WO2018201058A2 - Sialidase inhibitors and preparation thereof - Google Patents

Sialidase inhibitors and preparation thereof Download PDF

Info

Publication number
WO2018201058A2
WO2018201058A2 PCT/US2018/029965 US2018029965W WO2018201058A2 WO 2018201058 A2 WO2018201058 A2 WO 2018201058A2 US 2018029965 W US2018029965 W US 2018029965W WO 2018201058 A2 WO2018201058 A2 WO 2018201058A2
Authority
WO
WIPO (PCT)
Prior art keywords
sialic acid
group
anhydro
sialoside
sialidase
Prior art date
Application number
PCT/US2018/029965
Other languages
French (fr)
Other versions
WO2018201058A3 (en
Inventor
Wanqing Li
Xi Chen
An Xiao
Xixuan LI
Yanhong Li
Teri SLACK
Original Assignee
The Regents Of The University Of California
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by The Regents Of The University Of California filed Critical The Regents Of The University Of California
Priority to US16/608,640 priority Critical patent/US11325936B2/en
Publication of WO2018201058A2 publication Critical patent/WO2018201058A2/en
Publication of WO2018201058A3 publication Critical patent/WO2018201058A3/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H5/00—Compounds containing saccharide radicals in which the hetero bonds to oxygen have been replaced by the same number of hetero bonds to halogen, nitrogen, sulfur, selenium, or tellurium
    • C07H5/04—Compounds containing saccharide radicals in which the hetero bonds to oxygen have been replaced by the same number of hetero bonds to halogen, nitrogen, sulfur, selenium, or tellurium to nitrogen
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D309/00—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings
    • C07D309/16—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings having one double bond between ring members or between a ring member and a non-ring member
    • C07D309/28—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings having one double bond between ring members or between a ring member and a non-ring member with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D309/30—Oxygen atoms, e.g. delta-lactones
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/70—Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7012—Compounds having a free or esterified carboxyl group attached, directly or through a carbon chain, to a carbon atom of the saccharide radical, e.g. glucuronic acid, neuraminic acid
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H1/00—Processes for the preparation of sugar derivatives
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H13/00—Compounds containing saccharide radicals esterified by carbonic acid or derivatives thereof, or by organic acids, e.g. phosphonic acids
    • C07H13/02—Compounds containing saccharide radicals esterified by carbonic acid or derivatives thereof, or by organic acids, e.g. phosphonic acids by carboxylic acids
    • C07H13/04—Compounds containing saccharide radicals esterified by carbonic acid or derivatives thereof, or by organic acids, e.g. phosphonic acids by carboxylic acids having the esterifying carboxyl radicals attached to acyclic carbon atoms
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H13/00—Compounds containing saccharide radicals esterified by carbonic acid or derivatives thereof, or by organic acids, e.g. phosphonic acids
    • C07H13/02—Compounds containing saccharide radicals esterified by carbonic acid or derivatives thereof, or by organic acids, e.g. phosphonic acids by carboxylic acids
    • C07H13/08—Compounds containing saccharide radicals esterified by carbonic acid or derivatives thereof, or by organic acids, e.g. phosphonic acids by carboxylic acids having the esterifying carboxyl radicals directly attached to carbocyclic rings
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H15/00—Compounds containing hydrocarbon or substituted hydrocarbon radicals directly attached to hetero atoms of saccharide radicals
    • C07H15/20—Carbocyclic rings
    • C07H15/207—Cyclohexane rings not substituted by nitrogen atoms, e.g. kasugamycins
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00—Preparation of compounds containing saccharide radicals
    • C12P19/26—Preparation of nitrogen-containing carbohydrates
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00—Preparation of compounds containing saccharide radicals
    • C12P19/26—Preparation of nitrogen-containing carbohydrates
    • C12P19/28—N-glycosides

Definitions

  • Microbial sialidases are important targets for designing anti-viral and anti-bacterial drugs.
  • Sialic acids are common terminal monosaccharides on the carbohydrate moieties of mammalian cell surface glycoconjugates and play important biological roles.
  • Sialidases or neuraminidases the exoglycosidases that catalyze the cleavage of the terminal sialic acids, are widely spread in vertebrates and microbes residing in or infecting vertebrates. Viral and bacterial sialidases are therefore attractive targets for designing inhibitors as potent antimicrobial therapeutics.
  • Sialidase transition state analog inhibitor 2-deoxy-2,3-dehydro-N-acetylneuraminic acid has played a leading role in developing clinically used anti- influenza virus drugs. It was also a lead compound for rational design of clinical anti- influenza virus drugs Relenza (Zanamivir or 4-deoxy-4-guanidino-Neu5Ac2en) and Tamiflu (Oseltamivir). Numerous 2,3-dehydro-2-deoxy-sialic acids (Sia2ens) have been synthesized according to previously reported chemical methods. Chemical modification of selectively protected sialic acids is a common strategy to obtain Sia2ens, which is considered too environmentally unfriendly as organic solvents are used. It also requires multiple protection and deprotection steps.
  • a method for forming a sialic acid product selected from the group consisting of a 2-deoxy-2,3-dehydro-sialic acid, a 2,7-anhydro-sialic acid, and derivatives thereof.
  • the method includes: forming a reaction mixture comprising a glycoside acceptor, a sialic acid donor, and a sialyltransferase; maintaining the reaction mixture under conditions sufficient to form a sialoside; and contacting the sialoside with a Streptococcus pneumoniae sialidase to form the sialic acid product.
  • SpNanC is used for forming 2-deoxy-2,3-dehydro-sialic acids.
  • SpNanB is use for forming 2,7-anhydro-sialic acids.
  • the method further includes contacting a sialic acid and a CMP-sialic acid synthetase in the presence of CTP to form a CMP-sialic acid for use as the sialic acid donor. In some embodiments, the method further includes contacting a
  • forming the sialic acid, forming the CMP-sialic acid, forming the sialoside, and forming the sialic acid product are conducted in one pot.
  • R 1 , R 2 , R 3 , and R 4 are independently selected from the group consisting of
  • R 5 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)R a , -N 3 , -NH2, -OC(0)R a , -OH, and hydrogen;
  • each R a is independently selected from the group consisting of optionally substituted
  • Ci-12 alkyl optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce- ⁇ aryl, and optionally substituted C7-22 arylalkyl;
  • R 1 , R 2 , R 3 , and R 4 is other than -OH when R 5 is -NHAc or -NHGc.
  • R 11 , R 12 , and R 14 are independently selected from the group consisting of
  • R 15 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)R a , -N 3 , - H2, -OC(0)R a , -OH, and hydrogen;
  • R a is selected from the group consisting of optionally substituted Ci-12 alkyl
  • Ci-12 haloalkyl optionally substituted C3-10 cycloalkyl, optionally substituted Ce- ⁇ aryl, and optionally substituted C7-22 arylalkyl;
  • Ac is -C(0)CH 3 ;
  • Gc is -C(0)CH 2 OH
  • R 11 , R 12 , and R 14 is other than -OH when R 15 is -NHAc or -NHGc.
  • Compounds of Formula I and Formula II can be used as sialidase inhibitors, as well as for the study of sialidase activity and for the chemical or chemoenzymatic synthesis of sialosides.
  • FIG. 1 shows the pH profile of SpNanC using Neu5Ac ⁇ 2-3Ga NP as the substrate. Buffers used: MES, pH 5.0-6.5; Tris-HCl, pH 7.0-9.0; CAPS, pH 10.0.
  • FIG. 2 shows the effects of Mg 2+ , EDTA and DTT on the sialidase activity of SpNanC when Neu5Ac ⁇ 2-3Gai /?NP was used as a substrate.
  • FIG. 3 shows the temperature profile of SpNanC using Neu5Ac ⁇ 2-3Gai /?NP as the substrate. The assay was done at temperatures ranging from 4 °C to 60 °C. Reactions were allowed to proceed in MES buffer (pH 6.5, 100 mM) for 10 min.
  • MES buffer pH 6.5, 100 mM
  • FIG. 4 shows one embodiment of a procedure for one-pot, multi-enzyme synthesis of 2-deoxy-2,3-dehydro-sialic acids according to the present disclosure.
  • PmAldolase a CMP-sialic acid synthetase (e.g., NmCSS), and a sialyltransferase (e.g., PmSTl_M144D).
  • the sialosides are then utilized by SpNanC to produce 2-deoxy-2,3- dehydro-sialic acids (Sia2ens).
  • Sia2ens can be completed in one pot starting directly from the corresponding sialic acids or their six-carbon precursors.
  • This method provides a fast and efficient access to a library of Sia2ens.
  • An inexpensive sialyltransferase acceptor such as lactose can be used in a catalytic amount for the production of Sia2en, which allows the economic production of the desired Sia2en inhibitors in an environmentally friendly way.
  • the reaction can be carried out in two steps.
  • a one- pot, multi-enzyme sialylation reaction can be performed to form a sialoside a lactoside tagged with a hydrophobic aglycon to allow easy purification of the product.
  • the purified sialoside is used as the substrate for SpNanC-catalyzed reaction for the production of Sia2en.
  • the tagged sialoside and the corresponding tagged lactoside product can be easily separated from Sia2en produced by SpNanC using reverse phase chromatography (e.g., using a CI 8 cartridge or column).
  • 2,7-anhydro-sialic acid-forming property of S. pneumoniae sialidase SpNanB can be leveraged in an effective one-pot multienzyme (OPME) strategy for obtaining direct access to 2,7-anhydro-Sia and its C-5, C-9, and C-7 derivatives from N- acetylmannosamine (ManNAc) and derivatives.
  • Sialosides are synthesized using the multi- enzyme strategy described above, and they can then be utilized by SpNanB to produce 2,7- anhydro-sialic acids (2,7- anhydro-Sias).
  • a two-step reaction can also be performed to allow easy production and separation of the 2,7-anhydro-Sias.
  • a one-pot, multi-enzyme sialylation reaction can be performed to form a sialoside a lactoside tagged with a hydrophobic aglycon to allow easy purification of the product.
  • the purified sialoside is used as the substrate for SpNanB-catalyzed reaction for the production of 2,7-anhydro-Sias.
  • the tagged sialoside and the corresponding tagged lactoside product can be easily separated from 2,7-anhydro- Sias produced by SpNanB using reverse phase chromatography (e.g., using a CI 8 cartridge or column).
  • sialic acid refers to N- and O-substituted derivatives of neuraminic acid (i.e., N- and O-substituted derivatives of 5-amino-2-keto-3,5-dideoxy-D- glycero-D-galactononulosonic acid—also referred to as (4S,5R,6R,7S,8R)-5-amino-4,6,7,8,9- pentahydroxy-2-oxo-nonanoic acid).
  • Sialic acids include, but are not limited to, N-acetyl neuraminic acid (Neu5Ac), N-glycolyl neuraminic acid (Neu5Gc), and 2-keto-3-deoxy-D- glycero-D-galactonononic acid (KDN), as well as O-acetyl, O-lactyl, O-methyl, O-sulfate and O-phosphate derivatives.
  • the terms "2-deoxy-2,3-dehydro-sialic acid” and "Sia2en” refer to sialic acids having a double bond between C2 and C3 of the neuraminic acid core. Sia2ens include, but are not limited to, compounds of Formula I as described herein.
  • 2,7-anhydro-sialic acid refers to sialic acids wherein the C2 and C7 of the pyranose form of the neuraminic acid core are linked via an oxygen atom.
  • 2,7-Anhydro- sialic acids include, but are not limited to, compounds of Formula II as described herein.
  • glycoside refers to a saccharide compound having a moiety "-OR" replacing a hydroxyl group of the hemiacetal at the anomeric carbon of the cyclic form of the parent compound, wherein R is another saccharide (e.g., a monosaccharide, oligosaccharide, or polysaccharide) or a non-saccharide moiety (e.g., a lipid, a protein, a peptide, a linker moiety, a label moiety, etc.).
  • a “glycoside acceptor” refers to a glycoside which is used for further elaboration via covalent modification with another saccharide moiety such as a sialic acid.
  • sialic acid pyranose moiety wherein a hydroxyl group of the hemiacetal at the anomeric carbon (i.e., carbon 2) of the cyclic form of the parent compound is replaced with a moiety -OR as described above.
  • Sialosides include, but are not limited to, sialyl lactose, sialyl lactosides, sialyl Tn antigen, and sialyl Lewis x .
  • sialidase refers to an enzyme that catalyzes the cleavage of a terminal sialic acid from a sialylated substrate (i.e., a sialoside) such as an
  • oligosaccharide a polysaccharide, a glycosylated protein, a glycosylated lipid, a glycosylated small molecule, or a glycosylated peptide.
  • sialyltransferase refers to an enzyme that catalyzes the transfer of a sialic acid residue from a sialic acid donor (e.g., a sialic acid nucleotide donor) to an acceptor such as an oligosaccharide, a polysaccharide, a glycosylated protein, a glycosylated lipid, a glycosylated small molecule, or a glycosylated peptide.
  • a sialic acid donor e.g., a sialic acid nucleotide donor
  • acceptor such as an oligosaccharide, a polysaccharide, a glycosylated protein, a glycosylated lipid, a glycosylated small molecule, or a glycosylated peptide.
  • CMP-sialic acid synthetase refers to a polypeptide that catalyzes the synthesis of cytidine monophosphate sialic acid (CMP-sialic acid) from cytidine triphosphate (CTP) and sialic acid.
  • sialic acid aldolase refers to an aldolase that catalyzes a reversible reaction that converts a suitable hexosamine, hexose, pentose, or derivative (such as N-acetyl mannosamine) to sialic acid via reaction with pyruvate.
  • lactose refers to -D-galactopyranosyl-(l ⁇ 4)-D-glucose (i.e., ⁇ -lactose) and isomers thereof such as a-lactose.
  • lactoside refers to refers to a disaccharide derivative wherein a hydroxyl group of the hemiacetal at the anomeric carbon (carbon 1) of
  • R is a non-sugar structure such as propyl azide, carboxybenzyl (Cbz)-protected propyl amine, fluorenylmethyloxycarbonyl (Fmoc)-protected propyl amine, or the like.
  • pyruvate refers to the anion of 2-oxopropanoic acid having the formula CH3C(0)C(0)0 " .
  • pyruvate can be provided in reactions mixtures as the protonated acid or a salt such as sodium pyruvate.
  • alkyl by itself or as part of another substituent, refers to a straight or branched, saturated, aliphatic radical having the number of carbon atoms indicated.
  • Alkyl can include any number of carbons, such as C1-2, C1-3, C1-4, C1-5, Ci-6, C1-7, Ci-8, Ci-9, Ci-io, C2-3, C2-4, C2-5, C2-6, C3-4, C3-5, C3-6, C4-5, C4-6 and C5-6.
  • Ci-6 alkyl includes, but is not limited to, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, hexyl, etc.
  • Alkyl can also refer to alkyl groups having up to 20 carbons atoms, such as, but not limited to heptyl, octyl, nonyl, decyl, etc. Alkyl groups can be substituted or unsubstituted. Unless otherwise specified, "substituted alkyl” groups can be substituted with one or more groups selected from halo, hydroxy, amino, alkylamino, ami do, acyl, nitro, cyano, and alkoxy.
  • alkylene refers to an alkyl group, as defined above, linking at least two other groups (i.e., a divalent alkyl radical). The two moieties linked to the alkylene group can be linked to the same carbon atom or different carbon atoms of the alkylene group.
  • haloalkyl by itself or as part of another substituent, refers to an alkyl group where some or all of the hydrogen atoms are replaced with halogen atoms.
  • alkyl groups haloalkyl groups can have any suitable number of carbon atoms, such as Ci-6.
  • haloalkyl includes trifluoromethyl, fiuoromethyl, etc.
  • perfluoro can be used to define a compound or radical where all the hydrogens are replaced with fluorine.
  • perfiuoromethyl refers to
  • cycloalkyl by itself or as part of another substituent, refers to a saturated or partially unsaturated, monocyclic, fused bicyclic or bridged poly cyclic ring assembly containing from 3 to 12 ring atoms, or the number of atoms indicated.
  • Cycloalkyl can include any number of carbons, such as C3-6, C4-6, C5-6, C3-8, C4-8, C5-8, Ce-8, C3-9, C3-10, C3-11, and C3-12.
  • Saturated monocyclic cycloalkyl rings include, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and cyclooctyl.
  • Saturated bicyclic and poly cyclic cycloalkyl rings include, for example, norbornane, [2.2.2] bicyclooctane, decahydronaphthalene and adamantane.
  • Cycloalkyl groups can also be partially unsaturated, having one or more double or triple bonds in the ring.
  • Representative cycloalkyl groups that are partially unsaturated include, but are not limited to, cyclobutene, cyclopentene, cyclohexene, cyclohexadiene (1,3- and 1,4-isomers), cycloheptene, cycloheptadiene, cyclooctene, cyclooctadiene (1,3-, 1,4- and 1,5 -isomers), norbomene, and norbornadiene.
  • exemplary groups include, but are not limited to cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl and cyclooctyl.
  • exemplary groups include, but are not limited to cyclopropyl, cyclobutyl, cyclopentyl, and cyclohexyl. Cycloalkyl groups can be substituted or unsubstituted.
  • substituted cycloalkyl groups can be substituted with one or more groups selected from halo, hydroxy, amino, alkylamino, amido, acyl, nitro, cyano, and alkoxy.
  • lower cycloalkyl refers to a cycloalkyl radical having from three to seven carbons including, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and cycloheptyl.
  • aryl by itself or as part of another substituent, refers to an aromatic ring system having any suitable number of carbon ring atoms and any suitable number of rings.
  • Aryl groups can include any suitable number of carbon ring atoms, such as Ce, C7, Ce, Cs>, Cio, C11, C12, Ci3, CM, C15 or Ci6, as well as Ce- ⁇ , Ce-u, or Ce-14 .
  • Aryl groups can be monocyclic, fused to form bicyclic (e.g., benzocyclohexyl) or tricyclic groups, or linked by a bond to form a biaryl group.
  • Representative aryl groups include phenyl, naphthyl and biphenyl.
  • aryl groups include benzyl, having a methylene linking group. Some aryl groups have from 6 to 12 ring members, such as phenyl, naphthyl or biphenyl. Other aryl groups have from 6 to 10 ring members, such as phenyl or naphthyl. Some other aryl groups have 6 ring members, such as phenyl.
  • Aryl groups can be substituted or
  • substituted aryl groups can be substituted with one or more groups selected from halo, hydroxy, amino, alkylamino, amido, acyl, nitro, cyano, and alkoxy.
  • alkoxy by itself or as part of another substituent, refers to a group having the formula -OR, wherein R is alkyl.
  • halo and halogen, by themselves or as part of another substituent, refer to a fluorine, chlorine, bromine, or iodine atom.
  • hydroxy refers to the moiety -OH.
  • cyano refers to a carbon atom triple-bonded to a nitrogen atom (i.e., the moiety -C ⁇ N).
  • carboxy refers to the moiety -C(0)OH. A carboxy moiety can be ionized to form the corresponding carboxylate anion.
  • the term “amido” refers to a moiety -NRC(0)R or -C(0)NR 2 , wherein each R group is H or alkyl.
  • the term “nitro” refers to the moiety -NO2.
  • acylating refers to the conversion of an alcohol group (-OH) to an ester group (-OC(O)R) or to the conversion of an amino group (-NH2) to an amide group (-NHC(O)R), where R is an alkyl group as described below.
  • Some embodiments disclosed herein provide methods which include contacting a sialoside with a Streptococcus pneumoniae sialidase to form a sialic acid product such as a 2- deoxy-2,3-dehydro-sialic acid or a 2,7-anhydro-sialic acid.
  • Sia2ens Deoxy-2,3-dehydro-sialic acids
  • Sia2ens can be used as antimicrobial therapeutics or as materials for the synthesis of other carbohydrates.
  • Examples of Sia2ens include, for example, certain compounds described by Li and Chen (Mol. BioSyst. 2011, 7, 1060-1072); Khedri and Chen (Org. Biomol. Chem. 2012, 10, 6112-6120); Meindl
  • the sialic acid product is a 2-deoxy-2,3-dehydro-sialic acid or a derivative thereof.
  • a sialidase can be used to convert a sialoside according to Formula III to a Sia2en as shown in Scheme 1 :
  • R 1 , R 2 , R 3 , and R 4 can independently be -NHC(0)R a , -N 3 , -NH 2 , -NHR a , -OC(0)R a , -OH, or hydrogen;
  • R 5 can be -NHAc, -NHGc, -NHC(0)R a , -N 3 , -NH 2 , -OC(0)R a , -OH, or hydrogen (wherein Ac is -C(0)CH 3 and Gc is -C(0)CH 2 OH); and each R a can independently be optionally substituted Ci-12 alkyl, optionally substituted
  • Ci-12 haloalkyl optionally substituted C3-10 cycloalkyl, optionally substituted Ce- ⁇ aryl, and optionally substituted C7-22 arylalkyl.
  • R 6 can be a monosaccharide, an oligosaccharide, a polysaccharide, a glycosylated lipid, a glycosylated protein, a glycosylated peptide, a glycosylated small molecule, or a non-saccharide moiety.
  • a sialidase can be used to convert a sialoside according to Formula Ilia to a Sia2en according to Formula la as shown in Scheme 1 A (wherein R ⁇ R 6 are defined as for Scheme 1).
  • the Streptococcus pneumoniae sialidase used for preparing Sia2ens is SpNanC (NCBI Accession No. WP_024478413.1), comprising the amino acid sequence set forth in SEQ ID NO: 1, or a catalytically active variant thereof.
  • an SpNanC variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO: 1 is used in the method.
  • the SpNanC variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO: 1.
  • Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the sequence (e.g., a peptide of the invention) in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence which does not comprise additions or deletions, for optimal alignment of the two sequences.
  • the percentage is calculated by determining the number of positions at which the identical amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
  • nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same. Sequences are “substantially identical” to each other if they have a specified percentage of nucleotides or amino acid residues that are the same (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. These definitions also refer to the complement of a nucleic acid test sequence.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • BLAST and BLAST 2.0 algorithms can be used, which are described in Altschul et al. , (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res.
  • the SpNanC is S. pneumoniae TIGR4 SpNanC, comprising the amino acid sequence set forth in SEQ ID NO:2, or a catalytically active variant thereof.
  • an S. pneumoniae TIGR4 SpNanC variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO:2 is used in the method.
  • pneumoniae TIGR4 SpNanC variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO:2.
  • the sialic acid product is a 2,7-anhydro-sialic acid or a derivative thereof.
  • a sialidase can be used to convert a sialoside according to Formula Ila to a 2,7-anhydro-sialic acid as shown in Scheme 2:
  • R 11 , R 12 , and R 14 can independently be -NHC(0)R a , -N 3 , -NH 2 , -NHR a , -OC(0)R a , -OH, or hydrogen;
  • R 15 can be -NHAc, -NHGc, -NHC(0)R a , -N 3 ,
  • each R a can independently be optionally substituted Ci-12 alkyl, optionally substituted
  • Ci-12 haloalkyl optionally substituted C3-10 cycloalkyl, optionally substituted Ce- ⁇ aryl, and optionally substituted C7-22 arylalkyl.
  • R 16 can be a monosaccharide, an oligosaccharide, a polysaccharide, a glycosylated lipid, a glycosylated protein, a glycosylated peptide, a glycosylated small molecule, or a non-saccharide moiety.
  • a sialidase can be used to convert a sialoside according to Formula IVa to a 2,7-anhydro-sialic acid according to Formula Ila as shown in Scheme 2A (wherein R 11 , R 12 , R 14 , R 15 , and R 16 as defined as for Scheme 2):
  • the Streptococcus pneumoniae sialidase used for forming 2,7-anhydro-sialic acids is SpNanB, having the amino acid sequence set forth in SEQ ID NO:3, or a catalytically active variant thereof.
  • an SpNanB variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO: 3 is used in the method.
  • the SpNanB variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO:3.
  • the methods include providing reaction mixtures that contain the S. pneumoniae sialidases described herein.
  • the sialidases can be, for example, isolated or otherwise purified prior to addition to the reaction mixture.
  • a "purified" enzyme e.g., an SpNanC or variant thereof, an SpNanB or variant thereof, a sialyltransferase, a CMP-sialic acid synthetase, or a sialic acid aldolase
  • an enzyme which is provided as a purified protein composition wherein the enzyme constitutes at least about 50% of the total protein in the purified protein composition.
  • the enzyme e.g., an SpNanC or SpNanB
  • the enzyme can constitute about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the total protein in the purified protein composition.
  • the sialidase in the reaction mixture is provided as a purified protein composition wherein the sialidase constitutes at least about 95% of the total protein in purified protein composition.
  • the amount of the sialidase in a purified protein composition can be determined by any number of known methods including, for example, by polyacrylamide gel electrophoresis (e.g., SDS-PAGE) followed by detection with a staining reagent (e.g., Coomassie Brilliant Blue G-250, a silver nitrate stain, and/or a reagent containing a sialidase antibody).
  • a staining reagent e.g., Coomassie Brilliant Blue G-250, a silver nitrate stain, and/or a reagent containing a sialidase antibody.
  • the reaction mixtures can be formed and used in vitro.
  • the sialidases and other enzymes used in the methods can also be secreted by a cell present in the reaction mixture.
  • a sialidase variant or another enzyme can catalyze the reaction within a cell expressing the variant.
  • Reaction mixtures can contain additional reagents for use in glycosylation techniques.
  • the reaction mixtures can contain buffers (e.g., 2-(N-morpholino)ethanesulfonic acid (MES), 2-[4-(2-hydroxyethyl)piperazin-l- yljethanesulfonic acid (HEPES), 3 -morpholinopropane-1 -sulfonic acid (MOPS), 2-amino-2- hydroxymethyl-propane-l,3-diol (TRIS), potassium phosphate, sodium phosphate, phosphate-buffered saline, sodium citrate, sodium acetate, and sodium borate), cosolvents (e.g., dimethylsulfoxide, dimethylformamide, ethanol, methanol, tetrahydrofuran, acetone, and acetic acid), salts (e.g., NaCl, KC1, CaCh, and salts of Mn 2
  • buffers e.g.
  • detergents/surfactants e.g., a non-ionic surfactant such as NN-bis[3-(D- gluconamido)propyl]cholamide, polyoxyethylene (20) cetyl ether, dimethyldecylphosphine oxide, branched octylphenoxy poly(ethyleneoxy)ethanol, a polyoxyethylene- polyoxypropylene block copolymer, /-octylphenoxypolyethoxyethanol, polyoxyethylene (20) sorbitan monooleate, and the like; an anionic surfactant such as sodium cholate, N- lauroylsarcosine, sodium dodecyl sulfate, and the like; a cationic surfactant such as hexdecyltrimethyl ammonium bromide, trimethyl(tetradecyl) ammonium bromide, and the like; or a zwitterionic surfactant such as an amidosulfobetaine, 3-[(3
  • Buffers, cosolvents, salts, detergents/surfactants, chelators, reducing agents, and labels can be used at any suitable concentration, which can be readily determined by one of skill in the art.
  • buffers, cosolvents, salts, detergents/surfactants, chelators, reducing agents, and labels are included in reaction mixtures at concentrations ranging from about 1 ⁇ to about 1 M.
  • a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, a reducing agent, or a label can be included in a reaction mixture at a concentration of about 1 ⁇ , or about 10 ⁇ , or about 100 ⁇ , or about 1 mM, or about 10 mM, or about 25 mM, or about 50 mM, or about 100 mM, or about 250 mM, or about 500 mM, or about 1 M.
  • the reaction mixtures contain a sialoside and a sialoside as described herein, as well as one or more components selected from a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, a reducing agent, and a label.
  • the reaction mixtures contain a sialoside and a sialoside as described herein, as well as one or more components selected from a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, and a reducing agent.
  • the reaction mixtures consist essentially of a sialoside and a sialidase as described herein, and one or more components selected from a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, and a reducing agent.
  • Reactions are conducted under conditions sufficient to convert the sialoside to the sialic acid product (e.g., a 2-deoxy-2,3-dehydro-sialic acid, a 2,7-anhydro-sialic acid, or a derivative thereof).
  • the reactions can be conducted at any suitable temperature. In general, the reactions are conducted at a temperature of from about 4°C to about 40°C. The reactions can be conducted, for example, at about 25°C or about 37°C.
  • the reactions can be conducted at any suitable pH. In general, the reactions are conducted at a pH of from about 4.5 to about 10. The reactions can be conducted, for example, at a pH of from about 5 to about 9. The reactions can be conducted for any suitable length of time.
  • reaction mixtures are incubated under suitable conditions for anywhere between about 1 minute and several hours.
  • the reactions can be conducted, for example, for about 1 minute, or about 5 minutes, or about 10 minutes, or about 30 minutes, or about 1 hour, or about 2 hours, or about 4 hours, or about 8 hours, or about 12 hours, or about 24 hours, or about 48 hours, or about 72 hours, or about 96 hours, or about 120 hours, or about 144 hours, or about 168 hours.
  • Other reaction conditions may be employed in the methods, depending on the identity of a particular sialoside or sialidase.
  • sialosides can be used in the methods disclosed herein, including sialosides according to Formula III, Formula Ilia, Formula IV, and Formula IVa as described above.
  • a sialoside will include at least one sialic acid covalently linked to another carbohydrate moiety or a non-carbohydrate moiety.
  • the covalent linkages generally consist of glycosidic linkages (i.e., C-O-C bonds) formed from a hydroxyl group of the hemiacetal at the sialic acid anomeric carbon and a hydroxyl group of an adjacent sugar or an adjacent non- carbohydrate moiety.
  • Linkages can occur, for example, between the carbon-2 of a sialic acid and the carbon-3 of an adjacent sugar (i.e., a 2-3 linkage).
  • the sialic acid can be linked in the sialoside such that the bond at the anomeric carbon is in the a-configuration.
  • the sialoside is a compound according to Formula III or Formula Ilia, wherein R 6 is a galactoside (e.g., lactose or a lactoside). In some embodiments, R 6 is bonded to the compound via a 2-3 linkage (i.e., between carbon-2 of the sialic acid and carbon-3 of the galactose). In some embodiments, the sialoside is a compound according to Formula IV or Formula IV a, wherein R 16 is a galactoside (e.g., lactose or a lactoside). In some embodiments, R 16 is bonded to the compound via a 2-3 linkage (i.e., between carbon-2 of the sialic acid and carbon-3 of the galactose).
  • R 6 or R 16 is present as a member of an oligosaccharide, a polysaccharide, a glycosylated natural product, a glycopeptide, a glycoprotein, or a glycolipid.
  • Suitable natural products include non-ribosomal glycopeptides (such as bleomycin), glycoalkaloids (such as solanine), ginsenosides (such as sanchinoside CI), aminoglycosides (such as gentamicin, kanamycin, neomycin, and streptomycin), avermectins, and anthracyclines (such as daunorubicin).
  • Suitable glycolipids include glycoglycerolipids (such as monogalactosyldiacylglycerols, digalactosylmonoacylglycerols, and sulfoquinovosyl diacylglycerols), glycosphingolipids (such as lacto-, neolacto-, ganglio-, globo-, and iso- globo-series glycosphingolipids), and glycophosphatidylinositols (e.g., 1-phosphatidyl-L- myo-inositol 2,6-di-O-a-D-mannopyranoside.).
  • Suitable glycoproteins include mucins, immunoglobulins, lectins, and collagens.
  • the sialoside is a compound according to Formula V:
  • R 6a is a monosaccharide, disaccharide or
  • R 6b is a linker, and subscript y is 0 or 1.
  • the linker is selected from Ci-6 alkylene; Ci-6 alkylene-NH-C(0)-Ci-6 alkylene; and Ci-6 alkylene-NH-C(0)-(CH2-(CH2CH 2 0)p-NH-C(0)) m -Ci-6 alkylene, where subscript m is 0 or 1, and subscript p is an integer from 1 to 6.
  • subscript y is 1 and R 6c is Ci-6 alkylene (e.g., ⁇ -propylene), which is optionally substituted with one or more groups selected from halo, hydroxy, amino, azido (i.e., -N3), alkylamino, amido, acyl, nitro, cyano, and alkoxy.
  • Functional groups in sialosides can be modified protecting groups.
  • protecting group refers to a chemical moiety that renders a functional group (e.g., an amino group) unreactive, but is also removable so as to restore the reactive functional group.
  • a functional group e.g., an amino group
  • protecting groups include, but are not limited to,
  • benzyloxycarbonyl (Z or Cbz); 9-fluorenylmethyloxycarbonyl (Fmoc); fert-butyloxycarbonyl (Boc); allyloxycarbonyl (Alloc); / ⁇ -toluene sulfonyl (Tos); 2,2,5,7,8-pentamethylchroman-6- sulfonyl (Pmc); 2,2,4,6,7-pentamethyl-2,3-dihydrobenzofuran-5-sulfonyl (Pbf); mesityl-2- sulfonyl (Mts); 4-methoxy-2,3,6-trimethylphenylsulfonyl (Mtr); acetamido; phthalimido; and the like.
  • Other protecting groups are known to those of skill in the art including, for example, those described by Green and Wuts (Protective Groups in Organic Synthesis, 4 th Ed. 2007, Wiley-Interscience, New
  • the sialoside is a compound according to Formula Va:
  • the sialoside is an ⁇ 2-3-linked sialoside or a derivative thereof.
  • the ⁇ 2- 3-linked sialoside is selected from the group consisting of Neu5Ac ⁇ 2-3Lac, Neu5Gc ⁇ 2- 3Lac, Neu5TFA ⁇ 2-3Lac, Neu5Ac ⁇ 2-3LacbProN 3 , Neu5Ac ⁇ 2-3LacbProNHCbz,
  • the sialoside can be prepared prior to forming the sialic acid product, or prepared in situ immediately prior to formation of the sialic acid product.
  • the methods disclosed herein also include forming a reaction mixture containing an acceptor glycoside, a sialic acid donor, and a sialyltransferase under conditions sufficient to form the sialoside.
  • Sialic acid donors generally include a nucleotide and a sialic acid moiety.
  • Suitable nucleotides include, but are not limited to, adenine, guanine, cytosine, uracil and thymine nucleotides with one, two or three phosphate groups.
  • the nucleotide can be cytidine monophosphate (CMP).
  • CMP cytidine monophosphate
  • the sialic acid donor can contain a number of sialic acid moieties.
  • the method includes contacting an acceptor sugar and a sialyltransferase in the presence of a CMP-sialic acid to form the ⁇ 2-3-linked sialoside.
  • the acceptor sugar is lactose.
  • the lactose is ⁇ - lactose (i.e., -D-galactopyranosyl-(l ⁇ 4)-D-glucose; "Gai i-4Glc”), or a or ⁇ -lactoside (e.g., Gal l-4Glc ProNHCbz, where Pro is -(CH 2 ) 3 ).
  • any suitable sialyltransferase (also referred to as "ST") can be used in the methods for forming the sialosides disclosed herein.
  • the sialyltransferase is selected from the group consisting of PmSTl, a PmSTl variant, PmST2, a PmST2 variant, PmST3, a PmST3 variant, and a polysialyltransferase.
  • the sialyltransferase is PmSTl (NCBI Accession No.
  • the sialyltransferase is PmSTl_M144D or a catalytically active variant thereof.
  • the sialyltransferase comprises the polypeptide sequence set forth in SEQ ID NO:4, or a catalytically active variant thereof.
  • the sialyltransferase is PmST2 (UniProtKB Accession No. Q9CNC4) or a catalytically active variant thereof.
  • PmST2 are variants thereof are described in U.S. Pat. No. 9,102,967, which is incorporated herein by reference in its entirety.
  • the sialyltransferase comprises the polypeptide sequence set forth in SEQ ID NO:5, or a catalytically active variant thereof.
  • the sialyltransferase is PmST3 or a catalytically active variant thereof, as described in U.S. Pat. No. 9,783,838, which is incorporated herein by reference in its entirety.
  • the sialyltransferase is PmST3A35 or a catalytically active variant thereof.
  • the sialyltransferase comprises the polypeptide sequence set forth in SEQ ID NO:6, or a catalytically active variant thereof.
  • the sialyltransferase is PmSTl M144D, having the amino acid sequence set forth in SEQ ID NO:4 or a catalytically active variant thereof.
  • a PmSTl_M144D variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO: 4 is used in the method.
  • the PmSTl_M144D variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO:4.
  • lactose, lactosides, and other acceptors can be used in catalytic amounts for the economic production of the sialic acid products.
  • catalytic it is meant that less than one molar equivalent of the acceptor per molar equivalent of the sialic acid donor is used.
  • reaction mixture may contain an acceptor such as lactose in an amount ranging from about 0.1 mol% to about 50 mol% with respect to the amount of the sialic acid donor.
  • the amount of the acceptor in the reaction mixture can range, for example, from about 1 mol% to about 50 mol%, or from about 5 mol% to about 45 mol%, or from about 10 mol% to about 30 mol%, with respect to the amount of the sialic acid donor.
  • the amount of the acceptor in reaction mixture can be about 5, 10, 15, 20, 25, 30, 35, 40, or 45 mol% with respect to the amount of the sialic acid donor.
  • a sialic acid donor e.g., a CMP-sialic acid
  • the methods also include forming a reaction mixture including a CMP-sialic acid synthetase, cytidine triphosphate, and N-acetylneuraminic acid (Neu5 Ac) or a Neu5 Ac analog, under conditions suitable to form CMP-Neu5Ac or a CMP-Neu5Ac analog.
  • the method further includes contacting a sialic acid and a CMP-sialic acid synthetase in the presence of CTP to form the CMP-sialic acid.
  • CMP-sialic acid synthetases from E. coli, C. thermocellum, S. agalactiae, P. multocida, H. ducreyi, or N. meningitidis can be used.
  • the CMP-sialic acid synthetase is NmCSS (NCBI Accession No. WP_025459740.1) or a catalytically active variant thereof.
  • the CMP-sialic acid synthetase comprises the polypeptide sequence set forth in SEQ ID NO:7 or a catalytically active variant thereof.
  • an NmCSS variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO:7 is used in the method.
  • the NmCSS variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO:7.
  • the CMP-sialic acid synthetase is a purified CMP-sialic acid synthetase as described above with respect to sialidases.
  • Other components e.g., buffers, cosolvents, salts, detergents/surfactants, chelators, and/or reducing agents, as described above
  • the step of forming the sialic acid donor and the step of forming the sialylated product are performed in one pot.
  • the sialic acid moiety of the sialic acid donor is prepared separately prior to use in the methods.
  • the sialic acid moiety can be prepared in situ immediately prior to use in the methods.
  • the methods include forming a reaction mixture including a sialic acid aldolase, pyruvic acid or derivatives thereof, and N-acetylmannosamine or derivatives thereof, under conditions suitable to form Neu5Ac or a Neu5Ac analog.
  • the method further includes contacting a C6-monosaccharide and a sialic acid aldolase in the presence of pyruvate to form to the sialic acid.
  • sialic acid aldolase i.e., N-acetylneuraminate pyruvate lyase, EC 4.1.3.3 can be used in the methods.
  • sialic acid aldolases from ?. coli, L. plantarum, P. multocida, or N. meningitidis can be used.
  • the sialic acid aldolase is PmAldolase (NCBI Accession No. WP_005723432.1) or a catalytically active variant thereof.
  • the sialic acid aldolase comprises the polypeptide sequence set forth in SEQ ID NO: 8, or a catalytically active variant thereof.
  • a PmAldolase variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO: 8 is used in the method.
  • the PmAldolase variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO: 8.
  • the sialic acid aldolase is a purified sialic acid aldolase as described above with respect to sialidases.
  • Other components e.g., buffers, cosol vents, salts, detergents/surfactants, chelators, and/or reducing agents, as described above
  • the step of forming the sialic acid moiety, the step of forming the sialic acid donor, and the step of forming the sialylated product are performed in one pot.
  • the methods disclosed herein can further include one or more chemical transformations in addition to the enzymatic steps described above.
  • one or more of R 1 , R 2 , R 3 , and R 4 in a Sia2en according to Formula I may be an azido group -N 3 , which can be reduced via hydrogenolysis with Pd/C or another suitable catalyst to provide an amino group -NH 2 .
  • Amino groups and/or hydroxyl group in Sia2en products can be acylated to provide the corresponding esters and amides.
  • an amino group R 1 in a compound according to Formula I can be acylated to provide an amide having the formula -NHC(0)R a , wherein R a is Ci-12 alkyl, Ci-12 haloalkyl, C3-10 cycloalkyl, Ce- ⁇ aryl, or C7-22 arylalkyl.
  • Esters and amides can be optionally substituted with one or more independently-selected substituents such as halo, hydroxy, amino, alkylamino, amido, acyl, nitro, cyano, and alkoxy.
  • Acylation can be conducted with a suitable carboxylic acid R a COOH or a reactive carboxylic derivative such as an acid chloride or an activated ester (e.g., an N- hydroxysuccinimidyl ester or a pentafluorophenyl ester).
  • a suitable carboxylic acid R a COOH or a reactive carboxylic derivative such as an acid chloride or an activated ester (e.g., an N- hydroxysuccinimidyl ester or a pentafluorophenyl ester).
  • the carboxylic acid or carboxylic acid derivative can be used with a coupling agent such as a carbodiimide (e.g., NN - dicyclohexylcarbodiimide (DCC), NN -dicyclopentylcarbodiirnide, NN - diisopropylcarbodiimide (DIC), l-ethyl-3-(3-dimethylaminopropyl)carbodiirnide (EDC), N-t- butyl-N-methylcarbodiimide (BMC), N-i-but l-N-ethylcarbodiimide (BEC), l,3-bis(2,2- dimethyl-l,3-dioxolan-4-ylmethyl)carbodiimide (BDDC), etc.), a phosphonium salt (HOBt, PyBOP, HO At, etc.), or an aminium/uronium salt (e.g., tetramethyl amin
  • Amino groups can also be modified via reductive animation.
  • reductive animation conditions refers to conditions suitable for converting an amine - ⁇ 2 to a substituted amine -NHCH(R b )2, wherein one R b is Ci-12 alkyl, Ci-12 haloalkyl, C3-10 cycloalkyl, Ce- ⁇ aryl, or C7-22 arylalkyl and the other R b is hydrogen, Ci-12 alkyl,
  • Reductive animation can be conducted with a suitable aldehyde or ketone R b C(0)R b and a reducing agent such as sodium borohydride, sodium cyanoborohydride, or the like.
  • R 1 , R 2 , R 3 , and R 4 are independently selected from the group consisting of
  • R 5 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)R a , -N3, -NH2, -OC(0)R a , -OH, and hydrogen;
  • each R a is independently selected from the group consisting of optionally substituted Ci-12 alkyl, optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce- ⁇ aryl, and optionally substituted C7-22 arylalkyl;
  • Gc is -C(0)CH 2 OH.
  • R 1 , R 2 , R 3 , and R 4 is other than -OH when R 5 is -NHAc or -NHGc.
  • the compound has a structure according to Formula la:
  • R 1 , R 2 , R 3 , and R 4 are independently selected from the group consisting of -N 3 , -NH 2 , -NHC(0)R a , -NHR a , and -OH in compounds of Formula I or Formula la.
  • R 5 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)CF 3 (i.e., -NHTFA), -OH, and -OAc.
  • R 1 , R 2 , R 3 , and R 4 are independently selected from the group consisting of -N 3 and -OH, and R 5 is -NHAc, -NHGc, or -NHTFA. In some embodiments, R 1 , R 2 , R 3 , and R 4 are independently selected from the group consisting of -NHC(0)R a (e.g., -NHAc) and -OH, and R 5 is -NHAc, -NHGc, or -NHTFA.
  • -NHC(0)R a e.g., -NHAc
  • R 5 is -NHAc, -NHGc, or -NHTFA.
  • At least one of R 1 , R 2 , R 3 , and R 4 is independently -N 3 , -NH 2 , -NHC(0)R a , or -NHR a in compounds of Formula I or Formula la. In some embodiments, at least two of R 1 , R 2 , R 3 , and R 4 are independently -N 3 , -NH 2 , -NHC(0)R a , or -NHR a . In some embodiments, at least three of R 1 , R 2 , R 3 , and R 4 are independently -N 3 , -NH 2 , -NHC(0)R a , or -NHR a .
  • remaining R 1 , R 2 , R 3 , and R 4 groups are independently selected from -OH and -OC(0)R a . In some such embodiments, the remaining R 1 , R 2 , R 3 , and R 4 groups are -OH. In some embodiments, R 1 , R 2 , R 3 , and R 4 are independently -N 3 , -NH 2 , -NHC(0)R a , or -NHR a .
  • R 5 is -NHAc or -NHGc and at least one of R 1 , R 2 , R 3 , and R 4 is independently -N 3 , -NH 2 , or -NHC(0)R a in compounds of Formula I or Formula la.
  • R 5 is -NHAc or -NHGc and at least two of R 1 , R 2 , R 3 , and R 4 are independently -N 3 , -NH 2 , or -NHC(0)R a .
  • R 5 is -NHAc or -NHGc and at least three of R 1 , R 2 , R 3 , and R 4 are independently -N 3 , -NH 2 , or -NHC(0)R a .
  • remaining R 1 , R 2 , R 3 , and R 4 groups are independently selected from -OH and -OC(0)R a .
  • the remaining R 1 , R 2 , R 3 , and R 4 groups are -OH.
  • R 5 is -NHAc or -NHGc and R 1 , R 2 , R 3 , and R 4 are independently -N 3 , -NH 2 , or -NHC(0)R a .
  • R 1 is -NHC(0)R a or -NHR a in compounds of Formula I or Formula la.
  • R a is Ci-12 alkyl or C 3 -io cycloalkyl.
  • R a can be, for example, methyl, ethyl, ⁇ -propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, branched pentyl, «-hexyl, branched hexyl, n-heptyl, branched heptyl, «-octyl, branched oct l, «-nonyl, branched nonyl, «-decyl, branched «-decyl, n-undecyl, branched undecyl, n-dodecyl, branched dodecyl, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, or cyclooctyl.
  • R 3 is selected from the group
  • R 5 is selected from the group consisting of -NHAc, -NHGc, and -NHC(0)R a .
  • R a is C3-10 cycloalkyl.
  • R a can be C3-10 cycloalkyl or C7-22 arylalkyl.
  • R a can be, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, or cyclooctyl.
  • R a can be benzyl (i.e., phenylmethyl), (2-phenyl)ethyl, (3-phenyl)propyl, (2-phenyl)propyl, (4- phenyl)butyl, or the like.
  • the compound is selected from the group consisting of:
  • R 11 , R 12 , and R 14 are independently selected from the group consisting of
  • R 15 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)R a , -N3, -NH 2 , -OC(0)R a , -OH, and hydrogen;
  • R a is selected from the group consisting of optionally substituted Ci-12 alkyl, optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce- ⁇ aryl, and optionally substituted C7-22 arylalkyl;
  • Gc is -C(0)CH 2 OH.
  • At least one of R 11 , R 12 , and R 14 is other than -OH when R 15 is -NHAc or -NHGc.
  • the compound has a structure according to Formula Ila:
  • R 11 , R 12 , and R 14 are independently selected from the group consisting of -N3, -NH2, -NHC(0)R a , -NHR a , and -OH in compounds of Formula II or Formula Ila.
  • R 15 is selected from the group consisting of -NHC(0)R a , -NHAc, -NHGc, -NHTFA, -OH, and -OAc.
  • R 11 , R 12 , and R 14 are independently selected from the group consisting of -N 3 and -OH, and R 15 is -NHC(0)R a -NHAc, -NHGc, or -NHTFA.
  • R 11 , R 12 , and R 14 are independently selected from the group consisting of -NHC(0)R a (e.g., -NHAc) and -OH, and R 15 is -NHAc, -NHGc, or -NHTFA.
  • -NHC(0)R a e.g., -NHAc
  • R 15 is -NHAc, -NHGc, or -NHTFA.
  • At least one of R 11 , R 12 , and R 14 is independently -N 3 , -NH2, -NHC(0)R a , or -NHR a in compounds of Formula II or Formula Ila. In some embodiments, at least two of R 11 , R 12 , and R 14 are independently -N 3 , -NH2, -NHC(0)R a , or -NHR a . In some embodiments, remaining R 11 , R 12 , and R 14 groups are independently selected from -OH and -OC(0)R a . In some such embodiments, the remaining R 11 , R 12 , and R 14 groups are -OH.
  • R 11 , R 12 , and R 14 are independently -N 3 , -NH2, -NHC(0)R a , or -NHR a .
  • R 15 is -NHC(0)R a -NHAc, or -NHGc, and at least one of R 11 , R 12 , and R 14 is independently -N 3 , -NH2, or -NHC(0)R a in compounds of Formula II or Formula Ila.
  • R 15 is -NHC(0)R a -NHAc, or -NHGc, and at least two of R 11 , R 12 , and R 14 are independently -N3, -NH2, or -NHC(0)R a .
  • remaining R 11 , R 12 , and R 14 groups are independently selected from -OH and -OC(0)R a . In some such embodiments, the remaining R 11 , R 12 , and R 14 groups are -OH.
  • R 15 is -NHC(0)R a -NHAc, or -NHGc, and R 11 , R 12 , and R 14 are
  • R 15 is selected from the group consisting of -NHAc, - NHGc, and -NHC(0)R a in compounds of Formula II or Formula Ila.
  • R a is selected from the group consisting of optionally substituted Ci-12 alkyl, optionally substituted Ci-12 haloalkyl, and optionally substituted C3-10 cycloalkyl.
  • R a can be, for example, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, seobutyl, fert-butyl, n- pentyl, branched pentyl, n-hexyl, branched hexyl, n-heptyl, branched heptyl, n-octyl, branched octyl, «-nonyl, branched nonyl, «-decyl, branched «-decyl, n-undecyl, branched undecyl, n-dodecyl, or branched dodecyl.
  • R a can be chloromethyl, dichloromethyl, trichloromethyl, fluoromethyl, difluoromethyl, trifluoromethyl, 2,2,2-trichloroethyl, 2,2,2- trifluoroethyl, pentachloroethyl, pentafluoroethyl, 1,1,1,3,3,3-hexachloropropyl, 1,1,1,3,3,3- hexafluoropropyl, or the like.
  • R a can be cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, or cyclooctyl.
  • the compound is selected from the group consisting of
  • the compound is selected from the group consisting of
  • methods for inhibiting sialidases include contacting the sialidase with an effective amount of a 2-deoxy-2,3-dehydro-sialic acid or a 2,7-anhydro-sialic acid.
  • the sialidase is a microbial sialidase or a viral sialidase.
  • Organisms that contain sialidases include bacteria (including, but not limited to, Vibrio cholerae, Clostridium perfringens, Streptococcus pneumoniae, and Arthrobacter sialophilus) and viruses (including, but not limited to, orthomyxoviruses or paramyxoviruses such as influenza virus A and B, parainfluenza virus, mumps virus,
  • bacteria including, but not limited to, Vibrio cholerae, Clostridium perfringens, Streptococcus pneumoniae, and Arthrobacter sialophilus
  • viruses including, but not limited to, orthomyxoviruses or paramyxoviruses such as influenza virus A and B, parainfluenza virus, mumps virus,
  • the sialidase is SpNanA (NCBI Accession No. WP_010976603.1), SpNanB (NCBI Accession No. NP_359124.1), SpNanC (NCBI Accession No. WP_024478413.1), AuSialidase (NCBI Accession No. WP_062095054.1), CpNanI (NCBI Accession No. WP_011590331.1), CpNanH (UniProtKB Accession No. PI 0481), VcSialidase (NCBI Accession No.
  • WP_001889713.1 BiNanH2 (NCBI Accession No. WP_012578573.1), hNEU2 (GenBank Accession No. CAB41449.1), hNEU3 (GenBank Accession No. AAI36398.1), or variants thereof containing one or more amino acid substitutions, deletions, and/or other peptide sequence variations.
  • Variants may contain, for example, 1-2 amino acid substitutions or deletions, or 1-4 amino acid substitutions or deletions, or 1-10 amino acid substitutions or deletions, or 1-25 amino acid substitutions or deletions.
  • Inhibiting the sialidase generally includes contacting the sialidase with an amount of the compound sufficient to reduce the activity of the sialidase as compared to the sialidase activity in the absence of the compound.
  • contacting the sialidase with the sialidase inhibitor can result in from about 1% to about 99% sialidase inhibition (i.e., the activity of the inhibited sialidase ranges from 99% to 1% of the sialidase activity in the absence of the compound).
  • the level of sialidase inhibition can range from about 1% to about 10%, or from about 10% to about 20%, or from about 20% to about 30%, or from about 30% to about 40%, or from about 40% to about 50%, or from about 50% to about 60%, or from about 60% to about 70%, or from about 70% to about 80%, or from about 80% to about 90%, or from about 90% to about 99%.
  • the level of sialidase inhibition can range from about 5% to about 95%, or from about 10% to about 90%, or from about 20% to about 80%, or from about 30% to about 70%, or from about 40% to about 60%.
  • contacting the sialidase with a 2-deoxy-2,3-dehydro-sialic acid or a 2,7- anhydro-sialic acid will result in essentially complete (i.e., 100%) sialidase inhibition.
  • a method for treating cancer which includes administering an effective amount of a 2-deoxy-2,3-dehydro-sialic acid (e.g., a compound of Formula I as described herein) or a 2,7-anhydro-sialic acid (e.g., a compound of Formula II) to a subject in need thereof.
  • a 2-deoxy-2,3-dehydro-sialic acid e.g., a compound of Formula I as described herein
  • a 2,7-anhydro-sialic acid e.g., a compound of Formula II
  • a method for treating a viral infection or a bacterial infection which includes administering an effective amount of a 2-deoxy-2,3-dehydro-sialic acid (e.g., a compound of Formula I as described herein) or a 2,7- anhydro-sialic acid (e.g., a compound of Formula II) to a subject in need thereof.
  • a 2-deoxy-2,3-dehydro-sialic acid e.g., a compound of Formula I as described herein
  • a 2,7- anhydro-sialic acid e.g., a compound of Formula II
  • Sialidase inhibitors as described herein can be administered at any suitable dose in the methods for disease treatment.
  • a sialidase inhibitor is administered at a dose ranging from about 0.1 milligrams to about 1000 milligrams per kilogram of a subject's body weight (i.e., about 0.1-1000 mg/kg).
  • the dose of sialidase inhibitor can be, for example, about 0.1-1000 mg/kg, or about 1-500 mg/kg, or about 25-250 mg/kg, or about 50-100 mg/kg.
  • the dose of sialidase inhibitor can be about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950 or 1000 mg/kg.
  • the dosages can be varied depending upon the requirements of the patient, the severity of the disorder being treated, and the particular formulation being administered.
  • the dose administered to a patient should be sufficient to result in a beneficial therapeutic response in the patient.
  • the size of the dose will also be determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of the drug in a particular patient.
  • Sialidase inhibitors can be administered for periods of time which will vary depending upon the nature of the particular disorder, its severity, and the overall condition of the subject to whom the sialidase inhibitor is administered. Administration can be conducted, for example, hourly, every 2 hours, three hours, four hours, six hours, eight hours, or twice daily including every 12 hours, or any intervening interval thereof. Administration can be conducted once daily, or once every 36 hours or 48 hours, or once every month or several months. Following treatment, a subject can be monitored for changes in his or her condition and for alleviation of the symptoms of the disorder.
  • the dosage of the sialidase inhibitor can either be increased in the event the subject does not respond significantly to a particular dosage level, or the dose can be decreased if an alleviation of the symptoms of the disorder is observed, or if the disorder has been remedied, or if unacceptable side effects are seen with a particular dosage.
  • a therapeutically effective amount of a sialidase inhibitor can be administered to the subject in a treatment regimen comprising intervals of at least 1 hour, or 6 hours, or 12 hours, or 24 hours, or 36 hours, or 48 hours between dosages. Administration can be conducted at intervals of at least 72, 96, 120, 144, 168, 192, 216, or 240 hours (i.e., 3, 4, 5, 6, 7, 8, 9, or 10 days). In certain embodiments, administration of one or more sialidase inhibitors is conducted in periods ranging from several months to several years.
  • compositions for the administration of sialidase inhibitors including 2-deoxy-2,3-dehydro-sialic acids and 2,7-anhydro-sialic acids as described herein.
  • the pharmaceutical compositions can be prepared by any of the methods well known in the art of pharmacy and drug delivery. In general, methods of preparing the compositions include the step of bringing the active ingredient into association with a carrier containing one or more accessory ingredients.
  • the pharmaceutical compositions are typically prepared by uniformly and intimately bringing the active ingredient into association with a liquid carrier or a finely divided solid carrier or both, and then, if necessary, shaping the product into the desired formulation.
  • the compositions can be conveniently prepared and/or packaged in unit dosage form.
  • the pharmaceutical compositions can be in the form of sterile injectable aqueous or oleaginous solutions and suspensions.
  • Sterile injectable preparations can be formulated using non-toxic parenterally-acceptable vehicles including water, Ringer's solution, and isotonic sodium chloride solution, and acceptable solvents such as 1,3-butane diol.
  • sterile, fixed oils are conventionally employed as a solvent or suspending medium.
  • any bland fixed oil can be employed including synthetic mono- or diglycerides.
  • fatty acids such as oleic acid find use in the preparation of injectables.
  • Aqueous suspensions contain the active materials in admixture with excipients including, but not limited to: suspending agents such as sodium carboxymethylcellulose, methylcellulose, oleagino-propylmethylcellulose, sodium alginate, polyvinyl-pyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents such as lecithin,
  • poly oxy ethylene stearate, and polyethylene sorbitan monooleate and preservatives such as ethyl, ft-propyl, and />-hydroxybenzoate.
  • Oily suspensions can be formulated by suspending the active ingredient in a vegetable oil, for example, arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as liquid paraffin.
  • the oily suspensions can contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol. These compositions can be preserved by the addition of an anti-oxidant such as ascorbic acid.
  • Dispersible powders and granules can contain the active ingredient in admixture with a dispersing agent, wetting agent, suspending agent, or combinations thereof. Additional excipients can also be present.
  • the pharmaceutical compositions can also be in the form of oil-in-water emulsions.
  • the oily phase can be a vegetable oil, for example olive oil or arachis oil, or a mineral oil, for example liquid paraffin or mixtures of these.
  • Suitable emulsifying agents can be naturally- occurring gums, such as gum acacia or gum tragacanth; naturally-occurring phospholipids, such as soy lecithin; esters or partial esters derived from fatty acids and hexitol anhydrides, such as sorbitan monooleate; and condensation products of said partial esters with ethylene oxide, such as polyoxy ethylene sorbitan monooleate.
  • compositions containing the sialidase inhibitors described herein can also be in a form suitable for oral use.
  • suitable compositions for oral administration include, but are not limited to, tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsions, hard or soft capsules, syrups, elixirs, solutions, buccal patches, oral gels, chewing gums, chewable tablets, effervescent powders, and effervescent tablets.
  • Compositions for oral administration can be formulated according to any method known to those of skill in the art. Such compositions can contain one or more agents selected from sweetening agents, flavoring agents, coloring agents, antioxidants, and preserving agents in order to provide pharmaceutically elegant and palatable preparations.
  • Tablets generally contain the active ingredient in admixture with non-toxic pharmaceutically acceptable excipients, including: inert diluents, such as cellulose, silicon dioxide, aluminum oxide, calcium carbonate, sodium carbonate, glucose, mannitol, sorbitol, lactose, calcium phosphate, and sodium phosphate; granulating and disintegrating agents, such as com starch and alginic acid; binding agents, such as polyvinylpyrrolidone (PVP), cellulose, polyethylene glycol (PEG), starch, gelatin, and acacia; and lubricating agents such as magnesium stearate, stearic acid, and talc.
  • inert diluents such as cellulose, silicon dioxide, aluminum oxide, calcium carbonate, sodium carbonate, glucose, mannitol, sorbitol, lactose, calcium phosphate, and sodium phosphate
  • granulating and disintegrating agents such as com starch and alginic acid
  • the tablets can be uncoated or coated, enterically or otherwise, by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period.
  • a time delay material such as glyceryl monostearate or glyceryl distearate can be employed.
  • Tablets can also be coated with a semi-permeable membrane and optional polymeric osmogents according to known techniques to form osmotic pump compositions for controlled release.
  • compositions for oral administration can be formulated as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent (such as calcium carbonate, calcium phosphate, or kaolin), or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium (such as peanut oil, liquid paraffin, or olive oil).
  • an inert solid diluent such as calcium carbonate, calcium phosphate, or kaolin
  • an oil medium such as peanut oil, liquid paraffin, or olive oil
  • sialidase inhibitors described herein can also be administered topically as a solution, ointment, cream, gel, suspension, mouth washes, eye-drops, and the like. Still further, transdermal delivery of the sialidase inhibitors can be accomplished by means of iontophoretic patches and the like. The compound can also be administered in the form of suppositories for rectal administration of the drug. These compositions can be prepared by mixing the drug with a suitable non-irritating excipient which is solid at ordinary
  • an sialidase inhibitor described herein is administered via intraperitoneal injection. In some embodiments, the sialidase inhibitor is administered orally. In some embodiments, the sialidase inhibitor is administered intravenously.
  • Sialidase inhibitors can be administered alone or in combination with one or more additional therapeutically active agents including, but not limited to, additional sialidase inhibitors (e.g., oseltamivir, zanamivir, peramivir, and the like), viral replication inhibitors (e.g., rimantadine and the like), macrolide antibiotics (e.g., erythromycin and the like), cephalosporin antibiotics (e.g., cefuroxime, ceflacor and the like), and fluoroquinolone antibiotics (e.g., ciprofloxacin, moxifloxacin, and the like).
  • additional sialidase inhibitors e.g., oseltamivir, zanamivir, peramivir, and the like
  • viral replication inhibitors e.g., rimantadine and the like
  • macrolide antibiotics e.g., erythromycin and the like
  • cephalosporin antibiotics e.g.
  • Sialidase inhibitors can also be administered in combination with cytotoxic/anti-cancer agents including, but not limited to, angiogenesis inhibitors (e.g., bevacizumab, ranibizumab, and the like), anthracyclines (e.g., doxorubicin, daunorubicin, and the like), platins (e.g., cisplatin, oxaliplatin, carboplatin, and the like), antimetabolites (e.g., 5-fluorouracil, methotrexate, and the like), kinase inhibitors (e.g., erlotinib, gefitinib, and the like), nucleoside analogs (e.g., gemcitabine, cytarabine, and the like), and taxanes (e.g., paclitaxel, docetaxel, and the like).
  • angiogenesis inhibitors e.g., bevacizumab, ranibizumab, and the
  • E. coli electrocompetent DH5a and chemically competent BL21 (DE3) cells were from Invitrogen (Carlsbad, CA).
  • Herculase II Fusion DNA Polymerase was from Agilent Technologies (Santa Clara, CA).
  • T4 DNA ligase and 1 kb DNA ladder were from Promega (Madison, WI).
  • EcoRl and Hind l restriction enzymes and vector plasmid pMAL-c4X were from New England BioLabs (Beverly, MA).
  • GeneJET PCR Purification Kit and GeneJET Plasmid Miniprep Kit were from Thermo Fisher Scientific (Waltham, MA).
  • Ni 2+ -NTA agarose (nickel-nitrilotriaceticacid agarose) was from 5 PRIME (Gaithersburg, MD).
  • Bicinchoninic acid (BCA) protein assay kit was from Pierce Biotechnology Inc. (Rockford, IL). Recombinant sialidases were expressed and purified as reported previously for human cytosolic sialidase hNEU2, as well as bacterial sialidases from Streptococcus pneumoniae (SpNanA, SpNanB, and SpNanC), Pasteurella multocida (PmSTl), Bifidobacterium infantis (BiNanH2). Commercially available bacterial sialidases used included those from
  • Arthrobacter ureafaciens (Prozyme), Clostridium perfringens CpNanI (Sigma-Aldrich) and CpNanH (Prozyme), and Vibrio cholerae (Prozyme).
  • Aspergillus oryzae ⁇ -galactosidase was purchased from Sigma-Aldrich.
  • Pasteurella multocida sialic acid aldolase (PmNanA), Neisseria meningitidis CMP-sialic acid synthetase (NmCSS), and Pas teurella multocida sialyltransferase 1 M144D mutant (PmSTl_M144D) were expressed and purified as described previously.
  • ManNAc N-Acetylmannosamine derivatives N-glycolylmannosamine (ManNGc, 2), 6-azido-6-deoxy-N-acetylmannosamine (ManNAc6N3, 3), 6-acetamido-6- deoxy-N-acetylmannosamine (ManNAc6NAc, 4), 4-deoxy-N-acetylmannosamine
  • DNA sequencing was performed by Genewiz (South Plainfield, NJ). Nuclear Magnetic Resonance (NMR) spectra were recorded in the NMR facility of the University of California, Davis on a Bruker Avance-400 NMR spectrometer (400 MHz for 1 H, 100 MHz for 1 C). Chemical shifts are reported in parts per million (ppm) on the ⁇ scale. High resolution electrospray ionization (ESI) mass spectra were obtained using a Thermo Electron LTQ-Orbitrap Hybrid MS at the Mass Spectrometry Facility at the University of California, Davis.
  • NMR Nuclear Magnetic Resonance
  • ESI electrospray ionization
  • SpNanC was cloned as a N-maltose binding protein (MBP)-fused and C- His6-tagged recombinant protein in pMAL-c4X vector using genomic DNA of Streptococcus pneumoniae TIGR4 (ATCC#BAA-334D-5) as the template for polymerase chain reactions (PCR).
  • MBP N-maltose binding protein
  • PCR polymerase chain reactions
  • the primers used were: forward primer 5'- GATCGAATTCATGAAAAAAAATATT AAAC AATATG-3 ' (EcoW restriction site is underlined) and reverse primer 5 -ACGCAAGC ⁇ AGTGGTGGTGGTGGTGGTG ATTCTTTTTC AG ATCTTC-3' (Hindlll restriction site is underlined and the sequence that encodes the hexahistidine tag is italicized).
  • A26SpNanC- His6 (abbreviated as SpNanC) was cloned as a C-His6-tagged recombinant protein in pET22b(+) vector with N-terminal 26 amino acids truncation using genomic DNA of Streptococcus pneumoniae TIGR4 (ATCC#BAA-334D-5) as the template for polymerase chain reactions (PCR).
  • the primers used were: forward primer 5'-GATCGAATTCGGCTCA GGAGACTGAAACTT-3 ' (EcoRl restriction site is underlined) and reverse primer 5'-ACGC CTCGAGATTCTTTTTC AGATCTTCAATC-3 ' (Xhol restriction site is underlined).
  • PCR was performed in a 50 reaction mixture containing S. pneumonia TIGR4 genomic DNA (10 ng), forward and reverse primers (0.25 ⁇ each), 5 * Herculase reaction buffer (10 ⁇ ), dNTP mixture (0.4 mM), and Herculase II fusion DNA polymerase (1 ⁇ ).
  • the PCR procedure included an initial cycle of 4 min at 95 °C, followed by 35 cycles of 45 s at 95 °C, 45 s at 52 °C, and 2 min at 72 °C. For the final extension, the reaction was held at 72 °C for 10 min.
  • MBP-SpNanC-His6 the resulting PCR product was purified and digested with EcoRl and HindUl restriction enzymes.
  • the purified and digested PCR product was ligated with pre-digested pMAL-c4X vector and transformed into electrocompetent E. coli DH5 ⁇ cells.
  • A26SpNanC-His6 abbreviated as SpNanC
  • the resulting PCR product was purified and digested with EcoRl and Xhol restriction enzymes.
  • the purified and digested PCR product was ligated with pre-digested pET22b(+) vector and transformed into electrocompetent E. coli DH5 ⁇ cells. Selected clones were grown for minipreps and characterization by restriction mapping. DNA sequences were confirmed by DNA sequencing performed by Genewiz (South Plainfield, NJ). [0134] Expression. Positive plasmids were selected and transformed into E. coli BL21
  • the plasmid-bearing E. coli strains were cultured in LB-rich medium (10 g L 1 tryptone, 5 g L 1 yeast extract and 10 g L 1 NaCl) supplemented with ampicillin (100 ⁇ g mL -1 ). Expression of the target protein was achieved by inducing the E. coli culture with 0.5 mM of isopropyl-l-thio- -D-galactopyranoside (IPTG) when OD600 nm reached 0.8 - 1.0 followed by incubating at 20 °C for 20 h with shaking at 190 rpm in a C25KC incubator shaker (New Brunswick Scientific, Edison, NJ).
  • IPTG isopropyl-l-thio- -D-galactopyranoside
  • His6-tagged target proteins were purified from cell lysate. To obtain the cell lysate, cell pellet harvested by centrifugation at 4000 rpm for 50 min was resuspended (25 mL L 1 cell culture) in lysis buffer (100 mM Tris-HCl pH 8.0 with 0.1% Triton X-100). Sonication protocol was 3s (sonication)/3s (rest) for a total of 4 min on ice.
  • Lysed cells were centrifuged at 8,000 rpm for 50 min and the supernatant was collected as the supernatant. Purification of His6-tagged proteins from the lysate was achieved using a Ni 2+ - resin column. The column was pre-equilibrated with 10 column volumes of binding buffer (5 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl pH 7.5) before the lysate was loaded. After washing with 10 column volumes of binding buffer, the protein was eluted with an elution buffer (200 mM imidazole, 0.1 M NaCl, 50 mM Tris-HCl pH 7.5). Fractions containing the purified enzymes were combined and dialyzed against dialysis buffer (20 mM Tris-HCl pH 7.5 with 10% glycerol) and stored at -80 °C.
  • binding buffer 5 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl pH 7.5
  • pH Profile by Capillary Electrophoresis (CE) Assays Enzymatic assays were performed in a 10 reaction mixture containing a buffer (100 mM) with a pH in the range of 5.0-11.0, Neu5Ac ⁇ 2-3Ga NP (2 mM) and SpNanC (10 ng). Buffers used were: MES, pH 5.0-6.5; Tris-HCl, pH 7.0-9.0; N-cyclohexyl-3-aminopropanesulfonic acid (CAPS), pH 10.0. Reactions were allowed to proceed for 30 min at 37 °C and were stopped by adding 10 ⁇ L of cold ethanol to each reaction mixture.
  • CE Capillary Electrophoresis
  • PDA Photodiode Array
  • Reactions were allowed to proceed for 30 min and were stopped by adding 40 ⁇ CAPS buffer (0.5 M, pH 10.5). The amount of the />-nitrophenolate formed was determined by measuring the absorbance of the reaction mixtures at 405 nm using a microtiter plate reader. Reactions with Gal ⁇ NP (0.3 mM) and ⁇ -galactosidase (12 ⁇ g) in Tris-HCl buffer (100 mM, pH 7.0) were used as controls. The amount of excess ⁇ -galactosidase to be used was predetermined to ensure the complete and fast hydrolysis of the Gai /?NP.
  • Sialidase substrate specificity assays were carried out at 37 °C in duplicate in 384-well plates in a final volume of 20 containing the Tris- HCl buffer (100 mM, pH 7.0), SpNanC (2 ⁇ g), a sialoside substrate (0.3 mM), and a ⁇ - galactosidase (12 ⁇ g). Reactions were carried out for 30 min and were stopped by adding the 40 ⁇ . CAPS buffer (0.5 M, pH 10.5).
  • Sia2ens from the corresponding six-carbon precursors of sialic acids, four enzymes were employed (Scheme 3): a sialic acid aldolase from Pasteu -ella multocida (PmAldolase), a CMP-sialic acid synthetase from Neisseria meningitidis (NmCSS), a Pasteurella multocida sialyltransferase 1 mutant (PmSTl_M144D), and SpNanC.
  • PmAldolase catalyzes the formation of sialic acid from its six-carbon monosaccharide precursor and pyruvate.
  • the NmCSS catalyzes the conversion of cytidine 5 '-triphosphate (CTP) and sialic acid for the formation CMP-sialic acid, which was used together with an acceptor such as lactose by PmSTl_M144D for the synthesis of the corresponding ⁇ 2-3- linked sialosides, providing the substrates for SpNanC for the production of the desired Sia2ens.
  • Scheme 3 One-pot four-enzyme (OP4E) synthesis of Sia2ens.
  • SpNanC was cloned in pMAL-c4X vector and expressed as an N-terminal maltose binding protein (MBP)-fused and C-terminal His6-tagged recombinant protein in Escherichia coli BL21(DE3) cells.
  • MBP maltose binding protein
  • Ni 2+ -affinity column purified MBP-SpNanC-His6 showed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) analysis, in addition to a faint band at around 120 kDa with the expected size of the fusion protein, there was a major band at about 80 kDa corresponding to the protein without the MBP-tag.
  • SDS-PAGE sodium dodecyl sulfate polyacrylamide gel electrophoresis
  • the N-terminal 26 aa- truncated protein was re-cloned in pET22b(+) vector as a C-His6-tagged recombinant protein (A26SpNanC-His6).
  • A26SpNanC-His6 a C-His6-tagged recombinant protein
  • About 108 mg Ni 2+ -column purified A26SpNanC-His6 (abbreviated as SpNanC) can be routinely obtained from one liter E. coli culture.
  • sialosides with non-human sialic acid form N-glycolylneuraminic acid (Neu5Gc) and its C-9 derivatives are also suitable substrates for the enzyme.
  • Sialosides containing 2-keto-3-deoxynonulsonic acid (Kdn) or its derivatives with modifications at C-5, or C-9 are not effective substrates of SpNanC.
  • PmAldolase has good activity in the pH range of 6.0-9.0 and wild-type PmSTl maintains good a2-3-sialyltransferase activity in the pH range of 6.0-10.0.
  • a pH of 7.5 with Tris-HCl buffer was chosen for the OPME reaction to balance the pH preference of SpNanC and NmCSS.
  • Neu5Ac2en (6) can be synthesized from ManNAc (1) in 72% yield using the methods described herein.
  • ManNAc or its derivatives (20-300 mg), lactose (0.25 equiv.), sodium pyruvate (8 equiv.), CTP (1.5 equiv.) were dissolved in Tris-HCl buffer (100 mM, pH 7.5, 10-20 mL) containing 20 mM of MgCh. The pH of the solution was further adjusted to 7.5 with 4 M NaOH.
  • PmAldolase 1.5-3.0 mg
  • NmCSS 1.0-2.0 mg
  • PmSTl_M144D 2.0-4.0 mg
  • SpNanC 0.05-0.2 mg
  • ManNAc or its derivatives (20-300 mg), lactose (1.0 equiv.), sodium pyruvate (8 equiv.), CTP (1.5 equiv.) were dissolved in Tris-HCl buffer (100 mM, pH 8.5, 10-20 mL) containing 20 mM of MgCh. The pH of the solution was further adjusted to 8.5 with 4 M NaOH.
  • PmAldolase 1.5-3.0 mg
  • NmCSS 1.0-2.0 mg
  • PmSTl_M144D 2.0-4.0 mg
  • SpNanC 0.05-0.2 mg
  • the one-pot procedure is more time efficient and the reactions are usually completed within a 2-6 hour time frame.
  • the two-step procedure is commonly performed for 12-20 hours in total but can improve the synthetic yield especially for the processes with slow sialoside formation rates.
  • Neu5Ac9NAc2en (9) was 30% or 34% starting from ManNAc without the need of purifying the intermediates of enzymatic reactions.
  • Neu5Ac9N32en (8) containing an C9-azido group was synthesized from ManNAc6N3 (3) in a yield of 61% using the one-step procedure, and 79% with the two-step procedure.
  • Neu5Ac9NAc2en (9) containing a C9-acetamido group was synthesized from ManNAc6NAc (4) in a yield of 63% with the one-step procedure and 71% using the two-step procedure.
  • Neu5Ac9NAc2en (9) is a more stable analog of Neu5Ac90Ac2en and may be a better inhibitor for sialidases that prefer to cleave 9-O-acetyl Neu5Ac.
  • Neu5Ac2en (100.5 mg, 0.3208 mmol) was dissolved in a mixed solvent of FhO/MeOH (7.5 mL/2.5 mL) containing Tris-HCl buffer (100 mM, pH 7.0). SpNanC (8 mg) was added in two portions at an interval of 4 h and the reaction was incubated in an isotherm incubator for 24 h at 37 °C with agitation at 100 rpm. The reaction was quenched by adding the same volume of ice-cold ethanol and incubating at 4 °C for 1 h. The formed precipitates were removed by centrifugation and the supernatant was concentrated.
  • the C9-azido group of Neu5Ac9N32en (8) allows further derivatization to be carried out.
  • the azido group of Neu5Ac9N32en (8) was reduced to a free amino group with 1,3-propanedithiol to produce intermediate 11, after which different groups were installed (Scheme 4).
  • This provided for the preparation of Neu5Ac9NPent2en (12), with an improved selectivity against human NEU1, and Neu5Ac9NCyclopro2en (13), with a higher selectivity against viral sialidases.
  • Reagents and conditions (a) 1,3-propanedithiol, TEA, Py/FhO, 95%; (b) pentanoyl chloride, TEA, THF/H2O, 91%; (c) cyclopropanecarbonyl chloride, TEA, THF/H2O, 85%.
  • the C-5 group of Neu5Ac2en (6) can also be easily derivatized by removal of the N-acetyl group at C-5 using 2 M of sodium hydroxide solution to produce Neu2en (14) with a free amino group at C-5. Selective acylation of the amino group on C-5 afterwards provided the C5-derivatized Sia2ens conveniently (Scheme 5). Neu5Gc2en (7) was again generated by this method. Neu5PhAc2en (15) was also synthesized conveniently. Scheme 5. Derivatization at C-5 of Neu5Ac2en (6).
  • Reagents and conditions (a) 2M NaOH, 75 °C, 90%; (b) 1) Acetoxyacetyl chloride, K2CO3, MeOH, 2) NaOH, 75%; (c) Phenylacetyl chloride, TEA, THF/H2O, 49%.
  • Inhibition assays were carried out in duplicates in 384-well plates in a final volume of 20 containing Neu5Aca2-3Gai >NP (0.3 mM) and ⁇ -galactosidase (12 ⁇ g) with or without inhibitors.
  • the assay conditions varied for different sialidases as described below: SpNanA (0.0015 ⁇ g), NaOAc buffer (100 mM, pH 6.0); SpNanB (0.003 ⁇ g), NaOAc buffer (100 mM, pH 6.0); SpNanC (0.02 ⁇ g), MES buffer (100 mM, pH 6.5); AuSialidase (1.0 mU), NaOAc buffer (100 mM, pH 5.5); CpNanI (2.0 mU), MES buffer (100 mM, pH 5.0); CpNanH (0.5 mU), MES buffer (100 mM, pH 5.0); VcSialidase (1.5 mU), NaCl (150 mM), CaCh (10 mM), NaOAc buffer (100 mM, pH 5.5); PmSTl (34.4 ⁇ g), NaOAc buffer (100 mM, pH 5.5); BiNanH2, NaOAc buffer (100 mM, pH 5.0); hNEU
  • the reactions were incubated for 30 min at 37 °C, and were stopped by adding CAPS buffer (N-cyclohexyl-3-aminopropane sulfonic acid, 40 ⁇ , 0.5 M, pH 10.5).
  • CAPS buffer N-cyclohexyl-3-aminopropane sulfonic acid, 40 ⁇ , 0.5 M, pH 10.5
  • the amount of the /?ara-nitrophenolate formed was determined by measuring the ⁇ 405 ⁇ of the reaction mixtures using a microplate reader.
  • the percentage inhibitions were determined using a concentration of 0.1 mM of each inhibitor, with reactions without inhibitors as controls.
  • IC50 values were tested by varying the concentrations of inhibitors from 0 to 1000 ⁇ to get the concentration-response plots of the inhibitors.
  • the values of IC50 were calculated by the software Grafit 5.0.
  • the obtained compounds were tested as inhibitors against several glycoside hydrolase GH33 family sialidases as described above.
  • the sialidases were categorized based on their protein sequence similarity in the Carbohydrate Active Enzyme (CAZy) database.
  • sialidases include human cytosolic sialidase hNEU2 and several bacterial sialidases including recombinant enzymes cloned from Streptococcus pneumoniae (SpNanA, SpNanB, and SpNanC), Pasteur ella multocida (PmSTl), Bifidobacterium infantis (BiNanH2), as well as commercially available sialidases from Arthrobacter ureafaciens (AuSialidase), Clostridium perfringens (CpNanI, CpNanH), and Vibrio cholerae (VcSialidase).
  • Neu5Ac2en (6) is an overall broad spectrum inhibitor among all compounds tested and had more than 50% inhibition against SpNanA, AuSialidase, CpNanI, VcSialidase, BiNanH2, and hNEU2.
  • Neu5Gc2en (7) was much more selective and had more than 50% inhibition against only VcSialidase and hNEU2 as reported previously.
  • C9-Derivatization of Neu5Ac2en such as Neu5Ac9Ac2en (9),
  • Neu5Ac9NPent2en (12), and Neu5Ac9NCyclopro2en (13) did not affect the percentage inhibition of SpNanA, CpNanI, or BiNanH2 but lower the inhibitory activity against AuSialidase, VcSialidase.
  • the C9-modification of Neu5Ac2en was not well tolerated by hNEU2.
  • C5 -derivatization of Neu5Ac2en by substituting the N-acetyl group with an N-benzylcarbonyl group was only well tolerated by hNEU2, but not by any bacterial sialidases tested.
  • Neu5Ac7deoxy2en 10-10 would be an inhibitor selective against several bacterial sialidases but not hNEU2. Indeed, it retained the inhibitory activity of Neu5Ac2en (6) against SpNanA, AuSialidase, CpNanI.
  • Sia2ens sialidase transition state analog inhibitors 2,3-dehydro-2-deoxy-sialic acids
  • Such compounds can be further derivatized at various positions and can be readily converted stereo-specifically to methyl ⁇ - sialosides as demonstrated for Neu5Ac ⁇ OMe (16).
  • Inhibition studies demonstrated improved selectivity of several Neu5Ac2en (6) derivatives with modifications at C-5 or C-9.
  • Example 5 Sia2en Hydration Using SpNanC
  • the enzymes can be used in a stepwise process, where the SpNanC hydration reaction is carried out and quenched once completed, after which NmCSS and a2-3-sialyltransferase are added to form ⁇ 2-3-linked sialosides.
  • Scheme 7 SpNanC-catalyzed one-pot multienzyme (OPME) synthesis of sialosides from Sia2ens.
  • One-pot multienzyme reaction was carried out in Tris-HCl buffer solution (100 mM, pH 8.5) with N-acetylmannosamine (ManNAc), mannose, or derivatives (100 mM), sodium pyruvate (300 mM), cytidine-5 ' -triphosphate (CTP, 120 mM), MgCh (20 mM), Lactose (25 mM), PmNanA (0.15 mg/mL), NmCSS (0.25 mg/mL) , PmSTl M144D (0.25 mg/mL), SpNanB (0.2 mg/mL). The mixture is incubated at 37 °C for 6 h with shaking.
  • sialidases were expressed and purified as reported previously for human cytosolic sialidase hNEU2, as well as bacterial sialidases from Streptococcus pneumoniae (SpNanA, SpNanB, and SpNanC), Pasteur ella multocida sialyltransferase 1 with ⁇ 2-3-sialidase activity (PmSTl), and Bifidobacterium infantis sialidase BiNanH2.
  • bacterial sialidases used included those from Arthrobacter ureafaciens (Prozyme), Clostridium perfringens CpNanI (Sigma-Aldrich), and Vibrio cholerae (Sigma-Aldrich). Aspergillus oryzae ⁇ -galactosidase was purchased from Sigma- Aldrich.
  • Pasteurella multocida sialic acid aldolase PmNanA
  • Neisseria meningitidis CMP- sialic acid synthetase NmCSS
  • Pasteurella multocida sialyltransferase 1 M144D mutant PmSTl_M144D
  • NMR Nuclear Magnetic Resonance
  • CombiFlash® Rf 200i system Thin layer chromatography (TLC) was performed on silica gel plates (Sorbent Technologies) using anisaldehyde sugar stain for detection. Gel filtration chromatography was performed with a column (100 cm ⁇ 2.5 cm) packed with Bio-Gel P-2 Fine resins (Bio-Rad). All reagents were at least of reagent grade and were used as supplied without further purification unless indicated.
  • ManNAc 1.0 g
  • ManNTFA 300 mg
  • lactose 0.5 equiv.
  • sodium pyruvate 5 equiv.
  • CTP 1.5 equiv.
  • Tris-HCl buffer 100 mM, pH 7.5, 100 or 20 mL
  • the pH of the solution was further adjusted to 7.5 with 4 M NaOH.
  • PmAldolase 8.0 or 4.0 mg
  • NmCSS 4.0 or 2.0 mg
  • PmSTl_M144D 8.0 or 4.0 mg
  • SpNanB 4.0 or 2.0 mg
  • the reaction was quenched by adding the same volume of ice-cold ethanol and incubating at 4 °C for 1 h.
  • the formed precipitates were removed by centrifugation and the supernatant was concentrated.
  • the residue was purified gradually by passing it through a BioGel P-2 gel filtration column, a silica column
  • Sialidase Inhibition assays were carried out in duplicates in 384- well plates in a final volume of 20 ⁇ L containing Neu5Aco2-3GaiP/?NP (0.3 mM) and ⁇ - galactosidase (12 ⁇ g) with or without inhibitors.
  • the assay conditions varied for different sialidases as described below: SpNanA (0.0015 ⁇ g), NaOAc buffer (100 mM, pH 6.0);
  • SpNanB (0.003 ⁇ g), NaOAc buffer (100 mM, pH 6.0); SpNanC (0.01 ⁇ g), MES buffer (100 mM, pH 6.5); AuSialidase (1.0 mU), NaOAc buffer (100 mM, pH 5.5); CpNanI (1.3 mU), MES buffer (100 mM, pH 5.0); VcSialidase (0.57 mU), NaCl (150 mM), CaCh (10 mM), NaOAc buffer (100 mM, pH 5.5); PmSTl (0.4 ⁇ g), CMP (0.4 mM), NaOAc buffer (100 mM, pH 5.5); BiNanH2 (0.029 ⁇ g), NaOAc buffer (100 mM, pH 5.0); hNEU2 (1.2 ⁇ g), MES buffer (100 mM, pH 5.0).
  • the reactions were incubated for 30 min at 37 °C, and were stopped by adding CAPS buffer (N-cyclohexyl-3-aminopropane sulfonic acid, 40 ⁇ L, 0.5 M, pH 10.5).
  • CAPS buffer N-cyclohexyl-3-aminopropane sulfonic acid, 40 ⁇ L, 0.5 M, pH 10.5
  • the amount of the para-nitrophenolate formed was determined by measuring the A405 nm of the reaction mixtures using a microplate reader.
  • ICso values were obtained by varying the concentrations of inhibitors from 0 to 1000 ⁇ to get the concentration-response plots of the inhibitors.
  • the values of ICso were calculated by the software Grafit 5.0.
  • Mass spectroscopy showed a m/z value of 333.1051, corresponded to 7-azido-Neu5Ac (7N3Neu5Ac). Monitoring the reaction by NMR also confirmed Neu5Ac7N3 as the product. This indicates that in the case of substrates baring 7-modified sialic acids, SpNanB can catalyze the hydrolysis of 7-modified sialosides directly in the absence of a 7-OH required for intramolecular trans-sialidase reaction.
  • the 2,7-anhydro-Neu5Ac hydrolysis activity of SpNanB is a concern since SpNanB might hydrolyze the 2,7-anhydro-Neu5cyclohexyl inhibitor.
  • no hydrolysis activity was observed when 2,7-anhydro-Neu5cyclohexyl was incubated with SpNanB under the same condition used for the hydrolysis of 2,7-anhydro-Neu5Ac.
  • the bacterial sialidases tested include recombinant sialidases cloned from Streptococcus pneumoniae (SpNanA, SpNanB, and SpNanC), Pasteurella multocida sialyltransferase with ⁇ 2-3-sialidase activity (PmSTl), Bifidobacterium infantis sialidase BiNanH2, as well as commercially available sialidases from Arthrobacter ureafaciens (AuSialidase), Clostridium perfringens (CpNanI), and Vibrio cholerae (VcSialidase). Recombinant human cytosolic sialidase hNEU2 was also tested.
  • 2,7-anhydro-Neu5cyclohexyl did show effective inhibitory activity against SpNanB, as well as weak inhibition against SpNanA.
  • 2,7- anhydro-Neu5cyclohexyl also showed inhibition against SpNanC.
  • 2,7-anhydro- Neu5TFA the intermediate designed for the synthesis of 2,7-anhydro-Neu5cyclohexyl, also showed moderate inhibitory activity against SpNanA, AuSialidase, and weak inhibition against SpNanB and VcSialidase.
  • Table 7 Percentage inhibition (%) of 2,7-anhydro-sialic acids (1-4) (1 mM of each inhibitor was used) against bacterial and human sialidases.
  • IC50 values were obtained (Table 8).
  • a novel one-pot multienzyme (OPME) strategy was developed for preparative and gram-scale synthesis of 2,7-anhydro-sialic acids. These 2,7-anhydro-sialic acids were screened as sialidase inhibitors. The rationally designed inhibitor 2,7-anhydro- Neu5cyclohexyl (2-4) showed inhibition against both SpNanB and SpNanC. This study demonstrated a new idea of exploring the family of 2,7-anhydro-sialic acids as sialidase inhibitors.
  • the one-pot multienzyme (OPME) procedures allow the production of 2,3-dehydro- 2-deoxy-sialic acids (Sia2ens) and 2,7-anhydro-sialic acids directly from Neu5 Ac, ManNAc, or derivatives and the use of only catalytic amount of the acceptor (e.g. lactose).
  • the purification procedures for certain products were found to be tedious and multiple column purification processes may be necessary to obtain pure compounds in some cases.
  • an improved two-step OPME procedure has been developed.
  • a hydrophobic chromophore or fluorophore is attached to the acceptor to allow easy purification by C18-cartridge or C18-columns.
  • Both carboxybenzyl (Cbz)-protected propyl amine and fluorenylmethyloxycarbonyl (Fmoc)-protected propyl amine were tested as the tag for the acceptor (e.g., lactosides) and both worked well.
  • Cbz protecting group is particularly stable during the reaction and purification processes and was chosen for the large-scale production of 2,7-anhydro-Neu5Ac.
  • the synthesis of other 2,7- anhydro-sialic acids and 2,3-dehydro-2-deoxy-sialic acids (Sia2ens) can be performed similarly.
  • the ⁇ 2-3 -linked sialosides (Neu5Ac ⁇ 2-3Lac ⁇ ProNHCbz 5 and Neu5Ac ⁇ 2-3Lac ⁇ ProNHFmoc 6) can be used in SpNanB-catalyzed reaction for the formation of desired 2,7-anhydro-Neu5Ac (1) in high yields.
  • both sialoside product and lactoside can be readily separated from each other and from other components of the enzymatic reaction by passing a C18-cartridge.
  • 2,7-anhydro-Neu5Ac (1) is readily eluted from the C18-cartridge to obtain pure product.
  • step 1 or step 2 of the next round of the reaction can be readily purified and reused in step 1 or step 2 of the next round of the reaction.
  • step 1 + step 2 Each round of reactions (step 1 + step 2) efficiently convert Neu5Ac and CTP to 2,7-anhydro-Neu5Ac (1), CMP, and pyrophosphate (PPi) while both lactoside and sialoside are recycled.
  • the two-step synthesis scheme can be repeated multiple time in large scales (e.g., gram-scale), and each time produces pure 2,7-anhydro-Neu5Ac (1) with easy purification procedures.
  • Three experiments were performed to demonstrate the efficiency of the method with lactoside Lac ⁇ ProNHCbz 3 as the sialyltransferase acceptor. Experiments 1 and 2 shown below use a slight excess of Neu5Ac while Experiment 3 uses a slight excess of lactoside.
  • Step 1 One-pot two-enzyme synthesis of Neu5Ac ⁇ 2-3Lac ⁇ ProNHCbz (5) using an excess of Neu5Ac.
  • TLC thin-layer chromatography
  • Step 2 Formation of 2,7-anhydro-Neu5 Ac (7) from Neu5 Ac ⁇ 2-3Lac ⁇ ProNHCbz (5) by SpNanB-catalyzed reaction.
  • OPME one- pot multienzyme
  • Step 1 After the first 2-step one-pot multienzyme (OPME) cycle was complete, the recovered Lac ⁇ ProNHCbz (3) (870 mg, 1.63 mM) was used in the one-pot two-enzyme synthesis of Neu5Ac ⁇ 2-3Lac ⁇ ProNHCbz (5, 1.28 g, 1.55 mM) with 95% yield, which combined with 117 mg Neu5Ac ⁇ 2-3Lac ⁇ ProNHCbz (5) recycled from Experiment 1 totaled 1.38 g.
  • OPME one-pot multienzyme
  • Step 2 Neu5Ac ⁇ 2-3Lac ⁇ ProNHCbz (5, 1.38 g, 1.68 mM) was used in a SpNanB- catalyzed reaction for the formation of 2,7-anhydro-Neu5Ac (1, 450 mg) and
  • Lac ⁇ ProNHCbz (3, 820 mg). A yield of 92% was obtained for the production of the desired target 2,7-anhydro-Neu5Ac (1). The remaining unreacted Neu5Ac ⁇ 2-3Lac ⁇ ProNHCbz (5,
  • Step 1 One-pot two-enzyme synthesis of Neu5Ac ⁇ 2-3Lac ⁇ ProNHCbz (5) using a slightly excess amount of lactoside Lac ⁇ ProNHCbz (3).
  • TLC thin-layer chromatography
  • HRMS electrospray ionization
  • Lac ⁇ ProNHCbz (3) was eluted from the column at 20% ACN.
  • One of the advantages of this one-pot two-enzyme synthesis of Neu5Ac ⁇ 2-3Lac ⁇ ProNHCbz (5) is that Neu5Ac (2) is efficiently converted to Neu5Ac ⁇ 2-3Lac ⁇ ProNHCbz (5), and the excess Lac ⁇ ProNHCbz (3) can be recovered and reused.
  • Neu5Ac ⁇ 2-3Lac ⁇ ProNHCbz (5) can be used in the second step to produce 2,7-anhydro-Neu5Ac (1).
  • Step 2 Formation of 2,7-anhydro-Neu5Ac (7) from Neu5 Ac ⁇ 2-3Lac ⁇ ProNHCbz (5) by SpNanB-catalyzed reaction.
  • a method for forming a sialic acid product selected from the group consisting of a 2-deoxy-2,3-dehydro-sialic acid, a 2,7-anhydro-sialic acid, and derivatives thereof, the method comprising:
  • reaction mixture comprising a glycoside acceptor, a sialic acid donor, and a sialyltransferase
  • sialic acid product is a 2- deoxy-2,3-dehydro-sialic acid or a derivative thereof.
  • sialic acid product is a 2,7- anhydro-sialic acid or a derivative thereof.
  • Streptococcus pneumoniae sialidase is SpNanB having the amino acid sequence set forth in SEQ ID NO:3, or a catalytically active variant thereof.
  • ⁇ 2-3-linked sialoside is selected from the group consisting of Neu5Ac ⁇ 2-3Lac, Neu5Gc ⁇ 2-3Lac, Neu5TFA ⁇ 2- 3Lac, Neu5Ac ⁇ 2-3Lac ⁇ ProN 3 , Neu5Gc ⁇ 2-3Lac ⁇ ProN 3 , Neu5TFA ⁇ 2-3Lac ⁇ ProN 3 , Neu5Ac ⁇ 2-3Lac ⁇ ProNHCbz, Neu5Gc ⁇ 2-3Lac ⁇ ProNHCbz, Neu5TFA ⁇ 2- 3Lac ⁇ ProNHCbz, Neu5Ac ⁇ 2-3Lac ⁇ ProNHFmoc, Neu5Gc ⁇ 2-3Lac ⁇ ProNHFmoc, Neu5TFA ⁇ 2-3Lac ⁇ ProNHFmoc, and derivatives thereof.
  • glycoside acceptor is lactose or a lactoside.
  • reaction mixture comprises a catalytic amount of the glycoside acceptor.
  • sialyltransferase is PmSTl_M144D comprising the amino acid sequence set forth in SEQ ID NO: 4 or a catalytically active variant thereof.
  • sialic acid aldolase is PmAldolase comprising the amino acid sequence set forth in SEQ ID NO: 8 or a catalytically active variant thereof.
  • R 1 , R 2 , R 3 , and R 4 are independently selected from the group consisting of
  • R 5 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)R a , -N 3 , -NH 2 ,
  • each R a is independently selected from the group consisting of optionally substituted Ci-12 alkyl, optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce- ⁇ aryl, and optionally substituted C7-22 arylalkyl;
  • Gc is -C(0)CH 2 OH
  • R 1 , R 2 , R 3 , and R 4 is other than -OH when R 5 is -NHAc or -NHGc.
  • R 11 , R 12 , and R 14 are independently selected from the group consisting of
  • R 15 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)R a , -N3, -NH 2 , -OC(0)R a , -OH, and hydrogen;
  • R a is selected from the group consisting of optionally substituted Ci-12 alkyl
  • Ci-12 haloalkyl optionally substituted C3-10 cycloalkyl, optionally substituted Ce- ⁇ aryl, and optionally substituted C7-22 arylalkyl;
  • Gc is -C(0)CH 2 OH
  • R 11 , R 12 , and R 14 is other than -OH when R 15 is -NHAc or -NHGc.
  • a pharmaceutical composition comprising a compound according to any one of embodiments 23-34 and a pharmaceutically acceptable excipient.
  • a method of inhibiting a sialidase comprising contacting the sialidase with an effective amount of a compound according to any one of embodiments 23-34
  • NmCSS NCBI Accesion No. WP_025459740.1

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

New 2-deoxy-2,3-dehydro-sialic acids and 2,7-anhydro-sialic acids, which are useful as sialidase inhibitors, and enzymatic methods for preparing them are disclosed. The methods include forming a reaction mixture comprising a glycoside acceptor, a sialic acid donor, and a sialyltransferase; maintaining the reaction mixture under conditions sufficient to form a sialoside; and contacting the sialoside with a Streptococcus pneumoniae sialidase to form the sialic acid product. Methods for the inhibition and sialidases and the treatment of cancer and infectious diseases are also disclosed.

Description

SIALIDASE INHIBITORS AND PREPARATION THEREOF CROSS REFERENCES TO RELATED APPLICATIONS
[0001] The present application claims priority to U.S. Provisional Pat. Appl. No.
62/491,038, filed on April 27, 2017, and U.S. Provisional Pat. Appl. No. 62/542,540, filed on August 8, 2017, which applications are incorporated herein by reference in their entirety.
STATEMENT AS TO RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED RESEARCH AND DEVELOPMENT
[0002] This invention was made with government support under Grant Nos. R01 AI130684 and U01GM120419 awarded by the National Institutes of Health. The government has certain rights in the invention.
BACKGROUND OF THE INVENTION
[0003] Microbial sialidases are important targets for designing anti-viral and anti-bacterial drugs. Sialic acids are common terminal monosaccharides on the carbohydrate moieties of mammalian cell surface glycoconjugates and play important biological roles. Sialidases or neuraminidases, the exoglycosidases that catalyze the cleavage of the terminal sialic acids, are widely spread in vertebrates and microbes residing in or infecting vertebrates. Viral and bacterial sialidases are therefore attractive targets for designing inhibitors as potent antimicrobial therapeutics.
[0004] Sialidase transition state analog inhibitor 2-deoxy-2,3-dehydro-N-acetylneuraminic acid (Neu5Ac2en, DANA) has played a leading role in developing clinically used anti- influenza virus drugs. It was also a lead compound for rational design of clinical anti- influenza virus drugs Relenza (Zanamivir or 4-deoxy-4-guanidino-Neu5Ac2en) and Tamiflu (Oseltamivir). Numerous 2,3-dehydro-2-deoxy-sialic acids (Sia2ens) have been synthesized according to previously reported chemical methods. Chemical modification of selectively protected sialic acids is a common strategy to obtain Sia2ens, which is considered too environmentally unfriendly as organic solvents are used. It also requires multiple protection and deprotection steps.
BRIEF SUMMARY OF THE INVENTION
[0005] In some embodiments, there is provided a method for forming a sialic acid product selected from the group consisting of a 2-deoxy-2,3-dehydro-sialic acid, a 2,7-anhydro-sialic acid, and derivatives thereof. The method includes: forming a reaction mixture comprising a glycoside acceptor, a sialic acid donor, and a sialyltransferase; maintaining the reaction mixture under conditions sufficient to form a sialoside; and contacting the sialoside with a Streptococcus pneumoniae sialidase to form the sialic acid product. [0006] In some embodiments, SpNanC is used for forming 2-deoxy-2,3-dehydro-sialic acids. In some embodiments, SpNanB is use for forming 2,7-anhydro-sialic acids.
[0007] In some embodiments, the method further includes contacting a sialic acid and a CMP-sialic acid synthetase in the presence of CTP to form a CMP-sialic acid for use as the sialic acid donor. In some embodiments, the method further includes contacting a
C6-monosaccharide and a sialic acid aldolase in the presence of pyruvate to form to the sialic acid. In some embodiments, forming the sialic acid, forming the CMP-sialic acid, forming the sialoside, and forming the sialic acid product are conducted in one pot.
[0008] Compounds accordin to Formula I, and salts thereof, are also provided:
Figure imgf000004_0001
For compounds of Formula I:
R1, R2, R3, and R4 are independently selected from the group consisting of
-NHC(0)Ra, -N3, -NH2, -NHRa, -OC(0)Ra, -OH, and hydrogen;
R5 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)Ra, -N3, -NH2, -OC(0)Ra, -OH, and hydrogen;
each Ra is independently selected from the group consisting of optionally substituted
Ci-12 alkyl, optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce-ιο aryl, and optionally substituted C7-22 arylalkyl;
Ac is -C(0)CH3; and Gc is -C(0)CH2OH;
provided that at least one of R1, R2, R3, and R4 is other than -OH when R5 is -NHAc or -NHGc.
[0009] Compounds of Formula II and salts thereof, are also provided:
Figure imgf000005_0001
For compounds of Formula II:
R11, R12, and R14 are independently selected from the group consisting of
-NHC(0)Ra, -N3, -NH2, -NHRa, -OC(0)Ra, -OH, and hydrogen;
R15 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)Ra, -N3, - H2, -OC(0)Ra, -OH, and hydrogen;
Ra is selected from the group consisting of optionally substituted Ci-12 alkyl,
optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce-ιο aryl, and optionally substituted C7-22 arylalkyl; Ac is -C(0)CH3; and
Gc is -C(0)CH2OH;
provided that at least one of R11, R12, and R14 is other than -OH when R15 is -NHAc or -NHGc.
[0010] Compounds of Formula I and Formula II can be used as sialidase inhibitors, as well as for the study of sialidase activity and for the chemical or chemoenzymatic synthesis of sialosides.
BRIEF DESCRIPTION OF THE DRAWINGS
[0011] FIG. 1 shows the pH profile of SpNanC using Neu5Acα2-3Ga NP as the substrate. Buffers used: MES, pH 5.0-6.5; Tris-HCl, pH 7.0-9.0; CAPS, pH 10.0.
[0012] FIG. 2 shows the effects of Mg2+, EDTA and DTT on the sialidase activity of SpNanC when Neu5Acα2-3Gai /?NP was used as a substrate. [0013] FIG. 3 shows the temperature profile of SpNanC using Neu5Acα2-3Gai /?NP as the substrate. The assay was done at temperatures ranging from 4 °C to 60 °C. Reactions were allowed to proceed in MES buffer (pH 6.5, 100 mM) for 10 min.
[0014] FIG. 4 shows one embodiment of a procedure for one-pot, multi-enzyme synthesis of 2-deoxy-2,3-dehydro-sialic acids according to the present disclosure.
DETAILED DESCRIPTION OF THE INVENTION
I. Introduction
[0015] Taking advantage of the unique Neu5Ac2en-forming property of Streptococcus pneumoniae sialidase SpNanC, an effective one-pot multienzyme (OPME) strategy has been developed to directly access Neu5Ac2en and its C-5, C-9, and C-7 derivatives from N- acetylmannosamine (ManNAc) and derivatives. In this OPME synthesis, sialosides are synthesized from simple carbohydrate precursors using a sialic acid aldolase (e.g.,
PmAldolase), a CMP-sialic acid synthetase (e.g., NmCSS), and a sialyltransferase (e.g., PmSTl_M144D). The sialosides are then utilized by SpNanC to produce 2-deoxy-2,3- dehydro-sialic acids (Sia2ens).
[0016] Using the methods described herein, the synthesis of Sia2ens can be completed in one pot starting directly from the corresponding sialic acids or their six-carbon precursors. This method provides a fast and efficient access to a library of Sia2ens. An inexpensive sialyltransferase acceptor such as lactose can be used in a catalytic amount for the production of Sia2en, which allows the economic production of the desired Sia2en inhibitors in an environmentally friendly way.
[0017] Alternatively, the reaction can be carried out in two steps. In the first step, a one- pot, multi-enzyme sialylation reaction can be performed to form a sialoside a lactoside tagged with a hydrophobic aglycon to allow easy purification of the product. In the second step, the purified sialoside is used as the substrate for SpNanC-catalyzed reaction for the production of Sia2en. The tagged sialoside and the corresponding tagged lactoside product can be easily separated from Sia2en produced by SpNanC using reverse phase chromatography (e.g., using a CI 8 cartridge or column).
[0018] In addition, the 2,7-anhydro-sialic acid-forming property of S. pneumoniae sialidase SpNanB can be leveraged in an effective one-pot multienzyme (OPME) strategy for obtaining direct access to 2,7-anhydro-Sia and its C-5, C-9, and C-7 derivatives from N- acetylmannosamine (ManNAc) and derivatives. Sialosides are synthesized using the multi- enzyme strategy described above, and they can then be utilized by SpNanB to produce 2,7- anhydro-sialic acids (2,7- anhydro-Sias).
[0019] A two-step reaction can also be performed to allow easy production and separation of the 2,7-anhydro-Sias. In the first step, a one-pot, multi-enzyme sialylation reaction can be performed to form a sialoside a lactoside tagged with a hydrophobic aglycon to allow easy purification of the product. In the second step, the purified sialoside is used as the substrate for SpNanB-catalyzed reaction for the production of 2,7-anhydro-Sias. The tagged sialoside and the corresponding tagged lactoside product can be easily separated from 2,7-anhydro- Sias produced by SpNanB using reverse phase chromatography (e.g., using a CI 8 cartridge or column).
II. Definitions
[0020] As used herein, the term "sialic acid" refers to N- and O-substituted derivatives of neuraminic acid (i.e., N- and O-substituted derivatives of 5-amino-2-keto-3,5-dideoxy-D- glycero-D-galactononulosonic acid— also referred to as (4S,5R,6R,7S,8R)-5-amino-4,6,7,8,9- pentahydroxy-2-oxo-nonanoic acid). Sialic acids include, but are not limited to, N-acetyl neuraminic acid (Neu5Ac), N-glycolyl neuraminic acid (Neu5Gc), and 2-keto-3-deoxy-D- glycero-D-galactonononic acid (KDN), as well as O-acetyl, O-lactyl, O-methyl, O-sulfate and O-phosphate derivatives. [0021] The terms "2-deoxy-2,3-dehydro-sialic acid" and "Sia2en" refer to sialic acids having a double bond between C2 and C3 of the neuraminic acid core. Sia2ens include, but are not limited to, compounds of Formula I as described herein.
[0022] The term "2,7-anhydro-sialic acid" refers to sialic acids wherein the C2 and C7 of the pyranose form of the neuraminic acid core are linked via an oxygen atom. 2,7-Anhydro- sialic acids include, but are not limited to, compounds of Formula II as described herein.
[0023] As used herein, the term "glycoside" refers to a saccharide compound having a moiety "-OR" replacing a hydroxyl group of the hemiacetal at the anomeric carbon of the cyclic form of the parent compound, wherein R is another saccharide (e.g., a monosaccharide, oligosaccharide, or polysaccharide) or a non-saccharide moiety (e.g., a lipid, a protein, a peptide, a linker moiety, a label moiety, etc.). A "glycoside acceptor" refers to a glycoside which is used for further elaboration via covalent modification with another saccharide moiety such as a sialic acid.
[0024] A "sialoside" refers to a sialic acid pyranose moiety wherein a hydroxyl group of the hemiacetal at the anomeric carbon (i.e., carbon 2) of the cyclic form of the parent compound is replaced with a moiety -OR as described above. Sialosides include, but are not limited to, sialyl lactose, sialyl lactosides, sialyl Tn antigen, and sialyl Lewisx.
[0025] As used herein, the term "sialidase" refers to an enzyme that catalyzes the cleavage of a terminal sialic acid from a sialylated substrate (i.e., a sialoside) such as an
oligosaccharide, a polysaccharide, a glycosylated protein, a glycosylated lipid, a glycosylated small molecule, or a glycosylated peptide.
[0026] As used herein, the term "sialyltransferase" refers to an enzyme that catalyzes the transfer of a sialic acid residue from a sialic acid donor (e.g., a sialic acid nucleotide donor) to an acceptor such as an oligosaccharide, a polysaccharide, a glycosylated protein, a glycosylated lipid, a glycosylated small molecule, or a glycosylated peptide. [0027] As used herein, the term "CMP-sialic acid synthetase" refers to a polypeptide that catalyzes the synthesis of cytidine monophosphate sialic acid (CMP-sialic acid) from cytidine triphosphate (CTP) and sialic acid.
[0028] As used herein, the term "sialic acid aldolase" refers to an aldolase that catalyzes a reversible reaction that converts a suitable hexosamine, hexose, pentose, or derivative (such as N-acetyl mannosamine) to sialic acid via reaction with pyruvate.
[0029] As used herein, the term "lactose" refers to -D-galactopyranosyl-(l→4)-D-glucose (i.e., β-lactose) and isomers thereof such as a-lactose.
[0030] As used herein, the term "lactoside" refers to refers to a disaccharide derivative wherein a hydroxyl group of the hemiacetal at the anomeric carbon (carbon 1) of
glucopyranose in lactose is replaced with a moiety -OR, as described above. In some embodiments, R is a non-sugar structure such as propyl azide, carboxybenzyl (Cbz)-protected propyl amine, fluorenylmethyloxycarbonyl (Fmoc)-protected propyl amine, or the like.
[0031] As used herein, the term "pyruvate" refers to the anion of 2-oxopropanoic acid having the formula CH3C(0)C(0)0". One of skill in the art will appreciate that pyruvate can be provided in reactions mixtures as the protonated acid or a salt such as sodium pyruvate. [0032] As used herein, the term "alkyl," by itself or as part of another substituent, refers to a straight or branched, saturated, aliphatic radical having the number of carbon atoms indicated. Alkyl can include any number of carbons, such as C1-2, C1-3, C1-4, C1-5, Ci-6, C1-7, Ci-8, Ci-9, Ci-io, C2-3, C2-4, C2-5, C2-6, C3-4, C3-5, C3-6, C4-5, C4-6 and C5-6. For example, Ci-6 alkyl includes, but is not limited to, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, hexyl, etc. Alkyl can also refer to alkyl groups having up to 20 carbons atoms, such as, but not limited to heptyl, octyl, nonyl, decyl, etc. Alkyl groups can be substituted or unsubstituted. Unless otherwise specified, "substituted alkyl" groups can be substituted with one or more groups selected from halo, hydroxy, amino, alkylamino, ami do, acyl, nitro, cyano, and alkoxy.
[0033] As used herein, the term "alkylene" refers to an alkyl group, as defined above, linking at least two other groups (i.e., a divalent alkyl radical). The two moieties linked to the alkylene group can be linked to the same carbon atom or different carbon atoms of the alkylene group. [0034] As used herein, the term "haloalkyl," by itself or as part of another substituent, refers to an alkyl group where some or all of the hydrogen atoms are replaced with halogen atoms. As for alkyl groups, haloalkyl groups can have any suitable number of carbon atoms, such as Ci-6. For example, haloalkyl includes trifluoromethyl, fiuoromethyl, etc. In some instances, the term "perfluoro" can be used to define a compound or radical where all the hydrogens are replaced with fluorine. For example, perfiuoromethyl refers to
1,1,1 -trifluoromethyl.
[0035] As used herein, the term "cycloalkyl," by itself or as part of another substituent, refers to a saturated or partially unsaturated, monocyclic, fused bicyclic or bridged poly cyclic ring assembly containing from 3 to 12 ring atoms, or the number of atoms indicated.
Cycloalkyl can include any number of carbons, such as C3-6, C4-6, C5-6, C3-8, C4-8, C5-8, Ce-8, C3-9, C3-10, C3-11, and C3-12. Saturated monocyclic cycloalkyl rings include, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and cyclooctyl. Saturated bicyclic and poly cyclic cycloalkyl rings include, for example, norbornane, [2.2.2] bicyclooctane, decahydronaphthalene and adamantane. Cycloalkyl groups can also be partially unsaturated, having one or more double or triple bonds in the ring. Representative cycloalkyl groups that are partially unsaturated include, but are not limited to, cyclobutene, cyclopentene, cyclohexene, cyclohexadiene (1,3- and 1,4-isomers), cycloheptene, cycloheptadiene, cyclooctene, cyclooctadiene (1,3-, 1,4- and 1,5 -isomers), norbomene, and norbornadiene. When cycloalkyl is a saturated monocyclic C3-8 cycloalkyl, exemplary groups include, but are not limited to cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl and cyclooctyl. When cycloalkyl is a saturated monocyclic C3-6 cycloalkyl, exemplary groups include, but are not limited to cyclopropyl, cyclobutyl, cyclopentyl, and cyclohexyl. Cycloalkyl groups can be substituted or unsubstituted. Unless otherwise specified, "substituted cycloalkyl" groups can be substituted with one or more groups selected from halo, hydroxy, amino, alkylamino, amido, acyl, nitro, cyano, and alkoxy. The term "lower cycloalkyl" refers to a cycloalkyl radical having from three to seven carbons including, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and cycloheptyl.
[0036] As used herein, the term "aryl," by itself or as part of another substituent, refers to an aromatic ring system having any suitable number of carbon ring atoms and any suitable number of rings. Aryl groups can include any suitable number of carbon ring atoms, such as Ce, C7, Ce, Cs>, Cio, C11, C12, Ci3, CM, C15 or Ci6, as well as Ce-ιο, Ce-u, or Ce-14 . Aryl groups can be monocyclic, fused to form bicyclic (e.g., benzocyclohexyl) or tricyclic groups, or linked by a bond to form a biaryl group. Representative aryl groups include phenyl, naphthyl and biphenyl. Other aryl groups include benzyl, having a methylene linking group. Some aryl groups have from 6 to 12 ring members, such as phenyl, naphthyl or biphenyl. Other aryl groups have from 6 to 10 ring members, such as phenyl or naphthyl. Some other aryl groups have 6 ring members, such as phenyl. Aryl groups can be substituted or
unsubstituted. Unless otherwise specified, "substituted aryl" groups can be substituted with one or more groups selected from halo, hydroxy, amino, alkylamino, amido, acyl, nitro, cyano, and alkoxy.
[0037] As used herein, the term "alkoxy," by itself or as part of another substituent, refers to a group having the formula -OR, wherein R is alkyl.
[0038] As used herein, the terms "halo" and "halogen," by themselves or as part of another substituent, refer to a fluorine, chlorine, bromine, or iodine atom.
[0039] As used herein, the term "hydroxy" refers to the moiety -OH.
[0040] As used herein, the term "cyano" refers to a carbon atom triple-bonded to a nitrogen atom (i.e., the moiety -C≡N). [0041] As used herein, the term "carboxy" refers to the moiety -C(0)OH. A carboxy moiety can be ionized to form the corresponding carboxylate anion.
[0042] As used herein, the term "amido" refers to a moiety -NRC(0)R or -C(0)NR2, wherein each R group is H or alkyl. [0043] As used herein, the term "nitro" refers to the moiety -NO2.
[0044] As used herein, the term "acylating" refers to the conversion of an alcohol group (-OH) to an ester group (-OC(O)R) or to the conversion of an amino group (-NH2) to an amide group (-NHC(O)R), where R is an alkyl group as described below.
III. Methods for preparing sialic acid products [0045] Some embodiments disclosed herein provide methods which include contacting a sialoside with a Streptococcus pneumoniae sialidase to form a sialic acid product such as a 2- deoxy-2,3-dehydro-sialic acid or a 2,7-anhydro-sialic acid.
[0046] A number of useful sialic products can be prepared using the methods disclosed herein. Deoxy-2,3-dehydro-sialic acids (Sia2ens), for example, can be used as antimicrobial therapeutics or as materials for the synthesis of other carbohydrates. Examples of Sia2ens include, for example, certain compounds described by Li and Chen (Mol. BioSyst. 2011, 7, 1060-1072); Khedri and Chen (Org. Biomol. Chem. 2012, 10, 6112-6120); Meindl
(Monatshefte fur Chemie 1969, 100, 1295-1306); Nitabaru (Angew. Chem. Int. Ed. 2012, 51, 1644-1647); Tian (Angew. Chem. Int. Ed. 2014, 53, 13885-13888); Kiefel (Chem. Rev. 2002, 102, 471-490); Laborda (Molecules 2016, 21, 1513); Hemeon (Synthesis 2007, 2007, 1899-1926); Claesson (Acta Chem. Scand. 1982, 36B, 719-720); Albohy (ACS Med. Chem. Lett. 2013, 4, 532-537); Magesh (Bioorg. Med. Chem. Lett. 2008, 18, 532-537); Maring (WO 01/28981); and Von Itzstein (WO 2016/033660).
[0047] In some embodiments, the sialic acid product is a 2-deoxy-2,3-dehydro-sialic acid or a derivative thereof. For example, a sialidase can be used to convert a sialoside according to Formula III to a Sia2en as shown in Scheme 1 :
Scheme 1
Figure imgf000012_0001
[0048] In Scheme 1 , R1, R2, R3, and R4 can independently be -NHC(0)Ra, -N3, -NH2, -NHRa, -OC(0)Ra, -OH, or hydrogen; R5 can be -NHAc, -NHGc, -NHC(0)Ra, -N3, -NH2, -OC(0)Ra, -OH, or hydrogen (wherein Ac is -C(0)CH3 and Gc is -C(0)CH2OH); and each Ra can independently be optionally substituted Ci-12 alkyl, optionally substituted
Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce-ιο aryl, and optionally substituted C7-22 arylalkyl. R6 can be a monosaccharide, an oligosaccharide, a polysaccharide, a glycosylated lipid, a glycosylated protein, a glycosylated peptide, a glycosylated small molecule, or a non-saccharide moiety. [0049] In some embodiments, a sialidase can be used to convert a sialoside according to Formula Ilia to a Sia2en according to Formula la as shown in Scheme 1 A (wherein R^R6 are defined as for Scheme 1).
Scheme 1A
Figure imgf000012_0002
[0050] In some embodiments, the Streptococcus pneumoniae sialidase used for preparing Sia2ens is SpNanC (NCBI Accession No. WP_024478413.1), comprising the amino acid sequence set forth in SEQ ID NO: 1, or a catalytically active variant thereof.
[0051] In some embodiments, an SpNanC variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO: 1 is used in the method. The SpNanC variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO: 1. [0052] Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the sequence (e.g., a peptide of the invention) in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence which does not comprise additions or deletions, for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. [0053] "Identical" and "identity," in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same. Sequences are "substantially identical" to each other if they have a specified percentage of nucleotides or amino acid residues that are the same (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. These definitions also refer to the complement of a nucleic acid test sequence.
[0054] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. For sequence comparison of nucleic acids and proteins, for example, BLAST and BLAST 2.0 algorithms can be used, which are described in Altschul et al. , (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available at the National Center for Biotechnology Information website, ncbi.nlm.nih.gov. The BLAST algorithms provide a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul, Proc. Nat 'l. Acad. Sci. USA, 90: 5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
[0055] In some embodiments, the SpNanC is S. pneumoniae TIGR4 SpNanC, comprising the amino acid sequence set forth in SEQ ID NO:2, or a catalytically active variant thereof. [0056] In some embodiments, an S. pneumoniae TIGR4 SpNanC variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO:2 is used in the method. The S. pneumoniae TIGR4 SpNanC variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO:2.
[0057] In some embodiments, the sialic acid product is a 2,7-anhydro-sialic acid or a derivative thereof. For example, a sialidase can be used to convert a sialoside according to Formula Ila to a 2,7-anhydro-sialic acid as shown in Scheme 2:
Scheme 2
Figure imgf000014_0001
[0058] In Scheme 2, R11, R12, and R14 can independently be -NHC(0)Ra, -N3, -NH2, -NHRa, -OC(0)Ra, -OH, or hydrogen; R15 can be -NHAc, -NHGc, -NHC(0)Ra, -N3,
-NH2, -OC(0)Ra, -OH, or hydrogen (wherein Ac is -C(0)CH3 and Gc is -C(0)CH2OH); and each Ra can independently be optionally substituted Ci-12 alkyl, optionally substituted
Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce-ιο aryl, and optionally substituted C7-22 arylalkyl. R16 can be a monosaccharide, an oligosaccharide, a polysaccharide, a glycosylated lipid, a glycosylated protein, a glycosylated peptide, a glycosylated small molecule, or a non-saccharide moiety. [0059] In some embodiments, a sialidase can be used to convert a sialoside according to Formula IVa to a 2,7-anhydro-sialic acid according to Formula Ila as shown in Scheme 2A (wherein R11, R12, R14, R15, and R16 as defined as for Scheme 2):
Scheme 2A
Figure imgf000015_0001
[0060] In some embodiments, the Streptococcus pneumoniae sialidase used for forming 2,7-anhydro-sialic acids is SpNanB, having the amino acid sequence set forth in SEQ ID NO:3, or a catalytically active variant thereof.
[0061] In some embodiments, an SpNanB variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO: 3 is used in the method. The SpNanB variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO:3.
[0062] The methods include providing reaction mixtures that contain the S. pneumoniae sialidases described herein. The sialidases can be, for example, isolated or otherwise purified prior to addition to the reaction mixture. As used herein, a "purified" enzyme (e.g., an SpNanC or variant thereof, an SpNanB or variant thereof, a sialyltransferase, a CMP-sialic acid synthetase, or a sialic acid aldolase) refers to an enzyme which is provided as a purified protein composition wherein the enzyme constitutes at least about 50% of the total protein in the purified protein composition. For example, the enzyme (e.g., an SpNanC or SpNanB) can constitute about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the total protein in the purified protein composition. In some embodiments, the sialidase in the reaction mixture is provided as a purified protein composition wherein the sialidase constitutes at least about 95% of the total protein in purified protein composition. The amount of the sialidase in a purified protein composition can be determined by any number of known methods including, for example, by polyacrylamide gel electrophoresis (e.g., SDS-PAGE) followed by detection with a staining reagent (e.g., Coomassie Brilliant Blue G-250, a silver nitrate stain, and/or a reagent containing a sialidase antibody). The reaction mixtures can be formed and used in vitro. The sialidases and other enzymes used in the methods can also be secreted by a cell present in the reaction mixture. Alternatively, a sialidase variant or another enzyme can catalyze the reaction within a cell expressing the variant.
[0063] Reaction mixtures can contain additional reagents for use in glycosylation techniques. For example, in certain embodiments, the reaction mixtures can contain buffers (e.g., 2-(N-morpholino)ethanesulfonic acid (MES), 2-[4-(2-hydroxyethyl)piperazin-l- yljethanesulfonic acid (HEPES), 3 -morpholinopropane-1 -sulfonic acid (MOPS), 2-amino-2- hydroxymethyl-propane-l,3-diol (TRIS), potassium phosphate, sodium phosphate, phosphate-buffered saline, sodium citrate, sodium acetate, and sodium borate), cosolvents (e.g., dimethylsulfoxide, dimethylformamide, ethanol, methanol, tetrahydrofuran, acetone, and acetic acid), salts (e.g., NaCl, KC1, CaCh, and salts of Mn2+and Mg2+),
detergents/surfactants (e.g., a non-ionic surfactant such as NN-bis[3-(D- gluconamido)propyl]cholamide, polyoxyethylene (20) cetyl ether, dimethyldecylphosphine oxide, branched octylphenoxy poly(ethyleneoxy)ethanol, a polyoxyethylene- polyoxypropylene block copolymer, /-octylphenoxypolyethoxyethanol, polyoxyethylene (20) sorbitan monooleate, and the like; an anionic surfactant such as sodium cholate, N- lauroylsarcosine, sodium dodecyl sulfate, and the like; a cationic surfactant such as hexdecyltrimethyl ammonium bromide, trimethyl(tetradecyl) ammonium bromide, and the like; or a zwitterionic surfactant such as an amidosulfobetaine, 3-[(3- cholamidopropyl)dimethyl-ammonio]-l-propanesulfonate, and the like), chelators (e.g., ethylene glycol-bis(2-aminoethylether)-N,N,N^V-tetraacetic acid (EGTA), 2-({2-
[Bis(carboxymethyl)amino]ethyl} (carboxymethyl)amino)acetic acid (EDTA), and l,2-bis(o- aminophenoxy)ethane-N,N,N^V-tetraacetic acid (BAPTA)), reducing agents (e.g., dithiothreitol (DTT), β-mercaptoethanol (BME), and tris(2-carboxyethyl)phosphine (TCEP)), and labels (e.g., fluorophores, radiolabels, and spin labels). Buffers, cosolvents, salts, detergents/surfactants, chelators, reducing agents, and labels can be used at any suitable concentration, which can be readily determined by one of skill in the art. In general, buffers, cosolvents, salts, detergents/surfactants, chelators, reducing agents, and labels are included in reaction mixtures at concentrations ranging from about 1 μΜ to about 1 M. For example, a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, a reducing agent, or a label can be included in a reaction mixture at a concentration of about 1 μΜ, or about 10 μΜ, or about 100 μΜ, or about 1 mM, or about 10 mM, or about 25 mM, or about 50 mM, or about 100 mM, or about 250 mM, or about 500 mM, or about 1 M. In some embodiments, the reaction mixtures contain a sialoside and a sialoside as described herein, as well as one or more components selected from a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, a reducing agent, and a label. In some embodiments, the reaction mixtures contain a sialoside and a sialoside as described herein, as well as one or more components selected from a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, and a reducing agent. In some embodiments, the reaction mixtures consist essentially of a sialoside and a sialidase as described herein, and one or more components selected from a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, and a reducing agent.
[0064] Reactions are conducted under conditions sufficient to convert the sialoside to the sialic acid product (e.g., a 2-deoxy-2,3-dehydro-sialic acid, a 2,7-anhydro-sialic acid, or a derivative thereof). The reactions can be conducted at any suitable temperature. In general, the reactions are conducted at a temperature of from about 4°C to about 40°C. The reactions can be conducted, for example, at about 25°C or about 37°C. The reactions can be conducted at any suitable pH. In general, the reactions are conducted at a pH of from about 4.5 to about 10. The reactions can be conducted, for example, at a pH of from about 5 to about 9. The reactions can be conducted for any suitable length of time. In general, the reaction mixtures are incubated under suitable conditions for anywhere between about 1 minute and several hours. The reactions can be conducted, for example, for about 1 minute, or about 5 minutes, or about 10 minutes, or about 30 minutes, or about 1 hour, or about 2 hours, or about 4 hours, or about 8 hours, or about 12 hours, or about 24 hours, or about 48 hours, or about 72 hours, or about 96 hours, or about 120 hours, or about 144 hours, or about 168 hours. Other reaction conditions may be employed in the methods, depending on the identity of a particular sialoside or sialidase.
[0065] A number of sialosides can be used in the methods disclosed herein, including sialosides according to Formula III, Formula Ilia, Formula IV, and Formula IVa as described above. In general, a sialoside will include at least one sialic acid covalently linked to another carbohydrate moiety or a non-carbohydrate moiety. The covalent linkages generally consist of glycosidic linkages (i.e., C-O-C bonds) formed from a hydroxyl group of the hemiacetal at the sialic acid anomeric carbon and a hydroxyl group of an adjacent sugar or an adjacent non- carbohydrate moiety. Linkages can occur, for example, between the carbon-2 of a sialic acid and the carbon-3 of an adjacent sugar (i.e., a 2-3 linkage). The sialic acid can be linked in the sialoside such that the bond at the anomeric carbon is in the a-configuration.
[0066] In some embodiments, the sialoside is a compound according to Formula III or Formula Ilia, wherein R6 is a galactoside (e.g., lactose or a lactoside). In some embodiments, R6 is bonded to the compound via a 2-3 linkage (i.e., between carbon-2 of the sialic acid and carbon-3 of the galactose). In some embodiments, the sialoside is a compound according to Formula IV or Formula IV a, wherein R16 is a galactoside (e.g., lactose or a lactoside). In some embodiments, R16 is bonded to the compound via a 2-3 linkage (i.e., between carbon-2 of the sialic acid and carbon-3 of the galactose).
[0067] In some embodiments, R6 or R16 is present as a member of an oligosaccharide, a polysaccharide, a glycosylated natural product, a glycopeptide, a glycoprotein, or a glycolipid. Suitable natural products include non-ribosomal glycopeptides (such as bleomycin), glycoalkaloids (such as solanine), ginsenosides (such as sanchinoside CI), aminoglycosides (such as gentamicin, kanamycin, neomycin, and streptomycin), avermectins, and anthracyclines (such as daunorubicin). Suitable glycolipids include glycoglycerolipids (such as monogalactosyldiacylglycerols, digalactosylmonoacylglycerols, and sulfoquinovosyl diacylglycerols), glycosphingolipids (such as lacto-, neolacto-, ganglio-, globo-, and iso- globo-series glycosphingolipids), and glycophosphatidylinositols (e.g., 1-phosphatidyl-L- myo-inositol 2,6-di-O-a-D-mannopyranoside.). Suitable glycoproteins include mucins, immunoglobulins, lectins, and collagens.
[0068] In some embodiments the sialoside is a compound according to Formula V:
Figure imgf000018_0001
In compounds according to Formula lb, R6a is a monosaccharide, disaccharide or
oligosaccharide, and subscript x is 0 or 1. R6b is a linker, and subscript y is 0 or 1. In some embodiments, the linker is selected from Ci-6 alkylene; Ci-6 alkylene-NH-C(0)-Ci-6 alkylene; and Ci-6 alkylene-NH-C(0)-(CH2-(CH2CH20)p-NH-C(0))m-Ci-6 alkylene, where subscript m is 0 or 1, and subscript p is an integer from 1 to 6. In some embodiments, subscript y is 1 and R6c is Ci-6 alkylene (e.g., ^-propylene), which is optionally substituted with one or more groups selected from halo, hydroxy, amino, azido (i.e., -N3), alkylamino, amido, acyl, nitro, cyano, and alkoxy. Functional groups in sialosides can be modified protecting groups.
[0069] The term "protecting group" refers to a chemical moiety that renders a functional group (e.g., an amino group) unreactive, but is also removable so as to restore the reactive functional group. Examples of protecting groups include, but are not limited to,
benzyloxycarbonyl (Z or Cbz); 9-fluorenylmethyloxycarbonyl (Fmoc); fert-butyloxycarbonyl (Boc); allyloxycarbonyl (Alloc); /^-toluene sulfonyl (Tos); 2,2,5,7,8-pentamethylchroman-6- sulfonyl (Pmc); 2,2,4,6,7-pentamethyl-2,3-dihydrobenzofuran-5-sulfonyl (Pbf); mesityl-2- sulfonyl (Mts); 4-methoxy-2,3,6-trimethylphenylsulfonyl (Mtr); acetamido; phthalimido; and the like. Other protecting groups are known to those of skill in the art including, for example, those described by Green and Wuts (Protective Groups in Organic Synthesis, 4th Ed. 2007, Wiley-Interscience, New York).
[0070] In some embodiments the sialoside is a compound according to Formula Va:
Figure imgf000019_0001
[0071] Accordingly some embodiments disclosed herein provide methods wherein the sialoside is an α2-3-linked sialoside or a derivative thereof. In some embodiments, the α2- 3-linked sialoside is selected from the group consisting of Neu5Acα2-3Lac, Neu5Gcα2- 3Lac, Neu5TFAα2-3Lac, Neu5Acα2-3LacbProN3, Neu5Acα2-3LacbProNHCbz,
Neu5TFAα2-3LacbProN3, Neu5TFAα2-3LacbProNHCbz, and derivatives thereof. [0072] The sialoside can be prepared prior to forming the sialic acid product, or prepared in situ immediately prior to formation of the sialic acid product. In some embodiments, the methods disclosed herein also include forming a reaction mixture containing an acceptor glycoside, a sialic acid donor, and a sialyltransferase under conditions sufficient to form the sialoside. Sialic acid donors generally include a nucleotide and a sialic acid moiety. Suitable nucleotides include, but are not limited to, adenine, guanine, cytosine, uracil and thymine nucleotides with one, two or three phosphate groups. In some embodiments, the nucleotide can be cytidine monophosphate (CMP). The sialic acid donor can contain a number of sialic acid moieties. In some embodiments, the method includes contacting an acceptor sugar and a sialyltransferase in the presence of a CMP-sialic acid to form the α2-3-linked sialoside. In some embodiments, the acceptor sugar is lactose. In some embodiments, the lactose is β- lactose (i.e., -D-galactopyranosyl-(l→4)-D-glucose; "Gai i-4Glc"), or a or β-lactoside (e.g., Gal l-4Glc ProNHCbz, where Pro is -(CH2)3 ).
[0073] Any suitable sialyltransferase (also referred to as "ST") can be used in the methods for forming the sialosides disclosed herein. In some embodiments, the sialyltransferase is a beta-galactoside alpha-2,3-sialyltransferases belonging to Glycosyltransferase family 80 (GT80 using CAZy nomenclature), which catalyzes the following conversion: CMP-sialic acid + β-D-galactosyl-R = CMP + a-sialic acid-(2→3)- -D-galactosyl-R, where the acceptor is Gai OR, where R is H, a monosaccharide, an oligosaccharide, a polysaccharide, a glycopeptide, a glycoprotein, a glycolipid, or a hydroxyl-containing compound.
[0074] In some embodiments, the sialyltransferase is selected from the group consisting of PmSTl, a PmSTl variant, PmST2, a PmST2 variant, PmST3, a PmST3 variant, and a polysialyltransferase.
[0075] In some embodiments, the sialyltransferase is PmSTl (NCBI Accession No.
WP_005753497.1) or a catalytically active variant thereof. In some embodiments, the sialyltransferase is PmSTl_M144D or a catalytically active variant thereof. In some embodiments, the sialyltransferase comprises the polypeptide sequence set forth in SEQ ID NO:4, or a catalytically active variant thereof.
[0076] In some embodiments, the sialyltransferase is PmST2 (UniProtKB Accession No. Q9CNC4) or a catalytically active variant thereof. PmST2 are variants thereof are described in U.S. Pat. No. 9,102,967, which is incorporated herein by reference in its entirety. In some embodiments, the sialyltransferase comprises the polypeptide sequence set forth in SEQ ID NO:5, or a catalytically active variant thereof.
[0077] In some embodiments, the sialyltransferase is PmST3 or a catalytically active variant thereof, as described in U.S. Pat. No. 9,783,838, which is incorporated herein by reference in its entirety. In some embodiments, the sialyltransferase is PmST3A35 or a catalytically active variant thereof. In some embodiments, the sialyltransferase comprises the polypeptide sequence set forth in SEQ ID NO:6, or a catalytically active variant thereof.
[0078] In some embodiments, the sialyltransferase is PmSTl M144D, having the amino acid sequence set forth in SEQ ID NO:4 or a catalytically active variant thereof. [0079] In some embodiments, a PmSTl_M144D variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO: 4 is used in the method. The PmSTl_M144D variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO:4. [0080] Advantageously, lactose, lactosides, and other acceptors can be used in catalytic amounts for the economic production of the sialic acid products. By "catalytic," it is meant that less than one molar equivalent of the acceptor per molar equivalent of the sialic acid donor is used. For example, reaction mixture may contain an acceptor such as lactose in an amount ranging from about 0.1 mol% to about 50 mol% with respect to the amount of the sialic acid donor. The amount of the acceptor in the reaction mixture can range, for example, from about 1 mol% to about 50 mol%, or from about 5 mol% to about 45 mol%, or from about 10 mol% to about 30 mol%, with respect to the amount of the sialic acid donor. The amount of the acceptor in reaction mixture can be about 5, 10, 15, 20, 25, 30, 35, 40, or 45 mol% with respect to the amount of the sialic acid donor. [0081] A sialic acid donor (e.g., a CMP-sialic acid) can be prepared prior to forming the sialoside, or prepared in situ immediately prior to formation of the sialoside. In some embodiments, the methods also include forming a reaction mixture including a CMP-sialic acid synthetase, cytidine triphosphate, and N-acetylneuraminic acid (Neu5 Ac) or a Neu5 Ac analog, under conditions suitable to form CMP-Neu5Ac or a CMP-Neu5Ac analog. In some embodiments, the method further includes contacting a sialic acid and a CMP-sialic acid synthetase in the presence of CTP to form the CMP-sialic acid.
[0082] Any suitable CMP-sialic acid synthetase (i.e., N-acetylneuraminate
cytidylyltransferase, EC 2.7.7.43) can be used in the methods. For example, CMP-sialic acid synthetases from E. coli, C. thermocellum, S. agalactiae, P. multocida, H. ducreyi, or N. meningitidis can be used. In some embodiments, the CMP-sialic acid synthetase is NmCSS (NCBI Accession No. WP_025459740.1) or a catalytically active variant thereof. In some embodiments, the CMP-sialic acid synthetase comprises the polypeptide sequence set forth in SEQ ID NO:7 or a catalytically active variant thereof.
[0083] In some embodiments, an NmCSS variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO:7 is used in the method. The NmCSS variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO:7.
[0084] In some embodiments, the CMP-sialic acid synthetase is a purified CMP-sialic acid synthetase as described above with respect to sialidases. Other components (e.g., buffers, cosolvents, salts, detergents/surfactants, chelators, and/or reducing agents, as described above) can be included in the reaction mixture for forming the CMP-Neu5Ac/CMP-Neu5Ac analog. In some embodiments, the step of forming the sialic acid donor and the step of forming the sialylated product are performed in one pot.
[0085] In some embodiments, the sialic acid moiety of the sialic acid donor is prepared separately prior to use in the methods. Alternatively, the sialic acid moiety can be prepared in situ immediately prior to use in the methods. In some embodiments, the methods include forming a reaction mixture including a sialic acid aldolase, pyruvic acid or derivatives thereof, and N-acetylmannosamine or derivatives thereof, under conditions suitable to form Neu5Ac or a Neu5Ac analog. In some embodiments, the method further includes contacting a C6-monosaccharide and a sialic acid aldolase in the presence of pyruvate to form to the sialic acid. [0086] Any suitable sialic acid aldolase (i.e., N-acetylneuraminate pyruvate lyase, EC 4.1.3.3) can be used in the methods. For example, sialic acid aldolases from ?. coli, L. plantarum, P. multocida, or N. meningitidis can be used. In some embodiments, the sialic acid aldolase is PmAldolase (NCBI Accession No. WP_005723432.1) or a catalytically active variant thereof. In some embodiments, the sialic acid aldolase comprises the polypeptide sequence set forth in SEQ ID NO: 8, or a catalytically active variant thereof.
[0087] In some embodiments, a PmAldolase variant containing an amino acid sequence having at least about 80% sequence identity to the amino acid sequence set forth in SEQ ID NO: 8 is used in the method. The PmAldolase variant can have, for example, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO: 8.
[0088] In some embodiments, the sialic acid aldolase is a purified sialic acid aldolase as described above with respect to sialidases. Other components (e.g., buffers, cosol vents, salts, detergents/surfactants, chelators, and/or reducing agents, as described above) can be included in the reaction mixture for forming the Neu5Ac/Neu5Ac analog. In some embodiments, the step of forming the sialic acid moiety, the step of forming the sialic acid donor, and the step of forming the sialylated product are performed in one pot.
[0089] The methods disclosed herein can further include one or more chemical transformations in addition to the enzymatic steps described above. In certain instances, for example, one or more of R1, R2, R3, and R4 in a Sia2en according to Formula I may be an azido group -N3, which can be reduced via hydrogenolysis with Pd/C or another suitable catalyst to provide an amino group -NH2. Amino groups and/or hydroxyl group in Sia2en products can be acylated to provide the corresponding esters and amides. As a non-limiting example, an amino group R1 in a compound according to Formula I can be acylated to provide an amide having the formula -NHC(0)Ra, wherein Ra is Ci-12 alkyl, Ci-12 haloalkyl, C3-10 cycloalkyl, Ce-ιο aryl, or C7-22 arylalkyl. Esters and amides can be optionally substituted with one or more independently-selected substituents such as halo, hydroxy, amino, alkylamino, amido, acyl, nitro, cyano, and alkoxy.
[0090] Acylation can be conducted with a suitable carboxylic acid RaCOOH or a reactive carboxylic derivative such as an acid chloride or an activated ester (e.g., an N- hydroxysuccinimidyl ester or a pentafluorophenyl ester). The carboxylic acid or carboxylic acid derivative can be used with a coupling agent such as a carbodiimide (e.g., NN - dicyclohexylcarbodiimide (DCC), NN -dicyclopentylcarbodiirnide, NN - diisopropylcarbodiimide (DIC), l-ethyl-3-(3-dimethylaminopropyl)carbodiirnide (EDC), N-t- butyl-N-methylcarbodiimide (BMC), N-i-but l-N-ethylcarbodiimide (BEC), l,3-bis(2,2- dimethyl-l,3-dioxolan-4-ylmethyl)carbodiimide (BDDC), etc.), a phosphonium salt (HOBt, PyBOP, HO At, etc.), or an aminium/uronium salt (e.g., tetramethyl aminium salts, bispyrrolidino aminium salts, bispiperidino aminium salts, imidazolium uronium salts, pyrimidinium uronium salts, uronium salts derived from NNN -trimethyl-N -phenylurea, morpholino-based aminium/uronium coupling reagents, antimoniate uronium salts, etc.). Coupling agents such as carbodiimides can be used in conjunction with nucleophilic catalysts such as 4-(N,N-dimethylamino)pyridine and the like to promote formation of the desired ester or amide.
[0091] Amino groups can also be modified via reductive animation. As used herein, the term "reductive animation conditions" refers to conditions suitable for converting an amine -ΝΗ2 to a substituted amine -NHCH(Rb)2, wherein one Rb is Ci-12 alkyl, Ci-12 haloalkyl, C3-10 cycloalkyl, Ce-ιο aryl, or C7-22 arylalkyl and the other Rb is hydrogen, Ci-12 alkyl,
Ci-12 haloalkyl, C3-10 cycloalkyl, Ce-ιο aryl, or C7-22 arylalkyl. Reductive animation can be conducted with a suitable aldehyde or ketone RbC(0)Rb and a reducing agent such as sodium borohydride, sodium cyanoborohydride, or the like.
IV. 2-Deoxy-2,3-dehydro-sialic acids and 2,7-anhydro-sialic acids [0092] Some embodiments disclosed herein rovide a compound according to Formula I:
Figure imgf000024_0001
or a salt thereof, wherein:
R1, R2, R3, and R4 are independently selected from the group consisting of
-NHC(0)Ra, -N3, -NH2, -NHRa, -OC(0)Ra, -OH, and hydrogen;
R5 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)Ra, -N3, -NH2, -OC(0)Ra, -OH, and hydrogen;
each Ra is independently selected from the group consisting of optionally substituted Ci-12 alkyl, optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce-ιο aryl, and optionally substituted C7-22 arylalkyl;
Ac is -C(0)CH3; and
Gc is -C(0)CH2OH.
[0093] In general, at least one of R1, R2, R3, and R4 is other than -OH when R5 is -NHAc or -NHGc. [0094] In some embodiments the compound has a structure according to Formula la:
Figure imgf000025_0001
[0095] In some embodiments, R1, R2, R3, and R4 are independently selected from the group consisting of -N3, -NH2, -NHC(0)Ra, -NHRa, and -OH in compounds of Formula I or Formula la. In some such embodiments, R5 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)CF3 (i.e., -NHTFA), -OH, and -OAc. In some embodiments, R1, R2, R3, and R4 are independently selected from the group consisting of -N3 and -OH, and R5 is -NHAc, -NHGc, or -NHTFA. In some embodiments, R1, R2, R3, and R4 are independently selected from the group consisting of -NHC(0)Ra (e.g., -NHAc) and -OH, and R5 is -NHAc, -NHGc, or -NHTFA.
[0096] In some embodiments, at least one of R1, R2, R3, and R4 is independently -N3, -NH2, -NHC(0)Ra, or -NHRa in compounds of Formula I or Formula la. In some embodiments, at least two of R1, R2, R3, and R4 are independently -N3, -NH2, -NHC(0)Ra, or -NHRa. In some embodiments, at least three of R1, R2, R3, and R4 are independently -N3, -NH2, -NHC(0)Ra, or -NHRa. In some embodiments, remaining R1, R2, R3, and R4 groups are independently selected from -OH and -OC(0)Ra. In some such embodiments, the remaining R1, R2, R3, and R4 groups are -OH. In some embodiments, R1, R2, R3, and R4 are independently -N3, -NH2, -NHC(0)Ra, or -NHRa.
[0097] In some embodiments, R5 is -NHAc or -NHGc and at least one of R1, R2, R3, and R4 is independently -N3, -NH2, or -NHC(0)Ra in compounds of Formula I or Formula la. In some embodiments, R5 is -NHAc or -NHGc and at least two of R1, R2, R3, and R4 are independently -N3, -NH2, or -NHC(0)Ra. In some embodiments, R5 is -NHAc or -NHGc and at least three of R1, R2, R3, and R4 are independently -N3, -NH2, or -NHC(0)Ra. In some embodiments, remaining R1, R2, R3, and R4 groups are independently selected from -OH and -OC(0)Ra. In some such embodiments, the remaining R1, R2, R3, and R4 groups are -OH. In some embodiments, R5 is -NHAc or -NHGc and R1, R2, R3, and R4 are independently -N3, -NH2, or -NHC(0)Ra.
[0098] In some embodiments, R1 is -NHC(0)Ra or -NHRa in compounds of Formula I or Formula la. In some embodiments, Ra is Ci-12 alkyl or C3-io cycloalkyl. Ra can be, for example, methyl, ethyl, ^-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, branched pentyl, «-hexyl, branched hexyl, n-heptyl, branched heptyl, «-octyl, branched oct l, «-nonyl, branched nonyl, «-decyl, branched «-decyl, n-undecyl, branched undecyl, n-dodecyl, branched dodecyl, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, or cyclooctyl. [0099] In some embodiments, R3 is selected from the group consisting of -OH and hydrogen.
[0100] In some embodiments, R5 is selected from the group consisting of -NHAc, -NHGc, and -NHC(0)Ra. In some such embodiments, Ra is C3-10 cycloalkyl. When R5 is
-NHC(0)Ra, for example, Ra can be C3-10 cycloalkyl or C7-22 arylalkyl. Ra can be, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, or cyclooctyl. Ra can be benzyl (i.e., phenylmethyl), (2-phenyl)ethyl, (3-phenyl)propyl, (2-phenyl)propyl, (4- phenyl)butyl, or the like.
[0101] In some embodiments, the compound is selected from the group consisting of:
Figure imgf000026_0001
and salts thereof.
[0102] Some embodiments disclosed herein provide a compound according to Formula II:
Figure imgf000026_0002
or a salt thereof, wherein:
R11, R12, and R14 are independently selected from the group consisting of
-NHC(0)Ra, -N3, -NH2, -NHRa, -OC(0)Ra, -OH, and hydrogen;
R15 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)Ra, -N3, -NH2, -OC(0)Ra, -OH, and hydrogen; Ra is selected from the group consisting of optionally substituted Ci-12 alkyl, optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce-ιο aryl, and optionally substituted C7-22 arylalkyl;
Ac is -C(0)CH3; and
Gc is -C(0)CH2OH.
[0103] In general, at least one of R11, R12, and R14 is other than -OH when R15 is -NHAc or -NHGc.
[0104] In some embodiments the compound has a structure according to Formula Ila:
Figure imgf000027_0001
[0105] In some embodiments, R11, R12, and R14 are independently selected from the group consisting of -N3, -NH2, -NHC(0)Ra, -NHRa, and -OH in compounds of Formula II or Formula Ila. In some such embodiments, R15 is selected from the group consisting of -NHC(0)Ra, -NHAc, -NHGc, -NHTFA, -OH, and -OAc. In some embodiments, R11, R12, and R14 are independently selected from the group consisting of -N3 and -OH, and R15 is -NHC(0)Ra -NHAc, -NHGc, or -NHTFA. In some embodiments, R11, R12, and R14 are independently selected from the group consisting of -NHC(0)Ra (e.g., -NHAc) and -OH, and R15 is -NHAc, -NHGc, or -NHTFA.
[0106] In some embodiments, at least one of R11, R12, and R14 is independently -N3, -NH2, -NHC(0)Ra, or -NHRa in compounds of Formula II or Formula Ila. In some embodiments, at least two of R11, R12, and R14 are independently -N3, -NH2, -NHC(0)Ra, or -NHRa. In some embodiments, remaining R11, R12, and R14 groups are independently selected from -OH and -OC(0)Ra. In some such embodiments, the remaining R11, R12, and R14 groups are -OH. In some embodiments, R11, R12, and R14 are independently -N3, -NH2, -NHC(0)Ra, or -NHRa. [0107] In some embodiments, R15 is -NHC(0)Ra -NHAc, or -NHGc, and at least one of R11, R12, and R14 is independently -N3, -NH2, or -NHC(0)Ra in compounds of Formula II or Formula Ila. In some embodiments, R15 is -NHC(0)Ra -NHAc, or -NHGc, and at least two of R11, R12, and R14 are independently -N3, -NH2, or -NHC(0)Ra. In some embodiments, remaining R11, R12, and R14 groups are independently selected from -OH and -OC(0)Ra. In some such embodiments, the remaining R11, R12, and R14 groups are -OH. In some embodiments, R15 is -NHC(0)Ra -NHAc, or -NHGc, and R11, R12, and R14 are
independently -N3, -NH2, or -NHC(0)Ra.
[0108] In some embodiments, R15 is selected from the group consisting of -NHAc, - NHGc, and -NHC(0)Ra in compounds of Formula II or Formula Ila. In some such embodiments, Ra is selected from the group consisting of optionally substituted Ci-12 alkyl, optionally substituted Ci-12 haloalkyl, and optionally substituted C3-10 cycloalkyl. Ra can be, for example, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, seobutyl, fert-butyl, n- pentyl, branched pentyl, n-hexyl, branched hexyl, n-heptyl, branched heptyl, n-octyl, branched octyl, «-nonyl, branched nonyl, «-decyl, branched «-decyl, n-undecyl, branched undecyl, n-dodecyl, or branched dodecyl. Ra can be chloromethyl, dichloromethyl, trichloromethyl, fluoromethyl, difluoromethyl, trifluoromethyl, 2,2,2-trichloroethyl, 2,2,2- trifluoroethyl, pentachloroethyl, pentafluoroethyl, 1,1,1,3,3,3-hexachloropropyl, 1,1,1,3,3,3- hexafluoropropyl, or the like. Ra can be cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, or cyclooctyl.
[0109] In some embodiments, the compound is selected from the group consisting of
Figure imgf000028_0001
and salts thereof.
[0110] In some embodiments, the compound is selected from the group consisting of
Figure imgf000028_0002
and salts thereof.
V. Methods and compositions for sialidase inhibition and disease treatment
[0111] In some embodiments, methods for inhibiting sialidases are provided. The methods include contacting the sialidase with an effective amount of a 2-deoxy-2,3-dehydro-sialic acid or a 2,7-anhydro-sialic acid. In certain embodiments, the sialidase is a microbial sialidase or a viral sialidase. Organisms that contain sialidases include bacteria (including, but not limited to, Vibrio cholerae, Clostridium perfringens, Streptococcus pneumoniae, and Arthrobacter sialophilus) and viruses (including, but not limited to, orthomyxoviruses or paramyxoviruses such as influenza virus A and B, parainfluenza virus, mumps virus,
Newcastle disease virus, fowl plague virus, and sendai virus). In some embodiments, the sialidase is SpNanA (NCBI Accession No. WP_010976603.1), SpNanB (NCBI Accession No. NP_359124.1), SpNanC (NCBI Accession No. WP_024478413.1), AuSialidase (NCBI Accession No. WP_062095054.1), CpNanI (NCBI Accession No. WP_011590331.1), CpNanH (UniProtKB Accession No. PI 0481), VcSialidase (NCBI Accession No.
WP_001889713.1), BiNanH2 (NCBI Accession No. WP_012578573.1), hNEU2 (GenBank Accession No. CAB41449.1), hNEU3 (GenBank Accession No. AAI36398.1), or variants thereof containing one or more amino acid substitutions, deletions, and/or other peptide sequence variations. Variants may contain, for example, 1-2 amino acid substitutions or deletions, or 1-4 amino acid substitutions or deletions, or 1-10 amino acid substitutions or deletions, or 1-25 amino acid substitutions or deletions.
[0112] Inhibiting the sialidase generally includes contacting the sialidase with an amount of the compound sufficient to reduce the activity of the sialidase as compared to the sialidase activity in the absence of the compound. For example, contacting the sialidase with the sialidase inhibitor can result in from about 1% to about 99% sialidase inhibition (i.e., the activity of the inhibited sialidase ranges from 99% to 1% of the sialidase activity in the absence of the compound). The level of sialidase inhibition can range from about 1% to about 10%, or from about 10% to about 20%, or from about 20% to about 30%, or from about 30% to about 40%, or from about 40% to about 50%, or from about 50% to about 60%, or from about 60% to about 70%, or from about 70% to about 80%, or from about 80% to about 90%, or from about 90% to about 99%. The level of sialidase inhibition can range from about 5% to about 95%, or from about 10% to about 90%, or from about 20% to about 80%, or from about 30% to about 70%, or from about 40% to about 60%. In some embodiments, contacting the sialidase with a 2-deoxy-2,3-dehydro-sialic acid or a 2,7- anhydro-sialic acid will result in essentially complete (i.e., 100%) sialidase inhibition.
[0113] Aberrant sialylation is associated with cancer development as well as with sialic acid storage disease, which can lead to neurological complications. Inhibition of human sialidase NEU3 (hNEU3), in particular, can induce apoptosis in human breast cancer cells and colon cancer cells, which could be leveraged to prevent cancer progression. The diverse roles of sialidases in bacterial and viral pathogens are implicated in invasion,
immunosuppression, and virulence. Degradation of human sialic acids by pathogen sialidases contributes to the severity of infectious diseases such as influenza, pneumonia, periodontitis, and bacterial vaginosis. The methods described herein can therefore be employed for the production of sialidase inhibitors for use in the treatment of cancer and infectious diseases, among other conditions.
[0114] Provided in some embodiments is a method for treating cancer which includes administering an effective amount of a 2-deoxy-2,3-dehydro-sialic acid (e.g., a compound of Formula I as described herein) or a 2,7-anhydro-sialic acid (e.g., a compound of Formula II) to a subject in need thereof. In some embodiments, there is provided a method for treating a viral infection or a bacterial infection which includes administering an effective amount of a 2-deoxy-2,3-dehydro-sialic acid (e.g., a compound of Formula I as described herein) or a 2,7- anhydro-sialic acid (e.g., a compound of Formula II) to a subject in need thereof.
[0115] Sialidase inhibitors as described herein can be administered at any suitable dose in the methods for disease treatment. In general, a sialidase inhibitor is administered at a dose ranging from about 0.1 milligrams to about 1000 milligrams per kilogram of a subject's body weight (i.e., about 0.1-1000 mg/kg). The dose of sialidase inhibitor can be, for example, about 0.1-1000 mg/kg, or about 1-500 mg/kg, or about 25-250 mg/kg, or about 50-100 mg/kg. The dose of sialidase inhibitor can be about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950 or 1000 mg/kg. The dosages can be varied depending upon the requirements of the patient, the severity of the disorder being treated, and the particular formulation being administered. The dose administered to a patient should be sufficient to result in a beneficial therapeutic response in the patient. The size of the dose will also be determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of the drug in a particular patient. Determination of the proper dosage for a particular situation is within the skill of the typical practitioner. The total dosage can be divided and administered in portions over a period of time suitable to treat to the seizure disorder. [0116] Sialidase inhibitors can be administered for periods of time which will vary depending upon the nature of the particular disorder, its severity, and the overall condition of the subject to whom the sialidase inhibitor is administered. Administration can be conducted, for example, hourly, every 2 hours, three hours, four hours, six hours, eight hours, or twice daily including every 12 hours, or any intervening interval thereof. Administration can be conducted once daily, or once every 36 hours or 48 hours, or once every month or several months. Following treatment, a subject can be monitored for changes in his or her condition and for alleviation of the symptoms of the disorder. The dosage of the sialidase inhibitor can either be increased in the event the subject does not respond significantly to a particular dosage level, or the dose can be decreased if an alleviation of the symptoms of the disorder is observed, or if the disorder has been remedied, or if unacceptable side effects are seen with a particular dosage.
[0117] A therapeutically effective amount of a sialidase inhibitor can be administered to the subject in a treatment regimen comprising intervals of at least 1 hour, or 6 hours, or 12 hours, or 24 hours, or 36 hours, or 48 hours between dosages. Administration can be conducted at intervals of at least 72, 96, 120, 144, 168, 192, 216, or 240 hours (i.e., 3, 4, 5, 6, 7, 8, 9, or 10 days). In certain embodiments, administration of one or more sialidase inhibitors is conducted in periods ranging from several months to several years.
[0118] Also provided are pharmaceutical compositions for the administration of sialidase inhibitors, including 2-deoxy-2,3-dehydro-sialic acids and 2,7-anhydro-sialic acids as described herein. The pharmaceutical compositions can be prepared by any of the methods well known in the art of pharmacy and drug delivery. In general, methods of preparing the compositions include the step of bringing the active ingredient into association with a carrier containing one or more accessory ingredients. The pharmaceutical compositions are typically prepared by uniformly and intimately bringing the active ingredient into association with a liquid carrier or a finely divided solid carrier or both, and then, if necessary, shaping the product into the desired formulation. The compositions can be conveniently prepared and/or packaged in unit dosage form. [0119] The pharmaceutical compositions can be in the form of sterile injectable aqueous or oleaginous solutions and suspensions. Sterile injectable preparations can be formulated using non-toxic parenterally-acceptable vehicles including water, Ringer's solution, and isotonic sodium chloride solution, and acceptable solvents such as 1,3-butane diol. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose, any bland fixed oil can be employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid find use in the preparation of injectables.
[0120] Aqueous suspensions contain the active materials in admixture with excipients including, but not limited to: suspending agents such as sodium carboxymethylcellulose, methylcellulose, oleagino-propylmethylcellulose, sodium alginate, polyvinyl-pyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents such as lecithin,
poly oxy ethylene stearate, and polyethylene sorbitan monooleate; and preservatives such as ethyl, ft-propyl, and />-hydroxybenzoate.
[0121] Oily suspensions can be formulated by suspending the active ingredient in a vegetable oil, for example, arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as liquid paraffin. The oily suspensions can contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol. These compositions can be preserved by the addition of an anti-oxidant such as ascorbic acid.
[0122] Dispersible powders and granules (suitable for preparation of an aqueous suspension by the addition of water) can contain the active ingredient in admixture with a dispersing agent, wetting agent, suspending agent, or combinations thereof. Additional excipients can also be present.
[0123] The pharmaceutical compositions can also be in the form of oil-in-water emulsions. The oily phase can be a vegetable oil, for example olive oil or arachis oil, or a mineral oil, for example liquid paraffin or mixtures of these. Suitable emulsifying agents can be naturally- occurring gums, such as gum acacia or gum tragacanth; naturally-occurring phospholipids, such as soy lecithin; esters or partial esters derived from fatty acids and hexitol anhydrides, such as sorbitan monooleate; and condensation products of said partial esters with ethylene oxide, such as polyoxy ethylene sorbitan monooleate. [0124] Pharmaceutical compositions containing the sialidase inhibitors described herein can also be in a form suitable for oral use. Suitable compositions for oral administration include, but are not limited to, tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsions, hard or soft capsules, syrups, elixirs, solutions, buccal patches, oral gels, chewing gums, chewable tablets, effervescent powders, and effervescent tablets. Compositions for oral administration can be formulated according to any method known to those of skill in the art. Such compositions can contain one or more agents selected from sweetening agents, flavoring agents, coloring agents, antioxidants, and preserving agents in order to provide pharmaceutically elegant and palatable preparations.
[0125] Tablets generally contain the active ingredient in admixture with non-toxic pharmaceutically acceptable excipients, including: inert diluents, such as cellulose, silicon dioxide, aluminum oxide, calcium carbonate, sodium carbonate, glucose, mannitol, sorbitol, lactose, calcium phosphate, and sodium phosphate; granulating and disintegrating agents, such as com starch and alginic acid; binding agents, such as polyvinylpyrrolidone (PVP), cellulose, polyethylene glycol (PEG), starch, gelatin, and acacia; and lubricating agents such as magnesium stearate, stearic acid, and talc. The tablets can be uncoated or coated, enterically or otherwise, by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period. For example, a time delay material such as glyceryl monostearate or glyceryl distearate can be employed. Tablets can also be coated with a semi-permeable membrane and optional polymeric osmogents according to known techniques to form osmotic pump compositions for controlled release. [0126] Compositions for oral administration can be formulated as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent (such as calcium carbonate, calcium phosphate, or kaolin), or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium (such as peanut oil, liquid paraffin, or olive oil).
[0127] The sialidase inhibitors described herein can also be administered topically as a solution, ointment, cream, gel, suspension, mouth washes, eye-drops, and the like. Still further, transdermal delivery of the sialidase inhibitors can be accomplished by means of iontophoretic patches and the like. The compound can also be administered in the form of suppositories for rectal administration of the drug. These compositions can be prepared by mixing the drug with a suitable non-irritating excipient which is solid at ordinary
temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug. Such materials include cocoa butter and polyethylene glycols. [0128] In some embodiments, an sialidase inhibitor described herein is administered via intraperitoneal injection. In some embodiments, the sialidase inhibitor is administered orally. In some embodiments, the sialidase inhibitor is administered intravenously.
[0129] Sialidase inhibitors can be administered alone or in combination with one or more additional therapeutically active agents including, but not limited to, additional sialidase inhibitors (e.g., oseltamivir, zanamivir, peramivir, and the like), viral replication inhibitors (e.g., rimantadine and the like), macrolide antibiotics (e.g., erythromycin and the like), cephalosporin antibiotics (e.g., cefuroxime, ceflacor and the like), and fluoroquinolone antibiotics (e.g., ciprofloxacin, moxifloxacin, and the like). Sialidase inhibitors can also be administered in combination with cytotoxic/anti-cancer agents including, but not limited to, angiogenesis inhibitors (e.g., bevacizumab, ranibizumab, and the like), anthracyclines (e.g., doxorubicin, daunorubicin, and the like), platins (e.g., cisplatin, oxaliplatin, carboplatin, and the like), antimetabolites (e.g., 5-fluorouracil, methotrexate, and the like), kinase inhibitors (e.g., erlotinib, gefitinib, and the like), nucleoside analogs (e.g., gemcitabine, cytarabine, and the like), and taxanes (e.g., paclitaxel, docetaxel, and the like).
VI. Examples
Example 1. Methods for the Preparation of Sia2ens.
[0130] E. coli electrocompetent DH5a and chemically competent BL21 (DE3) cells were from Invitrogen (Carlsbad, CA). Herculase II Fusion DNA Polymerase was from Agilent Technologies (Santa Clara, CA). T4 DNA ligase and 1 kb DNA ladder were from Promega (Madison, WI). EcoRl and Hind l restriction enzymes and vector plasmid pMAL-c4X were from New England BioLabs (Beverly, MA). GeneJET PCR Purification Kit and GeneJET Plasmid Miniprep Kit were from Thermo Fisher Scientific (Waltham, MA). Ni2+-NTA agarose (nickel-nitrilotriaceticacid agarose) was from 5 PRIME (Gaithersburg, MD).
Bicinchoninic acid (BCA) protein assay kit was from Pierce Biotechnology Inc. (Rockford, IL). Recombinant sialidases were expressed and purified as reported previously for human cytosolic sialidase hNEU2, as well as bacterial sialidases from Streptococcus pneumoniae (SpNanA, SpNanB, and SpNanC), Pasteurella multocida (PmSTl), Bifidobacterium infantis (BiNanH2). Commercially available bacterial sialidases used included those from
Arthrobacter ureafaciens (Prozyme), Clostridium perfringens CpNanI (Sigma-Aldrich) and CpNanH (Prozyme), and Vibrio cholerae (Prozyme). Aspergillus oryzae β-galactosidase was purchased from Sigma-Aldrich. Pasteurella multocida sialic acid aldolase (PmNanA), Neisseria meningitidis CMP-sialic acid synthetase (NmCSS), and Pas teurella multocida sialyltransferase 1 M144D mutant (PmSTl_M144D) were expressed and purified as described previously. N-Acetylmannosamine (ManNAc) derivatives N-glycolylmannosamine (ManNGc, 2), 6-azido-6-deoxy-N-acetylmannosamine (ManNAc6N3, 3), 6-acetamido-6- deoxy-N-acetylmannosamine (ManNAc6NAc, 4), 4-deoxy-N-acetylmannosamine
(ManNAc4deoxy, 5) used for Sia2en synthesis as well as Siaα2-3Gai /?NP used for substrate specificity studies were synthesized as described previously.
[0131] DNA sequencing was performed by Genewiz (South Plainfield, NJ). Nuclear Magnetic Resonance (NMR) spectra were recorded in the NMR facility of the University of California, Davis on a Bruker Avance-400 NMR spectrometer (400 MHz for 1H, 100 MHz for 1 C). Chemical shifts are reported in parts per million (ppm) on the δ scale. High resolution electrospray ionization (ESI) mass spectra were obtained using a Thermo Electron LTQ-Orbitrap Hybrid MS at the Mass Spectrometry Facility at the University of California, Davis. Column chromatography was performed using RediSep Rf silica columns or an ODS- SM (C18) column (51 g, 50 μm, 120 A, Yamazen) on the CombiFlash® Rf 200i system. Thin layer chromatography (TLC) was performed on silica gel plates (Sorbent Technologies) using anisaldehyde sugar stain for detection. Gel filtration chromatography was performed with a column (100 cm χ 2.5 cm) packed with Bio-Gel P-2 Fine resins (Bio-Rad). All reagents were at least of reagent grade and were used as supplied without further purification unless indicated.
[0132] Cloning. SpNanC was cloned as a N-maltose binding protein (MBP)-fused and C- His6-tagged recombinant protein in pMAL-c4X vector using genomic DNA of Streptococcus pneumoniae TIGR4 (ATCC#BAA-334D-5) as the template for polymerase chain reactions (PCR). The primers used were: forward primer 5'- GATCGAATTCATGAAAAAAAATATT AAAC AATATG-3 ' (EcoW restriction site is underlined) and reverse primer 5 -ACGCAAGC ΎΤΤΎ AGTGGTGGTGGTGGTGGTG ATTCTTTTTC AG ATCTTC-3' (Hindlll restriction site is underlined and the sequence that encodes the hexahistidine tag is italicized). A26SpNanC- His6 (abbreviated as SpNanC) was cloned as a C-His6-tagged recombinant protein in pET22b(+) vector with N-terminal 26 amino acids truncation using genomic DNA of Streptococcus pneumoniae TIGR4 (ATCC#BAA-334D-5) as the template for polymerase chain reactions (PCR). The primers used were: forward primer 5'-GATCGAATTCGGCTCA GGAGACTGAAACTT-3 ' (EcoRl restriction site is underlined) and reverse primer 5'-ACGC CTCGAGATTCTTTTTC AGATCTTCAATC-3 ' (Xhol restriction site is underlined). [0133] PCR was performed in a 50 reaction mixture containing S. pneumonia TIGR4 genomic DNA (10 ng), forward and reverse primers (0.25 μΜ each), 5 * Herculase reaction buffer (10 μί), dNTP mixture (0.4 mM), and Herculase II fusion DNA polymerase (1 μί). The PCR procedure included an initial cycle of 4 min at 95 °C, followed by 35 cycles of 45 s at 95 °C, 45 s at 52 °C, and 2 min at 72 °C. For the final extension, the reaction was held at 72 °C for 10 min. For MBP-SpNanC-His6, the resulting PCR product was purified and digested with EcoRl and HindUl restriction enzymes. The purified and digested PCR product was ligated with pre-digested pMAL-c4X vector and transformed into electrocompetent E. coli DH5α cells. For A26SpNanC-His6 (abbreviated as SpNanC), the resulting PCR product was purified and digested with EcoRl and Xhol restriction enzymes. The purified and digested PCR product was ligated with pre-digested pET22b(+) vector and transformed into electrocompetent E. coli DH5α cells. Selected clones were grown for minipreps and characterization by restriction mapping. DNA sequences were confirmed by DNA sequencing performed by Genewiz (South Plainfield, NJ). [0134] Expression. Positive plasmids were selected and transformed into E. coli BL21
(DE3) chemical competent cells. The plasmid-bearing E. coli strains were cultured in LB-rich medium (10 g L 1 tryptone, 5 g L 1 yeast extract and 10 g L 1 NaCl) supplemented with ampicillin (100 μg mL-1). Expression of the target protein was achieved by inducing the E. coli culture with 0.5 mM of isopropyl-l-thio- -D-galactopyranoside (IPTG) when OD600 nm reached 0.8 - 1.0 followed by incubating at 20 °C for 20 h with shaking at 190 rpm in a C25KC incubator shaker (New Brunswick Scientific, Edison, NJ).
[0135] Purification. His6-tagged target proteins were purified from cell lysate. To obtain the cell lysate, cell pellet harvested by centrifugation at 4000 rpm for 50 min was resuspended (25 mL L 1 cell culture) in lysis buffer (100 mM Tris-HCl pH 8.0 with 0.1% Triton X-100). Sonication protocol was 3s (sonication)/3s (rest) for a total of 4 min on ice.
Lysed cells were centrifuged at 8,000 rpm for 50 min and the supernatant was collected as the supernatant. Purification of His6-tagged proteins from the lysate was achieved using a Ni2+- resin column. The column was pre-equilibrated with 10 column volumes of binding buffer (5 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl pH 7.5) before the lysate was loaded. After washing with 10 column volumes of binding buffer, the protein was eluted with an elution buffer (200 mM imidazole, 0.1 M NaCl, 50 mM Tris-HCl pH 7.5). Fractions containing the purified enzymes were combined and dialyzed against dialysis buffer (20 mM Tris-HCl pH 7.5 with 10% glycerol) and stored at -80 °C.
[0136] Quantification of Purified Protein. Protein concentration was determined in a 96- well plate using a Bicinchoninic Acid (BCA) Protein Assay Kit (Pierce Biotechnology, Rockford, IL) with bovine serum albumin as a protein standard. The absorbance of each sample was measured at 562 nm by a BioTek Synergy™ HT Multi-Mode Microplate Reader.
[0137] Sodium dodecylsulfate-polyacrylamide gel electrophoresis (SDS-PAGE). SDS- PAGE was performed in a 10% Tris-glycine gel using a Bio-Rad Mini-protein III cell gel electrophoresis unit (Bio-Rad, Hercules, CA) at DC = 150 V. Bio-Rad Precision Plus Protein Standards (10-250 kDa) were used as molecular weight standards. Gels were stained with Coomassie Blue R-250.
[0138] pH Profile by Capillary Electrophoresis (CE) Assays. Enzymatic assays were performed in a 10 reaction mixture containing a buffer (100 mM) with a pH in the range of 5.0-11.0, Neu5Acα2-3Ga NP (2 mM) and SpNanC (10 ng). Buffers used were: MES, pH 5.0-6.5; Tris-HCl, pH 7.0-9.0; N-cyclohexyl-3-aminopropanesulfonic acid (CAPS), pH 10.0. Reactions were allowed to proceed for 30 min at 37 °C and were stopped by adding 10 μL of cold ethanol to each reaction mixture. Samples were centrifuged and the supernatants were analyzed by a P/ACETM Capillary Electrophoresis (CE) system equipped with a Photodiode Array (PDA) detector (Beckman Coulter Inc., Fullerton, CA). CE conditions were as follows: 75 μιτι i.d. capillary, 25 KV/80 μΑ, 5 s vacuum injections, monitored at 300 nm, the running buffer used was sodium tetraborate (25 mM, pH 11.0).
[0139] Effects of MgCh, ethylenediaminetetraacetic acid (EDTA) and dithiothreitol (DTT). Microtiter plate assays were used to study the effect of MgCh or DTT. Reactions were carried out at 37 °C in duplicate in 384-well plates with a final volume of 20 μί containing the Tris-HCl buffer (100 mM, pH 7.0), SpNanC (40 ng), Neu5Acα2-3Ga NP (0.3 mM), β-galactosidase (12 μg) and different concentrations of MgCh (5 mM, 10 mM, 20 mM, 50 mM) or EDTA (0.2 mM, 1 mM, 5 mM, 10 mM) or DTT (5 mM, 10 mM). Reactions were allowed to proceed for 30 min and were stopped by adding 40 μί CAPS buffer (0.5 M, pH 10.5). The amount of the />-nitrophenolate formed was determined by measuring the absorbance of the reaction mixtures at 405 nm using a microtiter plate reader. Reactions with Gal ^NP (0.3 mM) and β-galactosidase (12 μg) in Tris-HCl buffer (100 mM, pH 7.0) were used as controls. The amount of excess β-galactosidase to be used was predetermined to ensure the complete and fast hydrolysis of the Gai /?NP.
[0140] Kinetics of 0c2-3-Sialidase Activity by Capillary Electrophoresis (CE) Assays.
Assays were carried out in duplicate in a total volume of 10 in Tris-HCl buffer (pH 7.0, 100 mM) containing SpNanC (12 ng) and Neu5Acα2-3Gai /?NP. All reactions were allowed to proceed for 10 min at 37 °C. Apparent kinetic parameters were obtained by varying the Neu5Acα2-3Ga NP concentration from 0.5 to 10.0 mM (0.5 mM, 1.0 mM, 2.0 mM, 4.0 mM, 8.0 mM and 10.0 mM). The reaction mixture was stopped were stopped by adding 10 μL of cold ethanol. Apparent kinetic parameters were obtained by fitting the data into the Michaelis-Menten equation using Grafit 5.0.
[0141] Substrates Specificity Assays. Sialidase substrate specificity assays were carried out at 37 °C in duplicate in 384-well plates in a final volume of 20 containing the Tris- HCl buffer (100 mM, pH 7.0), SpNanC (2 μg), a sialoside substrate (0.3 mM), and a β- galactosidase (12 μg). Reactions were carried out for 30 min and were stopped by adding the 40 μΐ. CAPS buffer (0.5 M, pH 10.5).
[0142] To produce Sia2ens from the corresponding six-carbon precursors of sialic acids, four enzymes were employed (Scheme 3): a sialic acid aldolase from Pasteu -ella multocida (PmAldolase), a CMP-sialic acid synthetase from Neisseria meningitidis (NmCSS), a Pasteurella multocida sialyltransferase 1 mutant (PmSTl_M144D), and SpNanC. The PmAldolase catalyzes the formation of sialic acid from its six-carbon monosaccharide precursor and pyruvate. The NmCSS catalyzes the conversion of cytidine 5 '-triphosphate (CTP) and sialic acid for the formation CMP-sialic acid, which was used together with an acceptor such as lactose by PmSTl_M144D for the synthesis of the corresponding α2-3- linked sialosides, providing the substrates for SpNanC for the production of the desired Sia2ens. Scheme 3. One-pot four-enzyme (OP4E) synthesis of Sia2ens.
Figure imgf000039_0001
[0143] To obtain sufficient amounts of SpNanC for the OPME synthesis of Sia2ens, full length SpNanC from Streptococcus pneumonia TIGR4 was cloned in pMAL-c4X vector and expressed as an N-terminal maltose binding protein (MBP)-fused and C-terminal His6-tagged recombinant protein in Escherichia coli BL21(DE3) cells. Ni2+-affinity column purified MBP-SpNanC-His6 showed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) analysis, in addition to a faint band at around 120 kDa with the expected size of the fusion protein, there was a major band at about 80 kDa corresponding to the protein without the MBP-tag. N-Terminal protein sequencing of the major band indicated that the MBP tag and the first twenty-six amino acids (26 aa) of SpNanC was cleaved during the expression and purification. The resulting protein retained its activity. The N-terminal 26 aa- truncated protein was re-cloned in pET22b(+) vector as a C-His6-tagged recombinant protein (A26SpNanC-His6). About 108 mg Ni2+-column purified A26SpNanC-His6 (abbreviated as SpNanC) can be routinely obtained from one liter E. coli culture.
[0144] pH profile study of SpNanC using Neu5Acα2-3Gai /?NP as the substrate and capillary electrophoresis (CE) detection at A3oo nm (FIG. 1) indicated that the enzyme is active in a pH range of 6.0-9.0 and has highest activity at pH 7.0. It does not require a metal ion for activity and the addition of a reducing reagent dithiothreitol (DTT) does not affect its activity (FIG. 2). Kinetics studies indicated that SpNanC is a highly active sialidase using
Neu5Acα2-3Ga NP as the substrate (kCatlKM = 150 s"1 rnM"1 with KM = 2.7 ± 0.5 mM and kcat = 406.8 ± 39.0 s_1) compared to a previously reported recombinant SpNanC using a2-3- sialyllactose as the substrate
Figure imgf000040_0001
Figure imgf000040_0002
[0145] Substrate specificity studies of SpNanC using a library of /¾zra-nitrophenol (/?NP)- tagged a2-3-linked sialosides indicated that the enzyme can tolerate Neu5Ac modifications at C-5, C-9, and C-7.
Table 1. Substrate specificity of SpNanC.
Figure imgf000040_0003
[0146] Different from what was described in a previous report, sialosides with non-human sialic acid form N-glycolylneuraminic acid (Neu5Gc) and its C-9 derivatives are also suitable substrates for the enzyme. Sialosides containing 2-keto-3-deoxynonulsonic acid (Kdn) or its derivatives with modifications at C-5, or C-9 are not effective substrates of SpNanC. Among compounds tested, two of the sialosides containing C7-modified Kdn (Kdn70Meα2- 3Gai /?NP and Kdn7deoxyα2-3Gai /?NP) were able to be cleaved off by SpNanC with low yields (23% and 10% respectively in reactions using 3 μg of SpNanC) (Table 1).
[0147] The substrate promiscuities of SpNanC and enzymes involved in one-pot multi enzyme (OPME) synthesis of sialosides provided an opportunity for synthesizing Sia2ens from six-carbon precursors of sialic acids. Because SpNanC has a dual function of forming Neu5Ac2en from sialosides and further hydration of Neu5Ac2en to form Neu5Ac, the effects of SpNanC loading in the one-pot four-enzyme reaction was studied. A concentration of SpNanC in the range of 0.004-0.04 mg/mL was useful for reactions containing 10 mM of the ManNAc precursor, as assessed by conducting small scale reactions followed by thin layer chromatography (TLC) and mass spectroscopy analyses suggested that. Secondly, the choice of the acceptor and the amount needed to be considered. Due to its low cost, commercially available lactose was chosen as the acceptor. As shown in Scheme 3, lactose is used as a sialyltransferase acceptor and is regenerated in the SpNanC reaction. Therefore, only a catalytic amount of lactose is needed for the Sia2en production reactions. For example, 0.25 equivalents (2.5 mM) of lactose provided a good reaction rate. Thirdly, the choice of pH of the reaction mixture was considered. SpNanC is active in a pH range of 6.0- 9.0 and has highest activity at pH 7.0 and good activity in the pH range of 6.0-7.5 (FIG. 1) while NmCSS is active in the pH range of 7.0-10.0 with highest activity at pH 9.0.
PmAldolase has good activity in the pH range of 6.0-9.0 and wild-type PmSTl maintains good a2-3-sialyltransferase activity in the pH range of 6.0-10.0. A pH of 7.5 with Tris-HCl buffer was chosen for the OPME reaction to balance the pH preference of SpNanC and NmCSS. Neu5Ac2en (6) can be synthesized from ManNAc (1) in 72% yield using the methods described herein.
Example 2. Pre-formation of Sialosides Increases Sia2en Yields. [0148] Similar reaction conditions were applied to N-glycolylmannosamine (ManNGc, 2, the six-carbon precursor for non-human Neu5Gc) for the synthesis of Neu5Gc2en (7).
Surprisingly, only a trace amount of the desired product was obtained. To overcome this challenge, an alternative two-step procedure was developed. In this case, a one-pot three- enzyme sialoside formation reaction with equal molar amounts of lactose and ManNGc was carried out overnight before SpNanC was added. The yield for Neu5Gc2en (7) was improved to 60% by the two-step procedure. A similar two-step procedure applied for the synthesis of Neu5Ac2en (6) was able to improve the yield from 72% of the one-step procedure to 82%. Table 2. Sia2ens obtained by OPME synthesis.
Figure imgf000042_0001
[0149] One-pot four-enzyme (OP4E) synthesis of Sia2ens (One-step procedure).
ManNAc or its derivatives (20-300 mg), lactose (0.25 equiv.), sodium pyruvate (8 equiv.), CTP (1.5 equiv.) were dissolved in Tris-HCl buffer (100 mM, pH 7.5, 10-20 mL) containing 20 mM of MgCh. The pH of the solution was further adjusted to 7.5 with 4 M NaOH.
PmAldolase (1.5-3.0 mg), NmCSS (1.0-2.0 mg), PmSTl_M144D (2.0-4.0 mg), SpNanC (0.05-0.2 mg) were added and the reaction was incubated in an isotherm incubator for 3-6 h at 37 °C with agitation at 100 rpm. The reaction was quenched by adding the same volume of ice-cold ethanol and incubating at 4 °C for 1 h. The formed precipitates were removed by centrifugation and the supernatant was concentrated. The residue was purified gradually by passing it through a BioGel P-2 gel filtration column, a silica column (EtOAc/MeOH/LhO = 4:2:0.2), followed by a C18 column (100% H2O) to give the pure compound.
[0150] One-pot four-enzyme (OP4E) synthesis of Sia2ens (Two-step procedure).
ManNAc or its derivatives (20-300 mg), lactose (1.0 equiv.), sodium pyruvate (8 equiv.), CTP (1.5 equiv.) were dissolved in Tris-HCl buffer (100 mM, pH 8.5, 10-20 mL) containing 20 mM of MgCh. The pH of the solution was further adjusted to 8.5 with 4 M NaOH.
PmAldolase (1.5-3.0 mg), NmCSS (1.0-2.0 mg), PmSTl_M144D (2.0-4.0 mg) were added and the reaction was incubated in an isotherm incubator overnight at 37 °C with agitation at 100 rpm to ensure a full completion of the sialoside formation. SpNanC (0.05-0.2 mg) was added afterwards and the reaction was incubated for another 3-8 h until the reaction was finished. The work-up procedures were the same as described in the one-step procedure.
[0151] 5-Acetamido-2,6-anhydro-3,5-dideoxy-D-glycero-D-galacto-non-2-enonic acid (Neu5Ac2en, 6). Yield, 72% for one-step procedure; 82% for two-step procedure; white solid. The spectroscopic data coincide with the previous report.
[0152] 2,6-Anhydro-3,5-dideoxy-5-glycolylamido-D-glycero-D-galacto-non-2-enonic acid (Neu5Gc2en, 7). Yield, < 5% based on TLC for one-step procedure; 60% for two-step procedure; white solid. The spectroscopic data coincide with the previous report. [0153] 5-Acetamido-2,6-anhydro-9-azido-3,5,9-trideoxy-D-glycero-D-galacto-non-2- enonic acid (Neu5Ac9N32en, 8). Yield, 61% for one-step procedure; 79% for two-step procedure; white solid. The spectroscopic data coincide with the previous report.
[0154] 5,9-Diacetamido-2,6-anhydro-3,5,9-trideoxy-D-glycero-D-galacto-non-2-enonic acid (Neu5Ac9NAc2en, 9). Yield, 63% for one-step procedure; 71% for two-step procedure; white solid. ¾ NMR (400 MHz, D2O) δ 6.02 (d, J= 2.4 Hz, 1H, H-3), 4.51 (dd, J = 8.8, 2.4 Hz, 1H, H-4), 4.29 (dd, J= 10.8, 1.2 Hz, 1H, H-6), 4.09 (dd, J= 10.8, 8.8 Hz, 1H, H-5), 3.96 (ddd, J = 9.2, 7.4, 3.2 Hz, 1H, H-8), 3.62 (dd, J = 14.2, 3.2 Hz, 1H, H-9), 3.55 (dd, J = 9.2, 1.2 Hz, 1H, H-7), 3.29 (dd, J= 14.2, 7.4 Hz, 1H, H-9), 2.07 (s, 3H, COCH3), 2.02 (s, 3Η, COCH3); 13C NMR (100 MHz, D2O) δ 174.69, 174.62, 165.75, 143.91, 112.14, 75.76, 69.25, 68.33, 67.06, 49.60, 42.59, 22.05, 21.79; HRMS (ESI) Anal. Calcd for C13H19N2O8 [M-H]": 331.1147, Found: 331.1131.
[0155] 5-Acetamido-2,6-anhydro-3,5,7-trideoxy- D-glycero-D-galacto-non-2-enonic acid (Neu5Ac7deoxy2en, 10). Yield, 11% for one-step procedure; 25% for two-step procedure. ¾ NMR (400 MHz, D2O) δ 5.75 (d, J = 2.8 Hz, 1H, H-3), 4.36 (dd, J= 8.0, 2.8 Hz, 1H, H-4), 4.15 (td, J = 9.6, 2.4 Hz, 1H, H-6), 4.08 - 4.00 (m, 1H, H-8), 3.87 (dd, J= 9.6, 8.0 Hz, 1H, H-5), 3.61 (dd, J= 11.6, 4.0 Hz, 1H, H-9), 3.49 (dd, J = 11.8, 6.8 Hz, 1H, H-9), 2.06 (s, 3H, COCH3), 1.84-1.76 (m, 1Η, Η-7), 1.74-1.66 (m, 1Η, H-7); 13C NMR (100 MHz, D2O) δ 174.42, 169.61, 147.88, 107.49, 74.13, 67.39, 66.95, 65.73, 53.43, 33.73, 22.06; HRMS (ESI) Anal. Calcd for CiiHieNOv [M-H]": 274.0932, Found: 274.0916. [0156] In general, the one-pot procedure is more time efficient and the reactions are usually completed within a 2-6 hour time frame. In comparison, the two-step procedure is commonly performed for 12-20 hours in total but can improve the synthetic yield especially for the processes with slow sialoside formation rates.
[0157] The enzymatic approach compared favorably to the traditional chemical methods which used organic solvents and involved multiple protection and deprotection steps. For example, chemical synthesis of Neu5Ac9NAc2en (9) from Neu5Ac involved nine steps and multiple purification processes with an overall yield of 9-14% (see, Magesh, et al. Bioorg. Med. Chem. Lett. 2008, 18, 532-537). For the chemoenzymatic approach described here, ManNAc6NAc (4) was chemically synthesized from ManNAc via ManNAc6N3 (3) intermediate in three steps with a 48% overall yield. Considering the 63% or 71% yield for the one-step or two-step OPME synthetic process (Table 2), the overall yield for
Neu5Ac9NAc2en (9) was 30% or 34% starting from ManNAc without the need of purifying the intermediates of enzymatic reactions.
Example 3. Synthetic Elaboration of Sia2ens at C-5, C-9, and C-7.
[0158] Other than OPME synthesis of Neu5Gc2en, the synthesis of a C-5 derivative of Neu5Ac2en and C-9 derivatives of Neu5Ac2en were also carried out. Neu5Ac9N32en (8) containing an C9-azido group was synthesized from ManNAc6N3 (3) in a yield of 61% using the one-step procedure, and 79% with the two-step procedure. Similarly, Neu5Ac9NAc2en (9) containing a C9-acetamido group was synthesized from ManNAc6NAc (4) in a yield of 63% with the one-step procedure and 71% using the two-step procedure. Neu5Ac9NAc2en (9) is a more stable analog of Neu5Ac90Ac2en and may be a better inhibitor for sialidases that prefer to cleave 9-O-acetyl Neu5Ac.
[0159] The OPME system was also tested for the synthesis of a C-7 derivative of
Neu5Ac2en. The one-step procedure was able to obtain the target compound
Neu5Ac7deoxy2en (10) from ManNAc4deoxy (5) in a low 11% yield. The two-step procedure was able to improve the yield to 25%. The lower yield was believed to be due to the lower efficiency in sialoside formation.
Derivatization at C-9 of Neu5Ac9N32en
[0160] 5-Acetamido-9-amino-2,6-anhydro-3,5,9-trideoxy-D-glycero-D-galacto-non-2- enonic acid (Neu5Ac9NH22en, 11). To a stirred solution of Neu5Ac9N32en (40 mg, 0.12 mmol) in mixed solvent of pyridine/FhO (1.5 mL/1.5 mL), 1,3-propanedithiol (120 μί, 1.2 mmol) and triethylamine (160 μί, 1.1 mmol) were added and the mixture was stirred for 24 h. The solvent was concentrated in vacuo. The crude product was re-dissolved in water. One drop of 1M NaOH was added to replace the triethylamine salt formed with the carboxylic acid. The solution was passed through a BioGel P-2 gel filtration column to give 11 (35 mg, 95%) as a white solid. This compound was directly utilized for subsequent reactions without further characterization.
[0161] 5-Acetamido-2,6-anhydro-3,5,9-trideoxy-9-valeramido-D-glycero-D-galacto- non-2-enonic acid (Neu5Ac9NPent2en, 12). To a stirred solution of Neu5Ac9NH22en (15.8 mg, 0.0506 mmol) in mixed solvent of THF/H2O (2.0 mL/0.5 mL), pentanoyl chloride (12 μί, 0.10 mmol) and triethylamine (35 μί, 0.25 mmol) were added and the mixture was stirred for 2.5 h. The solvent was concentrated in vacuo. The crude product was re-dissolved in water. One drop of 1M NaOH was added to replace the triethylamine salt formed with the carboxylic acid. The solution was passed through a BioGel P-2 gel filtration column to give 12 (18.2 mg, 91%) as a white solid. ¾ NMR (400 MHz, D2O) δ 5.70 (d, J= 2.4 Hz, 1H, H- 3), 4.47 (dd, J = 8.8, 2.4 Hz, 1H, H-4), 4.22 (dd, J= 10.8, 1.2 Hz, 1H, H-6), 4.06 (dd, J = 10.8, 8.8 Hz, 1H, H-5), 3.98 (ddd, J = 9.2, 7.0, 3.2 Hz, 1H, H-8), 3.58 (dd, J = 14.2, 3.2 Hz, 1H, H-9), 3.51 (dd, J = 9.2, 1.2 Hz, 1H, H-7), 3.37 (dd, J= 14.2, 7.0 Hz, 1H, H-9), 2.36-2.23 (m, 2H, CH2), 2.08 (s, 3Η, COCH3), 1.64-1.52 (m, 2Η, CH2), 1.39 - 1.26 (m, 2Η, CH2), 0.90 (t, J= 7.4 Hz, 3H, CH3); 1 C NMR (100 MHz, D2O) δ 177.89, 174.60, 169.59, 147.92, 107.60, 75.20, 69.41, 68.33, 67.55, 49.92, 42.37, 35.51, 27.66, 22.11, 21.54, 12.98; HRMS (ESI) Anal. Calcd for C16H25N2O8 [M-H]": 373.1616, Found: 373.1597.
[0162] 5-Acetamido-2,6-anhydro-9-cyclopropylcarboxamido-3,5,9-trideoxy-D-glycero- D-galacto-non-2-enonic acid (Neu5Ac9NCyclopro2en, 13). To a stirred solution of Neu5Ac9NH22en (19.3 mg, 0.0618 mmol) in mixed solvent of THF/H2O (2.0 mL/0.5 mL), cyclopropanecarbonyl chloride (11 μί, 0.12 mmol) and triethylamine (43 μΐ., 0.31 mmol) were added and the mixture was stirred for 5 h. The solvent was concentrated in vacuo. The crude product was re-dissolved in water. One drop of 1M NaOH was added to replace the triethylamine salt formed with the carboxylic acid. The solution was passed through a BioGel P-2 gel filtration column to give 13 (26.2 mg, 85%) as a white solid. ¾ NMR (400 MHz, D2O) δ 5.70 (d, J = 2.4 Hz, 1H, H-3), 4.47 (dd, J= 8.8, 2.4 Hz, 1H, H-4), 4.22 (dd, J = 10.8, 1.2 Hz, 1H, H-6), 4.06 (dd, J= 10.8, 8.8 Hz, 1H, H-5), 3.99 (ddd, J= 9.4, 7.2, 3.2 Hz, 1H, H- 8), 3.62 (dd, J = 14.2, 3.2 Hz, 1H, H-9), 3.51 (dd, J= 9.2, 1.2 Hz, 1H, H-7), 3.37 (dd, J = 14.2, 7.2 Hz, 1H, H-9), 2.08 (s, 3H, COCH3), 1.73-1.61 (m, 1Η, CH), 0.89-0.83 (m, 4Η, CH2CH2); 13C NMR (100 MHz, D2O) δ 177.84, 174.58, 169.60, 147.92, 107.57, 75.17, 69.34, 68.39, 67.53, 49.88, 42.65, 22.09, 13.97, 6.69, 6.62; HRMS (ESI) Anal. Calcd for C15H21N2O8 [M-H]-: 357.1303, Found: 357.1285.
Derivatization at C-5 of Neu5Ac2en
[0163] 5-Amino-2,6-anhydro-3,5-dideoxy-D-glycero-D-galacto-non-2-enonic acid (Neu2en, 14). A solution of Neu5Ac2en (200 mg, 0.639 mmol) in 2M NaOH (10 mL) was stirred at 75 °C for 12 h. The solution was directly passed through a BioGel P-2 gel filtration column to give 14 (156 mg, 90%) as a white solid. This compound was directly utilized for subsequent reactions without further characterization.
[0164] 2,6-Anhydro-3,5-dideoxy-5-glycolylamido-D-glycero-D-galacto-non-2-enonic acid (Neu5Gc2en, 7). To a stirred solution of Neu2en (22.3 mg, 0.0822 mmol) in anhydrous MeOH (1 mL), acetoxyacetyl chloride (17 μί, 0.16 mmol) and K2CO3 (22.7 mg, 0.16 mmol) were added and the mixture was stirred for 6 h. The solvent was concentrated in vacuo. The crude product was re-dissolved in H2O (2 mL), and the pH of the solution was adjusted to 10- 11 by adding 1M NaOH. The solution was stirred for 1 h and was neutralized by
Dowex®50WX4 ion-exchange resin (H+). The solvent was concentrated in vacuo. The crude product was purified by column chromatography (EtOAc/MeOH/H20 = 4:2:0.2), followed by a short BioGel P-2 gel filtration column to give 7 (20.3 mg, 74.8%) as a white solid. The spectroscopic data coincide with the previous report.
[0165] 2,6-Anhydro-3,5-dideoxy-5-phenylacetamido-D-glycero-D-galacto-non-2- enonic acid (Neu5PhAc2en, 15). To a stirred solution of Neu2en (40.0 mg, 0.147 mmol) in mixed solvent of THF/H2O (3.0 mL/1.5 mL), phenylacetyl chloride (80 μί, 0.60 mmol) and triethylamine (200 μί, 1.43 mmol) were added and the mixture was stirred for 24 h. The solvent was concentrated in vacuo. The crude product was purified by column
chromatography (EtOAc/MeOH/H20 = 4:2:0.2). The product was re-dissolved in water. One drop of 1M NaOH was added to replace the triethylamine salt formed with the carboxylic acid. The solution was passed through a BioGel P-2 gel filtration column to give 15 (28.0 mg, 49%) as a white solid. ¾ NMR (400 MHz, D2O) δ 7.58 - 7.14 (m, 5H, CeHs), 5.69 (d, J = 2.4 Hz, 1H, H-3), 4.50 (dd, J= 8.8, 2.4 Hz, 1H, H-4), 4.22 (dd, J= 10.8, 1.2 Hz, 1H, H-6), 4.06 (dd, J= 10.8, 8.8 Hz, 1H, H-5), 3.89 (ddd, J= 9.6, 6.4, 2.6 Hz, 1H, H-8), 3.81 (dd, J = 12.0, 2.6 Hz, 1H, H-9), 3.69 (d, J = 3.2 Hz, 2H, CH2), 3.52 (dd, J = 12.0, 6.4 Hz, 1H, H-9), 3.40 (dd, J= 9.6, 1.2 Hz, 1H, H-7); 13C NMR (100 MHz, D2O) δ 175.25, 169.62, 147.85, 134.91, 129.10, 128.98, 127.37, 107.64, 75.19, 69.76, 68.25, 67.34, 63.17, 49.89, 42.63; HRMS (ESI) Anal. Calcd for C17H20NO8 [M-H]": 366.1194, Found: 366.1176.
[0166] Enzymatic synthesis of Neu5AcaOMe. Neu5Ac2en (100.5 mg, 0.3208 mmol) was dissolved in a mixed solvent of FhO/MeOH (7.5 mL/2.5 mL) containing Tris-HCl buffer (100 mM, pH 7.0). SpNanC (8 mg) was added in two portions at an interval of 4 h and the reaction was incubated in an isotherm incubator for 24 h at 37 °C with agitation at 100 rpm. The reaction was quenched by adding the same volume of ice-cold ethanol and incubating at 4 °C for 1 h. The formed precipitates were removed by centrifugation and the supernatant was concentrated. The residue was purified by column chromatography (EtOAc/MeOH/FhO = 5:2:0.2) followed by a C18 column (100% H2O) to give Neu5AcaOMe (71.8 mg, 65%) as a white solid. The spectroscopic data coincide with the previous report.
[0167] The C9-azido group of Neu5Ac9N32en (8) allows further derivatization to be carried out. The azido group of Neu5Ac9N32en (8) was reduced to a free amino group with 1,3-propanedithiol to produce intermediate 11, after which different groups were installed (Scheme 4). This provided for the preparation of Neu5Ac9NPent2en (12), with an improved selectivity against human NEU1, and Neu5Ac9NCyclopro2en (13), with a higher selectivity against viral sialidases.
Scheme 4. Derivatization at C-9 of Neu5Ac9N 2en (8).
Figure imgf000047_0001
Reagents and conditions: (a) 1,3-propanedithiol, TEA, Py/FhO, 95%; (b) pentanoyl chloride, TEA, THF/H2O, 91%; (c) cyclopropanecarbonyl chloride, TEA, THF/H2O, 85%.
[0168] The C-5 group of Neu5Ac2en (6) can also be easily derivatized by removal of the N-acetyl group at C-5 using 2 M of sodium hydroxide solution to produce Neu2en (14) with a free amino group at C-5. Selective acylation of the amino group on C-5 afterwards provided the C5-derivatized Sia2ens conveniently (Scheme 5). Neu5Gc2en (7) was again generated by this method. Neu5PhAc2en (15) was also synthesized conveniently. Scheme 5. Derivatization at C-5 of Neu5Ac2en (6).
Figure imgf000048_0001
Reagents and conditions: (a) 2M NaOH, 75 °C, 90%; (b) 1) Acetoxyacetyl chloride, K2CO3, MeOH, 2) NaOH, 75%; (c) Phenylacetyl chloride, TEA, THF/H2O, 49%.
Example 4. Sialidase Inhibition with Sia2ens.
[0169] Inhibition assays were carried out in duplicates in 384-well plates in a final volume of 20 containing Neu5Aca2-3Gai >NP (0.3 mM) and β-galactosidase (12 μg) with or without inhibitors. The assay conditions varied for different sialidases as described below: SpNanA (0.0015 μg), NaOAc buffer (100 mM, pH 6.0); SpNanB (0.003 μg), NaOAc buffer (100 mM, pH 6.0); SpNanC (0.02 μg), MES buffer (100 mM, pH 6.5); AuSialidase (1.0 mU), NaOAc buffer (100 mM, pH 5.5); CpNanI (2.0 mU), MES buffer (100 mM, pH 5.0); CpNanH (0.5 mU), MES buffer (100 mM, pH 5.0); VcSialidase (1.5 mU), NaCl (150 mM), CaCh (10 mM), NaOAc buffer (100 mM, pH 5.5); PmSTl (34.4 μg), NaOAc buffer (100 mM, pH 5.5); BiNanH2, NaOAc buffer (100 mM, pH 5.0); hNEU2 (22.0 μg), MES buffer (100 mM, pH 5.0). The reactions were incubated for 30 min at 37 °C, and were stopped by adding CAPS buffer (N-cyclohexyl-3-aminopropane sulfonic acid, 40 μί, 0.5 M, pH 10.5). The amount of the /?ara-nitrophenolate formed was determined by measuring the ^405■ of the reaction mixtures using a microplate reader. [0170] The percentage inhibitions were determined using a concentration of 0.1 mM of each inhibitor, with reactions without inhibitors as controls. IC50 values were tested by varying the concentrations of inhibitors from 0 to 1000 μΜ to get the concentration-response plots of the inhibitors. The values of IC50 were calculated by the software Grafit 5.0.
[0171] The obtained compounds were tested as inhibitors against several glycoside hydrolase GH33 family sialidases as described above. The sialidases were categorized based on their protein sequence similarity in the Carbohydrate Active Enzyme (CAZy) database. These include human cytosolic sialidase hNEU2 and several bacterial sialidases including recombinant enzymes cloned from Streptococcus pneumoniae (SpNanA, SpNanB, and SpNanC), Pasteur ella multocida (PmSTl), Bifidobacterium infantis (BiNanH2), as well as commercially available sialidases from Arthrobacter ureafaciens (AuSialidase), Clostridium perfringens (CpNanI, CpNanH), and Vibrio cholerae (VcSialidase). Inhibition studies using Neu5Acα2-3Gai /?NP as the sialidase substrate and 0.1 mM of each inhibitor showed that overall, Neu5Ac2en (6) and its derivatives at C5, C9, and C7 are not suitable inhibitors against SpNanB, SpNanC, CpNanH, and PmSTl (Table 3).
Table 3. Percentage inhibition (%) of Sia2ens against bacterial and human sialidases.
Figure imgf000049_0002
Figure imgf000049_0001
[0172] On the other hand, Neu5Ac2en (6) is an overall broad spectrum inhibitor among all compounds tested and had more than 50% inhibition against SpNanA, AuSialidase, CpNanI, VcSialidase, BiNanH2, and hNEU2. In comparison, Neu5Gc2en (7) was much more selective and had more than 50% inhibition against only VcSialidase and hNEU2 as reported previously. C9-Derivatization of Neu5Ac2en such as Neu5Ac9Ac2en (9),
Neu5Ac9NPent2en (12), and Neu5Ac9NCyclopro2en (13) did not affect the percentage inhibition of SpNanA, CpNanI, or BiNanH2 but lower the inhibitory activity against AuSialidase, VcSialidase. The C9-modification of Neu5Ac2en was not well tolerated by hNEU2. In comparison, C5 -derivatization of Neu5Ac2en by substituting the N-acetyl group with an N-benzylcarbonyl group (Neu5PhAc2en, 15) was only well tolerated by hNEU2, but not by any bacterial sialidases tested. It was shown previously that α2-3-sialyl Gai /?NP containing a terminal C7-deoxy Neu5Ac was a good substrate for several bacterial sialidases such as PmSTl, VcSialidase, Salmonella typhimurium sialidase, SpNanB, and CpNanI, but was a poor substrate for hNEU2. It was hypothesized that Neu5Ac7deoxy2en (10) would be an inhibitor selective against several bacterial sialidases but not hNEU2. Indeed, it retained the inhibitory activity of Neu5Ac2en (6) against SpNanA, AuSialidase, CpNanI. However, the inhibition against VcSialidase, BiNanH2, and hNEU2 was decreased simultaneously. [0173] For inhibitors with more than 65% inhibitory activity at 0.1 mM, IC50 values were obtained. As shown in Table 4, derivatization at C-5, and C-9 of Neu5Ac2en (6) did not alter its inhibitory activity against SpNanA or BiNanH2 significantly with IC50 values retained at around 6.8-11.0 μΜ and 29-40 μΜ, respectively. The C7-deoxy modification also did not alter the inhibition activity against SpNanA, but decreased inhibitor activity against
AuSialidase and increased IC50 value from 8.1 μΜ to 17 μΜ.
Table 4. IC50 values of Sia2ens against bacterial sialidases SpNanA, AuSialidase, and
BiNanH2.
Figure imgf000050_0001
[0174] A one-pot enzymatic strategy has been successfully developed for the synthesis of sialidase transition state analog inhibitors 2,3-dehydro-2-deoxy-sialic acids (Sia2ens) using the unique property of SpNanC-catalyzed reaction. Such compounds can be further derivatized at various positions and can be readily converted stereo-specifically to methyl α- sialosides as demonstrated for Neu5AcαOMe (16). Inhibition studies demonstrated improved selectivity of several Neu5Ac2en (6) derivatives with modifications at C-5 or C-9. Example 5. Sia2en Hydration Using SpNanC
[0175] SpNanC-catalyzed hydration of Neu5Ac2en (6) was explored for the synthesis of sialoside Neu5AcαOMe (16), a high value compound that has been used to remove anti- Neu5Ac antibodies in affinity column purification of anti-Neu5Gc antibodies and a probe for binding studies. The effects of methanol in the aqueous reaction mixtures was studied. A final percentage of 20-25% methanol was found to provide a good balance of enzyme activity and product yield. As shown in Scheme 6, Neu5AcαOMe (16) was successfully synthesized with a good 65% yield in the presence of 25% methanol. The only byproduct was Neu5Ac which was readily recovered. The advantage of the method lies in its stereo-selectivity. Once bound to the active site of SpNanC, water or methanol molecule was added only from the α-face of Neu5Ac2en (6) to form α-Neu5Ac or α-sialoside. This provides a convenient strategy of converting Neu5Ac2en byproduct formed in common chemical glycosylation reactions to a useful sialoside. Here, Neu5Ac2en serves as a novel sialylation donor.
Schem 6. SpNanC-catalyzed synthesis of Neu5AcαOMe from Neu5 Ac2en.
Figure imgf000051_0001
[0176] Besides the direct formation of Neu5 AcaOMe from Neu5Ac2en in the presence of methanol, the hydration of Neu5Ac2en derivatives by SpNanC was also explored. This can provide the sialic acid donor which can be used in the one-pot multi enzyme (OPME) synthesis of sialosides. As shown in Scheme 7, the hydration of Sia2ens by SpNanC provided the corresponding sialic acids, serving as an alternative source of sialic acids to the sialic acid aldolase-catalyzed reaction. SpNanC is an α2-3-specific sialidase, thus this strategy works extremely well for the formation of α2-6-sialosides. The enzymes can be used in a stepwise process, where the SpNanC hydration reaction is carried out and quenched once completed, after which NmCSS and a2-3-sialyltransferase are added to form α2-3-linked sialosides. Scheme 7. SpNanC-catalyzed one-pot multienzyme (OPME) synthesis of sialosides from Sia2ens.
Figure imgf000052_0001
[0177] Various Sia2ens with different modifications were tested using LacβProN3 as the sialylation acceptor. As shown in Table 5, Neu5Ac2en as well as its 9-modification were well tolerated by this strategy. Neu5Gc2en was not a good substrate for this reaction, due to the less efficient recognition of Neu5Gc derivatives by SpNanC. However, other 5-modified Neu5Ac2en which are recognized by SpNanC can be good substrates for this reaction.
Table 5. SpNanC-catalyzed one-pot multienzyme (OPME) synthesis of a2-6-sialosides from
Sia2ens as the synthon.
Figure imgf000052_0002
Example 6. Preparation of 2,7-Anhydro-Sialic Acids.
[0178] 2,7-anhydro-sialic acids were prepared from N-acetylmannosamine (ManNAc), mannose, or derivatives using the synthetic scheme showed in Scheme 8.
Scheme 8. SpNanB-catalyzed synthesis of 2,7-andydro-sialic acids.
Figure imgf000053_0001
R1 = NHAc, NHGc, N3, or AcN3, R2 = OH; Yields: 60-92%
[0179] One-pot multienzyme reaction was carried out in Tris-HCl buffer solution (100 mM, pH 8.5) with N-acetylmannosamine (ManNAc), mannose, or derivatives (100 mM), sodium pyruvate (300 mM), cytidine-5 ' -triphosphate (CTP, 120 mM), MgCh (20 mM), Lactose (25 mM), PmNanA (0.15 mg/mL), NmCSS (0.25 mg/mL) , PmSTl M144D (0.25 mg/mL), SpNanB (0.2 mg/mL). The mixture is incubated at 37 °C for 6 h with shaking. 5 mL cold methanol was added to stop reaction, and insoluble material removed by centrifugation. Purification by Bio-Gel P-2 size exclusion column followed by normal phase Amino HILIC purification (ACN/H2O) produced the desired 2,7-anhydro sialic acid or derivatives.
Example 7. Preparation of 2,7-Anhydro-Sialic Acids. [0180] Experimental Methods
[0181] Recombinant sialidases were expressed and purified as reported previously for human cytosolic sialidase hNEU2, as well as bacterial sialidases from Streptococcus pneumoniae (SpNanA, SpNanB, and SpNanC), Pasteur ella multocida sialyltransferase 1 with α2-3-sialidase activity (PmSTl), and Bifidobacterium infantis sialidase BiNanH2.
Commercially available bacterial sialidases used included those from Arthrobacter ureafaciens (Prozyme), Clostridium perfringens CpNanI (Sigma-Aldrich), and Vibrio cholerae (Sigma-Aldrich). Aspergillus oryzae β-galactosidase was purchased from Sigma- Aldrich. Pasteurella multocida sialic acid aldolase (PmNanA), Neisseria meningitidis CMP- sialic acid synthetase (NmCSS), and Pasteurella multocida sialyltransferase 1 M144D mutant (PmSTl_M144D) were expressed and purified as described previously. Siaα2-3Gai /?NP used for substrate specificity studies were synthesized as described previously.
[0182] Nuclear Magnetic Resonance (NMR) spectra were recorded in the NMR facility of the University of California, Davis on a Bruker Avance-400 NMR spectrometer (400 MHz for ¾, 100 MHz for 1 C). Chemical shifts are reported in parts per million (ppm) on the δ scale. High resolution electrospray ionization (ESI) mass spectra were obtained using a Thermo Electron LTQ-Orbitrap Hybrid MS at the Mass Spectrometry Facility at the
University of California, Davis. Column chromatography was performed using RediSe/? Rf silica columns or an ODS-SM (CI 8) column (51 g, 50 μιτι, 120 A, Yamazen) on the
CombiFlash® Rf 200i system. Thin layer chromatography (TLC) was performed on silica gel plates (Sorbent Technologies) using anisaldehyde sugar stain for detection. Gel filtration chromatography was performed with a column (100 cm χ 2.5 cm) packed with Bio-Gel P-2 Fine resins (Bio-Rad). All reagents were at least of reagent grade and were used as supplied without further purification unless indicated.
[0183] One-pot multienzyme (OPME) synthesis of 2,7-anhydro-sialic acids. ManNAc (1.0 g) or ManNTFA (300 mg), lactose (0.5 equiv.), sodium pyruvate (5 equiv.), CTP (1.5 equiv.) were dissolved in Tris-HCl buffer (100 mM, pH 7.5, 100 or 20 mL) containing 20 mM of MgCh. The pH of the solution was further adjusted to 7.5 with 4 M NaOH.
PmAldolase (8.0 or 4.0 mg), NmCSS (4.0 or 2.0 mg), PmSTl_M144D (8.0 or 4.0 mg), SpNanB (4.0 or 2.0 mg) were added and the reaction was incubated in an isotherm incubator for 16 h at 37 °C with agitation at 100 rpm. The reaction was quenched by adding the same volume of ice-cold ethanol and incubating at 4 °C for 1 h. The formed precipitates were removed by centrifugation and the supernatant was concentrated. The residue was purified gradually by passing it through a BioGel P-2 gel filtration column, a silica column
(EtOAc:MeOH:H20 = 4:2:0.2, by volume), followed by a CI 8 column (100% H20) to produce the pure compound.
[0184] 5-Acetamido-2,7-anhydro-3,5-dideoxy-a-D-glycero-D-galacto-non-2- ulopyranosonic acid (2,7-anhydro-Neu5Ac). 1.10 g, 78%, white solid. ¾ NMR (400 MHz, D2O) δ 4.51 (bs, 1H, H-6), 4.40 (dd, J = 7.8, 0.8 Hz, 1H, H-7), 3.95-3.90 (m, 1H, H-4), 3.89 (bs, 1H, H-5), 3.72 (dd, J = 11.8, 2.8 Hz, 1H, H-9), 3.56 (dd, J= 11.8, 6.0 Hz, 1H, H-9'), 3.50 (ddd, J = 7.8, 6.0, 2.8 Hz, 1H, H-8), 2.14 (dd, J = 15.2, 5.6 Hz, 1H, H-3ax), 2.00 (s, 3H, COCH3), 2.00-1.92 (m, 1Η, H-3eq); 13C NMR (100 MHz, D2O) δ 174.03, 173.51, 105.53, 77.12, 76.59, 71.91, 66.79, 62.23, 51.92, 35.25, 21.75; HRMS (ESI) Anal. Calcd for
CnHieNOs [M-H]": 290.0881, Found: 290.0886.
[0185] 2,7-Anhydro-3,5-dideoxy-5-trifluoroacetarnido-a-D-glycero-D-galacto-non-2- ulopyranosonic acid (2,7-anhydro-Neu5TFA). 219.8 mg, 55%, white solid. ¾ NMR (400 MHz, D2O) δ 4.65 (bs, 1H, H-6), 4.48 (dd, J = 7.8, 0.8 Hz, 1H, H-7), 4.07-4.04 (m, 2H, H-4, H-5), 3.78 (dd, J= 11.6, 2.8 Hz, 1H, H-9), 3.62 (dd, J = 11.6, 6.2 Hz, 1H, H-9'), 3.57 (ddd, J = 7.8, 6.2, 2.8 Hz, 1H, H-8), 2.24 (dd, J= 15.2, 5.4 Hz, 1H, H-3ax), 2.05 (d, J = 15.2 Hz, 1H, H-3eq); 13C NMR (100 MHz, D2O) δ 173.91, 158.47 (q, J = 38.0 Hz), 115.71 (q, J = 284.0 Hz), 105.57, 76.82, 76.47, 71.87, 66.14, 62.24, 52.96, 35.39; HRMS (ESI) Anal. Calcd for C11H16NO9 [M-H]": 344.0599, Found: 344.0591. [0186] Chemical derivatization at C-5 of 2,7-anhydro-sialic acids: 5-Amino-2,7- anhydro-3,5-dideoxy-a-D-glycero-D-galacto-non-2-ulopyranosonic acid (2,7-anhydro- Neu). 2,7-Anhydro-Neu5TFA (30.0 mg, 0.0817 mmol) was dissolved in Na2C03 aqueous solution (2 mL, pH = 9) and the reaction was stirred for 16 h. Without neutralization, the solution was directly passed through a BioGel P-2 gel filtration column to produce 2,7- Anhydro-Neu (20.1 mg, 99%) as white solid. ¾ NMR (400 MHz, D2O) δ 4.60 (bs, 1H, H-6), 4.42 (dd, 1H, J= 7.8, 0.6 Hz, H-7), 4.09-4.02 (m, 1H, H-4), 3.77 (dd, J= 11.6, 2.8 Hz, 1H, H-9), 3.61 (dd, J= 11.6, 6.0 Hz, 1H, H-9'), 3.56 (ddd, J= 7.8, 6.0, 2.8 Hz, 1H, H-8), 3.16 (bs, 1H, H-5), 2.26 (dd, J = 15.4, 5.6 Hz, 1H, H-3ax), 2.04 (d, J = 15.4 Hz, 1H, H-3eq); 13C NMR (100 MHz, D2O) δ 173.86, 105.70, 77.56, 76.58, 71.90, 67.26, 62.25, 52.76, 34.84; HRMS (ESI) Anal. Calcd for C11H16NO9 [M-H]": 248.0776, Found: 248.0771.
[0187] 2,7-Anhydro-5-cyclohexylamido-3,5-dideoxy-(-D-glycero-D-galacto-non-2- ulopyranosonic acid (2,7-anhydro-Neu5cyclohexyl). To a stirred solution of 2,7-anhydro- Neu (15.0 mg, 0.0602 mmol) in a mixed solvent of DMF/H20/AcOH (7:2: 1, 2 mL), cyclohexanone (62 μί, 0.60 mmol) and NaBftCN (38 mg, 0.60 mmol) were added and the reaction was stirred for 30 min. The solvent was concentrated in vacuo. The crude product was re-dissolved in water (1 mL) and was passed through a BioGel P-2 gel filtration column to produce 2,7-anhydro-Neu5cyclohexyl (20.8 mg, 98%) as white solid. ¾ NMR (400 MHz, D20) δ 4.77 (bs, 1H, H-6), 4.45 (d, J= 7.6 Hz, 1H, H-7), 4.23-4.16 (m, 1H, H-4), 3.77 (dd, J = 11.8, 2.8 Hz, 1H, H-9), 3.62 (dd, J= 11.8, 5.8 Hz, 1H, H-9'), 3.57 (ddd, J= 7.6, 5.8, 2.8 Hz, 1H, H-8), 3.36 (bs, 1H, H-5), 3.21 (bs, 1H, H-l' hexyl), 2.29 (dd, J= 15.4, 5.8 Hz, 1H, H-3ax), 2.17-1.98 (m, 3H, H-3eq, H hexyl), 1.93-1.77 (m, 2H, H hexyl), 1.75-1.61 (m, 1H, H hexyl), 1.45-1.24 (m, 4H, H hexyl), 1.25-1.09 (m, 1H, H hexyl); 13C NMR (100 MHz, D20) δ 173.54, 105.64, 76.73, 75.25, 71.80, 64.39, 62.21, 56.02, 55.52, 35.33, 29.97, 29.69, 24.70, 24.19, 24.15; HRMS (ESI) Anal. Calcd for C11H16NO9 [M-H]": 330.1558, Found: 330.1559.
|0188] Sialidase Inhibition assays. Inhibition assays were carried out in duplicates in 384- well plates in a final volume of 20 μL containing Neu5Aco2-3GaiP/?NP (0.3 mM) and β- galactosidase (12 μg) with or without inhibitors. The assay conditions varied for different sialidases as described below: SpNanA (0.0015 μg), NaOAc buffer (100 mM, pH 6.0);
SpNanB (0.003 μg), NaOAc buffer (100 mM, pH 6.0); SpNanC (0.01 μg), MES buffer (100 mM, pH 6.5); AuSialidase (1.0 mU), NaOAc buffer (100 mM, pH 5.5); CpNanI (1.3 mU), MES buffer (100 mM, pH 5.0); VcSialidase (0.57 mU), NaCl (150 mM), CaCh (10 mM), NaOAc buffer (100 mM, pH 5.5); PmSTl (0.4 μg), CMP (0.4 mM), NaOAc buffer (100 mM, pH 5.5); BiNanH2 (0.029 μg), NaOAc buffer (100 mM, pH 5.0); hNEU2 (1.2 μg), MES buffer (100 mM, pH 5.0). The reactions were incubated for 30 min at 37 °C, and were stopped by adding CAPS buffer (N-cyclohexyl-3-aminopropane sulfonic acid, 40 μL, 0.5 M, pH 10.5). The amount of the para-nitrophenolate formed was determined by measuring the A405 nm of the reaction mixtures using a microplate reader.
[0189] The percentage inhibitions were determined using a concentration of 1 mM of each inhibitor, with reactions without inhibitors as controls. ICso values were obtained by varying the concentrations of inhibitors from 0 to 1000 μΜ to get the concentration-response plots of the inhibitors. The values of ICso were calculated by the software Grafit 5.0.
[0190] Results
[0191] One-Pot Multienzyme (OPME) Synthesis of 2,7-anhydro-sialic acids. SpNanB was able to catalyze the formation of 2,7-anhydro-Neu5Ac directly fromNeu5Ac, similar to the function of leech IT trans-sialidase NanL. The new strategy for synthesis of 2,7-anhydro- Neu5Ac (2-1) therefore started with directly treating N-acetylneuraminic acid (Neu5Ac) with SpNanB. However, among various conditions of different buffers and SpNanB
concentrations less than 20% conversion at most was observed based on thin-layer chromatography (TLC) analysis, which was not satisfying for preparative scale synthesis. A more sophisticated one-pot multienzyme (OPME) system was then developed for the synthesis of 2,7-anhydro-sialic acids, resembling the OPME strategy developed for the synthesis of Sia2ens. The difference is that the core enzyme SpNanC in the previous system was replaced by SpNanB.
Scheme 9. One- ot multienzyme (OPME) synthesis of 2,7-anhydro-sialic acids.
Figure imgf000057_0001
[0192] As shown in Scheme 9, four enzymes were involved in the reactions including Pasteur ella multocida sialic acid aldolase (PmAldolase), Neisseria meningitidis CMP-sialic acid synthetase (NmCSS), Pasteurella multocida sialyltransferase 1 M144D mutant (PmSTl_M144D), and SpNanB, which produced the target product. In this one-pot reaction, the a2-3-sialyllactose formed by the sialoside formation reaction catalyzed by the first three enzymes provided a suitable substrate for SpNanB to form the desired product. The optimized condition provided 2,7-anhydro-Neu5Ac (2-1) in gram scale with 78% yield. The new method showed significant advantages compared to previously known chemical or enzymatic synthetic procedures.
[0193] Substrate specificity of SpNanB. Next, a library of /^ara-nitrophenol (/?NP)- tagged a2-3-linked sialosides with modifications on different positions were screened to explore the substrate specificity of SpNanB, to test the compatibility of the OPME synthesis for different derivatives (Table 6). None of the a2-6-linked sialosides were good substrates for SpNanB. The a2-3-linked sialosides bearing C5- and C9- modified Neu5Ac were well tolerated. Sialosides containing N-glycolylneuraminic acid (Neu5Gc), as well as its 9- modifications, were also tolerated by SpNanB. However, Kdn derivatives were generally not accepted.
[0194] Results for the substrate specificity of SpNanB indicated that C7-modified sialic acids were also good substrates for SpNanB. Because the hydroxyl group on C-7 is the nucleophile which attacks the anomeric carbon of sialic acid during the intramolecular trans- sialidase-catalyzed step, this was an unexpected result. Neu5Ac7N3-a2-3-Galp ?NP, one of the 7-modified sialosides, was tested to confirm the reaction and characterize the product formed. Thin layer chromatography (TLC) showed only two product spots throughout the reaction process, one of which represented Galp7?NP. Mass spectroscopy showed a m/z value of 333.1051, corresponded to 7-azido-Neu5Ac (7N3Neu5Ac). Monitoring the reaction by NMR also confirmed Neu5Ac7N3 as the product. This indicates that in the case of substrates baring 7-modified sialic acids, SpNanB can catalyze the hydrolysis of 7-modified sialosides directly in the absence of a 7-OH required for intramolecular trans-sialidase reaction.
Table 6. Substrate specificity of SpNanB.
Figure imgf000058_0001
Figure imgf000059_0002
[0195] Synthesis of 2,7-anhydro-sialic acid derivatives as sialidase inhibitors. The substrate promiscuities of SpNanB and other enzymes involved in the OPME synthesis made this method compatible with most 2,7-anhydro-sialic acid derivatives baring modifications on C-5 and C-9, except for Kdn derivatives. 2,7-anhydro-Neu5TFA (2-2) was synthesized in 55% yield, which was a suitable substrate for further chemical derivatization to produce the target product 2,7-anhydro-Neu5cyclohexyl (2-4). The lower yield compared to the yield of 2,7-anhydro-Neu5Ac was due to the lability of the trifluoroacetyl group. The trifluoroacetyl group was readily removed under mild basic condition to produce 2,7-anhydro-Neu (2-3) as the intermediate. The resulted amino group was coupled with the designed cyclohexyl group by reductive animation in almost quantitative yield.
Scheme 10. Synthesis of 2,7-anhydro-Neu5cyclohexyl (4) from 2,7-anhydro-Neu5TFA.
Figure imgf000059_0001
[0196] It was previously reported that SpNanB, similar to the leech intramolecular trans- sialidase, could have 2,7-anhydro-Neu5Ac hydrolysis activity (see, Xu, et al. J. Mol. Biol. 2008, 384, 436-449). In that report, the NMR time course study of product-release by SpNanB showed the presence of Neu5Ac after 24 h, but 2,7-anhydro-Neu5Ac was still the dominant product after 48 h. However, this 2,7-anhydro-Neu5Ac hydrolysis hypothesis was never directly confirmed by followed up experiments, probably due to the limited access of the 2,7-anhydro-Neu5Ac substrate. We confirmed the 2,7-anhydro-Neu5Ac hydrolysis activity of SpNanB by directly treating 2,7-anhydro-Neu5Ac with SpNanB. In the presence of SpNanB (1.0 mg/mL), 2,7-anhydro-Neu5Ac could be converted to Neu5Ac in an estimated yield of 80% based on TLC after incubating in 37 °C for 24 h. Therefore, SpNanB catalyzes the formation of 2,7-anhydro-sialic acid which can be hydrolyzed slowly by SpNanB to form sialic acid.
[0197] The 2,7-anhydro-Neu5Ac hydrolysis activity of SpNanB is a concern since SpNanB might hydrolyze the 2,7-anhydro-Neu5cyclohexyl inhibitor. Advantageously, no hydrolysis activity was observed when 2,7-anhydro-Neu5cyclohexyl was incubated with SpNanB under the same condition used for the hydrolysis of 2,7-anhydro-Neu5Ac.
[0198] Sialidase inhibition study. The designed inhibitor 2,7-anhydro-Neu5cyclohexyl (2-4), along with other 2,7-anhydro-sialic acids (2-1, 2-2, and 2-3), were tested for their inhibition activities against several glycoside hydrolase GH33 family sialidases categorized in the Carbohydrate Active Enzyme (CAZy) database. The bacterial sialidases tested include recombinant sialidases cloned from Streptococcus pneumoniae (SpNanA, SpNanB, and SpNanC), Pasteurella multocida sialyltransferase with α2-3-sialidase activity (PmSTl), Bifidobacterium infantis sialidase BiNanH2, as well as commercially available sialidases from Arthrobacter ureafaciens (AuSialidase), Clostridium perfringens (CpNanI), and Vibrio cholerae (VcSialidase). Recombinant human cytosolic sialidase hNEU2 was also tested.
[0199] Inhibition studies were carried out using Neu5Acα2-3Gai /?NP as the sialidase substrate. The 2,7-anhydro-sialic acids, along with Neu5Ac2en as a reference, were screened under a concentration of 1 mM to test whether they were effective inhibitors against these bacterial and human sialidases. As shown in Table 7, 2,7-anhydro-Neu5Ac (2-1) and 2,7- anhydro-Neu (2-3) were not effective inhibitors against all the sialidases tested.
Advantageously, 2,7-anhydro-Neu5cyclohexyl (2-4) did show effective inhibitory activity against SpNanB, as well as weak inhibition against SpNanA. Quite interestingly, 2,7- anhydro-Neu5cyclohexyl (2-4) also showed inhibition against SpNanC. 2,7-anhydro- Neu5TFA (2-2), the intermediate designed for the synthesis of 2,7-anhydro-Neu5cyclohexyl, also showed moderate inhibitory activity against SpNanA, AuSialidase, and weak inhibition against SpNanB and VcSialidase. Table 7. Percentage inhibition (%) of 2,7-anhydro-sialic acids (1-4) (1 mM of each inhibitor was used) against bacterial and human sialidases.
Figure imgf000061_0001
[0200] For inhibitors with more than 50% inhibitory activity against certain sialidases at 1 mM concentration, IC50 values were obtained (Table 8). 2,7-Anhydro-Neu5cyclohexyl (2-4) was an inhibitor with weak inhibition against SpNanB (IC50 = 180 ± 23 μΜ), and moderate inhibition against SpNanC (IC50 = 58.4 ± 2.4 μΜ). 2,7-Anhydro-Neu5TFA (2) showed weak inhibition against SpNanA (IC50 = 145 ± 16 μΜ) and AuSialidase (IC50 = 225 ± 34 μΜ).
Table 8. IC50 Values of 2,7-anhydro-Neu5TFA (2-2) and 2,7-anhydro-Neu5cyclohexyl (2-4) against Bacterial Sialidases SpNanA, SpNanB, SpNanC, AuSialidase, and VcSialidase.
Figure imgf000061_0002
[0201] A novel one-pot multienzyme (OPME) strategy was developed for preparative and gram-scale synthesis of 2,7-anhydro-sialic acids. These 2,7-anhydro-sialic acids were screened as sialidase inhibitors. The rationally designed inhibitor 2,7-anhydro- Neu5cyclohexyl (2-4) showed inhibition against both SpNanB and SpNanC. This study demonstrated a new idea of exploring the family of 2,7-anhydro-sialic acids as sialidase inhibitors. Example 8. Large-Scale 2-Step Preparation of 2,7-Anhydro-Sialic Acids.
[0202] The one-pot multienzyme (OPME) procedures allow the production of 2,3-dehydro- 2-deoxy-sialic acids (Sia2ens) and 2,7-anhydro-sialic acids directly from Neu5 Ac, ManNAc, or derivatives and the use of only catalytic amount of the acceptor (e.g. lactose). However, the purification procedures for certain products were found to be tedious and multiple column purification processes may be necessary to obtain pure compounds in some cases. In order to simplify the product purification procedures, an improved two-step OPME procedure has been developed. In this strategy, a hydrophobic chromophore or fluorophore is attached to the acceptor to allow easy purification by C18-cartridge or C18-columns. Both carboxybenzyl (Cbz)-protected propyl amine and fluorenylmethyloxycarbonyl (Fmoc)-protected propyl amine were tested as the tag for the acceptor (e.g., lactosides) and both worked well. Cbz protecting group is particularly stable during the reaction and purification processes and was chosen for the large-scale production of 2,7-anhydro-Neu5Ac. The synthesis of other 2,7- anhydro-sialic acids and 2,3-dehydro-2-deoxy-sialic acids (Sia2ens) can be performed similarly.
Scheme 11. Two-step one-pot multienzyme (OPME) production of 2,7-anhydro-Neu5Ac (1) from Neu5 Ac (2).
Figure imgf000063_0001
[0203] As shown in Scheme 11, two enzymes are involved in first step for one-pot multienzyme (OPME) high-yield synthesis of α2-3-linked sialosides (Neu5Acα2- 3LacβProNHCbz 5 and Neu5Acα2-3LacβProNHFmoc 6) from the corresponding lactosides (LacβProNHCbz 3 and LacβProNHFmoc 4). In the second step, the α2-3 -linked sialosides (Neu5Acα2-3LacβProNHCbz 5 and Neu5Acα2-3LacβProNHFmoc 6) can be used in SpNanB-catalyzed reaction for the formation of desired 2,7-anhydro-Neu5Ac (1) in high yields. In the first step, both sialoside product and lactoside can be readily separated from each other and from other components of the enzymatic reaction by passing a C18-cartridge. In the second step, 2,7-anhydro-Neu5Ac (1) is readily eluted from the C18-cartridge to obtain pure product. The remaining sialoside starting material and lactoside product can be readily purified and reused in step 1 or step 2 of the next round of the reaction. Each round of reactions (step 1 + step 2) efficiently convert Neu5Ac and CTP to 2,7-anhydro-Neu5Ac (1), CMP, and pyrophosphate (PPi) while both lactoside and sialoside are recycled.
[0204] The two-step synthesis scheme can be repeated multiple time in large scales (e.g., gram-scale), and each time produces pure 2,7-anhydro-Neu5Ac (1) with easy purification procedures. [0205] Three experiments were performed to demonstrate the efficiency of the method with lactoside LacβProNHCbz 3 as the sialyltransferase acceptor. Experiments 1 and 2 shown below use a slight excess of Neu5Ac while Experiment 3 uses a slight excess of lactoside.
[0206] Materials. All chemicals were obtained from commercial suppliers and used without further purification. ¾ NMR (400 or 800 MHz) and 13C NMR (400 or 800 MHz) spectra were recorded on a Bruker Avance-400 Spectrometer (400 MHz for ¾, 100 MHz for 1 C) or a Avance-800 Spectrometer (800 MHz for ¾, 200 MHz for 13C). High resolution electrospray ionization (ESI) mass spectra were obtained using a Thermo Electron LTQ- Orbitrap Hybrid MS at the Mass Spectrometry Facility in the University of California, Davis. Column chromatography was performed using RedLSte/? Rf silica columns or an ODS-SM column (51 g, 50 μm, 120 A, Yamazen) on the CombiFlash® Rf 200i system. Analytical thin-layer chromatography was performed on silica gel plates 60 GF254 (Sorbent
technologies) using anisaldehyde stain for detection. Recombinant NmCSS, PmSTl_M144D and SpNanB were expressed as described previously.
Experiment 1.
[0207] Step 1 : One-pot two-enzyme synthesis of Neu5Acα2-3LacβProNHCbz (5) using an excess of Neu5Ac. LacβProNHCbz (3) (1 g, 1.87 mM) and Neu5Ac (1.1 equiv. 0.68 g, 2.06 mM) were incubated at 30 °C with agitation at 120 rpm in Tris-HCl buffer (100 mM, pH = 8.5) containing CTP (1.2 equiv.), MgCb (20 mM), and an appropriate amount of NmCSS (5 mg) and PmSTlM144D (12 mg). The reaction was monitored by thin-layer chromatography (TLC) using developing solvent consisting of EtOAc:MeOH:H20 = 5:2: 1 (by volume) and the TLC plates were stained with a />-anisaldehyde sugar stain. After 4-6 h, the reaction was quenched by adding the same volume of pre-chilled ethanol and the reaction mixture was centrifuged to remove precipitates. The supernatant was concentrated and passed through a C18 column (H20:CH3CN= 1 :0 - 4: 1) to obtain Neu5Acα2-3LacβProNHCbz (5, 1.46 g), which would be used in the following reaction to produce 2,7-anhydro-Neu5Ac (1). The isolated yield was 95%. The remaining LacβProNHCbz (3) can be recycled and used for next round of sialylation reaction.
[0208] Step 2: Formation of 2,7-anhydro-Neu5 Ac (7) from Neu5 Acα2-3LacβProNHCbz (5) by SpNanB-catalyzed reaction. Neu5Acα2-3LacβProNHCbz (5, 1.46 g, 1.77 mM) was incubated at 30 °C in ammonia formate buffer (100 mM, pH = 5.5) containing an appropriate amount of SpNanB (5 mg). The reaction was monitored by thin-layer chromatography (TLC) using developing solvent consisting of EtOAc:MeOH:H20 = 5:2: 1 (by volume) and the TLC plates were stained with a />-anisaldehyde sugar stain. After 4 h, the reaction was quenched by adding the same volume of pre-chilled ethanol and the reaction mixture was centrifuged to remove precipitates. The supernatant was concentrated and passed through a C18 column (H20:CH3CN= 1 :0 - 2: 1) to obtain pure 2,7-anhydro-Neu5Ac (1) (0.47 g, 1.63 mM, yield = 92%), LacβProNHCbz (3) (870 mg) and Neu5Acα2-3LacβProNHCbz (117 mg). Ammonia formate buffer eluted out together with anhydro-Neu5Ac (1) could be removed easily by applying vacuum. LacβProNHCbz (3) (870 mg, yield = 92%) and Neu5Acα2- 3LacβProNHCbz (5, 117 mg) can be recovered and reused in the next cycle of two-step one- pot multienzyme (OPME) production of 2,7-anhydro-Neu5Ac (1) from Neu5Ac (2). Experiment 2. Synthetic cycle for two-step, one-pot multienzyme (OPME) production of 2, 7- anhydro-Neu5Ac .
[0209] Step 1. After the first 2-step one-pot multienzyme (OPME) cycle was complete, the recovered LacβProNHCbz (3) (870 mg, 1.63 mM) was used in the one-pot two-enzyme synthesis of Neu5Acα2-3LacβProNHCbz (5, 1.28 g, 1.55 mM) with 95% yield, which combined with 117 mg Neu5Acα2-3LacβProNHCbz (5) recycled from Experiment 1 totaled 1.38 g.
[0210] Step 2. Neu5Acα2-3LacβProNHCbz (5, 1.38 g, 1.68 mM) was used in a SpNanB- catalyzed reaction for the formation of 2,7-anhydro-Neu5Ac (1, 450 mg) and
LacβProNHCbz (3, 820 mg). A yield of 92% was obtained for the production of the desired target 2,7-anhydro-Neu5Ac (1). The remaining unreacted Neu5Acα2-3LacβProNHCbz (5,
110 mg, 7%) was then recycled. After 2 cycles of reactions, a total of 920 mg of 2,7-anhydro- Neu5Ac (1) was formed. At the same time, 820 mg of LacβProNHCbz (3) and 110 mg of Neu5Acα2-3LacβProNHCbz (5) were recovered so that the 2-step OPME synthesis of 2,7- anhydro-Neu5Ac (1) could be repeated.
Experiment 3.
[0211] Step 1 : One-pot two-enzyme synthesis of Neu5Acα2-3LacβProNHCbz (5) using a slightly excess amount of lactoside LacβProNHCbz (3). LacβProNHCbz (3) (1.0 equiv. 800 mg, 1.50 mM) and Neu5Ac (2) (0.95 equiv. 471 mg, 1.42 mM) were incubated at 30 °C with an agitation at 120 rpm in Tris-HCl buffer (100 mM, pH = 8.5) containing CTP (1.1 equiv.), MgCh (20 mM) and an appropriate amount of NmCSS (5 mg) and PmSTlM144D (12 mg). The reaction was monitored by thin-layer chromatography (TLC) using developing solvent consisting of EtOAc:MeOH:H20 = 5:2: 1 (by volume) stained with a />-anisaldehyde sugar stain and high-resolution electrospray ionization (ESI) mass spectra (HRMS). After 4 h, the mass spectra showed nearly complete consumption of Neu5Ac (2) or CMP-Neu5Ac, the reaction was quenched by adding the same volume of pre-chilled ethanol and the reaction mixture was centrifuged to remove precipitates. The supematant was concentrated and passed through a CI 8 column with isocratic flow (EhCXACN = 1 :0, 85: 15, and 4: 1) to obtain Neu5Acα2-3LacβProNHCbz (5, 1.17 g, separation yield = 96%) and remaining
LacβProNHCbz (3). Neu5Acα2-3LacβProNHCbz (5) was eluted at 15% ACN and
LacβProNHCbz (3) was eluted from the column at 20% ACN. One of the advantages of this one-pot two-enzyme synthesis of Neu5Acα2-3LacβProNHCbz (5) is that Neu5Ac (2) is efficiently converted to Neu5Acα2-3LacβProNHCbz (5), and the excess LacβProNHCbz (3) can be recovered and reused. Neu5Acα2-3LacβProNHCbz (5) can be used in the second step to produce 2,7-anhydro-Neu5Ac (1).
[0212] Step 2. Formation of 2,7-anhydro-Neu5Ac (7) from Neu5 Acα2-3LacβProNHCbz (5) by SpNanB-catalyzed reaction. Neu5Acα2-3LacβProNHCbz (5, 1.46 g, 1.77 mM) was incubated at 30 °C in ammonia formate buffer (100 mM, pH = 5.5) containing an appropriate amount of SpNanB (5 mg). The reaction was monitored by thin-layer chromatography (TLC) using developing solvent consisting of EtOAc:MeOH:H20 = 5:2: 1 (by volume) and the TLC plates were stained with a />-anisaldehyde sugar stain. After 4 h, the reaction was quenched by adding the same volume of pre-chilled ethanol and the reaction mixture was centrifuged to remove precipitates. The supernatant was concentrated and passed through a C18 column with isocratic flow (H20:ACN = 1 :0, 85: 15, and 4: 1) to obtain pure 2,7-anhydro-Neu5Ac (1) (0.47 g, 1.63 mM, yield = 92%), LacβProNHCbz (3) (870 mg), and Neu5Acα2- 3LacβProNHCbz (117 mg). 2,7-anhydro-Neu5Ac (1) was eluted at 100% H20, Neu5Acα2- 3LacβProNHCbz (5) was eluted at 15% ACN and LacβProNHCbz (3) was eluted at 20% ACN. Ammonium formate buffer eluted together with anhydro-Neu5Ac (1) and was readily removed by applying vacuum. LacβProNHCbz (3) (870 mg, yield = 92%) and Neu5Acα2- 3LacβProNHCbz (5, 117 mg) were recovered for reuse in subsequent cycles of the two-step one-pot multienzyme (OPME) procedure.
VII. Exemplary Embodiments
[0213] Exemplary embodiments provided in accordance with the presently disclosed subject matter include, but are not limited to, the claims and the following embodiments:
1. A method for forming a sialic acid product selected from the group consisting of a 2-deoxy-2,3-dehydro-sialic acid, a 2,7-anhydro-sialic acid, and derivatives thereof, the method comprising:
forming a reaction mixture comprising a glycoside acceptor, a sialic acid donor, and a sialyltransferase;
maintaining the reaction mixture under conditions sufficient to form a sialoside; and
contacting the sialoside with a Streptococcus pneumoniae sialidase to form the sialic acid product.
2. The method of embodiment 1, wherein the sialic acid product is a 2- deoxy-2,3-dehydro-sialic acid or a derivative thereof.
3. The method of embodiment 2, wherein the Streptococcus pneumoniae sialidase is SpNanC having the amino acid sequence set forth in SEQ ID NO: 1, or a catalytically active variant thereof.
4. The method of embodiment 3, wherein the SpNanC is S. pneumoniae TIGR4 SpNanC having the amino acid sequence set forth in SEQ ID NO:2, or a catalytically active variant thereof.
5. The method of embodiment 1, wherein the sialic acid product is a 2,7- anhydro-sialic acid or a derivative thereof. 6. The method of embodiment 5, wherein the Streptococcus pneumoniae sialidase is SpNanB having the amino acid sequence set forth in SEQ ID NO:3, or a catalytically active variant thereof.
7. The method of any one of embodiments 1-6, wherein the sialoside is an α2-3 -linked sialoside or a derivative thereof.
8. The method of embodiment 7, wherein the α2-3-linked sialoside is selected from the group consisting of Neu5Acα2-3Lac, Neu5Gcα2-3Lac, Neu5TFAα2- 3Lac, Neu5Acα2-3LacβProN3, Neu5Gcα2-3LacβProN3, Neu5TFAα2-3LacβProN3, Neu5Acα2-3LacβProNHCbz, Neu5Gcα2-3LacβProNHCbz, Neu5TFAα2- 3LacβProNHCbz, Neu5Acα2-3LacβProNHFmoc, Neu5Gcα2-3LacβProNHFmoc, Neu5TFAα2-3LacβProNHFmoc, and derivatives thereof.
9. The method of any one of embodiments 1-8, wherein the sialic acid donor is a CMP-sialic acid.
10. The method of embodiment 9, wherein the glycoside acceptor is lactose or a lactoside.
11. The method of any one of embodiments 1-10, wherein the reaction mixture comprises a catalytic amount of the glycoside acceptor.
12. The method of any one of embodiments 1-11, wherein the sialyltransferase is PmSTl_M144D comprising the amino acid sequence set forth in SEQ ID NO: 4 or a catalytically active variant thereof.
13. The method of any one of embodiments 1-12, wherein forming the sialoside and forming the sialic acid product are conducted in one pot.
14. The method of any one of embodiments 1-12, wherein forming the sialoside and forming the sialic acid product are conducted in two separate reactions. 15. The method of any one of embodiments 9-14, further comprising contacting a sialic acid and a CMP-sialic acid synthetase in the presence of CTP to form the CMP-sialic acid. 16. The method of embodiment 15, wherein the CMP-sialic acid synthetase is NmCSS comprising the amino acid sequence set forth in SEQ ID NO: 7, or a catalytically active variant thereof.
17. The method of embodiment 15 or embodiment 16, wherein forming the CMP-sialic acid, forming the sialoside, and forming the sialic acid product are conducted in one pot.
18. The method of any one of embodiments 15-17, further comprising contacting a C6-monosaccharide and a sialic acid aldolase in the presence of pyruvate to form to the sialic acid.
19. The method of embodiment 18, wherein the sialic acid aldolase is PmAldolase comprising the amino acid sequence set forth in SEQ ID NO: 8 or a catalytically active variant thereof.
20. The method of embodiment 18 or embodiment 19, wherein forming the sialic acid, forming the CMP-sialic acid, forming the sialoside, and forming the sialic acid product are conducted in one pot.
21. The method of any one of embodiments 1-20, further comprising acylating the sialic acid product.
22. The method of any one of embodiments 1-20, further comprising subjecting the sialic acid product to reductive amination conditions.
23. A compound accordin to Formula I:
Figure imgf000069_0001
or a salt thereof, wherein:
R1, R2, R3, and R4 are independently selected from the group consisting of
-NHC(0)Ra, -N3, -NH2, -NHRa, -OC(0)Ra, -OH, and hydrogen;
R5 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)Ra, -N3, -NH2,
-OC(0)Ra, -OH, and hydrogen; each Ra is independently selected from the group consisting of optionally substituted Ci-12 alkyl, optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce-ιο aryl, and optionally substituted C7-22 arylalkyl;
Ac is -C(0)CH3; and
Gc is -C(0)CH2OH;
provided that at least one of R1, R2, R3, and R4 is other than -OH when R5 is -NHAc or -NHGc.
24. The compound of embodiment 23, or a salt thereof, having a structure according to Formula la:
Figure imgf000070_0001
25. The compound of embodiment 23 or embodiment 24, or a salt thereof, wherein R1 is -NHC(0)Ra.
26. The compound of any one of embodiments 23-25, or a salt thereof, wherein R3 is selected from the group consisting of -OH and hydrogen.
27. The compound of any one of embodiments 23-26, or a salt thereof, wherein R5 is selected from the group consisting of -NHAc, -NHGc, -NH2, and -NHC(0)Ra.
28. The compound of embodiment 27, wherein R5 is -NHC(0)Ra and Ra is trifiuoromethyl.
29. The compound of embodiment 23, which is selected from the group consisting
Figure imgf000070_0002
and salts thereof.
30. A compound accordin to Formula II:
Figure imgf000071_0001
or a salt thereof, wherein:
R11, R12, and R14 are independently selected from the group consisting of
-NHC(0)Ra, -N3, -NH2, -NHRa, -OC(0)Ra, -OH, and hydrogen;
R15 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)Ra, -N3, -NH2, -OC(0)Ra, -OH, and hydrogen;
Ra is selected from the group consisting of optionally substituted Ci-12 alkyl,
optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce-ιο aryl, and optionally substituted C7-22 arylalkyl;
Ac is -C(0)CH3; and
Gc is -C(0)CH2OH;
provided that at least one of R11, R12, and R14 is other than -OH when R15 is -NHAc or -NHGc.
31. The compound of embodiment 30, or a salt thereof, having a structure according to Formula Ila:
Figure imgf000071_0002
32. The compound of embodiment 30, or a salt thereof, wherein R is selected from the group consisting of -NHAc, -NHGc, -NH2, and -NHC(0)Ra.
The compound of embodiment 31 , wherein R is -NHC(0)Ra and Ra is trifluoromethyl. 34. The compound of embodiment 30, which is selected from the group consisting of
Figure imgf000072_0001
and salts thereof.
35. A pharmaceutical composition comprising a compound according to any one of embodiments 23-34 and a pharmaceutically acceptable excipient.
36. A method of inhibiting a sialidase comprising contacting the sialidase with an effective amount of a compound according to any one of embodiments 23-34
[0214] Although the foregoing has been described in some detail by way of illustration and example for purposes of clarity of understanding, one of skill in the art will appreciate that certain changes and modifications may be practiced within the scope of the appended claims. In addition, each reference provided herein is incorporated by reference in its entirety to the same extent as if each reference was individually incorporated by reference. Where a conflict exists between the instant application and a reference provided herein, the instant application shall dominate.
INFORMAL SEQUENCE LISTING
SEQ ID NO: l
SpNanC (NCBI Accession No. WP_024478413.1)
KKNIKQYVTLGTVVVLSAFVANSVAAQETETSEVSTPELVQPVAPTTSISEVQHKSGN SSEVTVQPRTVETTVIO)PSSTAEETLVLEKNNVTLTGGGENVTKELKDKFTSGDFTV VIKYNQSSEKGLQALFGISNSKPGQQNSYVDVFLRDNGELGMEARDTSSNKNNLVSR PASVWGKYKQEAVTNTVAVVADSVKKTYSLYANGTKVVEKKVDNFLNIKDIKGID YYMLGGVKRAGKTAFGFNGTLENIKFFNSALDEETVKKMTTNAVTGHLIYTANDTT GSNYFRIPVLYTFSNGRVFSSIDARYGGTHDFLNKINIATSYSDDNGKTWTKPKLTLA FDDFAPVPLEWPREVGGRDLQISGGATYIDSVIVEKKNKQVLMFADVMPAGVSFRE ATRKDSGYKQIDGNYYLKLRKQGDTDYNYTIRENGTVYDDRTNRPTEFSVDKNFGI KQNGNYLWEQYSVSFENNKKTEYRNGTKVHMNIFYKDALFKVVPTNYIAYISSND HGESWSAPTLLPPIMGLNRNAPYLGPGRGIIESSTGRILIPSYTGKESAFIYSDDNGAS WKVKVVPLPSSWSAEAQFVELSPGVIQAYMRTNNGKIAYLTSKDAGTTWSAPEYLK FVSNPSYGTQLSIINYSQLIDGKKAVILSTPNSTNGRKHGQIWIGLINDDNTIDWRYHH DVDYSNYGYSYSTLTELPNHEIGLMFEKFDSWSRNELHMKNVVPYITFKIEDLKKN
SEQ ID NO:2
S. pneumoniae TIGR4 SpNanC (NCBI Accession No. AAK75424.1) KKNIKQYVTLGTVVVLSAFVANSVAAQETETSEVSTPKLVQPVAPTTPISEVQPTSDN SSEVTVQPRTVETTVKDPSSTAEETPVLEKNNVTLTGGGENVTKELKDKFTSGDFTV VIKYNQSSEKGLQALFGISNSKPGQQNSYVDVFLRDNGELGMEARDTSSNKNNLVSR PASVWGKYKQEAVTNTVAVVADSVKKTYSLYANGTKVVEKKVDNFLNIKDIKGID YYMLGGVKRAGKTAFGFNGTLENIKFFNSALDEETVKKMTTNAVTGHLIYTANDTT GSNYFRIPVLYTFSNGRVFSSIDARYGGTHDFLNKINIATSYSDDNGKTWTKPKLTLA FDDFAPVPLEWPREVGGRDLQISGGATYIDSVIVEKKNKQVLMFADVMPAGVSFRE ATRKDSGYKQIDGNYYLKLRKQGDTDYNYTIRENGTVYDDRTNRPTEFSVDKNFGI KQNGNYLWEQYSVSFENNKKTEYRNGTKVHMNIFYKDALFKVVPTNYIAYISSND HGESWSAPTLLPPIMGLNRNAPYLGPGRGIIESSTGRILIPSYTGKESAFIYSDDNGAS WKVKVVPLPSSWSAEAQFVELSPGVIQAYMRTNNGKIAYLTSKDAGTTWSAPEYLK FVSNPSYGTQLSIINYSQLIDGKKAVILSTPNSTNGRKHGQIWIGLINDDNTIDWRYHH DVDYSNYGYSYSTLTELPNHEIGLMFEKFDSWSRNELHMK VVPYITFKIEDLKK
SEQ ID NO:3 Streptococcus pneumoniae SpNanB (NCBI Accession No. NP_359124.1)
NELNYGQLSISPIFQGGSYQLNNKSIDISPLLLDKLSGDSQTVVMKFKADKPNSLQAL FGLSNSKAGFKNNYFSIFMRDSGEIGVEIRDAQKGINYLFSRPASLWGKHKGQAVEN TLVF V SD SKDKTYTMYVNGIEVF S ETVDTFLPI SNINGIDKATLGAVNREGKEHYL AK GSIDEISLFNKAISDQEVSTIPLSNPFQLIFQSGDSTQANYFRIPTLYTLSSGRVLSSIDAR YGGTHDSKSKINIATSYSDDNGKTWSEPIFAMKFNDYEEQLVYWPRDNKLKNSQISG SASFIDSSIVEDKKSGKTILLADVMPAGIGNNNANKADSGFKEINGHYYLKLKKNGD NDFRYTVRENGVVYDETTNKPTNYTINDKYEVLEGGKSLTVEQYSVDFDSGSLRER HNGKQVPMNVFYKDSLFKVTPTNYIAMTTSQNRGESWEQFKLLPPFLGEKHNGTYL CPGQGLALKSSNRLIFATYTSGELTYLISDDSGQTWKKSSASIPFENATAEAQMVELR DGVIRTFFRTTTGKIAYMTSRDSGETWSEVSYIDGIQQTSYGTQVSAIKYSQLIDGKE AVILSTPNSRSGRKGGQLVVGLVNKEDDSIDWKYHYDIDLPSYGYAYSAITELPNHHI GVLFEKYD SWS RNELHL SNV VQ YIDLEINDLTK
SEQ ID NO:4 PmSTl_M144D
KTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKD NRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSD EYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLST DYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEV QQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPR GGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTS NKQVKSKEDALNNPYVKVMRRLGIIDESQVIFWDSLKQL SEQ ID N0 5 PmST2
NLnCCTPLQVLIAEKIIAKFPHTPFYGVMLSTVSNKKFDFYAKRLAQQCQGFFSMVQ HKDRFNLLKEILYLKRTFSGKHFDQVFVANINDLQIQFLLSAIDFNLLNTFDDGTINIV PNSLFYQDDPATLQRKLINVLLGNKYSIQSLRALSHTHYTIYKGFKNIIERVEPIELVA ADNSEKVTSAVINVLLGQPVFAEDERNIALAERVIKQFNIHYYLPHPREKYRLAQVN YIDTELIFEDYILQQCQTHKYCVYTYFSSAIINIMNKSDNIEVVALKIDTENPAYDACY DLFDELGVNVIDIRE
SEQ ID NO:6 PmST3A35
DKFAEHEIPKAVIVAGNGESLSQIDYRLLPKNYDVFRCNQFYFEERYFLGNKIKAVFF TPGVFLEQYYTLYHLKRNNEYFVDNVILSSFNHPTVDLEKSQKIQALFIDVINGYEKY LSKLTAFDVYLRYKELYENQRITSGVYMCAVAIAMGYTDIYLTGIDFYQASEENYAF DNKKPNIIRLLPDFRKEKTLFSYHSKDIDLEALSFLQQHYHVNFYSISPMSPLSKHFPIP TVEDDCETTFVAPLKENYINDILLVDKLAAALE
SEQ ID NO:7
NmCSS (NCBI Accesion No. WP_025459740.1) EKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEE AKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAF SLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNG AIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILHHKES
SEQ ID NO: 8
PmAldolase (NCBI Accession No. WP_005723432.1)
TNIAIIPARAGSKGIPDKNLQPVGGHSLIGRAILAAKNADVFDMIVVTSDGDNILREAE KYGALALKRPAELAQDNSRTIDAILHALESLNIREGTCTLLQPTSPLRDHLDIKNAMD MYVNGGVHSVVSACECEHHPYKAFALSKDHEVLPVREIADFEAVRQTLPKMYRAN GAIYINDIAQLLKEKYFFIPPLKFYLMPTYHSVDIDVKQDLELAEILSNK

Claims

WHAT IS CLAIMED IS: 1. A method for forming a sialic acid product selected from the group consisting of a 2-deoxy-2,3-dehydro-sialic acid, a 2,7-anhydro-sialic acid, and derivatives thereof, the method comprising:
forming a reaction mixture comprising a glycoside acceptor, a sialic acid donor, and a sialyltransferase;
maintaining the reaction mixture under conditions sufficient to form a sialoside; and
contacting the sialoside with a Streptococcus pneumoniae sialidase to form the sialic acid product.
2. The method of claim 1, wherein the sialic acid product is a 2-deoxy- 2,3-dehydro-sialic acid or a derivative thereof.
3. The method of claim 2, wherein the Streptococcus pneumoniae sialidase is SpNanC having the amino acid sequence set forth in SEQ ID NO: 1, or a catalytically active variant thereof.
4. The method of claim 3, wherein the SpNanC is S. pneumoniae TIGR4 SpNanC having the amino acid sequence set forth in SEQ ID NO:2, or a catalytically active variant thereof.
5. The method of claim 1, wherein the sialic acid product is a 2,7- anhydro-sialic acid or a derivative thereof.
6. The method of claim 5, wherein the Streptococcus pneumoniae sialidase is SpNanB having the amino acid sequence set forth in SEQ ID NO:3, or a catalytically active variant thereof.
7. The method of claim 1, wherein the sialoside is an α2-3 -linked sialoside or a derivative thereof.
8. The method of claim 7, wherein the α2-3-linked sialoside is selected from the group consisting of Neu5Acα2-3Lac, Neu5Gcα2-3Lac, Neu5TFAα2-3Lac, Neu5Acα2-3LacβProN3, Neu5Gcα2-3LacβProN3, Neu5TFAα2-3LacβProN3, Neu5Acα2- 3LacβProNHCbz, Neu5Gcα2-3LacβProNHCbz, Neu5TFAα2-3LacβProNHCbz, Neu5Acα2-3LacβProNHFmoc, Neu5Gcα2-3LacβProNHFmoc, Neu5TFAα2- 3LacβProNHFmoc, and derivatives thereof.
9. The method of claim 1, wherein the sialic acid donor is a CMP-sialic acid.
10. The method of claim 9, wherein the glycoside acceptor is lactose or a lactoside.
11. The method of claim 1, wherein the reaction mixture comprises a catalytic amount of the glycoside acceptor.
12. The method of claim 1, wherein the sialyltransferase is PmSTl_M144D comprising the amino acid sequence set forth in SEQ ID NO:4 or a catalytically active variant thereof.
13. The method of claim 1, wherein forming the sialoside and forming the sialic acid product are conducted in one pot.
14. The method of claim 1, wherein forming the sialoside and forming the sialic acid product are conducted in two separate reactions.
15. The method of claim 9, further comprising contacting a sialic acid and a CMP-sialic acid synthetase in the presence of CTP to form the CMP-sialic acid.
16. The method of claim 15, wherein the CMP-sialic acid synthetase is NmCSS comprising the amino acid sequence set forth in SEQ ID NO:7, or a catalytically active variant thereof.
17. The method of claim 15, wherein forming the CMP-sialic acid, forming the sialoside, and forming the sialic acid product are conducted in one pot.
18. The method of claim 15, further comprising contacting a C6-monosaccharide and a sialic acid aldolase in the presence of pyruvate to form to the sialic acid.
19. The method of claim 18, wherein the sialic acid aldolase is
PmAldolase comprising the amino acid sequence set forth in SEQ ID NO: 8 or a catalytically active variant thereof.
20. The method of claim 18, wherein forming the sialic acid, forming the CMP-sialic acid, forming the sialoside, and forming the sialic acid product are conducted in one pot.
21. The method of claim 1, further comprising acylating the sialic acid product.
22. The method of claim 1, further comprising subjecting the sialic acid product to reductive animation conditions.
23. A compound according to Formula I:
Figure imgf000079_0001
or a salt thereof, wherein:
R1, R2, R3, and R4 are independently selected from the group consisting of
-NHC(0)Ra, -N3, -NH2, -NHRa, -OC(0)Ra, -OH, and hydrogen;
R5 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)Ra, -N3, -NH2, -OC(0)Ra, -OH, and hydrogen;
each Ra is independently selected from the group consisting of optionally substituted Ci-12 alkyl, optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce-ιο aryl, and optionally substituted C7-22 arylalkyl;
Ac is -C(0)CH3; and
Gc is -C(0)CH2OH;
provided that at least one of R1, R2, R3, and R4 is other than -OH when R5 is -NHAc or -NHGc.
24. The compound of claim 23, or a salt thereof, having a structure according to Formula la:
Figure imgf000080_0001
25. The compound of claim 23, or a salt thereof, wherein R1 is -NHC(0)Ra.
26. The compound of claim 23, or a salt thereof, wherein R3 is selected from the group consisting of -OH and hydrogen.
27. The compound of claim 23, or a salt thereof, wherein R5 is selected from the group consisting of -NHAc, -NHGc, -NH2, and -NHC(0)Ra.
28. The compound of claim 27, wherein R5 is -NHC(0)Ra and Ra is trifiuoromethyl.
29. The compound of claim 23, which is selected from the group consisting
Figure imgf000080_0002
and salts thereof.
30. A compound according to Formula II:
Figure imgf000080_0003
or a salt thereof, wherein:
R11, R12, and R14 are independently selected from the group consisting of
-NHC(0)Ra, -N3, -NH2, -NHRa, -OC(0)Ra, -OH, and hydrogen; R15 is selected from the group consisting of -NHAc, -NHGc, -NHC(0)Ra, -N3, -NH2, -OC(0)Ra, -OH, and hydrogen;
Ra is selected from the group consisting of optionally substituted Ci-12 alkyl,
optionally substituted Ci-12 haloalkyl, optionally substituted C3-10 cycloalkyl, optionally substituted Ce-ιο aryl, and optionally substituted C7-22 arylalkyl;
Ac is -C(0)CH3; and
Gc is -C(0)CH2OH;
provided that at least one of R11, R12, and R14 is other than -OH when R15 is -NHAc or -NHGc.
31. The compound of claim 30, or a salt thereof, having a structure according to Formula Ila:
Figure imgf000081_0001
32. The compound of claim 30, or a salt thereof, wherein R15 is selected from the group consisting of -NHAc, -NHGc, -NH2, and -NHC(0)Ra.
33 The compound of claim 31, wherein R is -NHC(0)Ra and Ra is trifiuoromethyl.
34 The compound of claim 30, which is selected from the group consisting of
Figure imgf000081_0002
and salts thereof.
35. A pharmaceutical composition comprising a compound according to any one of claims 23-34 and a pharmaceutically acceptable excipient.
36. A method of inhibiting a sialidase comprising contacting the sialidase with an effective amount of a compound according to any one of claims 23-34.
PCT/US2018/029965 2017-04-27 2018-04-27 Sialidase inhibitors and preparation thereof WO2018201058A2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/608,640 US11325936B2 (en) 2017-04-27 2018-04-27 Sialidase inhibitors and preparation thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762491038P 2017-04-27 2017-04-27
US62/491,038 2017-04-27
US201762542540P 2017-08-08 2017-08-08
US62/542,540 2017-08-08

Publications (2)

Publication Number Publication Date
WO2018201058A2 true WO2018201058A2 (en) 2018-11-01
WO2018201058A3 WO2018201058A3 (en) 2018-11-29

Family

ID=63919274

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/029965 WO2018201058A2 (en) 2017-04-27 2018-04-27 Sialidase inhibitors and preparation thereof

Country Status (2)

Country Link
US (1) US11325936B2 (en)
WO (1) WO2018201058A2 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110368386A (en) * 2019-08-23 2019-10-25 重庆化工职业学院 A kind of application of oxygen-containing endocyclic compound in the drug of preparation treatment malignant tumour
WO2021055753A1 (en) * 2019-09-20 2021-03-25 The Regents Of The University Of California Methods and compositions for inhibition of cmp-sugar synthetases

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5312747A (en) * 1990-12-17 1994-05-17 Li Yu Teh Isolation, purification and utilization of sialidase-L in the synthesis of 2,7-anhydro-N-acetylneuraminic acid and for the selective cleavage of sialylα2-3 D-galactose linkage
US8163281B2 (en) 2009-03-04 2012-04-24 The Regents Of The University Of Michigan Treatment of drug-related side effect and tissue damage by targeting the CD24-HMGB1-Siglec10 axis
WO2010127443A1 (en) * 2009-05-04 2010-11-11 National Research Council Of Canada Inhibitors of sialidase or sialidase-like enzymes
WO2013022836A2 (en) * 2011-08-05 2013-02-14 The Regents Of The University Of California Pmst1 mutants for chemoenzymatic synthesis of sialyl lewis x compounds
ES2769634T3 (en) * 2011-11-04 2020-06-26 Szewczuk Myron R Use of NEU1 sialidase inhibitors in cancer treatment
US9783838B2 (en) * 2011-11-07 2017-10-10 The Regents Of The University Of California PmST3 enzyme for chemoenzymatic synthesis of alpha-2-3-sialosides
US10342777B2 (en) * 2015-10-01 2019-07-09 Macau University Of Science And Technology Caffeoylquinic acid-rich extract and preparation as well as use thereof
GB201602105D0 (en) * 2016-02-05 2016-03-23 Inst Of Food Res Intramolecular Trains- Sialidase

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110368386A (en) * 2019-08-23 2019-10-25 重庆化工职业学院 A kind of application of oxygen-containing endocyclic compound in the drug of preparation treatment malignant tumour
WO2021055753A1 (en) * 2019-09-20 2021-03-25 The Regents Of The University Of California Methods and compositions for inhibition of cmp-sugar synthetases

Also Published As

Publication number Publication date
WO2018201058A3 (en) 2018-11-29
US20200190130A1 (en) 2020-06-18
US11325936B2 (en) 2022-05-10

Similar Documents

Publication Publication Date Title
JP2023182695A (en) COMPOSITIONS AND METHODS OF MODULATING IMMUNE RESPONSE BY ACTIVATING α PROTEIN KINASE 1
US10160986B2 (en) Chemoenzymatic synthesis of heparin and heparan sulfate analogs
WO2012007588A9 (en) Synthesis of new sialooligosaccharide derivatives
Pal et al. Chemical synthesis of the pentasaccharide repeating unit of the O-specific polysaccharide from Ruminococcus gnavus
US20080318293A1 (en) Sulfotransferase Inhibitors
US20220267363A1 (en) Sialidase-resistant saccharide and method of making and using the same
US11325936B2 (en) Sialidase inhibitors and preparation thereof
Von Itzstein et al. Sialic acids and sialic acid-recognising proteins: Drug discovery targets and potential glycopharmaceuticals
Mendoza et al. Synthesis of the O-linked pentasaccharide in glycoproteins of Trypanosoma cruzi and selective sialylation by recombinant trans-sialidase
Papi et al. Synthesis of an STnThr analogue, structurally based on a TnThr antigen mimetic
US20140024576A1 (en) Heptose derivatives for use in the treatment of bacterial infections
Repetto et al. Thiodisaccharides with galactofuranose or arabinofuranose as terminal units: synthesis and inhibitory activity of an exo β-D-galactofuranosidase
Giorgi et al. Synthesis of a model trisaccharide for studying the interplay between the anti α-Gal antibody and the trans-sialidase reactions in Trypanosoma cruzi
Hartlieb et al. Chemoenzymatic synthesis of CMP-N-acetyl-7-fluoro-7-deoxy-neuraminic acid
Sasaki et al. Design of N-acetyl-6-sulfo-β-D-glucosaminide-based inhibitors of influenza virus sialidase
JP2018030801A (en) Sialic acid derivative, production method thereof, sialidase inhibitor, antibacterial agent and antiviral agent using the same
EP0830365B1 (en) Modified kojibiosides analogues
JP5429734B2 (en) Glycosphingolipid synthesis method
JP6198207B2 (en) Novel sugar donor and method for synthesizing sugar chain using the same
Rigotti THESIS/THÈSE
WO2025088529A1 (en) N-derivatized sialic acids and related sialosides
BR102022009102A2 (en) COMPOUNDS DERIVED FROM ENT-ISOQUERCETIN, PRODUCTION PROCESSES AND USE AS NTPDASES INHIBITORS AND IN MEDICINES FOR THE TREATMENT OF CHAGAS DISEASE AND LEISHMANIASIS
Zunk An investigation into the synthesis of 5, 7-diamino-3, 5, 7, 9-tetradeoxy-nonulosonic acid analogues
WO2022197990A1 (en) Sulfur-substituted sugar to stabilize oligosaccharide
Carter A New Synthetic Pathway Towards Legionaminic Acid

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18790344

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 18790344

Country of ref document: EP

Kind code of ref document: A2