as (3',2')); (2',5')-(3',5') nucleotide linkages (abbreviated as (2',3')); and (2',5')-(2',5') nucleotide linkages (abbreviated as (2',2')). "Nucleotide" refers to any nucleoside linked to a phosphate group at the 5', 3' or 2' position of the sugar moiety.
[0184] In particular embodiments, STING agonists include c-AIMP; (3',2')c-AIMP; (2',2')c-AIMP; (2',3')c-AIMP; c-AIMP(S); c-(dAMP-dlMP); c-(dAMP-2'FdlMP); c-(2'FdAMP-2'FdlMP); (2',3')c- (AMP-2'FdlMP); c-[2'FdAMP(S)-2'FdlMP(S)]; c-[2'FdAMP(S)-2'FdlMP(S)](POM)2; and DMXAA. Additional examples of STING agonists are described in WO2016/145102.
[0185] Other immune stimulants can also be used as vaccine adjuvants. Additional exemplary small molecule immune stimulants include TGF-β inhibitors, SHP-inhibitors, STAT-3 inhibitors, and/or STAT-5 inhibitors. Exemplary siRNA capable of down-regulating immune-suppressive signals or oncogenic pathways (such as kras) can be used whereas any plasmid DNA (such as minicircle DNA) encoding immune-stimulatory proteins can also be used.
[0186] In particular embodiments, the immune stimulant may be a cytokine and or a combination of cytokines, such as IL-2, IL-12 or IL-15 in combination with IFN-a, IFN-β or IFN-γ, or GM-CSF, or any effective combination thereof, or any other effective combination of cytokines. The above- identified cytokines stimulate TH1 responses, but cytokines that stimulate TH2 responses may also be used, such as IL-4, IL-10, IL-1 1 , or any effective combination thereof. Also, combinations of cytokines that stimulate TH1 responses along with cytokines that stimulate TH2 responses may be used.
[0187] "Immune response" refers to a response of the immune system to an EBV antigen disclosed herein. In particular embodiments, an immune response to an EBV antigen can be an innate and/or adaptive response. In particular embodiments, an adaptive immune response can be a "primary immune response" which refers to an immune response occurring on the first exposure of a "naive" subject to an EBV antigen. For example, in the case of a primary antibody response, after a lag or latent period of from 3 to 14 days depending on, for example, the composition, dose, and subject, antibodies to the EBV antigen can be produced. Generally, IgM production lasts for several days followed by IgG production and the IgM response can decrease. Antibody production can terminate after several weeks but memory cells can be produced. In particular embodiments, an adaptive immune response can be a "secondary immune response", "anamnestic response," or "booster response" which refer to the immune response occurring on a second and subsequent exposure of a subject to an EBV antigen disclosed herein. Generally, in a secondary immune response, memory cells respond to the EBV antigen and therefore the secondary immune response can differ from a primary immune response qualitatively and/or quantitatively. For example, in comparison to a primary antibody response, the lag period of a secondary antibody response can be shorter, the peak antibody titer can be higher, higher affinity antibody can be produced, and/or antibody can persist for a greater period of time.
[0188] In particular embodiments, an immune response against EBV will include antibody production against: the D-l/D-ll domain of a gH/gL complex, gB, and/or an AMMO epitope.
[0189] A "therapeutic treatment" includes a treatment administered to a subject who displays symptoms or signs of an infection and is administered to the subject for the purpose of diminishing or eliminating those signs or symptoms of the infection or effects of the infection (e.g. IM, a lymphoproliferative disorder (e.g., Hodgkin lymphoma, non-Hodgkin lymphoma, Burkitt lymphoma, T cell lymphoma, lymphoproliferative disease), a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor). The therapeutic treatment can reduce, control, or eliminate the presence or activity of the infection and/or reduce, control or eliminate side effects of the infection.
[0190] In particular embodiments a therapeutic treatment can reduce, control, or eliminate EBV reactivation. In particular embodiments, a reduction in EBV reactivation can be determined by measuring expression of EBV latency genes, wherein detection of fewer latency genes or detection of lower expression levels of latency genes can indicate a reduction in EBV reactivation.
[0191] In particular embodiments a therapeutic treatment can reduce, control, or eliminate a primary infection with EBV. In particular embodiments a therapeutic treatment can reduce or eliminate the symptoms of IM.
[0192] In particular embodiments, a prophylactic and/or therapeutic treatment can reduce the severity of immunosuppression treatment complications resulting from EBV primary infection of an immunosuppressed individual. In particular embodiments a therapeutically effective treatment to reduce the severity of immunosuppression treatment complications can be given to a pediatric patient. A pediatric patient can refer to patient who is 18 years of age or younger. Pediatric patients are more likely to be EBV seronegative and therefore are at an increased risk of immunosuppression treatment complications from EBV primary infection, as compared to adult patients.
[0193] In particular embodiments a therapeutic treatment can eliminate or reduce the severity of a lymphoproliferative disorder. Elimination of or reduced severity of a lymphoproliferative disorder can be indicated by a reduction in lymphocyte count in an individual with the lymphoproliferative disorder.
[0194] In particular embodiments a therapeutic treatment can eliminate or reduce the risk or severity of a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor.
[0195] Function as an effective amount, prophylactic treatment or therapeutic treatment are not mutually exclusive, and in particular embodiments, administered dosages may accomplish more than one treatment type.
[0196] In particular embodiments, therapeutically effective amounts provide anti-infection effects. Anti-infection effects include a decrease in the number of infected cells, a decrease in volume of infected tissue, reduced infection-associated lymphoproliferation, reduced occurrence of infection-associated carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor, and/or reduction or elimination of a symptom associated with the treated infection.
[0197] Effects of EBV infection can include infectious mononucleosis (IM), a lymphoproliferative disorder, and/or a carcinoma (e.g., nasopharyngeal and/or gastric) or a smooth muscle tumor. IM is an illness caused by primary infection with EBV and symptoms of IM can include fever, swollen lymph nodes, swollen tonsils, loss of appetite, fatigue, abdominal pain, and/or spleen enlargement. In particular embodiments, therapeutically effective amounts provide anti-IM effects. Anti-IM effects include a reduction or elimination of an IM symptom.
[0198] Lymphoproliferative disorders can refer to the uncontrolled division of lymphocytes. Subjects with compromised immune systems are at increased risk of developing a lymphoproliferative disorder. Examples of lymphoproliferative disorders include Hodgkin lymphoma, non-Hodgkin lymphoma, Burkitt lymphoma, T cell lymphomas, follicular lymphoma, chronic lymphocytic leukemia, acute lymphoblastic leukemia, hairy cell leukemia, B-cell lymphomas, multiple myeloma, Waldenstrom's macroglobulinemia, Wiskott-Aldrich syndrome, lymphocyte-variant hypereosinophilia, post-transplant lymphoproliferative disorder, and autoimmune lymphoproliferative syndrome. In particular embodiments, lymphoproliferative disorders include lymphoproliferative disease, which is an EBV-related lymphoma that occurs in 1-20% of bone marrow and solid organ transplant recipients.
[0199] Symptoms of lymphoproliferative disorders can include adenopathy, splenomegaly, and/or an abnormally high lymphocyte count in a subject's blood sample. In particular embodiments, therapeutically effective amounts provide anti-lymphoproliferative disorder effects. Anti- lymphoproliferative disorder effects include a reduction or elimination of a lymphoproliferative disorder or a symptom of a lymphoproliferative disorder.
[0200] In particular embodiments, the term "carcinoma" designates any disease involving unregulated proliferation of epithelial cells, and which may result in unregulated cell growth, lack of differentiation, tumors formation, local tissue invasion, and/or metastasis formation. Nasopharyngeal carcinoma (NPC) is a malignant tumor arising from the epithelial lining of the nasopharynx, which is located behind the nose and above the back of the throat. NPC differs significantly from other cancers of the head and neck, based on its causes, occurrence, clinical behavior, and treatment options. NPC is consistently associated with EBV and is the third most frequent virus-associated malignancy in humans.
[0201] Gastric carcinomas include gastric cancer, including intestinal and diffuse gastric adenocarcinoma, gastrointestinal stromal tumor (GIST), gastrointestinal leiomyosarcoma, gastrointestinal carcinoid, gastrointestinal lymphoma, esophagogastric adenocarcinoma (OGA), and colorectal carcinoma.
[0202] Leiomyomas are tumors composed of smooth muscle cells which can range from clearly benign leiomyoma (fibroids) to malignant leiomyosarcoma. Intermediate variants have also been identified and are termed "smooth muscle tumors of uncertain malignant potential". These may include cellular leiomyomas. Leiomyomas and leiomyosarcomas are most prevalent in the uterine smooth muscle, however, they can occur in any organ system which possesses smooth muscle. The second highest incidence of occurrence for these tumor types is in the gastrointestinal tract. Leiomyomas represent one of the most common benign tumors of the stomach, while gastric leiomyosarcomas represent 2% of all malignant tumors that occur in the stomach.
[0203] In particular embodiments, therapeutically effective amounts provide anti-carcinoma (e.g., anti-NPC; anti-gastric carcinoma) or anti-smooth muscle tumor effects which can include reducing the risk or occurrence of a carcinoma or smooth muscle tumor, limiting the further development of the carcinoma or smooth muscle tumor (e.g., tumor growth and/or metastasis), reversing the severity of the carcinoma or smooth muscle tumor, or other beneficial clinical outcomes, as understood one of ordinary skill in the art. For example, beneficial clinical outcomes include loss of detectable tumor (complete response), decrease in tumor size (partial response, PR), tumor growth or cell number increase arrest (stable disease, SD), enhancement of anti-tumor immune response, and/or relief, to some extent, of one or more symptoms associated with a carcinoma or smooth muscle tumor; increase in the length of survival following treatment; and/or decreased mortality at a given point of time following treatment.
[0204] For administration, therapeutically effective amounts (also referred to herein as doses) can be initially estimated based on results from in vitro assays and/or animal model studies. Such information can be used to more accurately determine useful doses in subjects of interest. The actual dose amount administered to a particular subject can be determined by a physician, veterinarian or researcher taking into account parameters such as physical and physiological factors including target, body weight, severity of infection, stage of infection, effects of infection (e.g., IM, lymphoproliferative disorders), previous or concurrent therapeutic interventions, idiopathy of the subject and route of administration.
[0205] Useful doses can range from 0.1 to 5 μg/kg or from 0.5 to 1 μg /kg. In other non-limiting examples, a dose can include 1 μg /kg, 15 μg /kg, 30 μg /kg, 50 μg/kg, 55 μg/kg, 70 μg/kg, 90 μg/kg, 150 μg/kg, 350 μg/kg, 500 μg/kg, 750 μg/kg, 1000 μg/kg, 0.1 to 5 mg/kg or from 0.5 to 1 mg/kg. In other non-limiting examples, a dose can include 1 mg/kg, 10 mg/kg, 30 mg/kg, 50 mg/kg,
70 mg/kg, 100 mg/kg, 300 mg/kg, 500 mg/kg, 700 mg/kg, 1000 mg/kg or more.
[0206] Useful doses can also include greater than 102 cells, greater than 103 cells, greater than
104 cells, greater than 105 cells, greater than 106 cells, greater than 107 cells, greater than 108 cells, greater than 109 cells, greater than 1010 cells, or greater than 1011 cells.
[0207] Therapeutically effective amounts can be achieved by administering single or multiple doses during the course of a treatment regimen (e.g., daily, every other day, every 3 days, every
4 days, every 5 days, every 6 days, weekly, every 2 weeks, every 3 weeks, monthly, every 2 months, every 3 months, every 4 months, every 5 months, every 6 months, every 7 months, every 8 months, every 9 months, every 10 months, every 11 months or yearly).
[0208] The pharmaceutical compositions described herein can be administered by, without limitation, injection, inhalation, infusion, perfusion, lavage or ingestion. Routes of administration can include intravenous, intradermal, intraarterial, intraparenteral, intranasal, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intravesicular, oral, subcutaneous, and/or sublingual administration and more particularly by intravenous, intradermal, intraarterial, intraparenteral, intranasal, intranodal, intralymphatic, intraperitoneal, intralesional, intraprostatic, intravaginal, intrarectal, topical, intrathecal, intratumoral, intramuscular, intravesicular, oral, subcutaneous, and/or sublingual injection.
[0209] (X) Exemplary Embodiments.
1. An anti-EBV antibody including the CDRs:
SEQ ID NO: 1 1 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16;
SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , and SEQ ID NO: 22;
SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28;
SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, and SEQ ID NO: 34; or
SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, and SEQ ID NO: 40.
2. An anti-EBV antibody including SEQ ID NO: 41 and SEQ ID NO: 42, but with mutations to SEQ ID NO: 41 selected from one or more of D10E; G76S; S83R; T84S; F91Y; V107T; and P113S and/or mutations to SEQ ID NO: 42 selected from one or more of E3V; Q17K; R18T; T20R; Q49Y; S69N; and G100T.
3. An anti-EBV antibody including SEQ ID NO: 41 and SEQ ID NO: 42, but with mutations to SEQ ID NO: 41 including D10E; G76S; S83R; T84S; F91Y; V107T; and mutations to SEQ ID NO: 42 including E3V; Q17K; R18T; T20R; Q49Y; S69N; and G100T.
4. An anti-EBV antibody including SEQ ID NO: 1 and SEQ ID NO: 2.
5. An anti-EBV antibody including SEQ ID NO: 1 with a Q1 N mutation and SEQ ID NO: 2.
6. An anti-EBV antibody including SEQ ID NO: 3 and SEQ ID NO: 4.
7. An anti-EBV antibody including SEQ ID NO: 3 with a Q1 N mutation and SEQ ID NO: 4. An anti-EBV antibody including SEQ ID NO: 5 and SEQ ID NO: 6.
An anti-EBV antibody including SEQ ID NO: 5 with an E1 N mutation and SEQ ID NO: 6. An anti-EBV antibody including SEQ ID NO: 5 and SEQ ID NO: 6 with a Q1 N mutation. An anti-EBV antibody including SEQ ID NO: 5 with an E1 N mutation and SEQ ID NO: 6 with a Q1 N mutation.
An anti-EBV antibody including SEQ ID NO: 7 and SEQ ID NO: 8.
An anti-EBV antibody including SEQ ID NO: 7 with an Q1 N mutation and SEQ ID NO: 8. An anti-EBV antibody including SEQ ID NO: 9 and SEQ ID NO: 10.
An anti-EBV antibody including SEQ ID NO: 9 with an E1 N mutation and SEQ ID NO: 10. An anti-EBV antibody including SEQ ID NO: 9 and SEQ ID NO: 10 with a E1 N mutation. An anti-EBV antibody including SEQ ID NO: 9 with an E1 N mutation and SEQ ID NO: 10 with a E1 N mutation.
An anti-EBV antibody that binds the EBV core fusion machinery: heterodimer envelope glycoprotein H/envelope glycoprotein L (gH/gL) and/or glycoprotein B (gB).
An anti-EBV antibody that binds the D-l/D-ll groove of the EBV gH/gL heterodimer complex. An anti-EBV antibody that binds at least one of residues 60, 70-81 , 21 1-216, and 234-239 of gH; and/or at least one of residues 123-128 of gL.
An anti-EBV antibody that binds residues 60, 70-81 , 211-216, and 234-239 of gH; and residues 123-128 of Gl
An anti-EBV antibody that binds residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine.
A human anti-EBV antibody, or an antigen-binding portion therof (e.g., scFv) that dissociates from EBV gH/gL with a KD of 1X10"10 or less and a k0ff rate constant of 3X10"5 s"1 or less, both determined by surface plasmon resonance or biolayer interferometry.
An antibody that binds to Epstein Barr Virus (EBV) gH/gL, wherein the antibody (i) binds an epitope on EBV gH/gL including at least one of residues 60, 70-81 , 211-216, and 234-239 of gH; and/or at least one of residues 123-128 of gL, (ii) inhibits EBV envelope fusion with a target cell; and (iii) competes for binding with the antibody CL40.
An antibody that binds to Epstein Barr Virus (EBV) gH/gL, wherein the antibody (i) binds an epitope on EBV gH/gL including residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine; (ii) inhibits EBV envelope fusion with a target cell; and and (iii) competes for binding with the antibody CL40.
An anti-EBV antibody of any of embodiments 1-25, that neutralizes EBV infection of B cells and/or epithelial cells. An anti-EBV antibody of any of embodiments 1-25, that neutralizes EBV infection of B cells and/or epithelial cells.
An anti-EBV antibody of any of embodiments 1-25, that neutralizes EBV infection of B cells and/or epithelial cells with an IC50 of 3X10"9M or less.
An anti-EBV antibody of any of embodiments 1-25, wherein the antibody neutralizes EBV infection of B cells and wherein the neutralizing EBV infection includes at least 90% neutralization.
An anti-EBV antibody of any of embodiments 1-25, wherein the neutralizing antibody neutralizes EBV infection of epithelial cells and wherein the neutralizing EBV infection includes at least 80% or at least 90% neutralization.
An anti-EBV antibody of any of embodiments 1-30, including one or more mutations that increase binding to Fc receptors (e.g., G236A/S239D/A330L/I332E (GASDALIE)) or improve ADCC (e.g., substitutions at positions 298, 333, and/or 334 (EU numbering)).
An anti-EBV antibody of any of embodiments 1-31 , including one or more mutations that increase protein half-life in serum (e.g., M428L/N434S).
An anti-EBV antibody of any of embodiments 1-32, including a thioMab.
An anti-EBV antibody of any of embodiments 1-33, wherein the Fc region has a reduced fucose content or lacks fucose.
An anti-EBV antibody of any of embodiments 1-34, including one or more polyethylene glycol (PEG)-linkages.
An anti-EBV antibody of any of embodiments 1-35, including one or more human serum albumin (HSA)-linkages.
An anti-EBV antibody of any of embodiments 1-36, wherein the antibody is derived from a monoclonal antibody and the derivation includes at least one mutation of the monoclonal antibody.
An anti-EBV antibody of any of embodiments 1-37, wherein the antibody is an scFV or a Fab. An anti-EBV antibody of any of embodiments 1-38, wherein the antibody was produced by a 293F cell.
An EBV vaccine including one or more immunogenic proteins that form (i) an AMM01 epitope or (ii) an AMM05 epitope.
An EBV vaccine of embodiment 40, wherein the AMM01 epitope includes (i) gH or a fragment of gH that can bind to gl_, and (ii) gl_ or a fragment of gl_ that can bind to gH; wherein the gH and gl_ form a gH/gL heterodimer complex. An EBV vaccine of embodiment 41 , wherein the vaccine further includes gp42 or a fragment of gp42 that can bind to the gH/gL heterodimer complex.
An EBV vaccine of any of embodiments 40-42, wherein the AMM05 epitope includes gB or a fragment thereof.
An EBV vaccine of any of embodiments 40-43, further including one or more adjuvants. An EBV vaccine of embodiment 44, wherein the one or more adjuvants are selected from alum, a squalene-based adjuvant, a STING agonist, or a liposome-based adjuvant.
An EBV vaccine of any of embodiments 40-45, wherein the one or more immunogenic proteins are linked to a multimerization domain.
An EBV vaccine of embodiment 46, wherein the multimerization domain is a C4b domain. An EBV vaccine of embodiment 47, wherein the multimerization domain is selected from SEQ ID NOs: 55-59.
A cell genetically modified to express an anti-EBV antibody or an EBV vaccine of any of embodiments 1-48.
A cell of embodiment 49, wherein the cell is genetically modified ex vivo.
A cell of embodiment 49, wherein the cell is genetically modified in vivo.
A cell of any of embodiments 49-51 , wherein the cell is a B cell.
A cell of any of embodiments 49-51 , wherein the cell is a cell of hematopoeitic origin that differentiates into a B cell.
A cell of any of embodiments 49-51 , wherein the cell is a CD34+ hematopoeitic stem cell. A composition formulated for administration to a subject including an anti-EBV antibody, an EBV vaccine, or a cell of any of embodiments 1-50, or 52-54.
A method of treating a subject for EBV infection including administering to the subject a therapeutically effective amount of a composition of embodiment 55 thereby treating the subject for EBV infection.
A method of embodiment 56, wherein the treating reduces or eliminates infectious mononucleosis (IM) and/or symptoms of IM.
A method of embodiment 56 or 57, wherein the treating (i) reduces or eliminates a lymphoproliferative disorder and/or symptoms of the lymphoproliferative disorder (e.g., Hodgkin lymphoma, non-Hodgkin lymphoma, Burkitt lymphoma, T cell lymphoma, lymphoproliferative disease), (ii) reduces the risk or occurrence of a carcinoma (e.g., nasopharyngeal carcinoma, gastric carcinoma), and/or (iii) reduces the risk or occurrence of a smooth muscle tumor. A method of neutralizing EBV infection, including contacting cells or tissue with an antibody of any of embodiments 1-39 or a cell of embodiments 49-54, thereby reducing or inhibiting EBV infection of the cells or the tissue.
A method of embodiment 59, wherein the cells are epithelial cells.
A method of embodiment 59, wherein the cells are B cells.
A method of embodiment 59, wherein the cells are epithelial cells and B cells.
A method of embodiment 59, wherein the tissue is epithelial tissue.
A method of stimulating an anti-EBV immune response in a subject including administering to the subject a therapeutically effective amount of an EBV vaccine of any of embodiments 41- 49, thereby stimulating an EBV immune response in the subject.
A method of embodiment 64, wherein the subject is EBV seropositive.
A method of embodiment 64, wherein the subject is an EBV seronegative subject, and wherein the therapeutically effective amount reduces the risk of EBV infection.
A method of embodiment 64, wherein the EBV seronegative subject is a pediatric patient. A method of any of embodiments 56-67, wherein the administering is prior to treatment with an immunosuppressant.
A method of any of embodiments 56-68, wherein the subject is a transplant patient.
A method of any of embodiments 56-69, wherein the therapeutically effective amount reduces the risk or severity of infectious mononucleosis (IM).
An antibody or vaccine of any of the previous embodiments that is recombinantly produced. An antibody of any of the previous embodiments that is recombinantly produced and includes at least one mutation from the sequences depicted in FIG. 24 wherein the at least one mutation is outside of a CDR region.
An antibody of any of the preceding embodiments conjugated to an imaging agent or drug (e.g., alkaline phosphatase, horseradish peroxidase, β-galactosidase; pertussis-toxin, diphtheria toxin, ricin, saporin, pseudomonas exotoxin, calicheamicin, taxoids, maytansinoids, tubulysins, dolastatin, dolastatin analogues (e.g., auristatin E, monomethylauristatin E, auristatin PYE and auristatin PHE); Abiraterone, Adriamycine, Anthracycline (Doxorubicin), Azacitidine, Azathioprine, Beuacizumab, Bortezomib, Bleomycin, Capecitabine, Camptotecine, Carboplatin, Cetuximab, Chlorambucil, Cisplatin, curacin, Cyclophosphamide, Cyclophosphoramide, Cytarabine, Dacarbazine, Daunorubicin, Doxifluridine, Epirubicin, Epothilone, Etoposide, 5-Fluorouracil, Gemeitabine, hydroxyurea, Idarubicin, Irinotecan, Imatinib, Lenalidomide, Leucovorin, Leuprorelin, Mechlorethamine, Mercaptopurine, Methotrexate, Mitoxantrone, oxadiazolines, Oxaliplatin, Paclitaxel, Pemetrexed, retinoic acid, Rituximab, sulfonamides, Taxotere (Docetaxel), Teniposide, Tioguanine, Topotecan, Trastuzumab, Valrubicin, Vinblastin, Vincristine, Vindesine, and Vinorelbine.
74. Use of an antibody of embodiment 73, to target EBV antigen-expressing tumor cells for imaging or destruction.
[00210] As indicated previously, variants of the sequences disclosed and referenced herein are included. In particular embodiments, variants of proteins can include those having one or more conservative amino acid substitutions or one or more non-conservative substitutions that do not adversely affect the function of the protein in a measure described in for example, FIGs. 8A, 8B. A "conservative substitution" involves a substitution found in one of the following conservative substitutions groups: Group 1 : Alanine (Ala), Glycine (Gly), Serine (Ser), Threonine (Thr); Group 2: Aspartic acid (Asp), Glutamic acid (Glu); Group 3: Asparagine (Asn), Glutamine (Gin); Group 4: Arginine (Arg), Lysine (Lys), Histidine (His); Group 5: Isoleucine (lie), Leucine (Leu), Methionine (Met), Valine (Val); and Group 6: Phenylalanine (Phe), Tyrosine (Tyr), Tryptophan (Trp).
[00211] Additionally, amino acids can be grouped into conservative substitution groups by similar function or chemical structure or composition (e.g., acidic, basic, aliphatic, aromatic, sulfur- containing). For example, an aliphatic grouping may include, for purposes of substitution, Gly, Ala, Val, Leu, and lie. Other groups containing amino acids that are considered conservative substitutions for one another include: sulfur-containing: Met and Cysteine (Cys); acidic: Asp, Glu, Asn, and Gin; small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, Pro, and Gly; polar, negatively charged residues and their amides: Asp, Asn, Glu, and Gin; polar, positively charged residues: His, Arg, and Lys; large aliphatic, nonpolar residues: Met, Leu, lie, Val, and Cys; and large aromatic residues: Phe, Tyr, and Trp. Additional information is found in Creighton (1984) Proteins, W.H. Freeman and Company.
[00212] In particular embodiments, variants of the protein sequences (e.g., antibodies, vaccine proteins, and/or multimerization domains) disclosed herein include sequences with at least 70% sequence identity, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the protein sequences described or disclosed herein.
[00213] "% sequence identity" refers to a relationship between two or more sequences, as determined by comparing the sequences. In the art, "identity" also means the degree of sequence relatedness between protein sequences or nucleic acid sequences as determined by the match between strings of such sequences. "Identity" (often referred to as "similarity") can be readily calculated by known methods, including (but not limited to) those described in: Computational Molecular Biology (Lesk, A. M., ed.) Oxford University Press, NY (1988); Biocomputing: Informatics and Genome Projects (Smith, D. W., ed.) Academic Press, NY (1994); Computer Analysis of Sequence Data, Part I (Griffin, A. M., and Griffin, H. G., eds.) Humana Press, NJ (1994); Sequence Analysis in Molecular Biology (Von Heijne, G., ed.) Academic Press (1987); and Sequence Analysis Primer (Gribskov, M. and Devereux, J., eds.) Oxford University Press, NY (1992). Preferred methods to determine % sequence identity are designed to give the best match between the sequences tested. Methods to determine % sequence identity and similarity are codified in publicly available computer programs. Sequence alignments and % sequence identity calculations may be performed using the Megalign program of the LASERGENE bioinformatics computing suite (DNASTAR, Inc., Madison, Wisconsin). Multiple alignment of the sequences can also be performed using the Clustal method of alignment (Higgins and Sharp CABIOS, 5, 151-153 (1989) with default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=10). Relevant programs also include the GCG suite of programs (Wsconsin Package Version 9.0, Genetics Computer Group (GCG), Madison, Wsconsin); BLASTP, BLASTN, BLASTX (Altschul, et al., J. Mol. Biol. 215:403-410 (1990); DNASTAR (DNASTAR, Inc., Madison, Wsconsin); and the FASTA program incorporating the Smith-Waterman algorithm (Pearson, Comput. Methods Genome Res., [Proc. Int. Symp.] (1994), Meeting Date 1992, 11 1-20. Editor(s): Suhai, Sandor. Publisher: Plenum, New York, NY. Wthin the context of this disclosure it will be understood that where sequence analysis software is used for analysis, the results of the analysis are based on the "default values" of the program referenced. "Default values" will mean any set of values or parameters, which originally load with the software when first initialized.
[00214] (XI) Example 1. In particular embodiments, the anti-EBV antibodies have one or more of the following characteristics:
A) bind to recombinant and/or wild-type gH/gL;
B) bind residues 60, 70-81 , 211-216, and 234-239 of gH; and residues 123-128 of gl_;
C) bind residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine;
D) bind to endogenous gH/gL on the surface of an EBV virion;
E) compete for gH/gL binding with the CL40 antibody;
F) bind to gH D-l/D-ll linker region, as well as the gL C-terminus;
G) dissociate from EBV gH/gL with a KD of 1X10"10 or less and a k0ff rate constant of 3X10" 5 s"1 or less, both determined by surface plasmon resonance or biolayer interferometry;
H) bind to wild-type gH/gL with a KA of more than 1 X107M"\ more than 100 X107M"\ more than 200 X107M"1 or more than 500 X107M"1 ;
I) bind to recombinant and/or wild-type gB;
J) bind to endogenous gB on the surface of an EBV virion; K) reduce EBV fusion with a target cell;
L) reduce EBV fusion with an epithelial cell;
M) reduce EBV fusion with a B cell;
N) reduce EBV fusion with an epithelial cell and a B cell;
O) neutralize EBV infection of B cells and/or epithelial cells;
P) neutralize EBV infection of B cells and epithelial cells;
Q) neutralize EBV infection of B cells and/or epithelial cells with an IC50 of 3X10"9M or less;
R) include CDRs that include the amino acid sequences SEQ ID NOs: 11-16, SEQ ID NO: 17-22, SEQ ID NOs: 23-28, SEQ ID NOs: 29-34, or SEQ ID NOs: 35-40; and/or
S) are recombinantly produced with mutations outside of the CDR regions described herein.
[0215] Example 2. An anti-gH/gL antibody that neutralizes dual-tropic infection defines a site of vulnerability on Epstein-Barr virus. Epstein-Barr virus (EBV) infects the majority of adults worldwide. Although most primary infections are asymptomatic, EBV is a causative agent of infectious mononucleosis in children and young adults, and is associated with numerous hematopoietic and epithelial cell cancers (Cohen et al., 201 1 ; Young and Rickinson, 2004). EBV also causes lymphoproliferative disorders in immunocompromised patients such as those with HIV/AIDS or in patients undergoing immune suppression for organ transplantation (Taylor et al., 2015). Thus, a vaccine that prevents EBV infection would be of major benefit to public health (Cohen et al., 201 1). EBV targets B cells and epithelial cells during primary infection. Host cell entry is a complex process mediated by several viral glycoproteins that define tropism and mediate membrane fusion at the plasma membrane during epithelial cell infection or following endocytosis during B-cell infection (Miller and Hutt-Fletcher, 1992). Three virally encoded surface glycoproteins
(gH, gl_ and gB) share a conserved function among herpesviruses and are required for EBV infection of both B cells and epithelial cells (Connolly et al., 201 1).
[0216] gB is a type III transmembrane fusion protein that promotes the merger of the viral and host membranes (Backovic et al., 2009). gB activity is dependent upon the heterodimeric gH/gL complex, which acts as an adaptor that triggers gB-mediated fusion upon binding a cell-surface receptor on target host cells (Mohl et al., 2016; Stampfer and Heldwein, 2013). The gH/gL complex is anchored to the cell membrane through a C-terminal trans-membrane domain on gH. The expression of gL is critical for the correct folding and cell surface expression of the gH/gL complex (Hutchinson et al., 1992; Li et al., 1997). gH/gL assumes an elongated structure including four distinct domains designated D-l to D-IV. D-l is formed by gL and the N-terminus of gH whereas the rest of gH includesD-ll through D-IV (Matsuura et al., 2010). D-l and D-l I are separated by a prominent groove and connected by a linker helix (Matsuura et al., 2010). Mutations that affect membrane fusion have been identified throughout gH/gL, but most map to D-l and the DI/D-II interface, including the linker helix and the groove between D-l and D-l I (Chen et al., 2013a; Mohl et al., 2014; Omerovic et al., 2005; Plate et al., 201 1 ; Sathiyamoorthy et al., 2016; Wu et al., 2005), indicating that this region of gH/gL is important for the interaction with, or activation of gB.
[0217] gH/gL is required for efficient binding to epithelial cells (Molesworth et al., 2000; Oda et al., 2000). ανβδ, ανβ6, or ανβδ integrins (Chesnokova and Hutt-Fletcher, 201 1 ; Chesnokova et al., 2009), and the ephrin receptor A2 (EphA2) (Chen et al., 2018; Zhang et al., 2018) have been identified as epithelial cell surface receptors that interact directly with gH/gL to trigger gB- mediated fusion. An exposed KGD motif on D-l I has been proposed to mediate gH/gL binding to integrins since a D-ll-derived peptide containing the KGD motif inhibits binding of soluble gH/gL to epithelial cells and partially blocks EBV infection (Chesnokova and Hutt-Fletcher, 2011 ; Chesnokova et al., 2009). The binding site of EphA2 on gH/gL is unknown.
[0218] B cell infection requires an additional viral glycoprotein, gp42, which forms a 1 :1 complex with gH/gL (Kirschner et al., 2006). The N-terminus of gp42 mediates high-affinity interactions with gH/gL and the C-terminus binds to the B chain of human leukocyte antigen (HLA) class II which leads to triggering of gB-mediated fusion through the gH/gl_/gp42 complex (Haan et al., 2000; Sathiyamoorthy et al., 2014; Spriggs et al., 1996). Although gp42 is necessary for B cell infection, it inhibits epithelial cell infection (Kirschner et al., 2007; Kirschner et al., 2006; Wang et al., 1998) through a mechanism that is not entirely clear. Residues connecting the N- and C- terminal domains of gp42 make contact with the gH/gL KGD motif suggesting that gp42 could prevent integrin attachment by competing for the same binding site (Sathiyamoorthy et al., 2016).
[0219] However, an N-terminal peptide of gp42 that binds distal to the KGD motif is sufficient to inhibit epithelial cell infection (Kirschner et al., 2007; Sathiyamoorthy et al., 2016).
[0220] Virions produced in B cells contain lower levels of gp42 than virions produced in epithelial cells. Thus, virions that shed from one cell type preferentially infect the other (Borza and Hutt- Fletcher, 2002).
[0221] gp350 is the most abundant glycoprotein on the surface of EBV virions (Edson and Thorley-Lawson, 1981) and it promotes viral attachment to target cells through a high affinity interaction with CD21 (Tanner et al., 1987) or CD35 (Ogembo et al., 2013) without mediating fusion. Although anti-gp350 antibodies can inhibit B cell infection in vitro, some can enhance infection of CD21-negative epithelial cells (Turk et al., 2006).
[0222] Sera from EBV-infected individuals can neutralize both B cell and epithelial cell infection in vitro (Miller et al., 1972; Moss and Pope, 1972; Sashihara et al., 2009; Tugizov et al., 2003). However, the antigens and epitope specificities targeted by the corresponding neutralizing antibodies are not known. To date, only a handful of anti-EBV neutralizing monoclonal antibodies (MAbs) have been characterized, and all of them are of murine origin. The 72A1 MAb binds to the CD21/CD35 binding site on gp350 (Ogembo et al., 2013; Tanner et al., 1987) and potently neutralizes B cell infection (Hoffman et al., 1980; Sashihara et al., 2009), but has no effect on infection of CD21 -negative epithelial cells (Molesworth et al., 2000; Tugizov et al., 2003). The C1 MAb binds to an unknown epitope on gp350 and inhibits B cell infection but promotes infection of epithelial cells (Thorley-Lawson and Geilinger, 1980; Turk et al., 2006). F-2-1 targets gp42 and inhibits B cell but not epithelial cell infection (Chesnokova and Hutt-Fletcher, 201 1 ; Li et al., 1995; Molesworth et al., 2000; Strnad et al., 1982). CL55 is the only known EBV gB- specific MAb and it is non-neutralizing in both B-cell and epithelial cell infection assays (Chesnokova and Hutt-Fletcher, 201 1 ; Wu et al., 2005).
[0223] E1 D1 , CL59, and CL40 are murine MAbs which bind to gH/gL and neutralize epithelial cell infection but fail to efficiently block infection of B cells (Balachandran et al., 1987; Chesnokova and Hutt-Fletcher, 2011 ; Li et al., 1995; Molesworth et al., 2000).
[0224] Mutagenesis and negative-stain electron microscopy (EM) studies have mapped the CL59 epitope to D-IV of the gH/gL complex (Sathiyamoorthy et al., 2017; Wu et al., 2005). High- resolution structures have recently demonstrated that E1 D1 binds exclusively to gL (Sathiyamoorthy et al., 2016), and that CL40 binds to an epitope at the D-ll/D-lll interface of gH (Sathiyamoorthy et al., 2017), but the mechanisms by which these MAbs neutralize EBV infection have not been elucidated.
[0225] The isolation and structural characterization of neutralizing MAbs elicited during natural human infections with human immunodeficiency virus (HIV), influenza virus, respiratory syncytial virus (RSV), human cytomegalovirus (CMV) and dengue virus (DENV) have defined critical epitopes on these pathogens and advanced vaccine design (Rappuoli et al., 2016). To better characterize the human humoral immune response against EBV, antigen-specific memory B cells from EBV-infected individuals were sought. Several anti-gB antibodies were obtained one of which neutralized epithelial cell, but not B cell infection. One anti-gH/gL antibody, called AMM01 that potently neutralizes both epithelial and B cell infection in vitro (and thus defines an important site of EBV vulnerability) was obtained. Using a combination of cryo-electron microscopy (cyroEM) and X-ray crystallography the structure of the gH/gl_/gp42/AMM01 complex was determined. This analysis demonstrated that AMM01 binds to a discontinuous epitope on gH/gL at the interface between D-l and D-ll, which is implicated in triggering of gB- mediated fusion of the viral and cellular membranes.
[0226] The isolation and characterization of AMM01 described herein paves the way for the design of a gH/gL-based subunit vaccine. The dual-tropic inhibition of EBV entry by AMM01 indicates that this MAb could also have therapeutic potential in blocking EBV infection, reactivation, and amplification in immunocompromised individuals and transplant recipients.
[0227] Material and Methods.
[0228] Human Subjects. Peripheral blood mononuclear cells (PBMC) and serum were collected from seven HIV-uninfected, and eight HIV-infected adults recruited at the Seattle HIV Vaccine Trials Unit (Seattle, Washington, USA) as part of the study "Establishing Immunologic Assays for Determining HIV-1 Prevention and Control", also referred to as Seattle Assay Control or SAC. All participants signed informed consent, and the following institutional human subjects review committee approved the protocol prior to study initiation: Fred Hutchinson Cancer Research Center IRB (Seattle, Washington, USA). Donors were selected randomly and no considerations were made for age, or sex.
[0229] Plasmids. cDNA encoding to gH (AA 19-679, Genbank AFY97969.1), gp42 (amino acids 33-223, genbank: AFY97939.1), gp350 (AA 1-470, Genbank: AAD51697.1), and gB AA 23-683, Genbank: AFY97983.1) with the residues WY112-113 mutated to HR and WLIW193-196 mutated to RVEA (Backovic et al JIV 2007) were synthesized with an N-terminal TPA leader peptide (M DAM KRGLCCVLLLCGAVFVSPSAS (SEQ ID NO: 62)) and a C-terminal HIS-Avi Tag (GSGSGHHHHHHGLNDIFEAQKI EWHE (SEQ ID NO: 63)) and cloned into the EcoRI and Notl sites of the pTT3 plasmid. gl_ (AA 24-137 Genbank: AFY97944.1), was synthesized with an N- terminal TPA leader peptide (SEQ ID NO: 62) without a C terminal tag and cloned into the EcoRI and Notl sites of the pTT3 plasmid. Site directed mutagenesis was used to introduce stop codons into gH and gp42 between the HIS and Avi tags to produce expression plasmids without the Avi- Tag, and to introduce the T62A and T175A mutations into gH and gp42, respectively. The murine CD40L sequence flanked by an Xbal-Kozak sequence on the 5' end and a Not I site on the 3' end was synthesized by Genscript and cloned into the Xbal and Notl sites of pCDH-EF-MCS- IRES-RFP vector (Systembio) to create pCDH-muCD40L-RFP.
[0230] pCAGGS expression plasmids for gH, gl_, gB, and pT7EMCLuc (which carries a luciferase-containing reporter plasmid under the control of the T7 promoter) were kindly provided by Dr. R. Longnecker (Haan et al., 2001 ; Okuma et al., 1999; Plate et al., 201 1). Plasmids for the expression of humanized, recombinant 72A1 were provided by Dr. F. Wang (Herrman et al., 2015). p509, an expression plasmid encoding BZLF1 , was provided by Dr. W. Hammerschmidt (Delecluse et al., 1998). p2670, an expression plasmid encoding BALF4, was provided by Dr. H. Delecluse (Neuhierl et al., 2002).
[0231] Recombinant Antibody Cloning. Codon optimized cDNAs encoding a murine leader sequence MGWSCIILFLVATATGVHS (SEQ ID NO: 64) followed by the human lgG1 , IgL or IgK constant regions were synthesized by IDT and cloned into the EcoRI and BamHI sites of pTT3. VH and VL sequences recovered from sorted B cells using RT PCR (see below) were amplified with gene-specific primers or synthesized by IDT and assembled in frame into the appropriate linearized IgG IgK or IgL plasmid using InFusion cloning (Clontech) according to the manufacturer's instructions. The sequences of the recombinant antibody plasmids were verified by Sanger sequencing (Genewiz).
[0232] Cell lines. All cell lines were incubated at 37°C in the presence of 5% C02 and were not tested for mycoplasma contamination. 293T (ATCC: CRL-3216) cells were grown in DMEM containing 10% FBS, 2 mM L-glutamine, 100 U/ml penicillin, and 100 μg/ml streptomycin (cDMEM). CHO K-1 (ATCC: CCL-61), and AGS (ATCC: CRL- 1739) cells were maintained in Ham's F-12 + 10% FBS, 2 mM L-glutamine, 100 U/ml penicillin, and 100 μg/ml streptomycin (cF- 12). Raji cells, as well as the 72A1 (ATCC: HB-168), CL55 (Wu et al., 2005), F-2-1 (Strnad et al., 1982), CL40, CL59 (Molesworth et al., 2000), and E1 D1 (Balachandran et al., 1987) hybridomas, were maintained in RMPI + 10% FBS, 2 mM L-glutamine, 100 U/ml penicillin, and 100 μg/ml streptomycin (cRPMI). 293-2089 cells (Delecluse et al., 1998) were grown in cRPMI containing 100μg/ml hygromycin. AKATA B cells harboring EBV in which the thymidine kinase gene has been replaced with a neomycin and GFP cassette virus (AKTA-GFP) (Molesworth et al., 2000), were grown in cRMPI containing 350μg/ml G418. SVKCR2 cells (Li et al., 1992) were grown in DMEM containing 10% cosmic calf serum, 2 mM L-glutamine, 100 U/ml penicillin, and 100 μg/ml streptomycin, 10 ng/ml cholera toxin and 400 μg/ml G418. 293-T7 cells (Omerovic et al., 2005) were maintained in cDMEM containing 100μg/ml Zeocin. 293F cells (ThermoFisher) were maintained in Freestyle 293 media with gentle shaking.
[0233] Recombinant Protein Expression. Plasmids encoding EBV proteins, or antibody heavy and light chains were transfected into 293F cells at a density of 106 cells/ml in Freestyle 293 media (ThermoFisher) using the 293Free transfection reagent (EMD Millipore) according to the manufacturer's instructions. Expression was carried out in Freestyle 293 media for 6 days after which cells and cellular debris were removed by centrifugation at 4,000 χ g followed by filtration through a 0.22 μηι filter. Clarified cell supernatant containing EBV proteins was passed over Ni- NTA resin (Qiagen), pre-equilibrated with Ni-NTA binding buffer (0.3 M NaCI, 20 mM Tris, 10mM imidazole, pH 8.0), followed by extensive washing with Ni-NTA binding buffer, and then eluted with 250 mM imidazole, 0.3 M NaCI, 20 mM Tris, pH 8.0 (Ni-NTA elution buffer). Purified proteins were then dialyzed overnight into PBS. AVI-tagged gB, gp350, and gp42 were biotinylated in vitro using the In Vitro Biotin Ligase Kit (Avidity) according to the manufacturer's instructions.
[0234] Proteins were further purified by SEC using a 10/300 S 200 column (GE Healthcare) equilibrated into HBSE (10 mM HEPES, 150 mM NaCI, 2 mM EDTA pH 7.4), which also served to remove un-ligated biotin and BirA enzyme. Biotinylated proteins were flash frozen and stored at -20°C until use.
[0235] Clarified cell supernatant containing recombinant antibodies was passed over Protein A Agarose (Pierce, cat # 20333), followed by extensive washing with PBS, and then eluted with 1 ml of Pierce IgG Elution Buffer, pH 2.0 (cat. # 21028) into 0.1 ml of Tris HCI, pH 8.0. Purified antibodies were then dialyzed overnight into PBS.
[0236] Recombinant monomeric DRB1*01 : 1 complexed with the Human CLIP peptide was obtained from the NIH Tetramer Core Facility, ανβδ (Cat# 2528-AV-050), ανβ6 (Cat# 3817-AV- 050) and ανβδ (Cat# 4135-AV-050) integrins, and the Ephrin receptor A2 (Cat# 3035-A2-100) were purchased from R&D systems.
[0237] Recombinant Protein Biotinylation. AMM01 , E1 D1 , CL40, CL59, and gH/gL were biotinylated at a theoretical 1.5: 1 biotin/protein with the EZ-Link Sulfo-NHS-Biotin Kit (ThermoFisher Scientific) according to the manufacturer's instructions. Free biotin was removed by 3 successive rounds of dilution with PBS and concentration with a 30,000 MCOW concentrator (Amicon).
[0238] Antigen Binding Fragment (Fab) preparation. AMM01 Fab was produced by digesting AMM01 IgG with Endoproteinase Lys-C (Roche) overnight at 37°C (10Mg IgG: 1 ng Lys C). Fab fragments were separated from Fc fragments with protein A agarose (Pierce), then further purified with SEC (Superdex 200). CL40 Fab was produced by digesting CL40 IgG with activated immobilized ficin (Thermo Fisher) at 37°C for 48 hrs. Fab fragments were separated from Fc fragments with protein A agarose (Pierce), then further purified with SEC (Superdex 200).
[0239] 3T3-CD40L cell line generation. Lentiviruses were produced by co-transfecting the pCDH- muCD40L-RFP, psPAX2 (Addgene#12260) and pMD2.G (Addgene#12259) plasmids at a 4:2:1 ratio (6, 3, and 1.5 μg, respectively) into 293T cells using the GeneJuice Transfection reagent according to the manufacturer's instructions. 48 hours later the supernatant was collected and passed through a 0.22 μηι filter. Supernatant was then transferred to 3T3 cells followed by the addition of 4 μg/ml polybrene (ATCC # CRL-1658) and incubated overnight in cDMEM. Cells were then passaged for 7 days. CD40L-expressing cells were identified with a PE-labeled CD154 antibody (Biolegend Cat # 106505) and sorted by FACS on a Beckman FACS Ariall. Sorted cells were expanded and cultured indefinitely.
[0240] Biolayer Interferometry (BLI). BLI assays were performed on the Octet Red instrument (ForteBio, Inc.) at 30°C with shaking at 1 ,000 RPM.
[0241] Validation of EBV glycoprotein antigenicity using murine hybridomas: Anti-EBV antibodies were captured using Anti-Mouse IgG Fc capture (AMC) biosensors (Fortebio) by immersing sensors directly into hybridoma culture supernatants for 600s. A baseline signal (nm shift) was recorded for 1 min in kinetics buffer (KB: 1X PBS, 0.01 % BSA, 0.02% Tween 20, and 0.005% NaN3,) at pH 7.4 or pH 5.0 as indicated. Sensors were then immersed into solutions containing a 0.5μΜ concentration of each EBV glycoprotein for 250 s to measure association, followed by immersion in KB for 500 s to measure dissociation. All measurements of antibody binding were corrected by subtracting the signal obtained from simultaneous traces performed with the corresponding envelopes in the absence of antibody, using PBS only.
[0242] Kinetic analysis: Anti-Human IgG Fc capture (AHC) sensors (for human antibodies), AMC (for murine antibodies), or streptavidin sensors (for biotinylated antibodies or biotinylated gH/gL or gH T62A/gl_) were immersed in KB containing 10 μg/ml of purified antibody or biotinylated protein for 200s. After loading, the baseline signal was then recorded for 1 min in KB. The sensors were immersed into wells containing serial dilutions of purified recombinant gH/gL or gH-T62A/gL in KB for 250s (association phase), followed by immersion in KB for an additional 750s (dissociation phase). The background signal from each analyte-containing well was measured using empty reference sensors, and subtracted from the signal obtained with each corresponding ligand-coupled sensor. The background signal of ligand-coupled sensors in KB was subtracted from each sensor at each time-point using the data analysis software (ForteBio). Kinetic analyses were performed at least twice with an independently prepared analyte dilution series. Curve fitting was performed using a 1 :1 binding model and the data analysis software (ForteBio). Mean kon, koff values were determined by averaging all binding curves that matched the theoretical fit with an R2 value of≥0.99. Binding analyses at pH 5.0 were carried out as above using biotinylated antibodies and Streptavidin sensors.
[0243] Antibody competition binding assays: Biotinylated antibodies were diluted to 10 μg/ml and captured onto streptavidin sensors for 120s. The baseline interference was then read for 60s in KB buffer, followed by immersion for 250s (association phase) in a 250 nM solution of gH/gL alone, or gH/gL that had been pre-incubated with 500 nM of non-biotinylated Abs for 20 min in KB. Sensors were then immersed in KB for 750 s (dissociation phase). [0244] gH/gl_/gp42-HLA-DR binding assays: Biotinylated gH/gL was immobilized on streptavidin biosensors, and then immersed into KB buffer for 60 seconds followed by into a 1 μΜ solution of gp42 for 200 seconds. One biosensor was then immersed into a 1 μΜ solution of the AMM01 Fab, while the other was immersed in KB for 200 seconds. The biosensors were then immersed into a 500 nM solution of HLA-DR for 300 seconds (association phase) and then into KB for 300 seconds (dissociation phase). One gH/gl_-gp42 loaded sensor was immersed in buffer as a reference during the association and dissociation steps and used to subtract the background signal.
[0245] gH/gL-integrin binding assays: Biotinylated gH/gL was diluted to 10 μg/ml and captured onto streptavidin sensors for 120s. The baseline interference was then read for 60s in KB buffer containing followed by immersion for 200s (association phase) into KB buffer containing 1 μΜ of 8νβ5, 8νβ6, 8νβ8, gp42, or an HIV-1 Envelope protein (426c TM4 AV1-3(McGuire et al., 2016)). Sensors were then immersed in KB containing for 400s (dissociation phase).
[0246] gH/gL EphA2 binding assays: Biotinylated gH/gL was diluted to 30 μg/ml and immobilized on streptavidin biosensors for 120s, and then immersed in KB buffer for 60 seconds.
[0247] Biosensors were then immersed into either KB buffer or into a 1.5 μΜ solution of AMM01 for 60 seconds. The biosensors were then immersed into a 3.5 μΜ solution of EphA2 for 250 seconds (association phase) and then into KB for 250 seconds (dissociation phase). To control for non-specific binding due to the high analyte concentration, the binding signal to biotinylated gp42 immobilized on biosensors assayed under identical conditions was subtracted.
[0248] Serum ELISA. 50 ng/well of gp350, gp42 or gB, were adsorbed onto 96 well Immulon 2HB ELISA plates at either 37°C for 1 hour or room temperature overnight in a solution of 0.1 M NaHCOs pH 9.4-9.6. Plates were then washed 4 times with ELISA washing buffer (1 * PBS, 0.02% Tween 20) prior to blocking at 37°C for 1 hour or 4°C overnight with 250 μΙ per well of PBS containing 10% Non-Fat Milk and 0.02% Tween 20 (blocking buffer). After blocking, plates were washed 4* with ELISA washing buffer. Serum was diluted in blocking buffer and three-fold serial dilutions were performed in duplicate followed by a 1 hour incubation at 37°C. Following 4 additional washes with ELISA washing buffer, a 1 :3000 dilution of goat anti-human Ig HRP (Southern Biotech 2010-05) in blocking buffer was added to each well and incubated at 37°C for 1 hour followed by 4 washes with wash buffer. 50 μΙ/well of SureBlue Reserve TMB Microwell Peroxidase substrate (KPL 53-00-00) was added. After 3 min, 50 μΙ/well of 1 N Sulfuric Acid was added and the A450 of each well was read on a Molecular Devices SpectraMax M2. Analysis was performed using the Prism 6 package (Graphpad Software). [0249] ELISAs against gH/gL were performed essentially the same as above except for the following changes. 100 μΙ/well of a 1 μg/ml solution of His-tagged gH/gL was immobilized on Nickel Coated Plates (Pierce Cat# 15442) in 1 * PBS and 0.5% Tween 20 overnight at 4°C. The blocking buffer consisted of PBS containing 10% Non-Fat Milk, 0.02% Tween20, and 10 mM imidazole. The background of serum reactivity with the nickel-coated plates of each donor's sera was subtracted from that of gH/gL at each serum dilution.
[0250] Conjugation of antigens to fluorescently labeled streptavidin. Biotinylated EBV glycoproteins were mixed with streptavidin-phycoerythrin (SA-PE, Prozyme Cat # PJRS25) at a 4: 1 biotin to streptavidin ratio.
[0251] B cell sorting. Cryopreserved PBMC were thawed into cRMPI, at a concentration of 4 million PBMC/ml, followed by centrifugation at 300 χ g for 5 min. Cells were suspended in 100μΙ cRPMI and incubated with an irrelevant, Avi-tagged recombinant decoy protein from Plasmodium yoelii (PY-gamma, a kind gift from Dr. D.N. Sather) conjugated to streptavidin PE labeled with Dylite 650 (SA-PE-DL650) to a final concentration of 10 nM of PE-DL650 for 10 min at 4°C.
[0252] Antigen (gB, gH/gL, gp42, or gp350) conjugated to streptavidin-phycoerythrin (SA-PE) was then added to a final concentration of 10nM and incubated for 20 min at 4°C. 25 μΙ of Anti- PE MicroBeads (Miltenyi Biotech) were added and incubated for an additional 30 min at 4°C. The cell/bead mixture was then passed over a LS MACS separation column (Miltenyi Biotec # 130-042-401) on a MACS separator and washed with 6 ml of FACS buffer (PBS + 1 % FBS). The column was removed from the MACS separator and eluted two times with 5 ml of FACS buffer. PE-enriched PBMC were then pelleted by centrifugation at 300 χ g for 5 min, and then re- suspended in 100 μΙ of FACS buffer. Enriched PBMC were then stained with the following antibodies: IgM-FITC (BD #555782) at a 1 :20 dilution, lgD-PerCP-Cy5.5 (BD # 561316) at a 1 : 100 dilution, CD27-PE-Cy7 (eBioscience #25-0271-82) at a 1 :200 dilution, CD20-eF450 (eBioscience 48-0209-42) at a 1 : 100 dilution, CD3-BV711 (BD #563725) at a 1 : 100 dilution, CD14-BV711 (BD #563372) at a 1 : 100 dilution, CD16-BV71 1 (BD 563127) at a 1 : 100 dilution, CD19-BV786 (BD 563325) at a 1 :100 dilution, and a fixable viability dye eFluor 506 (eBioscience # 65-0866-14) at a 1 :200 dilution for 25 min at 4°C. Stained cells were diluted to 5 ml with FACS buffer, pelleted by centrifugation at 300 χ g for 5 min and then suspended in 0.5 ml of FACS buffer and subjected to FACS on a BD FACS Aria II.
[0253] Live, antigen-positive class-switched B cells (Live/dead-, CD3-, CD14-, CD16-, CD19+ CD20+ IgM-, IgD-, PE-DL650-, PE+) were sorted individually into 96 well plates containing 2.86x 104 irradiated 3T3-CD40L cells in ΙΟΟ μΙ/well IMDM containing 10% FBS, I x glutamax, 100 U/ml penicillin, 100 g/ml streptomycin, 100 U/ml IL2 (Roche, cat. no. 11 147528001) and 50 ng/ml IL21 (Invitrogen, cat. no. PHC0215) (Huang et al., 2013). Cells were cultured at 37°C, 5% CO2. 13 days later the 80 μΙ of supernatant was transferred into 96 well round-bottom plates. 20 μΙ of lysis buffer (15 mM Tris pH 8.0, containing RNAse inhibitor) was added to the wells containing cells. The cells were then frozen on dry ice and stored at -80°C.
[0254] Sorted Cell Supernatant Screening. Nunc 384 well MaxiSorp plates were coated overnight at room temperature with 50 μΙ of a 0.5 μg/ml solution of unlabeled goat anti human IgG or gB, in 0.1 M NaHC03 pH 9.4-9.6. 100 μΐ/well of a 1 μg/ml solution of His-tagged gH/gL was immobilized 96 well nickel coated plates in 1 χ PBS and 0.5% Tween 20 overnight at 4°C. ELISA plates were then washed 4* with ELISA wash buffer, and cell supernatant diluted 1 : 1 with blocking buffer was then added to the appropriate wells (one well per antigen). ELISA was performed as described under "Serum ELISA", except that all volumes were halved in the 384 well plates. Wells were scored as positive if the A450 was > 2 standard deviations of the A450 recorded with the feeder cell only control supernatants (n=4 wells).
[0255] VH/VL Recovery from Sorted Cells. Wells containing sorted cells that were antigen positive by ELISA were thawed and 15 μΙ of cell lysate was transferred to a thin wall PCR tube and mixed with 10 μΙ of RT mix containing 5 μΙ of first strand buffer, 1.25 μΙ of 100 mM DTT, 0.06 μΙ of IGEPAL (Sigma Aldrich Cat. # 68987-90-6), 125 ng of random hexamers (Invitrogen Cat. # N8080127), 2 μΙ of 10 mM dNTP mix, 0.5 μΙ of RNAse inhibitor (Invitrogen Cat# 100000840), and 1 μΙ of superscript III reverse transcriptase (Invitrogen Cat# 56575). RT was carried out at 42°C for 10 min, 25°C for 10 min, 50°C for 60 min, and 94°C for 5 min, followed by a hold at 4°C.
[0256] 3 μΙ of cDNA was used as a template for a two-step nested VH, VK, or VL amplification using the primer set and protocol developed by Doria-Rose and colleagues (Doria-Rose et al., 2015). VH and VL amplicons were Sanger sequenced and then cloned into recombinant expression vectors and expressed as recombinant IgGl proteins.
[0257] Virus Production. To produce B-cell tropic GFP reporter viruses (B95-8/F), 9* 106 293-2089 cells were seeded on a 15 cm tissue culture plate in cRPMI containing 100 μg/ml hygromycin. 24 hours later the cells were washed 2* with PBS, media was replaced with cRMPI without hygromycin, and the cells were and transfected with 15 μg of each of p509 (Delecluse et al., 1998) and p2670 (Neuhierl et al., 2002) expressing BZLF1 and BALF4, respectively, using GeneJuice transfection reagent (EMD Millipore Cat# 70967) according to the manufacturer's instructions. 72 hours later the cell supernatant was collected, cell debris removed by centrifugation at 300 χ g for 5 min and then passed through a 0.8 μηι filter. To produce epithelial cell tropic virus, B cells harboring AKATA-GFP EBV were suspended at 4* 106 cells/ml in RPMI containing 1 % FBS. Anti- human IgG was added to a final concentration 100 μg/ml and incubated at 37°C for 4 hours. Cells were then diluted to 2*106 cells/ml in RPMI containing 1 % FBS and incubated for 72 hours. Cells were pelleted by centrifugation at 300 χ g for 10 min and then the supernatant was passed through a 0.8 μηι filter. Bacitracin was added to a final concentration of 100 μg/ml.
[0258] Virions were concentrated 25* by centrifugation at 25000 χ g for 2 hours and re-suspended in RPMI containing 100μg/ml bacitracin. Virus was stored at 4°C for up to 2 weeks.
[0259] B cell Neutralization Assay. B cell neutralization assays were carried out in Raji cells essentially as described (Sashihara et al., 2009). Monoclonal antibodies were serially diluted in duplicate wells of 96 well round-bottom plates containing 25 μΙ of cRPMI in duplicate. 12.5 μΙ of B95-8/F virus (diluted to achieve an infection frequency of 1-5% at the final dilution) was added and incubated at 37°C for 1 hour. 12.5 μΙ of cRMPI containing 4* 106 Raji cells/ml was added to each well and incubated for another hour at 37°C. The cells were then pelleted, washed once with cRPMI, and re-suspended in cRMPI. Antibody concentration is reported relative to the final infection volume (50 μΙ). After 3 days at 37°C, cells were fixed in 2% paraformaldehyde. The percentage of GFP+ Raji cells as determined on a BD LSRII cytometer.
[0260] To account for any false positive cells due to auto-fluorescence in the GFP channel, the %GFP+ cells in negative control wells (no virus, n=5) was subtracted from each well. % neutralization in each well was defined as: [%GFP+ cells in the positive control wells containing virus alone (n=5 wells) - %GFP+ cells in the antibody containing well] / %GFP+ cells in the positive control wells χ 100.
[0261] The % neutralization for each well was plotted as a function of the logio of the MAb concentration. The neutralization curve was fit using the log(inhibitor) vs response-variable slope (four parameters) analysis in Graphpad Prism 6 software.
[0262] Epithelial Cell Neutralization Assay. 1.5* 104 SVKCR2 cells per well were seeded into a 96 well tissue culture plate. The following day antibodies were serially diluted in duplicate wells containing 20 μΙ of media in a 96 well round bottom plate followed by the addition of 20 μΙ of 25* concentrated epithelial cell-tropic virus and incubated for 15 min. Media was aspirated from the SVKCR2 cells and replaced by the antibody-virus mixture followed by a 3 hour incubation at 37°C. The antibody-virus mixture was then aspirated and replaced with media. 48 hours later the cells were trypsinized and the percentage of GFP positive cells were determined on an BD LSRII cytometer. Percent neutralization was determined as in the B cell neutralization assay.
[0263] Cell Surface Binding Assays. Streptavidin-PE conjugated to 0.5 μg of gH/gL biotin (gH/gL- PE), or to 0.5 μg of gB (gB-PE) was diluted in 10μΙ of PBS to individual wells of a 96 well plate. An equimolar amount of gp42 was added to select wells containing gH/gL-PE. 7 μg of monoclonal antibodies, AMM01 , AMM04, or CL40 were added to select wells containing gH/gL ± gp42 and incubated for 1.5 hours at room temperature. Meanwhile, adherent AGS cells were trypsinized, washed with cF-12 and then allowed to recover at 37°C 5% CO2 for 30 min. The cells were gently agitated and then returned to 37°C 5% CO2 for an additional 30 min. Recovered AGS, and Raji cells were pelleted by centrifugation at 300 x g for 3 min and then resuspended at a density of 1 x106 cells/ml in ice-cold 0.5% bovine serum albumin (BSA) in PBS. 100 μΙ of AGS or Raji cells were added to wells containing SA-PE, SA-gB, SA-PE gH/gL ± gp42 and ± antibodies in quadruplicate, and incubated on ice for 1 h. Cells were pelleted by centrifugation at 300 x g for 3 min, washed with 200 μΙ of ice cold 0.5% BSA in PBS, pelleted again and resuspended in 10% phosphate buffered formalin. The amount of PE staining was determined on a BD LSRII cytometer.
[0264] Virus Free Fusion Assay. CHO-K1 cells were seeded onto six-well plates at a density of 3* 105 cells/well. 24 hours later, the cells were transfected with 0.5 μg each of pCAGGS-gH, pCAGGS-gL, pCAGGS-gB (Haan et al., 2001) and 0.8 μg of pT7EMCLuc, which carries a luciferase-containing reporter plasmid under the control of the T7 promoter (Okuma et al., 1999), using GeneJuice, according to the manufacturer's instructions.
[0265] Meanwhile, 293- T7 cells were seeded into a 96 well plate at a density of 1 104 cells per well in a volume of 100 μΙ/well of cF-12 without Zeocin selection. 8 hours later, the transfected CHO cells were trypsinized, washed once with cF-12, and re-suspended at a density of 1 *105 cells/ml in F-12 media. 100 μΙ/well of CHO-K1 suspension was added to the plate containing 293- T7 cells. Immediately after the addition of CHO-K1 cells, 2 μg of AMM01 , AMM03, AMM05, or CL40 were added to 6 wells in parallel. 24 hours later, the media was aspirated and the cells were lysed in 100 μΙ of Steady-Glo luciferase reagent (Promega). 75 μΙ of cell lysate was transferred to a white bottom assay plate and luciferase activity was read on a Fluroskan Ascent FL fluorimeter.
[0266] Crystallization of the AMM01 FAb and data collection. Crystals of AMM01 Fab were obtained using a NT8 dispensing robot and screening was done with Rigaku Wizard Precipitant Synergy block#2, Molecular Dimensions Proplex screen HT-96, Hampton Research Crystal Screen HT by the vapor diffusion method. Crystals used for diffraction data were grown in 16.75% PEG 400, 13.4% PEG 3350, 0.1 M MgCI2, 0.1 M Tris pH 8.5. Crystals were cryo-protected in solutions containing 30% molar excess of their original reagents and 20% Glycerol. Crystal diffracted to 1.6 A (FIG. 1). Data was collected at ALS 5.1 and 5.2 and processed using HKL2000 (Otwinowski and Minor, 1997).
[0267] Structure solution and refinement. The structure of AMM01 Fab was solved by molecular replacement using Phaser in CCP4 (Collaborative Computational Project, 1994) and PDB ID 4FQQ_L (light chain) and 4JPK_H (heavy chain) as search model. COOT (Emsley et al., 2010) and PHENIX (Adams et al., 2010) were used for model building and refinement of the structure, which included TLS parameters. A cross validation (Rfree) test set consisting of 5% of the data was used throughout the refinement process. The refinement statistics are summarized in FIG. 2. Structural figures were made with Pymol (DeLano, 2002), or USCF Chimera(Pettersen et al., 2004).
[0268] Negative stain electron microscopy. Stock solution of gH/gL, gp42, AMM01 and CL40 were diluted to an estimated concentration of 25 nM of each component in 50 mM HEPES pH 7.5, 150 mM NaCI. Carbon-coated Ted Pella G400 copper grids, glow discharged immediately before use were used. A volume of 3.5 μΙ_ of sample was deposited on the grid for 20-30 s before excess solution was blotted away using Whatman No. 1 filter paper. This was immediately followed by two rounds of staining in 3.5 μΙ_ of 2% (w/v) of uranyl formate. Data was collected on an FEI Tecnai Spirit transmission electron microscope equipped with a US4000 CCD camera. Images were acquired at a nominal magnification of 67,000* at a defocus range between -1 μηι and -4 μηι.
[0269] CTF parameters were estimated using GCTF(Zhang, 2016). Particles were picked using DoG Picker(Voss et al., 2009). Particle images were extracted using a box size of 192 pixels binned by a factor of 2 to an effective pixel size of 3.2 A/pixel and analyzed using RELION 2.0 (Kimanius et al., 2016).
[0270] Cryo Electron Microscopy Sample Preparation and Data Collection. Stock solutions of gH/gL, gp42 and AMM01 were diluted to an estimated concentration of 3 μΜ of each component in 50 mM HEPES pH 7.5, 150 mM NaCI and 0.01 % (v/v) NP40. Protochips C-flat 1.2/1.3-4C-T carbon-coated copper grids, glow discharged immediately before use were used. Particles showed a preferred orientation in ice in the absence of NP40, limiting the overall resolution of the reconstructions. Addition of NP40 resulted in more diverse particle orientations, but resulted in significantly fewer particles in ice. To overcome this issue, a multiple blotting strategy was employed, as previously described (Snijder et al., 2017). After two rounds of sample application and blotting on the lab bench using Whatman No. 1 filter paper, a third volume of sample was applied to the grids, which were then mounted in an FEI Mark I Vitrobot for a final round of blotting and plunge-freezing in liquid ethane, using a 9 s blotting time with -3 mm offset at room temperature and 80-90% relative humidity.
[0271] Data were collected using the Leginon software (Suloway et al., 2005) on an FEI Titan Krios electron microscope, equipped with a Gatan Quantum GIF energy filter, operated in zero- loss mode with a slit-width of 20 eV, and a Gatan K2 Summit direct electron detector. The dose rate was adjusted to 8 counts/pixel/s, and each movie was acquired in counting mode fractionated in 75 frames of 200 ms. 2300 micrographs were collected in a single session with a defocus range included between 2.0 μηι and 4.0 μηι.
[0272] CryoEM data processing. Movie frames were aligned with MotionCor2 (Zheng et al., 2017), with the use of dose weighting. CTF parameters were estimated from the aligned micrographs without applied dose weighting, using GCTF (Zhang, 2016). Particles were picked from aligned dose-weighted micrographs using DoG Picker (Voss et al., 2009). Particle images were extracted using a box size of 224 pixels binned by a factor of 2 to an effective pixel size of 2.72 A/pixel and analyzed with RELION 2.0 (Kimanius et al., 2016). After 2 rounds of reference-free 2D classification, 137,000 particles were selected for 3D classification in 5 classes, starting with an initial model was generated from 2D class averages using the e2initialmodel.py function in EMAN2 (Tang et al., 2007). One predominant class of 104,000 particles was selected for further classification and refinement using the re-extracted particles with original pixel size of 1.36 A. In addition, one minor class of 15,000 particles with the displaced gp42 CTD was refined using the 2* binned images to a resolution of 10.5 A. The major class of gH/gl_-gp42-AMMO was further classified in 3 classes with a finer angular sampling (HEALPix order 3 with oversampling) and local searches. One dominant class of 72,000 particles was selected to generate the final map, at A resolution, using a solvent mask and the solvent fcs flag in RELION 2.0. A B-factor of -400 A2 was applied to sharpen the map. Reported resolutions are based on the gold-standard FSC=0.143 criterion (Rosenthal and Henderson, 2003; Scheres and Chen, 2012) and Fourier shell correlation curves were corrected for the effects of soft masking by high-resolution noise substitution (Chen et al., 2013b).
[0273] Model building. UCSF Chimera (Goddard et al., 2007) and Coot (Brown et al., 2015) were used to fit the crystal structures of gH/gl_/gp42 (PDB 5T1 D) and of AMM01 into the cryoEM map. The quality of the reconstruction is highest for the density corresponding to the gH core, for which several amino acid side chains are resolved. The quality of the reconstruction is lower for the regions corresponding to gl_, gp42 and AMM01. Refinement of the model was carried out using Rosetta density-guided iterative refinement (DiMaio et al., 2015) and Rosetta Relax (DiMaio et al., 2009). Deviations from the input structures were allowed only if supported by density or to resolve stereochemical issues. Glycans were initially docked into the density and their geometry was then refined using Rosetta, optimizing the fit-to-density as well as the energetics of protein/glycan contacts. The model of the gH/gl_/gp/42/AMM01 complex showing the displacement of gp42 was obtained by rigid-body docking the gp42 C-terminal domain into the corresponding density. The quality of the final model was validated using Molprobity (Chen et al., 2010) and Privateer (Agirre et al., 2015). Structure analysis was assisted by the PISA server (Krissinel and Henrick, 2007).
[0274] gH/gL mutant binding analysis. Targeted mutations were introduced into pCAGGS-gH or pCAGGS-gL using the Quickchange XL site-directed mutagenesis kit (Agilent Genomics) using the manufacturer's instructions. All mutations were confirmed by Sanger sequencing. Wildtype and mutant gH or gl_ plasmids were co-transfected into 4ml of 293F cells at a density of 106 cells/ml in Freestyle 293 media (ThermoFisher) using the 293Free transfection reagent (EMD Millipore) according to the manufacturer's instructions. 24h later, cells expressing wildtype gH/gL, each gH/gL mutant, or mock transfected cells were pelleted by centrifugation at 300 x g for 3 min and then re-suspended in 200 μΙ of PBS containing 0.5% BSA and 2 μg of the CL59 MAb and incubated on ice for 1 h. Meanwhile 3-fold serial dilutions of AMM01 labeled with Dylite 650 (ThermoFisher Cat #62265, according to the manufacturer's instructions) were prepared in 50 μΙ of PBS containing 0.5% BSA in 96 well plates. 20 μΙ of PBS containing 0.5% BSA and 0.5 μΙ of PE-anti-mouse IgG (ThermoFisher Cat# P852) was added to each well. Cells expressing gH/gL variants, as well as mock-transfected cells were washed with 3ml of PBS containing 0.5% BSA and resuspended in 650 μΙ of PBS containing 0.5% BSA. 30 μΙ of cell suspension was added to wells containing serially diluted AMM01 and anti-mouse PE in duplicate, followed by a 1 h incubation on ice. Each well was washed twice with 200 μΙ of PBS containing 0.5% BSA and then resuspended in 100 μΙ of 10% phosphate buffered formalin. gH/gL positive cells were determined by PE (CL59) staining, using mock-transfected cells as a reference. The level of AMM01 binding to gH/gL was determined by measuring the mean fluorescence intensity (MFI) of DL650 staining of PE+ cells. To account for differences in gH/gL expression the MFI of PE staining for each gH/gL variant (16 wells total) was averaged and used to normalize the DL650 staining of each well. The normalized MFI of DL650 was plotted against the concentration of AMM01 for each well and fit to a sigmoidal dose response curve using GraphPad Prism software.
[0275] Mass spectrometry to identify glycopeptides. 250 pmol of gH/gL and gp42 were separately prepared for mass spectrometry analysis of glycopeptides. Stock solutions were denatured, reduced and alkylated by dilution to 5 μΜ in 50 μί of buffer containing 100 mM Tris pH 8.5, 10 mM TCEP, 40 mM iodoacetamide and 2% (w/v) sodium deoxycholate. Samples were first heated to 95°C for 10 min and then incubated for an additional 20-30 min at room temperature in the dark. The samples were split in two for digestion with trypsin and chymotrypsin (Sigma Aldrich) in parallel, by diluting 20 μί of sample for each protease in a total volume of 100 μί 50 mM ammonium bicarbonate pH 8.5. Protease was added to the samples in a ratio of 1 :75 by weight and left to incubate at 37°C overnight. After digestion, 2 μί of formic acid was added to the samples to precipitate the sodium deoxycholate from solution. After centrifugation for 20 min at maximum speed in a bench top centrifuge, 80 μΙ_ of the supernatant was collected. For each sample 8 μΙ_ was injected on a Thermo Scientific Orbitrap Fusion Tribrid mass spectrometer. A 35-cm analytical column and a 3-cm trap column filled with ReproSil-Pur C18AQ 5 μηι beads (Dr. Maisch) were used. Nanospray LC- MS/MS was used to separate peptides over a 110-min gradient from 5% to 30% acetonitrile with 0.1 % formic acid. A positive spray voltage of 2, 100 V was used with an ion-transfer-tube temperature of 350°C. An electron-transfer/higher-energy collision dissociation ion-fragmentation scheme (Frese et al., 2013) was used with calibrated charge-dependent ETD parameters and supplemental higher-energy collision dissociation energy of 0.15. A resolution setting of 120,000 with an AGC target of 2 χ 105 was used for MS1 , and a resolution setting of 30,000 with an AGC target of 1 χ 105 was used for MS2. Data was searched with Protein Metrics Byonic software (Bern et al., 2012), using a small custom database of recombinant protein sequences including gH, gl_, gp42, other viral glycoproteins and the proteases used to prepare the glycopeptides. Reverse decoy sequences were also included in the search. Specificity of the search was set to C-terminal cleavage at R/K (trypsin) or F/W7Y/M/L (chymotrypsin), allowing up to two missed cleavages, with EThcD fragmentation (b/y- and c/z- type ions). A precursor mass and product mass tolerance of 12 ppm and 24 ppm respectively were used. Carbamidomethylation of cysteines was set as fixed modification, methionine oxidation as variable modification, and all four software-provided N-linked glycan databases were used to identify glycopeptides. All glycopeptide hits were manually inspected and only those with quality peptide sequence information are reported here.
[0276] Results. Isolation of anti-EBV human monoclonal antibodies from infected individuals. To understand the humoral immune response elicited during natural EBV infection, isolation of antigen-specific memory B cells against gp42, gp350, gH/gL and gB were sought using recombinant bait ectodomains produced in HEK 293 cells (FIG. 3A). All glycoproteins were recognized by known anti-EBV MAbs (FIG. 3B) and serum antibodies from 15 out of 16 donors, as tested by ELISA (FIG. 3C), indicating that the purified ectodomains were properly folded and exhibited native antigenicity. Although a range of binding specificities across donors was observed, most sera displayed the highest antibody titers against gp350 and the lowest against gH/gL.
[0277] EBV glycoproteins conjugated to streptavidin-PE were used to identify antigen-specific class-switched B cells. The majority of B cells stained positive with gp350 or gp42 (FIG. 4A) due to their ability to bind CD21 (Tanner et al., 1987) and CD35 (Ogembo et al., 2013) or MHCII (Haan et al., 2000; Spriggs et al., 1996), respectively. Attempts to completely block gp350 and gp42 binding to these cellular receptors with commercially available antibodies were unsuccessful and efforts to sort these B cells were not pursued further.
[0278] The number of B cells that stained with gH/gL or gB was comparable to the number of B cells that stained positive with the unconjugated PE control (FIG. 4A). This observation indicated that gH/gL- or gB-specific B cells are quite rare, and led us to use complimentary approaches to isolate them. A magnetic bead-based strategy coupled with an antigen decoy to enrich for, and identify rare, antigen-specific B cells (Taylor et al., 2012) was employed. This enrichment strategy reduced the number of background B cells and allowed us to more confidently identify gH/gL- and gB-specific B cells (FIG. 4A). Based on the number of cells that were excluded using this approach, it was estimated that a 2.5 fold enrichment of antigen specific B cells was achieved (FIG. 5). Sorting was carried out starting with a total of 8*108 cryopreserved peripheral blood mononuclear cells from three separate donors using PE-conjugated gH/gL, gB, or gH/gL and gB concurrently (FIG. 6). B cells were individually sorted into irradiated feeder cell cultures in the presence of recombinant cytokines. To verify isolation of antigen-specific B cells, the supernatants were screened for antigen reactivity by ELISA. Despite the implementation of an enrichment step, most of the sorted cells were false positives and only two gH/gL- and seven gB- specific B cells could be identified (FIG. 6). From these, paired variable heavy (VH) and variable light (VL) chain transcripts for one gH/gL antibody (AMM01) and four gB-specific antibodies (AMM02-AMM05) were successfully recovered. All of these antibodies are derived from distinct heavy and light chain genes, and displayed VH mutation frequencies ranging from 8-10% and VK VL frequencies ranging from 5-8% at the nucleotide level (FIG. 7). The VH/VL sequences were cloned into recombinant expression vectors and that AMM01 specifically bound to gH/gL, and that AMM02-AMM05 specifically bound to gB using biolayer interferometry (BLI, FIG. 4C) was verified.
[0279] AMM01 inhibits EBV infection of both epithelial cells and B cells. The ability of AMM01- AMM05 to neutralize EBV infection of epithelial cells (FIG. 8A) and B cells (FIG. 8B) was assessed. For comparison, the murine anti-gH/gL MAbs CL40, CL59 and E1 D1 , which have been reported to completely block epithelial cell infection but poorly inhibit B-cell infection (Chesnokova and Hutt- Fletcher, 2011 ; Wu et al., 2005) were also included.
[0280] In an epithelial cell infection assay, the anti-gH/gL MAbs AMM01 , CL40 and CL59 had comparable potency. AMM01 IC50 = 0.42 ±0.02 g/ml (n=6), CL40 IC50 = 0.89 ±0.21 μg/ml (n=4), and CL59 IC50 = 0.52 ±0.25 μg/ml (n=3). The anti-gH/gL E1 D1 antibody displayed incomplete neutralization at the highest concentration tested. The anti-gB MAb AMM05 also neutralized EBV infection of epithelial cells infection with an IC50 of 0.16 ± 0.09 μςΛτιΙ (n=3). The other anti-gB MAbs (AM M 02-AM M 04) were non-neutralizing (FIG. 8A).
[0281] AMM01 was the only anti-gH/gL Mab that was completely neutralizing in the B cell infection assay (FIG. 8B, IC50 = 0.16 ±0.06 μg/ml, n=5). In agreement with previous reports, CL40, CL59 and E1 D1 failed to completely neutralize EBV infection of B cells, (Chesnokova and Hutt-Fletcher, 2011 ; Molesworth et al., 2000) (FIG. 8B).
[0282] Despite not being completely neutralizing, CL40 was able to reduce B cell infection to 50% at a concentration of 14.6 ± 2.44 μg/ml (n=3), which is 100 times less potent than AMM01. An IC50 for CL59 was not measured because it did not reproducibly achieve 50% neutralization. E1 D1 was completely ineffective at neutralizing B cell infection (FIG. 8B). AMM01 displayed comparable potency to the anti-gp350 MAb 72A1 in this assay (FIG. 8B, IC50 0.08 ±0.003 Mg/ml, n=2).
[0283] Mapping the Epitope of the AMM01 Neutralizing MAb using CryoEM. To understand observed differences in the neutralization potency of AMM01 and other anti-gH/gL MAbs, their binding affinities for gH/gL were determined. AMM01 bound 1-2 orders of magnitude more tightly to gH/gL than other MAbs tested, due to a much slower off-rate (FIG. 9). Although membrane fusion with Raji B cells can occur independently of endocytosis (Miller and Hutt-Fletcher, 1992), binding assays at pH 5.0 were also carried out to assess whether differences in the neutralization potency of B cell infection might be due to the acidic pH of the endosomal compartment which could affect antibody binding. Only E1 D1 binding was affected by pH (FIGs. 9 and 10). Therefore, the higher potency of AMM01 could not be attributed to dissociation of the other MAbs from gH/gL due to exposure to the low pH of the endosomes upon virion internalization. Based on these results, it was surmised that epitope differences between the gH/gL MAbs may explain why AMM01 is the only MAb that completely neutralized infection of both B cells and epithelial cells. To delineate the epitope recognized by AMM01 , the gH/gL/gp42/AMM01 complex was analyzed by cryoEM (FIGs. 13A, 13B, 14, and 2). A reconstruction of the complex at a resolution of 4.8A, which resolves secondary structural elements and several amino acid side chains as well as densities corresponding to N-linked glycans on gH, gL and gp42 was determined. The local resolution varies between 4A in the region of the map corresponding to the gH core and 4.5-6.0A for gL, gp42 and AMM01 (FIG. 14). A 1.6A crystal structure of the unliganded AMM01 antigen binding fragment (Fab, FIG. 1) was determined and a model of the gH/gl_/gp42/AMM01 complex was generated using Rosetta (DiMaio et al., 2015) and available EBV glycoprotein structures (Matsuura et al., 2010; Sathiyamoorthy et al., 2016) (FIGs. 13C, 13D, 2). The architecture of gH/gl_/gp42 in the complex is in good agreement with the recently reported gH/gL/gp42/E1 D1 crystal structure (Ca root mean square deviation of 1.1 A over 915 aligned residues of gH/gl_/gp42) (Sathiyamoorthy et al., 2016). AMM01 binds to a discontinuous epitope spanning gH/gL D-l and D-ll, which includes residues of both gH and gl_, and burying a surface area of 1160 A2 on gH/gL and on AMM01 (FIGs. 13E, 13F).
[0284] CDRL2, CDRH1 and CDRH3 contact the 2a-4 helix (FIGs. 13E, 13F). CDRH3 also binds the short helix between the 2β-7 and 2β-8 strands, and the loop between 2a-1 and 2β-1. CDRL1 binds to the gH/gL interface, contacting the gH 2a-1 linker helix between D-l/D-ll, and the gL C- terminal La-3 helix (FIGs. 13E, 13F).
[0285] Using site-directed mutagenesis, several mutations were introduced in gH and gL at residues which are predicted to contact AMM01 based on the cryoEM structure, and binding of the Mab to cell surface expressed gH/gL was assessed (FIG. 15). Among the mutants tested, two residues, K73 and Y76 in the 2a-1 linker helix that led to a reduction in AMM01 binding when mutated to alanine were identified (FIGs. 15D, 13F). Substitution of K73 with a bulkier tryptophan residue virtually abrogated AMM01 binding (FIG. 15D), as predicted by the atomic model.
[0286] The N-linked glycan on gH-N60 is oriented such that it appears to form interactions with the AMM01 framework region and could putatively contact the CDRL2 (FIG. 13G). N-linked glycosylation in gH, gL and gp42 was profiled by on-line reversed-phase liquid chromatography with electron transfer/high-energy collision-dissociation tandem mass-spectrometry which verified the presence of several high-mannose and hybrid glycans at the gH-N60 position (FIGs. 14H, 6).
[0287] Disruption of the gH-N60 glycosylation sequon, by introducing a T62A substitution in gH, altered AMM01 binding kinetics, supporting that the glycan could interact with the antibody (FIG. 9). Additionally, the first residue of the AMM01 heavy chain, a pyroglutamic acid, appears to directly interact with the gp42 C-domain. Substitution of this residue by an asparagine (AMM01 Q1 NHC), however, did not significantly affect the AMMO binding affinity for gH/gL (FIG. 9), and had no significant effect on its ability to neutralize EBV infection of B cells, or epithelial cells (FIG. 16).
[0288] The cryoEM structure indicates that the AMM01 epitope is distinct from that of E1 D1 and CL59, which bind exclusively to gL and to D-IV, respectively (Sathiyamoorthy et al., 2016; Sathiyamoorthy et al., 2017). Comparison of the gH/gl_/gp42/AMM01 cryoEM structure with the recently described gH/gL/gp42 N-terminal domain/CL40 crystal structure (Sathiyamoorthy et al., 2017), showed not only that the epitopes of the two antibodies overlap at the 2a-4 helix, but also that their FAb fragments would clash with each other upon binding to gH/gL (FIGs. 17A-17C), suggesting that they would compete for binding via steric hindrance. To confirm this observation and assess whether AMM01 affects the binding of other anti-gH/gL MAbs, reciprocal competitive binding experiments were performed. Biotinylated anti-gH/gL MAbs were immobilized on streptavidin biosensors and used to measure binding to gH/gL which had been preincubated with a two-fold excess of non-biotinylated competing MAb (FIGs. 17D-17G).
[0289] The binding of each antibody to gH/gL was inhibited when incubated with an excess of the same unlabeled antibody, as indicated by a decrease in the nm shift of the binding trace (FIGs. 17D-17G). In agreement with the structural data, reduced binding of AMM01 to gH/gL when an excess of CL40 was present (FIG. 17D) and a complete inhibition of CL40 binding to gH/gL in the presence of an excess of AMM01 was observed (FIG. 17E). Consistent with the formation of higher-molecular weight complexes, an increase in the nm shift, for the other combinations of gH/gl_/MAbs was detected (FIG. 17F, or FIG. 17G). These results confirmed that the AMM01 epitope is distinct from that of CL59 and E1 D1 but partially overlaps with the CL40 epitope.
[0290] CL40 was reported to displace the gp42 CTD upon binding to the gH/gL/gp42 complex as a consequence of the overlap of their interaction sites on gH/gL (Sathiyamoorthy et al., 2017). Although the footprints of AMM01 and gp42 are distinct, gH residue N240 experiences a change of accessible surface area upon binding to either of these two proteins (FIG. 18A). Since AMM01 and gp42 are located on opposite sides of this residue, AMM01 and gp42 interactions with N240 do not appear mutually exclusive (FIG. 18B). Using a distinct subset of particles identified by three-dimensional classification of the cryoEM dataset, a second reconstruction of the gH/gl_/gp42/AMM01 complex at 10 A resolution in which the gp42 C-domain density is displaced relative to gH/gL was obtained (FIGs. 18C, 18D 14G).
[0291] Two-dimensional classification of negatively stained gH/gL/gp42 (FIG. 19A) and gH/gl_/gp42/AMM01 complexes (FIGs. 19B, 19C) also unambiguously showed that a small fraction of AMM01 -bound complexes had a displaced gp42 CTD (FIG. 19C). In contrast, gp42 was displaced from all gH/gL/gp42/CL40 complexes under the same conditions (FIG. 19D).
[0292] The cryoEM map at 4.8A resolution shows that the gp42-N173 glycan points toward the framework region of the AMM01 light chain, indicating that it might interfere with AMM01 binding (FIG. 18E). Using mass spectrometry, the presence of various glycans at this position was verified (FIGs. 14H, 9). In line with these observations, binding experiments revealed partial competition between AMM01 and gp42 for binding to gH/gL (FIG. 18F, left panel). This competition was fully abrogated by the introduction of a T175A mutation, which disrupts the N173 glycosylation sequon (FIG. 18F, right panel), while retaining nanomolar binding affinity between gp42 and gH/gL (FIG. 9). These data reveal that AMM01 can sterically displace the gp42 CTD from gH/gL through the gp42 N173 glycan. This mechanism is distinct from that of CL40-mediated gp42 CTD displacement, which results from a direct overlap between the Mab epitope and the gp42 CTD- binding site on gH/gL (Sathiyamoorthy et al., 2017).
[0293] AMM01 Neutralization Mechanism. Since AMM01 can alter the conformation of gp42 in the complex, it was assessed whether it also affected the ability of gH/gl_/gp42 to bind to HLA class II and did not observe difference in the binding irrespective of the presence of the AMM01 FAb (FIG. 20A). It was also assessed whether AMM01 binding to gH/gL/gp42 could affect the ability of the complex to bind to B cells. As expected, PE-labeled gH/gL bound to Raji cells in the presence, but not in the absence of gp42 (FIG. 20B). Pre-incubation of PE-labeled gH/gL with an excess of AMM01 , but not CL40 or the control MAb AMM04 reduced, but did not completely inhibit gH/gl_/gp42 binding to B cells (FIG. 20B). During epithelial cell infection, gH/gL binds directly to receptors on the surface of epithelial cells that presumably trigger gH/gL and lead to the subsequent activation of gB (Borza et al., 2004; Chen et al., 2012). Weak binding of PE- labeled gH/gL to the surface of the AGS epithelial cell line was observed (FIG. 20C). This binding was specific as direct binding of gH/gL to Raji cells under the same conditions was not detected (FIG. 20B), nor was binding of PE-labeled gB to either cell type (FIGs. 20B, 20C). Pre-incubation with AMM01 , CL40, or gp42 reduced, but did not abrogate gH/gL binding to AGS cells (FIG. 20C), whereas the anti-gB Mab AMM04 had no effect.
[0294] gH/gL is thought to interact directly with ανβδ, ανβθ, or ανβδ integrins present at the surface of epithelial cells through the KGD motif on gH D-ll (Chen et al., 2012; Chesnokova and Hutt-Fletcher, 201 1 ; Chesnokova et al., 2009). The results suggest that AMM01 binding could restrict integrin access to the KGD motif due to the proximity of its epitope (FIG. 13G). Binding of gH/gL to ανβδ, ανβθ or ανβδ integrins was not detected (FIG. 20D). These observations are in line with a recent report (Sathiyamoorthy et al., 2017), but contrast with previous studies (Chesnokova and Hutt-Fletcher, 201 1 ; Chesnokova et al., 2009).
[0295] Recently, a direct interaction between gH/gL and EphA2 has also been shown to be important for EBV viral entry (Chen et al., 2018; Zhang et al., 2018). A very weak binding signal between EphA2 and gH/gL that was unaltered by pre-incubation of AMM01 (FIG. 20E) was observed suggesting that AMM01 does not prevent a gH/gL-EphA2 interaction.
[0296] The observation that AMM01 potently neutralizes EBV infection of both B cells and epithelial cells points to a common mechanism of viral inhibition. Since AMM01 fails to completely block binding of gH/gL to epithelial cells, or gH/gL/gp42 to B cells it was hypothesized that AMM01 is likely interfering with gB activation and membrane fusion. Using a virus-free cell fusion assay (McShane and Longnecker, 2005), it was observed that the anti-gH/gL MAbs AMM01 and CL40, and the anti-gB MAb AMM05 significantly reduced cell fusion whereas the non-neutralizing MAb AMM03 had no effect (FIG. 20E).
[0297] Sequences for the VH/VL regions of the antibodies reported here can be found at genbank under the accession numbers: KY631779-KY631788. Glycopeptide LC- MS/MS raw data and Byonic search results have been deposited in proteomics identification (PRIDE) database under PXD006403. The cryoEM maps have been deposited in the Electron Microscopy Data Bank with accession code EMD-7344 (4.8A) and EMD-7345 (10 A). The atomic models of AMM01 (PDB ID: 6BLA) and gH/gl_-gp42-AMMO (PDB ID: 6C5V) have been deposited in the Protein Data Bank.
[0298] Discussion. Orally transmitted EBV establishes lytic infection in permissive cells in the oral mucosa such as epithelial cells or infiltrating B cells (Rickinson et al., 2014; Taylor et al., 2015). EBV has tropism for both cell types and it is not clear which one is preferentially infected during primary infection (Tangye et al., 2017). The virus could first infect epithelial cells and lytic viral replication would subsequently seed B cell infections.
[0299] Alternatively, the virus may initially infect infiltrating B cells, which would lead to subsequent targeting of epithelial cells. Neither scenario is mutually exclusive, thus a combination of epithelial and B cell neutralizing antibodies may be required to mosteffectively block incoming virus at the oral mucosa (Herrman et al., 2015).
[0300] Serum antibodies from natural infection can neutralize EBV entry in both B cells and epithelial cells in vitro but the epitopes targeted by these MAbs are unknown.
[0301] Previously isolated anti-gp350 MAbs can inhibit infection of B cells but not CD21 negative epithelial cells. Conversely, known anti-gH/gL antibodies are effective at preventing epithelial cell infection but fail to prevent B cell infection. These observations suggest that gp350 or gH/gL antibodies alone might not be sufficient to prevent EBV infection, and that an effective EBV subunit vaccine might need to elicit both types of MAbs to prevent an initial infection event.
[0302] Previous EBV subunit vaccine studies in humans have focused on gp350. Recombinant gp350 elicits antibodies that can neutralize B cell infection in vitro (Moutschen et al., 2007) and compete for binding with the 72A1 MAb, which is used as a surrogate marker for B cell neutralizing antibodies (Sokal et al., 2007). Although a gp350 subunit vaccine showed clinical benefit by reducing the incidence of infectious mononucleosis, it failed to protect from EBV infection in a phase II clinical trial in humans (Sokal et al., 2007). From these results emerged the idea that the efficacy of EBV subunit vaccines could be improved if they were formulated with additional glycoproteins (Cohen et al., 2013). The potent in vitro neutralizing activity of AMM01 suggests that a gH/gL-based vaccine capable of eliciting AMM01-like antibodies could be as effective as gp350 at eliciting a humoral immune response blocking EBV entry into B cells, while also preventing epithelial cell infection. Moreover a gH/gL vaccine would avoid the potential enhancement of epithelial cell infection reported for anti-gp350 antibodies (Turk et al., 2006). In support of this notion, rabbit immunization with gH/gL elicited higher antibody titers blocking B cell infection than gp350 (Cui et al., 2016). However, the epitope specificities of these serum antibodies have not been mapped and the efficacy with which they neutralize epithelial cell infection is not known.
[0303] AMM01 has utility as a therapeutic agent as well. Passive administration of the 72A1 MAb demonstrated capacity to prevent EBV infection during the early post- transplant period in high- risk EBV-seronegative transplant recipients. However, administration of 72A1 led to the production of anti-drug antibodies, which were attributed to its murine origin (Haque et al., 2006). Since AMM01 can neutralize infection of the two main cell types targeted by EBV, and is human- derived, this antibody presents a more effective and safer alternative than 72A1.
[0304] EBV infection of B cells and epithelial cells requires gH/gL to engage distinct cell- surface receptors, which lead to triggering of gB-mediated fusion. The unique ability of AMM01 among anti-gH/gL MAbs to neutralize both epithelial and B cell infection points to a common mechanism of neutralization, without being bound by theory, most likely by interfering with gB triggering. This is supported by the observation that AMM01 blocks cell-cell fusion in a virus-free assay. Mutagenesis data identified that the D-l/D-ll linker region is key for activation of membrane fusion during B cell and epithelial cell infection (Matsuura et al., 2010; Omerovic et al., 2005). Several of these critical residues are buried by AMM01 which suggests that this antibody inhibits fusion activation by preventing a direct interaction between gB and the linker-helix on gH/gL (Fig. 7A). Residues within the D-l/D-ll groove have been shown to mediate membrane fusion as well (Chen et al., 2013a; Matsuura et al., 2010; Plate et al., 2009). It has been proposed that conformational changes within the D-l/D-ll groove induced by from receptor binding might be required for triggering of (or interaction with) gB (Chen et al., 2013a; Chesnokova and Hutt- Fletcher, 201 1). Since AMM01 binds to elements of D-l (including gL), D-ll, and the linker helix bridging D-l and D-ll, it could also inhibit gB activation by acting as a molecular clamp which prevents movements within and across D-l and D-ll that are necessary for gB triggering (Fig. 7B).
[0305] The architecture of CMVgH/gL resembles that of EBVgH/gL, including a groovebetween D-l and D-ll that is connected by a linker helix (Chandramouli and Malito, 2017). It has been proposed that binding of the CMVgH/gl_/UL128/UL130/UL131 pentamer to a cell surface receptor induces a D-l rearrangement around the linker helix which leads to a widening of the D-l/D-ll groove and gB triggering (Chandramouli and Malito, 2017). Thus, antibodies that target the linker helix are important for CMV vaccine design as well. In line with this notion, the human MAb 13H1 1 , which neutralizes CMV infection of both epithelial cells and fibroblasts binds in proximity of the linker helix of CMVgH/gL.
[0306] The fusion inhibition activity of AMM01 is further supported by studies of neutralizing MAbs against gH/gL from other herpesviruses. MAbs that inhibit gB- mediated fusion of varicella zoster virus (VZV) bind to epitopes bridging the first two domains of VZVgH/gL (FIG. 22A, 22B) (Xing et al., 2015). Escape mutations from the LP11 antibody, which blocks the herpes simplex virus (HSV) gH/gL-gB interaction, also map to a similar epitope region on HSVgH/gL (Chowdary et al., 2010).
[0307] CL40 weakly neutralizes B-cell infection compared to AMM01 , and binds exclusively to gH D-ll/D-lll. Previous studies suggested that displacement of the gp42 CTD by CL40 prohibits a conformation of the gH/gL/gp42/HLA class II complex necessary for triggering gB-mediated fusion during B cell infection (Sathiyamoorthy et al., 2017). The observation that CL40 more readily displaces gp42 than AMM01 but fails to potently neutralize B-cell infection, suggests that this is not the primary mechanism of B-cell neutralization by AMM01.
[0308] The data also indicate that AMM01 could contribute to neutralization by restricting access of gH/gL or gH/gL/gp42 to cell surface receptors during epithelial and B cell infection, respectively (Fig. 7 C-D). Despite having no effect on the ability of the gH/gl_/gp42 complex to bind to soluble HLA class II, AMM01 reduced binding of gH/gl_/gp42 to the surface of B cells. In contrast, CL40 which binds to gH near the AMM01 epitope has no effect on the binding of gH/gl_/gp42 to B cells. This result could explain the difference in B cell neutralization potency between these two MAbs.
[0309] AMM01 also reduced binding of gH/gL to the surface of epithelial cells, ανβδ ανβ6, and ανβδ integrins (Chesnokova and Hutt- Fletcher, 2011 ; Chesnokova et al., 2009), and EphA2 (Chen et al., 2018; Zhang et al., 2018) have been implicated as cell surface EBV receptors during epithelial cell infection. Since a weak interaction between gH/gL and EphA2 was detected, which was unaffected by AMM01 , it is unlikely that AMM01 inhibits EBV infection of epithelial cells by blocking this interaction.
[0310] The KGD motif on D-ll of gH/gL is believed to mediate direct binding to integrins (Chesnokova and Hutt-Fletcher, 2011 ; Chesnokova et al., 2009; Sathiyamoorthy et al., 2016; Sathiyamoorthy et al., 2017). Although the KGD motif remains exposed when AMM01 is bound (Fig. 3G), its presence would greatly reduce accessibility to integrin. An interaction between gH/gL and soluble ανβδ ανβθ or ανβδ integrins was not detected by BLI (Fig. 6D), but the reduced binding of gH/gL to the epithelial cell surface observed in the presence of AMM01 indicates that the MAb may restrict binding to cell- surface anchored integrins, to membrane anchored EphA2, or to an alternative receptor (Fig. 7D).
[0311] In this Example, the AMM05 Mab was also characterized. AMM05 is the first reported anti-gB antibody with neutralizing activity against EBV, although it only inhibits entry into epithelial cells. The observed potency of AMM01 towards EBV infection of epithelial cells and B cells suggests that the mechanism of gB activation by gH/gL is similar in both cases. The inability of AMM05 to antagonize B cell infection, however, points to putative differences in gB triggering and/or fusion during EBV entry into the two cell types. This latter point is supported by mutagenesis studies of gH/gL, which revealed distinct effects on fusion with B cells and with epithelial cells (Chen et al., 2013a; Mohl et al., 2014; Sathiyamoorthy et al., 2016; Wu et al., 2005).
[0312] Most of the anti-gB MAbs characterized in this Example are non-neutralizing. It is emphasized that the gB protein used to sort B cells is most likely in the post-fusion conformation (Backovic et al., 2009) and might fail to bait out neutralizing antibodies recognizing the pre-fusion state, as was reported for the RSV fusion protein (Magro et al., 2012; McLellan et al., 2013).
[0313] In summary, AMM01 is currently the only known anti-gH/gL antibody that potently neutralizes both epithelial and B-cell infections. The near-atomic resolution cryoEM structure of the gH/gl_/gp42/AMM01 complex presented here defines a key site of EBV vulnerability and paves the way for the design of next-generation subunit vaccines. The moderate level of somatic mutation in AMM01 is within the range that could be elicited with current human vaccine regimens implemented for influenza or HIV (Easterhoff and Moody, 2017; Joyce et al., 2016; Moody et al., 2011 ; Wrammert et al., 2008). AMM01 can be used to treat and/or prevent EBV-related complications such as lymphoproliferative diseases in organ transplant recipients and immunocompromised individuals.
[0314] Example 3. Human hematopoietic progenitor stem cells engrafted in immunocompromised mice develop into human B cells that can be infected with EBV. A low EBV dose results in persistent latent infection that mimics natural human infection, while a higher dose results in a lymphoproliferative disease state. As a proof of concept that disclosed antibodies protect from infection, B cells were harvested from these mice and challenged with a low-dose EBV reporter virus that induces GFP expression upon infection. The absence of antibody could readily be detected (FIG. 23A, left), yet there was no evidence of infection in the presence of AMM01 (FIG. 233A, right).
[0315] Next, the ability of AMM01 to protect against EBV in vivo was assessed. 0.5mgAMMO1 or an irrelevant anti-HIV MAb was administered to humanized mice 2 days prior to a high dose (5X IC50) intravenous EBV challenge. 6 weeks later, nearly all of the human B cells (hCD45+,hCD19+) in the blood had died in mice that received the control antibody (FIG. 23B), while B cells survived in mice that received AMM01 (FIG. 23B). Similar results were observed in the spleen at week 7 (FIG. 23C). This data indicates that AMM01 has protective benefit at the tested physiological dose and route (i.e. low levels of incoming virions in the nasopharynx vs high level of virions injected intravenously).
[0316] As will be understood by one of ordinary skill in the art, each embodiment disclosed herein can comprise, consist essentially of or consist of its particular stated element, step, ingredient or component. Thus, the terms "include" or "including" should be interpreted to recite: "comprise, consist of, or consist essentially of." The transition term "comprise" or "comprises" means includes, but is not limited to, and allows for the inclusion of unspecified elements, steps, ingredients, or components, even in major amounts. The transitional phrase "consisting of excludes any element, step, ingredient or component not specified. The transition phrase "consisting essentially of" limits the scope of the embodiment to the specified elements, steps, ingredients or components and to those that do not materially affect the embodiment. In particular embodiments, a material effect would cause a statistically-significant reduction in the ability of an anti-EBV antibody to neutralize EBV in the assay described in relation to FIGs. 8A, 8B. In particular embodiments, a material effect would cause a statistically-significant reduction in a primary antibody response to an EBV vaccine.
[0317] Unless otherwise indicated, all numbers expressing quantities of ingredients, properties such as molecular weight, reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term "about." Accordingly, unless indicated to the contrary, the numerical parameters set forth in the specification and attached claims are approximations that may vary depending upon the desired properties sought to be obtained by the present invention. At the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques. When further clarity is required, the term "about" has the meaning reasonably ascribed to it by a person skilled in the art when used in conjunction with a stated numerical value or range, i.e. denoting somewhat more or somewhat less than the stated value or range, to within a range of ±20% of the stated value; ±19% of the stated value; ±18% of the stated value; ±17% of the stated value; ±16% of the stated value; ±15% of the stated value; ±14% of the stated value; ±13% of the stated value; ±12% of the stated value; ±1 1 % of the stated value; ±10% of the stated value; ±9% of the stated value; ±8% of the stated value; ±7% of the stated value; ±6% of the stated value; ±5% of the stated value; ±4% of the stated value; ±3% of the stated value; ±2% of the stated value; or ±1 % of the stated value.
[0318] Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth in the specific examples are reported as precisely as possible. Any numerical value, however, inherently contains certain errors necessarily resulting from the standard deviation found in their respective testing measurements.
[0319] The terms "a," "an," "the" and similar referents used in the context of describing the invention (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. Recitation of ranges of values herein is merely intended to serve as a shorthand method of referring individually to each separate value falling within the range. Unless otherwise indicated herein, each individual value is incorporated into the specification as if it were individually recited herein. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., "such as") provided herein is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention otherwise claimed. No language in the specification should be construed as indicating any non-claimed element essential to the practice of the invention.
[0320] Groupings of alternative elements or embodiments of the invention disclosed herein are not to be construed as limitations. Each group member may be referred to and claimed individually or in any combination with other members of the group or other elements found herein. It is anticipated that one or more members of a group may be included in, or deleted from, a group for reasons of convenience and/or patentability. When any such inclusion or deletion occurs, the specification is deemed to contain the group as modified thus fulfilling the written description of all Markush groups used in the appended claims.
[0321] Certain embodiments of this invention are described herein, including the best mode known to the inventors for carrying out the invention. Of course, variations on these described embodiments will become apparent to those of ordinary skill in the art upon reading the foregoing description. The inventor expects skilled artisans to employ such variations as appropriate, and the inventors intend for the invention to be practiced otherwise than specifically described herein. Accordingly, this invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
[0322] Furthermore, numerous references have been made to patents, printed publications, journal articles and other written text throughout this specification (referenced materials herein). Each of the referenced materials are individually incorporated herein by reference in their entirety for their referenced teaching.
[0323] In closing, it is to be understood that the embodiments of the invention disclosed herein are illustrative of the principles of the present invention. Other modifications that may be employed are within the scope of the invention. Thus, by way of example, but not of limitation, alternative configurations of the present invention may be utilized in accordance with the teachings herein. Accordingly, the present invention is not limited to that precisely as shown and described.
[0324] The particulars shown herein are by way of example and for purposes of illustrative discussion of the preferred embodiments of the present invention only and are presented in the cause of providing what is believed to be the most useful and readily understood description of the principles and conceptual aspects of various embodiments of the invention. In this regard, no attempt is made to show structural details of the invention in more detail than is necessary for the fundamental understanding of the invention, the description taken with the drawings and/or examples making apparent to those skilled in the art how the several forms of the invention may be embodied in practice.
[0325] Definitions and explanations used in the present disclosure are meant and intended to be controlling in any future construction unless clearly and unambiguously modified in the following examples or when application of the meaning renders any construction meaningless or essentially meaningless. In cases where the construction of the term would render it meaningless or essentially meaningless, the definition should be taken from Webster's Dictionary, 3rd Edition or a dictionary known to those of ordinary skill in the art, such as the Oxford Dictionary of Biochemistry and Molecular Biology (Ed. Anthony Smith, Oxford University Press, Oxford, 2004).
Example 2 References:
Adams, et al. (2010). Acta Crystallogr D Biol Crystallogr 66, 213-221.
Agirre, et al. (2015). Nature structural & molecular biology 22, 833-834.
Backovic, et al. (2009). Proceedings of the National Academy of Sciences of the United States of America 106, 2880-2885.
Balachandran, et al. (1987). Journal of virology 61 , 1125-1135.
Bern, et al. (2012). Byonic: advanced peptide and protein identification software. Current protocols in bioinformatics Chapter 13, Unit13 20.
Borza & Hutt-Fletcher (2002). Nature medicine 8, 594-599.
Borza, et al. (2004). Journal of virology 78, 5007-5014.
Brown, et al. (2015). Acta crystallographica Section D, Biological crystallography 71 , 136- 153.
Chandramouli & Malito (2017). Structural basis for potent antibody-mediated neutralization of human cytomegalovirus. 2.
Chen, et al. (2013a). Journal of virology 87, 3620-3627.
Chen, et al. (2012). The KGD motif of Epstein-Barr virus gH/gL is bifunctional, orchestrating infection of B cells and epithelial cells. mBio 3.
Chen, et al. (2018). Ephrin receptor A2 is a functional entry receptor for Epstein-Barr virus.
Nature Microbiology.
Chen, et al. (2013b). Ultramicroscopy 135, 24-35.
Chen, et al. (2010). Acta crystallographica Section D, Biological crystallography 66, 12-21.
Chesnokova, et al. (201 1). Journal of virology 85, 13214-13223.
Chesnokova, et al. (2009). PNAS USA 106, 20464-20469.
Chowdary, et al. (2010). Nature structural & molecular biology 17, 882-888.
Ciferri, et al. (2015). PLoS pathogens 11 , e1005230.
Cohen, et al. (2011). Science translational medicine 3, 107fs107.
Cohen, et al. (2013). Vaccine 31 Suppl 2, B194-196.
Collaborative Computational Project, N. (1994). Acta Crystallogr D Biol Crystallogr 50, 760-763. Connolly, et al. (201 1). Nature reviews Microbiology 9, 369-381.
Cui, et al. (2016). Vaccine 34, 4050-4055.
DeLano (2002). The PyMOL Molecular Graphics System (San Carlos, CA: DeLano Scientific).
Delecluse, et al. (1998). PNAS USA 95, 8245-8250.
DiMaio, et al. (2015). Nature methods 12, 361-365.
DiMaio, et al. (2009). Journal of molecular biology 392, 181-190. Doria-Rose, et al. (2015). Journal of virology 90, 76-91.
Easterhoff & Moody (2017). Boosting of HIV envelope CD4 binding site antibodies with long variable heavy third complementarity determining region in the randomized double blind RV305 HIV-1 vaccine trial. 13, e1006182.
Edson & Thorley-Lawson (1981). Journal of virology 39, 172-184.
Emsley, et al. (2010). Acta crystallographica Section D, Biological crystallography 66, 486-501. Frese, et al. (2013). Journal of proteome research 12, 1520-1525.
Goddard, et al. (2007). Journal of structural biology 157, 281-287.
Haan, et al. (2000). Journal of virology 74, 2451-2454.
Haan, et al. (2001). Virology 290, 106-114.
Haque, et al. (2006). The Journal of infectious diseases 194, 584-587.
Herrman, et al. (2015). Journal of virology 90, 1222-1230.
Hoffman, et al. (1980). PNAS USA 77, 2979-2983.
Huang, et al. (2013). Nature protocols 8, 1907-1915.
Hutchinson, et al. (1992). Journal of virology 66, 2240-2250.
Joyce, et al. (2016). Cell 166, 609-623.
Kimanius, et al. (2016). Accelerated cryo-EM structure determination with parallelisation using
GPUs in RELION-2. eLife 5.
Kirschner, et al. (2007). Journal of virology 81 , 9216-9229.
Kirschner, et al. (2006). Journal of virology 80, 9444-9454.
Krissinel & Henrick (2007). Journal of molecular biology 372, 774-797.
Li, et al. (1997). Journal of virology 71 , 1667-1670.
Li, et al. (1995). Journal of virology 69, 3987-3994.
Li, et al. (1992). Nature 356, 347-350.
Macagno, et al. (2010). Journal of virology 84, 1005-1013.
Magro, et al. (2012). PNAS USA 109, 3089-3094.
Matsuura, et al. (2010). PNAS USA 107, 22641-22646.
McGuire, et al. (2016). Nature communications 7, 10618.
McLellan, et al. (2013). Science 340, 11 13-1117.
McShane & Longnecker (2005). Methods Mol Biol 292, 187-196.
Miller, et al. (1972). The Journal of infectious diseases 125, 403-406.
Miller & Hutt-Fletcher (1992). Journal of virology 66, 3409-3414.
Mohl, et al. (2016). Molecules and cells 39, 286-291.
Mohl, et al. (2014). Journal of virology 88, 13570-13579. Molesworth, et al. (2000). Journal of virology 74, 6324-6332.
Moody, et al. (201 1). PloS one 6, e25797.
Moss & Pope, (1972). The Journal of general virology 17, 233-236.
Moutschen, et al. (2007). Vaccine 25, 4697-4705.
Neuhierl, et al. (2002). PNAS USA 99, 15036-15041.
Oda, et al. (2000). Virology 276, 52-58.
Ogembo, et al. (2013). Cell reports 3, 371-385.
Okuma, et al. (1999). Virology 254, 235-244.
Omerovic, et al. (2005). Journal of virology 79, 12408-12415.
Otwinowski & Minor (1997). Methods in enzymology 276, 307-326.
Pettersen, et al. (2004). Journal of computational chemistry 25, 1605-1612.
Plate, et al. (2011). Virology 413, 26-38.
Plate, et al. (2009). Journal of virology 83, 7678-7689.
Rappuoli, et al. (2016). The Journal of experimental medicine 213, 469-481.
Rickinson, et al. (2014). Trends in immunology 35, 159-169.
Rosenthal & Henderson (2003). Journal of molecular biology 333, 721-745.
Sashihara, et al. (2009). Virology 391 , 249-256.
Sathiyamoorthy, et al. (2016). Nature communications 7, 13557.
Sathiyamoorthy, et al. (2014). PLoS pathogens 10, e1004309.
Sathiyamoorthy, et al. (2017). PNAS USA 114, E8703-e8710.
Scheres & Chen (2012). Nature methods 9, 853-854.
Snijder, et al. (2017). Vitrification after multiple rounds of sample application and blotting improves particle density on cryo-electron microscopy grids. Journal of structural biology. Sokal, et al. (2007). The Journal of Infectious Diseases 196, 1749-1753.
Spriggs, et al. (1996). Journal of Virology 70, 5557-5563.
Stampfer & Heldwein (2013). Current Opinion in Virology 3, 13-19.
Strnad, et al. (1982). Journal of virology 41 , 258-264.
Suloway, et al. (2005). Journal of structural biology 151 , 41-60.
Tang, et al. (2007). Journal of structural biology 157, 38-46.
Tangye, et al. (2017). The Journal of experimental medicine 214, 269-283.
Tanner, et al. (1987). Cell 50, 203-213.
Taylor, et al. (2015). Annual review of immunology 33, 787-821.
Taylor, et al. (2012). The Journal of experimental medicine 209, 2065-2077.
Thorley-Lawson & Geilinger (1980). PNAS USA 77, 5307-5311. Tugizov, et al. (2003). Nature medicine 9, 307-314.
Turk, et al. (2006). Journal of virology 80, 9628-9633.
Voss, et al. (2009). Journal of structural biology 166, 205-213.
Wang, et al. (1998). Journal of virology 72, 5552-5558.
Wrammert, et al. (2008). Nature 453, 667-671.
Wu, et al. (2005). Journal of virology 79, 10923-10930.
Xing, et al. (2015). PNAS USA 112, 6056-6061.
Young & Rickinson (2004). Nature rReviews Cancer 4, 757-768.
Zhang, et al. (2018). Ephrin receptor A2 is an epithelial cell receptor for Epstein-Barr virus entry. Nature Microbiology.
Zhang, (2016). Journal of structural biology 193, 1-12.
Zheng, et al. (2017). Nature methods 14, 331-332.

Claims

CLAIMS What is claimed is:
1. An anti-EBV antibody including the complementary determining regions (CDRs):
SEQ ID NO: 11 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16;
SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , and SEQ ID NO: 22;
SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28;
SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, and SEQ ID NO: 34; or
SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, and SEQ ID NO: 40.
2. An anti-EBV antibody of claim 1 , comprising SEQ ID NO: 1 and SEQ ID NO: 2.
3. An anti-EBV antibody of claim 1, comprising SEQ ID NO: 1 with a Q1 N mutation and SEQ ID NO: 2.
4. An anti-EBV antibody that (i) binds residues 73 and 76 of gH wherein residue 73 is lysine and residue 76 is tyrosine; (ii) inhibits EBV envelope fusion with B cells and epithelial cells; and (iii) competes for binding with the antibody CL40.
5. An anti-EBV antibody or an antigen-binding portion therof that dissociates from EBV gH/gL with a KD of 1X10"10 or less and a k0ff rate constant of 3X10"5 s"1 or less, both determined by surface plasmon resonance or biolayer interferometry.
6. An anti-EBV antibody of any of claims 1-5, wherein the antibody neutralizes EBV infection of B cells and/or epithelial cells with an IC50 of 3X10"9M or less.
7. An anti-EBV antibody of any of claims 1 -5, comprising mutations: G236AI; S239D; A330L; and I332E.
8. An anti-EBV antibody of any of claims 1 -5, comprising mutations M428L and N434S.
9. An anti-EBV antibody of any of claims 1 -5, including a thioMab.
10. An anti-EBV antibody of any of claims 1 -5, wherein the Fc region has a reduced fucose content or lacks fucose.
11. An anti-EBV antibody of any of claims 1 -5, comprising a polyethylene glycol (PEG)-linkage.
12. An anti-EBV antibody any of claims 1 -5, comprising a human serum albumin (HSA)-linkage.
13. An anti-EBV antibody of any of claims 1 -5, wherein the antibody is an scFV or a Fab.
14. An anti-EBV antibody of any of claims 1 -5, conjugated to an imaging agent or a drug.
15. An EBV vaccine comprising a pharmaceutically acceptable carrier and (i) gH or a fragment thereof that binds to gl_, and (ii) gl_ or a fragment thereof binds to gH; wherein the gH or fragment thereof and gl_ or fragment thereof bind to form a gH/gL heterodimer complex.
16. An EBV vaccine of claim 15, further comprising gp42 or a fragment thereof that binds to the gH/gL heterodimer complex.
17. An EBV vaccine of comprising a pharmaceutically acceptable carrier and gB or a fragment thereof.
18. An EBV vaccine of any of claims 15-17, further comprising an adjuvant.
19. An EBV vaccine of claim 18, wherein the adjuvant is selected from alum, a squalene-based adjuvant, a STING agonist, or a liposome-based adjuvant.
20. An EBV vaccine of claims 15-17, further comprising a multimerization domain.
21. An EBV vaccine of claim 20, wherein the multimerization domain is a C4b domain.
22. An EBV vaccine of claim 20, wherein the multimerization domain is selected from SEQ ID NOs: 55-59.
23. A cell genetically modified to express an anti-EBV antibody of claim 1 or an EBV vaccine of claim 15 or claim 17.
24. A cell of claim 23, wherein the cell is genetically modified ex vivo.
25. A cell of claim 23, wherein the cell is genetically modified in vivo.
26. A cell of claim 23, wherein the cell is a B cell.
27. A cell of claim 23, wherein the cell is a cell of hematopoeitic origin that differentiates into a B cell.
28. A cell of claim 23, wherein the cell is a CD34+ hematopoeitic stem cell.
29. A composition formulated for administration to a subject including an anti-EBV antibody of claim 1 , an EBV vaccine of claim 15 or claim 17, or a cell genetically modified to express an anti-EBV antibody of claim 1 or an EBV vaccine of claim 15 or claim 17.
30. A method of treating a subject for EBV infection including administering to the subject a therapeutically effective amount of a composition of claim 29, thereby treating the subject for EBV infection.
31. A method of neutralizing EBV infection, including contacting cells or tissue with an antibody of claim 1 thereby reducing or inhibiting EBV infection of the cells or the tissue.
32. A method of claim 31 , wherein the cells are epithelial cells.
33. A method of claim 31 , wherein the cells are B cells.
34. A method of claim 31 , wherein the cells are epithelial cells and B cells.
35. A method of stimulating an anti-EBV immune response in a subject including administering to the subject a therapeutically effective amount of an EBV vaccine of claim 15 or claim 17.
36. A method of claim 35, wherein the subject is EBV seropositive.
37. A method of claim 35, wherein the subject is an EBV seronegative subject, and wherein the therapeutically effective amount reduces the risk of EBV infection.
38. A method of claim 35, wherein the EBV seronegative subject is a pediatric patient.
39. A method of claim 35, wherein the administering is prior to treatment with an immunosuppressant.
40. A method of claim 35, wherein the subject is a transplant patient.
PCT/US2018/032127 2017-05-10 2018-05-10 Epstein barr virus antibodies, vaccines, and uses of the same Ceased WO2018209125A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/612,265 US11116835B2 (en) 2017-05-10 2018-05-10 Epstein Barr virus antibodies, vaccines, and uses of the same

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762504447P 2017-05-10 2017-05-10
US62/504,447 2017-05-10
US201762560061P 2017-09-18 2017-09-18
US62/560,061 2017-09-18

Publications (1)

Publication Number Publication Date
WO2018209125A1 true WO2018209125A1 (en) 2018-11-15

Family

ID=64104945

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/032127 Ceased WO2018209125A1 (en) 2017-05-10 2018-05-10 Epstein barr virus antibodies, vaccines, and uses of the same

Country Status (2)

Country Link
US (1) US11116835B2 (en)
WO (1) WO2018209125A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021022037A1 (en) * 2019-07-30 2021-02-04 Immunome, Inc. Il-38-specific antiobodies
EP4293038A4 (en) * 2021-02-10 2025-06-18 Xiamen University Epitope peptide and antibody for preventing and treating eb virus infection and related diseases

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11168356B2 (en) * 2017-11-02 2021-11-09 The Chinese University Of Hong Kong Using nucleic acid size range for noninvasive cancer detection
US12070495B2 (en) 2019-03-15 2024-08-27 Modernatx, Inc. HIV RNA vaccines
US20230173088A1 (en) * 2021-12-08 2023-06-08 IgGenix, Inc. Compositions and methods for treating and suppressing allergic responses
CN119072319A (en) 2021-12-23 2024-12-03 萨那生物技术股份有限公司 Chimeric antigen receptor (CAR) T cells and related methods for treating autoimmune diseases
WO2024220598A2 (en) 2023-04-18 2024-10-24 Sana Biotechnology, Inc. Lentiviral vectors with two or more genomes
WO2024220597A2 (en) 2023-04-18 2024-10-24 Sana Biotechnology, Inc. Digital droplet based assay for detecting replication competent lentiviral vector
WO2025076445A1 (en) * 2023-10-04 2025-04-10 Agenus Inc. Anti-fap antibodies and methods of use thereof

Family Cites Families (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ATE240740T1 (en) 1991-03-15 2003-06-15 Amgen Inc PEGYLATION OF POLYPEPTIDES
ATE375365T1 (en) 1998-04-02 2007-10-15 Genentech Inc ANTIBODIES VARIANTS AND FRAGMENTS THEREOF
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
CA2704600C (en) 1999-04-09 2016-10-25 Kyowa Kirin Co., Ltd. A method for producing antibodies with increased adcc activity
EP1229125A4 (en) 1999-10-19 2005-06-01 Kyowa Hakko Kogyo Kk PROCESS FOR PRODUCING A POLYPEPTIDE
US6946292B2 (en) 2000-10-06 2005-09-20 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions with increased antibody dependent cytotoxic activity
US7064191B2 (en) 2000-10-06 2006-06-20 Kyowa Hakko Kogyo Co., Ltd. Process for purifying antibody
CA2953239A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kirin Co., Ltd. Antibody composition-producing cell
CA2463879C (en) 2001-10-25 2012-12-04 Genentech, Inc. Glycoprotein compositions
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
EP1498490A4 (en) 2002-04-09 2006-11-29 Kyowa Hakko Kogyo Kk PROCESS FOR PRODUCING ANTIBODY COMPOSITION
BR0309145A (en) 2002-04-09 2005-02-01 Kyowa Hakko Kogyo Kk Cells from which the genome is modified
CA2481658A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Method of enhancing of binding activity of antibody composition to fcy receptor iiia
EP1500400A4 (en) 2002-04-09 2006-10-11 Kyowa Hakko Kogyo Kk MEDICAMENT CONTAINING ANTIBODY COMPOSITION
ATE503829T1 (en) 2002-04-09 2011-04-15 Kyowa Hakko Kirin Co Ltd CELL WITH REDUCED OR DELETED ACTIVITY OF A PROTEIN INVOLVED IN GDP-FUCOSE TRANSPORT
CA2481925A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Therapeutic agent for patients having human fc.gamma.riiia
JPWO2005035586A1 (en) 2003-10-08 2007-11-22 協和醗酵工業株式会社 Fusion protein composition
JPWO2005035778A1 (en) 2003-10-09 2006-12-21 協和醗酵工業株式会社 Method for producing antibody composition using RNA that suppresses function of α1,6-fucosyltransferase
WO2005053742A1 (en) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. Medicine containing antibody composition
DK1791565T3 (en) 2004-09-23 2016-08-01 Genentech Inc Cysteingensplejsede antibodies and conjugates
EP2032606B1 (en) * 2006-05-30 2013-11-27 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
WO2010129033A2 (en) * 2009-04-29 2010-11-11 Calmune Corporation Modified antibodies for passive immunotherapy
WO2015054639A1 (en) * 2013-10-11 2015-04-16 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Epstein-barr virus vaccines
EA035817B1 (en) 2015-03-10 2020-08-14 Адуро Байотек, Инк. Compositions and methods for activating "stimulator of interferon gene"-dependent signalling

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
SAXENA ET AL.: "Advances in Therapeutic Fc Engineering. Modulation of IgG-Associated Effector Functions and Serum Half-life", FRONTIERS IN IMMUNOLOGY, vol. 7, no. 580, 12 December 2016 (2016-12-12), pages 1 - 11, XP055550439 *
SOCHAJ ET AL.: "Current methods for the synthesis of homogeneous antibody-drug conjugates", BIOTECHNOLOGY ADVANCES, vol. 33, no. 6, 1 November 2015 (2015-11-01), pages 775 - 784, XP055268076 *
STRUCTURE OF AMM01 FAB, AN ANTI EBV GH/GL NEUTRALIZING ANTIBODY, 2014, Retrieved from the Internet <URL:https://www.ebi.ac.uk/msd-srv/pisa/cgi-bin/piserver?qi=6bla>> [retrieved on 20180716] *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021022037A1 (en) * 2019-07-30 2021-02-04 Immunome, Inc. Il-38-specific antiobodies
EP4293038A4 (en) * 2021-02-10 2025-06-18 Xiamen University Epitope peptide and antibody for preventing and treating eb virus infection and related diseases

Also Published As

Publication number Publication date
US11116835B2 (en) 2021-09-14
US20200164059A1 (en) 2020-05-28

Similar Documents

Publication Publication Date Title
US11116835B2 (en) Epstein Barr virus antibodies, vaccines, and uses of the same
TW202146442A (en) Antibodies against sars-cov-2 and methods of using the same
WO2021203053A1 (en) Immunotherapy targeting a conserved region in sars coronaviruses
US20240150444A1 (en) Protective antibodies against respiratory viral infections
US12551549B2 (en) Methods of eliciting antibodies that bind to full-length glycosylated HIV-1 ENV using multimerized ENV cores
EP4230650B1 (en) Antibodies capable of binding to the spike protein of coronavirus sars-cov-2
CA3197642A1 (en) Polypeptides targeting sars-cov-2 and related compositions and methods
US20240101645A1 (en) Monoclonal antibodies against coronaviruses and uses thereof
WO2022167666A1 (en) Sarbecovirus binders
CN111818972A (en) Deimmunized anti-ERBB3 antibody
CN117693530A (en) Antibodies against MUC1-C/extracellular domain (MUC1-C/ECD)
US20210301026A1 (en) Csf1r binding agents
CN114181301B (en) ADE-effect-free neutralizing antibodies against SARS-CoV-2
US20250304657A1 (en) Antibodies with novel fc modification combinations that increase antibody function
US20250296987A1 (en) Rsv/hmpv cross-reactive antibodies
US20250002564A1 (en) Modified multabody constructs, compositions, and methods
WO2024068996A1 (en) Anti-sars-cov-2 antibodies and use thereof in the treatment of sars-cov-2 infection
US20250011397A1 (en) Modified multabody constructs, compositions, and methods targeting sars-cov-2
WO2025222144A1 (en) Antibodies and vaccines having vh3-21 and vl1-40 binding domains and uses thereof
WO2024211789A1 (en) Cross-flavivirus binding domains and uses thereof
WO2025250159A2 (en) N-linked glycan removal mutant antibodies and their use against influenza viruses
WO2023108117A2 (en) Engineered fc domains and engineered hcmv viral fc receptors
CN121511256A (en) Agonistaltic antibodies targeting JAML
HK40102189A (en) Antibodies against the muc1-c/extracellular domain (muc1-c/ecd)
KR20210041557A (en) Antibodies to Campylobacter spp.

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18798375

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 18798375

Country of ref document: EP

Kind code of ref document: A1