WO2018197520A1 - Methods and compositions of anti-crispr proteins for use in plants - Google Patents
Methods and compositions of anti-crispr proteins for use in plants Download PDFInfo
- Publication number
- WO2018197520A1 WO2018197520A1 PCT/EP2018/060510 EP2018060510W WO2018197520A1 WO 2018197520 A1 WO2018197520 A1 WO 2018197520A1 EP 2018060510 W EP2018060510 W EP 2018060510W WO 2018197520 A1 WO2018197520 A1 WO 2018197520A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cell
- acr
- cas endonuclease
- polynucleotide
- crispr
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2795/00—Bacteriophages
- C12N2795/00011—Details
- C12N2795/10011—Details dsDNA Bacteriophages
- C12N2795/10311—Siphoviridae
- C12N2795/10322—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- NB41268WOPCT_SequenceListing _ST25.TXT created on 24 April 2018 and having a size of 525,189 bytes and is filed concurrently with the specification.
- the sequence listing comprised in this ASCII formatted document is part of the specification and is herein incorporated by reference in its entirety.
- the disclosure relates to the field of molecular biology, in particular, to compositions and methods relating to anti-CRISPR (ACR) proteins compositions and methods of use in plants.
- ACR anti-CRISPR
- Recombinant DNA technology has made it possible to modify (edit) specific endogenous chromosomal sequences and/or insert DNA sequences at targeted genomic locations, thus altering the organism's phenotype.
- Site-specific integration techniques which employ site-specific recombination systems, as well as other types of recombination
- Genome-editing techniques such as designer zinc finger nucleases (ZFNs) or transcription activator-like effector nucleases (TALENs), or homing meganucleases, are available for producing targeted genome perturbations, but these systems tends to have a low specificity and employ designed nucleases that need to be redesigned for each target site, which renders them costly and time-consuming to prepare.
- ZFNs designer zinc finger nucleases
- TALENs transcription activator-like effector nucleases
- homing meganucleases are available for producing targeted genome perturbations, but these systems tends to have a low specificity and employ designed nucleases that need to be redesigned for each target site, which renders them costly and time-consuming to prepare.
- genome-editing tools have been developed from bacterial and archaeal CRISPR systems that offer improved programmability to address a wider array of target sequences as well as improved specificity and efficiency in some applications.
- ACR anti-CRISPR
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a plant cell comprising providing to said cell a Cas endonuclease, a guide RNA capable of binding to the target polynucleotide in the plant cell, and an anti-CRISPR polypeptide capable of reducing the activity of said Cas endonuclease in said plant cell.
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a plant cell comprising providing to said cell a Cas endonuclease, a guide RNA capable of binding to the target polynucleotide in the plant cell, and an anti-CRISPR polypeptide capable of reducing the activity of said Cas endonuclease in said plant cell, wherein the activity selected from the group consisting of: target polynucleotide binding, target polynucleotide nicldng, target polynucleotide double-strand-break creation, and target polynucleotide modification.
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a plant cell comprising providing to said cell a Cas endonuclease, a guide RNA capable of binding to the target polynucleotide in the plant cell, and an anti-CRISPR polypeptide capable of reducing the activity of said Cas endonuclease in said plant cell, wherein the activity selected from the group consisting of: target polynucleotide binding, target polynucleotide nicking, target polynucleotide double-strand-break creation, and target polynucleotide modification, wherein said target polynucleotide modification is selected from the group consisting of: insertion of at least one nucleotide, deletion of at least one nucleotide, substitution of at least one nucleotide, and chemical alteration of at least one nucleotide.
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a plant cell comprising providing to said cell a Cas endonuclease, a guide RNA capable of binding to the target polynucleotide in the plant cell, and an anti-CRISPR polypeptide capable of reducing the activity of said Cas endonuclease in said plant cell, wherein the Cas endonuclease lacks the ability to nick or cleave a target
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a plant cell comprising providing to said cell a Cas endonuclease, a guide RNA capable of binding to the target polynucleotide in the plant cell, and an anti-CRISPR polypeptide capable of reducing the activity of said Cas endonuclease in said plant cell, wherein said activity is decreased as compared to an isoline plant cell comprising said Cas endonuclease and guide RNA but not comprising said anti-CRISPR polypeptide.
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a plant cell comprising providing to said cell a Cas endonuclease, a guide RNA capable of binding to the target polynucleotide in the plant cell, and an anti-CRISPR polypeptide, wherein the activity of said Cas endonuclease in said plant cell is abolished during at least one timepoint, in at least one tissue or cell type, or during at least one phase of the cell or plant life cycle.
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a plant cell comprising providing to said cell a Cas endonuclease, a guide RNA capable of binding to the target polynucleotide in the plant cell, and an anti-CRISPR polypeptide capable of reducing the activity of said Cas endonuclease in said plant cell, wherein the Cas endonuclease is a Type II-A Cas endonuclease,
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a plant cell comprising providing to said cell a Cas endonuclease, a guide RNA capable of binding to the target polynucleotide in the plant cell, and an anti-CRISPR polypeptide capable of reducing the activity of said Cas endonuclease in said plant cell, wherein the Cas endonuclease is Cas9,
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a plant cell comprising providing to said cell a Cas endonuclease, a guide RNA capable of binding to the target polynucleotide in the plant cell, and an anti-CRISPR polypeptide capable of reducing the activity of said Cas endonuclease in said plant cell, wherein the Cas endonuclease is Cpfl.
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a plant cell comprising providing to said cell a Cas endonuclease, a guide RNA capable of binding to the target polynucleotide in the plant cell, and an anti-CRISPR (ACR) polypeptide capable of reducing the activity of said Cas endonuclease in said plant cell, wherein the ACR has an amino acid sequence at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at least 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at least 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 96%, at least 96%, between 96%, between 96%, between 96%, between
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a plant cell comprising providing to said cell a Cas endonuclease, a guide RNA capable of binding to the target polynucleotide in the plant cell, and an anti-CRISPR (ACR) polynucleotide capable of reducing the activity of said Cas endonuclease in said plant cell, wherein the ACR has a polynucleotide sequence at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at least 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at least 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 9
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide.
- ACR anti-CRISPR
- a method for increasing the ratio of on-target polynucleotide cleavage activity to off-target polynucleotide cleavage activity of a Cas endonuclease and guide polynucleotide complex in a plant cell, comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the specificity is increased by at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, at least 10%, or even greater than 10%, greater than 15%, greater than 20%, or greater than 25% compared to the cleavage ratio of the Cas endonuclease in a sample lacking said ACR polypeptide.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during a specific cell cycle,
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during meiosis.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during mitosis.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during a specific stage of the plant's development.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during a specific stage of the plant's development, wherein said stage is selected from the group consisting of: growth, reproductive, vegetative, and senescence.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during a specific time point.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed in a specific tissue or cell type of the plant, in some embodiments selected from the group consisting of: whole plant, seedling, meristematic tissue, ground tissue, vascular tissue, dermal tissue, seed, leaf, root, shoot, stem, flower, fruit, stolon, bulb, tuber, corm, keiki, shoot, bud, tumor tissue, single cells, protoplasts, embryos, and callus tissue.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease and the guide RNA are both provided as polynucleotides.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the guide RNA does not solely comprise ribonucleic acids.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease is provided as a protein and the guide polynucleotide is provided as an RNA molecule.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR is provided as a polynucleotide encoding a polypeptide.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR is provided as a polypeptide.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR is provided concurrently with either the Cas endonuclease or the guide polynucleotide.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR is provided prior to the introduction of the Cas endonuclease or the guide
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR is provided after the introduction of the Cas endonuclease or the guide polynucleotide.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein a polynucleotide encoding the ACR is pre-integrated into the genome of the cell or organism.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein a polynucleotide encoding the Cas endonuclease is pre-integrated into the genome of the cell or organism.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the expression or activity of the ACR is inducible.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the expression or activity of the ACR is inducible, wherein induction is in response to a condition selected from the group consisting of: temperature, presence or absence of an exogenously-applied molecule, activation or inhibition of an endogenous gene, light, cell cycle, organism phase, tissue or cell type, and environmental stress.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR protein comprises a coiled-coil motif.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR has an amino acid sequence at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at least 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at feast 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 96%, at least 96%, between 96% and 97%, at least 97%, between 97% and 98%, at least 98%, between 98% and 99%, at least 99%, between
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polynucleotide, wherein the ACR has a polynucleotide sequence at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at least 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at least 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 96%, at least 96%, between 96% and 97%, at least 97%, between 97% and 98%, at least 98%, between 98% and
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease is a Type Il-A Cas endonuclease.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease is Cas9.
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease is Cpfl .
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease lacks the ability to nick or cleave a target polynucleotide.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing to the target polynucleotide a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide.
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the specificity is increased by at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, at least 10%, or even greater than 10%, greater than 15%, greater than 20%, or greater than 25% compared to the cleavage ratio of the Cas endonuclease in a sample lacking said ACR polypeptide.
- ACR anti-CRISPR
- a method increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell, comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during a specific cell cycle.
- ACR anti-CRISPR
- a method increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell, comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during meiosis.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during mitosis.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during a specific stage of the plant's development.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during a specific stage of the plant's development, wherein said stage is selected from the group consisting of: growth, reproductive, vegetative, and senescence.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed during a specific time point.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein said method is performed in a specific tissue or cell type of the plant, in some embodiments selected from the group consisting of: whole plant, seedling, meristematic tissue, ground tissue, vascular tissue, dermal tissue, seed, leaf, root, shoot, stem, flower, fruit, stolon, bulb, tuber, corm, keiki, shoot, bud, tumor tissue, single cells, protoplasts, embryos, and callus tissue.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease and the guide RNA are both provided as polynucleotides.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the guide RNA does not solely comprise ribonucleic acids.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease is provided as a protein and the guide polynucleotide is provided as an RNA molecule.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR is provided as a polynucleotide encoding a polypeptide.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR is provided as a polypeptide.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR is provided concurrently with either the Cas endonuclease or the guide polynucleotide.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR is provided prior to the introduction of the Cas endonuclease or the guide polynucleotide.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR is provided after the introduction of the Cas endonuclease or the guide polynucleotide.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein a polynucleotide encoding the ACR is pre-integrated into the genome of the cell or organism.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRJSPR (ACR) polypeptide, wherein a polynucleotide encoding the Cas endonuclease is pre- integrated into the genome of the cell or organism.
- ACR anti-CRJSPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the expression or activity of the ACR is inducible.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the expression or activity of the ACR is inducible, wherein induction is in response to a condition selected from the group consisting of: temperature, presence or absence of an exogenously- applied molecule, activation or inhibition of an endogenous gene, light, cell cycle, organism phase, tissue or cell type, and environmental stress.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR protein comprises a coiled-coil motif.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the ACR has an amino acid sequence at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at least 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at least 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 96%, at least 96%, between 96% and 97%, at least 97%, between 97% and 98%, at least 98%, between 98% and 99%, at least 99%, between 99% and 100%
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polynucleotide, wherein the ACR has a polynucleotide sequence at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at least 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at least 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 96%, at least 96%, between 96% and 97%, at least 97%, between 97% and 98%, at least 98%, between 98% and 99%,
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease is a Type II-A Cas endonuclease.
- ACR anti-CRISPR
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease is Cas9.
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease is Cpf 1.
- ACR anti-CRISPR
- a method for increasing the efficiency of homologous recombination of a target polynucleotide in a plant cell comprising introducing together a Cas endonuclease, a guide polynucleotide, and an anti-CRISPR (ACR) polypeptide, wherein the Cas endonuclease lacks the ability to nick or cleave a target polynucleotide.
- ACR anti-CRISPR
- a plant cell comprising a Cas endonuclease and an ACR molecule is provided.
- a plant cell comprising a Cas endonuclease and an ACR molecule is provided, wherein said ACR molecule is provided as a polynucleotide by a phage or virus.
- a plant cell comprising a Cas endonuclease, a guide RNA, and an
- ACR molecule is provided.
- a plant cell comprising a heterologous Cas endonuclease, a guide
- RNA RNA, and an ACR protein
- the guide RNA is capable of binding to a target polynucleotide in the plant's genome.
- a plant cell comprising a Cas endonuclease and an ACR molecule
- the plant cell is obtained or derived from a plant selected from the group consisting of: maize, rice, sorghum, rye, barley, wheat, millet, oats, sugarcane, turfgrass, switchgrass, soybean, canola, alfalfa, sunflower, cotton, tobacco, peanut, potato, tobacco, Arabidopsis, vegetable, and safflower.
- a plant cell comprising a Cas endonuclease and an ACR molecule
- the ACR has an amino acid sequence at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at least 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at least 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 96%, at least 96%, between 96% and 97%, at least 97%, between 97% and 98%, at least 98%, between 98% and 99%, at least 99%, between 99% and 100%, or 100% sequence identity with at least 50, between 50 and 100, at least 100, between 100 and 125, at least 125, between 125 and 150, at least 150, between 150 and 175, at least 175, between 175
- a plant cell comprising a Cas endonuclease and an ACR molecule
- the ACR has a polynucleotide sequence at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at least 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at least 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 96%, at least 96%, between 96% and 97%, at least 97%, between 97% and 98%, at least 98%, between 98% and 99%, at least 99%, between 99% and 100%, or 100% sequence identity with at least 250, between 250 and 500, at least 500, between 500 and 600, or at least 600 contiguous nucleotides of a sequence selected from the group consisting
- plant cell comprising a recombinant construct comprising a polynucleotide sequence encoding an ACR protein, operably linked to a heterologous regulatory expression element is provided.
- plant cell comprising a recombinant construct comprising a polynucleotide sequence encoding an ACR protein, operably linked to a heterologous regulatory expression element is provided.
- plant cell comprising a recombinant construct comprising a polynucleotide sequence encoding an ACR protein, operably linked to a heterologous regulatory expression element
- said plant cell is selected from the group consisting of: maize, rice, sorghum, rye, barley, wheat, millet, oats, sugarcane, turfgrass, switchgrass, soybean, canola, alfalfa, sunflower, cotton, tobacco, peanut, potato, tobacco, Arabidopsis, vegetable, and safflower
- plant cell comprising a recombinant construct comprising a polynucleotide sequence encoding an ACR protein, operably linked to a heterologous regulatory expression element
- the heterologous regulatory expression element is inducible in response to a condition selected from the group consisting of: temperature, presence or absence of an exogenously-applied molecule, activation or inhibition of an endogenous gene, light, cell cycle, organism phase, tissue or cell type, and environmental stress.
- plant cell comprising a recombinant construct comprising a polynucleotide sequence encoding an ACR protein, operably linked to a heterologous regulatory expression element
- the ACR protein comprises a coiled-coil motif
- plant cell comprising a recombinant construct comprising a polynucleotide sequence encoding an ACR protein, operably linked to a heterologous regulatory expression element
- plant cell comprising a recombinant construct comprising a polynucleotide sequence encoding an ACR protein, operably linked to a heterologous regulatory expression element
- the ACR protein comprises an amino acid sequence at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at least 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at least 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 96%, at least 96%, between 96% and 97%, at least 97%, between 97% and 98%, at least 98%, between 98% and 99%, at least 99%, between 99% and 100%, or 100% sequence identity with at least 50, between 50 and 100, at least 100, between 100 and 125, at least 125,
- plant cell comprising a recombinant construct comprising a polynucleotide sequence encoding an ACR protein, operably linked to a heterologous regulatory expression element
- the polynucleotide sequence encoding the ACR protein shares at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at least 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at least 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 96%, at least 96%, between 96% and 97%, at least 97%, between 97% and 98%, at least 98%, between 98% and 99%, at least 99%, between 99% and 100%, or 100% sequence identity with at least 250, between 250 and 500, at least 500, between 500 and
- CRISPR protein comprising: (a) obtaining a bacterial host cell comprising a recombinant construct having a CRISPR system having a targeting sequence capable of targeting a genomic target sequence in a virulent phage; (b) introducing a construct comprising a promoter functional in the bacteria! host cell operably linked to a polynucleotide encoding a polypeptide to be assayed for anti-CRISPR activity; (c) challenging the bacterial host with the virulent phage; and
- a method for identifying an anti-CRISPR protein comprising: (a) obtaining a first bacterial host cell comprising a recombinant construct having a Type II-A CRISPR system having a targeting sequence capable of targeting a genomic target sequence in a first virulent phage; (b) challenging the first bacterial host with the virulent phage; (c) obtaining a second bacterial host cell comprising a recombinant construct having a Type II-A CRISPR system having a targeting sequence capable of targeting a genomic target sequence in a second virulent phage; (d) challenging the second bacterial host with the second virulent phage;
- a method for identifying an anti-CRTSPR protein comprising: (a) obtaining a phage that displays virulence against a bacterium comprising a CRISPR; (b) sequencing the genome of the phage; and (c) identifying at least one contiguous polynucleotide of at least 100 bases that shares at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at feast 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at least 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 96%, at least 96%, between 96% and 97%, at least 97%, between 97% and 98%, at least 98%, between 98% and 99%, at least 99%, between 99% and 100%,
- a method for modulating the activity of a Cas endonuclease with a target polynucleotide in a cell comprising providing an anti-CRlSPR polypeptide to the cell, wherein the anti-CRISPR polypeptide modulates the activity of the Cas endonuclease in the cell, wherein the concentration ratio of Cas endonuclease to anti-CRISPR polypeptide is in the range of 1 :1000 to 1 :100, 1: 100 to 1 : 10, 1 :10 to 1 :1, 1 :1 to 10:1, 10:1 to 100:1, 100:1 to 1000:1, or any concentration ratio between 1 :1000 and 1000:1.
- a method for increasing the specificity of a Cas endonuclease and guide polynucleotide complex in a cell comprising introducing an anti- CR1SPR (ACR) polypeptide to the cell, wherein the ACR polypeptide interacts with the Cas endonuclease, wherein the anti-CRISPR polypeptide modulates the activity of the Cas endonuclease in the cell, wherein the concentration ratio of Cas endonuclease to anti-CRISPR polypeptide is in the range of 1 :1000 to 1 : 100, 1 :100 to 1 :10, l :10 to 1 :1, 1 :1 to 10: 1, 10:l to 100:1, 100:1 to 1000: 1, or any concentration ratio between 1 :1000 and 1000: 1.
- ACR anti- CR1SPR
- a method for increasing site-specific homologous recombination frequency of a donor polynucleotide in a cell comprising introducing to the cell an anti-CRISPR (ACR) polypeptide to increase the homologous recombination of the donor polynucleotide by a polynucleotide-guided Cas endonuclease, wherein the anti-CRISPR polypeptide modulates the activity of the Cas endonuclease in the cell, wherein the concentration ratio of Cas endonuclease to anti-CRISPR polypeptide is in the range of 1 : 1000 to 1 : 100, 1 : 100 to 1 :10, 1 :10 to 1 :1, 1 :1 to 10:1, 10: 1 to 100:1, 100:1 to 1000:1, or any concentration ratio between 1 :1000 and 1000:1.
- ACR anti-CRISPR
- a cell comprising a Cas endonuclease and an ACR protein, wherein the concentration ratio of Cas endonuclease to anti-CRISPR polypeptide is in the range of 1 : 1000 to 1:100, 1 :100 to 1 : 10, 1 :10 to 1 :1, 1 :1 to 10: 1, 10:1 to 100:1, 100:1 to 1000: 1, or any concentration ratio between 1 : 1000 and 1000: 1; wherein the cell optionally further comprises a heterologous polynucleotide.
- the Cas endonuclease may be heterologous to the cell.
- the ACR may be heterologous to the cell.
- the Cas endonuclease and the ACR may be heterologous to the cell and/or to each other.
- ACR may be selected from the group consisting of: cleavage specificity, nicking specificity, binding specificity, or target recognition specificity.
- FIG. 1 provides one embodiment of a schematic for the discovery of virulent phages impeding CRISPR-based immunity.
- Top When a virulent phage is used to challenge a bacterium, phage-resistant survivors can be isolated. Six virulent phages infecting Streptococcus thermophilus DGCC7854 generated differing frequencies of CRISPR-immune survivors.
- FIGs. 2A-2D provide a representative anti-CRISPR activity of StAcrilA in
- FIG. 2A Genes cloned from the CRISPR restrictive (black capsid) phage D4276 were expressed in the DGCC7854-derived immunized strain, and the resulting transformants were assayed for increased sensitivity to the permissive (white capsid) phage D5842.
- FIG. 2B Titre of the restrictive (black) cos-type phage D4276 and permissive (white) cos-type phage D5842 on the naive DGCC7854 or its CR1 -immune derivative, carrying either the empty vector pNZ123 or the vector expressing StAcrilA (pNZAcr).
- FIG. 2C Titre of the permissive (white) pac-type phage 2972 on the naive DGCC7710, a CRl-immune mutant or a CR3-immune mutant carrying either the empty vector pNZ123 or the vector expressing StAcrilA (pNZAcr).
- Each column depicts the average of three biological replicates, each of three technical replicates.
- error bars represent the standard deviation
- an asterisk denotes a difference (p ⁇ 0.001) from all other data, while no other strain differed from any other (p>0.5) as determined by one-way ANOVA and Tukey HSD test.
- Figure 2D Number and characterization of survivors following a phage 2972 challenge of DGCC7710, carrying either the empty vector pNZ123 or the vector expressing StAcrllA (pNZAcr).
- the single CR1 acquisition detected in the presence of the ACR targeted the plasmid and not the phage.
- CR3 acquisitions targeted the phage, as expected. All cells maintained an intact stAcrl!A.
- FIGs. 3A-3B provide one embodiment of an anti-CRISPR gene and protein.
- ACR homologue Genomic context of the gene encoding the ACR in all phage homologues, as well as the closest non-phage homologue (using blastP).
- the ACR homologue is centered (filled with dots and labelled as ACR D4276_028; Sfi21_p24; V442_gp51 ; HMPREF 2991_02915; and
- FIG. 3B Protein alignment of all phage ACR homologues, as well as the closest non-phage homologue (using blastP), highlighting only differences. A dash (-) indicates the residue is absent from the protein.
- ENKLDKIIEKIDKL are predicted coiled-coil motifs (pCoils, >90% confidence) from the consensus, while an "E” (extended) and “H” (helical) indicator above the residue are the consensus predictions obtained from jnet, jhmm and jpssm.
- FIGs. 4A-4B provide schematic representation of one example of anti-CRISPR activity against SpCas9.
- FIG. 4A Generating an immunized Lactococcus lactis MGl 363 strain.
- pL2Cas9 contains the SpCas9 module from pCas9 on a pTRKL2 vector backbone.
- a spacer targeting orf44 of L. lactis virulent phage p2 was cloned-in to create a phage-targeting SpCas9.
- FIG. 4B The titre of virulent phage p2 on its host L.
- lactis MGl 363 carrying either pL2Cas9 or pL2Cas9 targeting the phage (pL2Cas9-44), and either the empty vector pNZ123 or the vector expressing StAcrllA (pNZAcr).
- the titre was assayed by spot test, and each bar represents an average of three biological replicates, each of three technical replicates. Only plaques with typical morphology were counted, although a secondary morphology of tiny plaques
- FIGs. 5A-5B provide a characterization of the "tiny-plaque" phenotype.
- phage p2 When phage p2 is plated on its host carrying pL2Cas9-44, its titre is greatly reduced and a tiny plaque phenotype emerges (see Figure 1).
- FIG. 5A By ECOI assays (also depicted by following every downward-pointing arrow in FIG. 5B), where the phage is passaged on the restrictive host carrying pL2Cas9-44 then plated on a permissive host, we determined that l/30 th of phage particles were still able to infect the restrictive host and release wild type (orange) progeny.
- FIG. 5B (Top 2 rows) A phage population is mixed, containing some pre-existing mutants in or/44 able to bypass the CRISPR- Cas system (top phage depicted on left). We attributed all of the large plaques (0.01% of the population) in FIG. 1 to pre-existing mutants able to replicate effectively on the restrictive host. When sequenced, all of these plaques contained pure populations mutated in the region targeted by pL2Cas9-44.
- FIG. 6 provides a dendrogram of additional, more distant ACR orthologs identified in genomes from Enterococcus faecalis, Enterococcus cecorum, Lactobacillus saerimneri, and Gramtlicatella sp.
- FIGs. 7A and 7B provides a representative anti-CRlSPR activity of the Acr2 protein (SEQ ID NO:28) in Streptococcus thermophilus.
- FIG. 7A Titer of the restrictive (black) cay-type phage D 181 1 and permissive (white) coy-type phage D5842 on the naive DGCC7854 or its CR1 -immune derivative, carrying either the empty vector pNZ 123 or the vector expressing the acr2 gene (SEQ ID NO:27) (pNZAcr).
- Each column depicts the average of three biological replicates, each of three technical replicates.
- FIG. 8 depicts one non-limiting depiction for using a Cas endonuclease to restore function, or abolish function in an ACR gene.
- an ACR recombinant gene expression cassette is designed to be non-functional, then following Cas endonuclease expression and RNA guided cleavage or after a sufficient time has passed for site-specific cleavage, converted into a functional expression cassette.
- FIG. 9 provides one non-limiting depiction for using a Cas endonuclease with an
- the gene encoding an out-of-frame ACR protein may be combined with other genes (such as, but not limited to, a selectable marker) in a polycistron separated by sequences encoding 'self-cleaving' 2A peptides. Then, following restoration of the ACR ORF, the other genes in the multicistronic expression cassette can also be converted into a functional state.
- FIG. 10 provides one non-limiting depiction of modulating Cas endonuclease activity in a cell during particular cell cycle(s).
- inactivating Cas9 during Gl when HR repair is inactive and permitting Cas9 re-activation during S and G2 when HR repair machinery is expressed and active may increase the frequency of homologous recombination in a cell.
- anti-CRISPR gene sequences and anti-CRISPR protein sequences are disclosed as representative, but not limiting, examples in this application:
- SEQID NO:2 anti-CRISPR protein encoded by SEQ ID NO: 1
- SEQID NO:4 anti-CRISPR protein encoded by SEQ ID NO:3
- SEQID NO:6 anti-CRISPR protein encoded by SEQ ID NO;5
- SEQID NO:8 / anti-CRISPR protein encoded by SEQ ID NO: 7
- SEQID NO: 10 / anti-CRISPR protein encoded by SEQ ID NO:9 MAYGKSRYNSYRKRSFNRSNKQRREYAQEMDRLEKAFENLDGWYLSSMKDSAYKDF GKYEIRLSNHSADNKYHDLENGRLIVNIKASKLNFVDnENKLDKlIEKIDKLDLDKYRFl NATNLEHD1KCYYKGFKTKXEVI
- SEQID NO:12 / anti-CRISPR protein encoded by SEQ ID NO:l 1
- SEQID NO:15 anti-CRISPR gene isolated from Bacteriophage D4252 ATGGCATACGGAAAAAGCAGATACAACTCATATAGAAAGCGCAGTTTTAACAGAAG
- SEQID NO:16 / anti-CRISPR protein encoded by SEQ ID NO:15
- SEQID NO:20 anti-CRlSPR protein encoded by SEQ ID NO: 19
- SEQID NO:22 / anti-CRISPR protein encoded by SEQ ID NO:21
- SEQID NO:26 / anti-CRISPR protein encoded by SEQ ID NO:25
- SEQID NO:28 anti-CRISPR protein encoded by SEQ ID NO:27
- a AATTCG AG A AC G A CTTTTATA A ACTGCCAGGC ATC A A GTTC ACTGATGCAAATTG G
- SEQID NO:30 anti-CRISPR protein encoded by SEQ ID NO:29
- SEQID NO:32 anti-CRISPR protein encoded by SEQ ID NO:31
- SEQID NO:34 anti-CRISPR protein encoded by SEQ ID NO:33
- SEQID NO:36 anti-CRISPR protein encoded by SEQ ID NO:35
- SEQID NO:38 / anti-CRISPR protein encoded by SEQ ID NO:37
- SEQID NO:40 anti-CRISPR protein encoded by SEQ ID NO:39
- SEQID NO:42 anti-CRISPR protein encoded by SEQ ID NO:41
- SEQID NO:46 anti-CRISPR protein encoded by SEQ ID NO:45
- SEQID NO:50 anti-CRISPR protein encoded by SEQ ID NO:49
- SEQID NO:52 anti-CRISPR protein encoded by SEQ ID NO:51
- SEQID NO:54 anti-CRISPR protein encoded by SEQ ID NO:53
- SEQID NO:56 anti-CRISPR protein encoded by SEQ ID NO:55
- SEQID NO:58 / anti-CRISPR protein encoded by SEQ ID NO:57
- SEQID NO:60 anti-CRISPR protein encoded by SEQ ID NO:59
- SEQID NO:62 anti-CRISPR protein encoded by SEQ ID NO:61
- SEQID NO:66 anti-CRISPR protein encoded by SEQ ID NO:65
- SEQID NO:68 / anti-CRISPR protein encoded by SEQ ID NO:67
- SEQID NO:70 / anti-CRISPR protein encoded by SEQ ID NO:69 MLINNDIKELILE Y VKRYFKFENDF YRLPGIKTTDAN WQKFKNGDTAIEKMGA SR VNSM LDCLFEDFELAMIGKAQDEYYLDNSLKMNMPFYAYYDMFKJCKQLVKWLKDHHDDILG GTGRMYTSSGNY1ANAYLEVALESSSLGSGSYMIQMRFKNYSKGQEPIPSGRQNRLEWI EKNLENIR
- SEQID NO:72 anti-CRISPR protein encoded by SEQ ID NO:71
- SEQID NO:76 anti-CRISPR protein encoded by SEQ ID NO:75
- SEQID NO:78 anti-CRiSPR protein encoded by SEQ ID NO:77
- SEQID NO:80 anti-CRISPR protein encoded by SEQ ID NO:79
- SEQID NO:82 anti-CRISPR protein encoded by SEQ ID NO:81
- SEQID NO:84 anti-CRISPR protein encoded by SEQ ID NO:83
- compositions and methods are provided for novel anti-CRlSPR ("ACR") polynucleotides and polypeptides as well as methods of use of such polynucleotides and polypeptides.
- ACR anti-CRlSPR
- the abbreviation "ACR” as used herein may be used as an alternative notation for "ACR polypeptide", “ACR protein”, or "ACR polynucleotide”, consistent with context.
- the disclosed methods include methods for inhibiting the activity of CRTSPR-Cas complexes from modifying target DNA molecules. Accordingly, the disclosed compositions and methods find a wide range of uses in genome editing applications, particularly in plants.
- the CRISPR-Cas system bases its utility as a genome-editing tool on its native function as an immune system in prokaryotes.
- the very first demonstration of its activity against bacterial viruses (phages) was also the first record of phages evading that immunity. This evasion can be due to point mutations, DNA modifications, or specific phage-encoded proteins that interfere with the CRISPR-Cas system, known as anti-CRISPRs (ACRs).
- ACRs anti-CRISPRs
- the latter category is of considerable biotechnological interest, as these ACRs can serve as off-switches for CRISPR-based genome-editing.
- Streptococcus thermophilic In challenging an S. thermophilus strain CRlSPR-immunized against a set of related virulent phages, we found one phage that evaded the CRISPR-Cas system at greater than 40000 times the rate of the others. We then identified an ACR solely responsible for the abolished immunity.
- Disclosed herein are methods of identifying an ACR, methods of using an ACR to modulate the activity of a Cas endonuclease, particularly in a cell, particularly in a plant cell, and exemplary but not limiting compositions of ACR polypeptides, and polynucleotides encoding the same.
- nucleic acid means a polynucleotide and includes a single or a double-stranded polymer of deoxyribonucleotide or ribonucleotide bases. Nucleic acids may also include fragments and modified nucleotides. Thus, the terms “polynucleotide”, “nucleic acid sequence”, “nucleotide sequence” and “nucleic acid fragment” are used interchangeably to denote a polymer of RNA and/or DNA and/or RNA-DNA that is single- or double-stranded, optionally comprising synthetic, non-naturally occurring, or altered nucleotide bases.
- Nucleotides are referred to by their single letter designation as follows: “A” for adenosine or deoxyadenosine (for RNA or DNA, respectively), “C” for cytosine or deoxycytosine, “G” for guanosine or deoxyguanosine, “U” for uridine, “T” for deoxythymidine, “R” for purines (A or G), “Y” for pyrimidines (C or T), "K” for G or T, “H” for A or C or T, “I” for inosine, and “N” for any nucleotide.
- gene as it applies to a prokaryotic and eukaryotic cell or organism cells encompasses not only chromosomal DNA found within the nucleus, but organelle DNA found within subcellular components (e.g., mitochondria, or plastid) of the cell.
- ORF Open reading frame
- sequences include reference to hybridization, under stringent hybridization conditions, of a nucleic acid sequence to a specified nucleic acid target sequence to a detectably greater degree (e.g., at least 2-fold over background) than its hybridization to non-target nucleic acid sequences and to the substantial exclusion of non-target nucleic acids.
- Selectively hybridizing sequences typically have about at least 80% sequence identity, or 90% sequence identity, up to and including 100% sequence identity (i.e., fully complementary) with each other.
- stringent conditions or “stringent hybridization conditions” includes reference to conditions under which a polynucleotide/probe will selectively hybridize to its target sequence in an in vitro hybridization assay. Stringent conditions are sequence-dependent and will be different in different circumstances. By controlling the stringency of the hybridization and/or washing conditions, target sequences can be identified which are 100% complementary to the polynucleotide/probe (homologous probing). Alternatively, stringency conditions can be adjusted to allow some mismatching in sequences so that lower degrees of similarity are detected
- a polynucleotide/probe is fewer than about 1000 nucleotides in length, fewer than 500 nucleotides, fewer than 100 nucleotides, fewer than 90 nucleotides, fewer than 80 nucleotides, fewer than 70 nucleotides, fewer than 60 nucleotides, fewer than 50 nucleotides, fewer than 40 nucleotides, fewer than 30 nucleotides, fewer than 20 nucleotides, 10 nucleotides, or even fewer than 10 nucleotides.
- stringent conditions will be those in which the salt concentration is less than about 1.5 M Na ion, typically about 0.01 to 1.0 M Na ion concentration (or other salt(s)) at pH 7.0 to 8.3, and at least 30°C for short
- polynucleotides/probes e.g., 10 to 50 nucleotides
- at least 60°C for long e.g., 10 to 50 nucleotides
- polynucleotides/probes e.g., greater than 50 nucleotides.
- Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide.
- Exemplary moderate stringency conditions include hybridization in 40 to 45% formamide, 1 M NaCl, 1% SDS at 37°C, and a wash in 0.5X to IX SSC at 55 to 60°C.
- Exemplary high stringency conditions include hybridization in 50% formamide, 1 M NaCl, 1% SDS at 37°C, and a wash in 0.1X SSC at 60 to 65°C.
- homology is meant DNA sequences that are similar.
- a "region of homology to a genomic region” that is found on the donor DNA is a region of DNA that has a similar sequence to a given "genomic region” in the cell or organism genome.
- a region of homology can be of any length that is sufficient to promote homologous recombination at the cleaved target site.
- the region of homology can comprise at least 5-10, 5-15, 5-20, 5-25, 5-30, 5-35, 5-40, 5-45, 5- 50, 5-55, 5-60, 5-65, 5- 70, 5-75, 5-80, 5-85, 5-90, 5-95, 5-100, 5-200, 5-300, 5-400, 5-500, 5-600, 5-700, 5-800, 5-900, 5-1000, 5-1 100, 5-1200, 5-1300, 5- 1400, 5-1500, 5-1600, 5-1700, 5-1800, 5-1900, 5-2000, 5-2100, 5-2200, 5-2300, 5-2400, 5-2500, 5-2600, 5-2700, 5-2800, 5-2900, 5-3000, 5-3100 or more bases in length such that the region of homology has sufficient similarity to undergo homologous recombination with the corresponding genomic region.
- “Sufficient similarity” indicates that two polynucleotide sequences have sufficient structural equivalency to act as substrates for a homologous recombination reaction.
- the structural equivalency includes overall length of each polynucleotide fragment, as well as the sequence similarity of the polynucleotides. Sequence similarity can be described by the percent sequence identity over the whole length of the sequences, and/or by conserved regions comprising localized similarities such as contiguous nucleotides having 100% sequence identity, and percent sequence identity over a portion of the length of the sequences.
- genomic region is a segment of a chromosome in the genome of a cell that is present on either side of a target site or, alternatively, also comprises a portion of a target site.
- the genomic region can comprise at least 5-10, 5-15, 5-20, 5-25, 5-30, 5-35, 5-40, 5-45, 5- 50, 5-55, 5-60, 5-65, 5- 70, 5-75, 5-80, 5-85, 5-90, 5-95, 5-100, 5-200, 5-300, 5-400, 5- 500, 5-600, 5-700, 5-800, 5-900, 5-1000, 5-1100, 5-1200, 5-1300, 5-1400, 5-1500, 5-1600, 5- 1700, 5-1800, 5-1900, 5-2000, 5-2100, 5-2200, 5-2300, 5-2400, 5-2500, 5-2600, 5-2700, 5-2800. 5-2900, 5-3000, 5-3100 or more bases such that the genomic region has sufficient similarity to undergo homologous recomb
- the frequency of homologous recombination is influenced by a number of factors. Different organisms vary with respect to the amount of homologous recombination and the relative proportion of homologous to non-homologous recombination. Generally, the length of the region of homology affects the frequency of homologous recombination events: the longer the region of homology, the greater the frequency. The length of the homology region needed to observe homologous recombination is also species-variable. In many cases, at least 5 kb of homology has been utilized, but homologous recombination has been observed with as little as 25-50 bp of homology.
- sequence identity or “identity” in the context of nucleic acid or polypeptide sequences refers to the nucleic acid bases or amino acid residues in two sequences that are the same when aligned for maximum correspondence over a specified comparison window.
- the term "percentage of sequence identity” refers to the value determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the results by 100 to yield the percentage of sequence identity.
- percent sequence identities include, but are not limited to, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100%, or any incremental or fractional percentage from 50% to 100%. These identities can be determined using any of the programs described herein.
- Sequence alignments and percent identity or similarity calculations may be determined using a variety of comparison methods designed to detect homologous sequences including, but not limited to, the MegAlignTM program of the LASERGENE bioinformatics computing suite (DNASTAR Inc., Madison, WI).
- sequence analysis software is used for analysis, that the results of the analysis will be based on the "default values" of the program referenced, unless otherwise specified.
- default values will mean any set of values or parameters that originally load with the software when first initialized.
- Clustal V method of alignment corresponds to the alignment method labeled Clustal V (described by Higgins and Sharp, (1989) 045/055:151-153; Higgins et al, (1992) Comput Appl Biosci 8:189-191) and found in the MegAlignTM program of the
- PENALTY 10
- KTUPLE-2 KTUPLE-2
- DIAGONALS SAVED 4.
- sequence distances table in the same program. Unless otherwise stated, sequence
- identity/similarity values refer to the value obtained using GAP Version 10 (GCG, Accelrys, San Diego, CA) using the following parameters: % identity and % similarity for a nucleotide sequence using a gap creation penalty weight of 50 and a gap length extension penalty weight of 3, and the nwsgapdna.cmp scoring matrix; % identity and % similarity for an amino acid sequence using a GAP creation penalty weight of 8 and a gap length extension penalty of 2, and the BLOSUM62 scoring matrix (Henikoff and Henikoff, (1989) Proc. Natl Acad. Sci. USA 89:10915).
- GAP uses the algorithm of Needleman and Wunsch, (1970) J Afo/ Biol 48:443-53, to find an alignment of two complete sequences that maximizes the number of matches and minimizes the number of gaps. GAP considers all possible alignments and gap positions and creates the alignment with the largest number of matched bases and the fewest gaps, using a gap creation penalty and a gap extension penalty in units of matched bases.
- BLAST is a searching algorithm provided by the National Center for Biotechnology
- NCBI National Network Search Information
- the program compares nucleotide or protein sequences to sequence databases and calculates the statistical significance of matches to identify sequences having sufficient similarity to a query sequence such that the similarity would not be predicted to have occurred randomly.
- BLAST reports the identified sequences and their local alignment to the query sequence. It is well understood by one skilled in the art that many levels of sequence identity are useful in identifying polypeptides from other species or modified naturally or synthetically wherein such polypeptides have the same or similar function or activity.
- percent identities include, but are not limited to, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100%, or any incremental or fractional percentage from 50% to 100%.
- any amino acid identity from 50% to 100% may be useful in describing the present disclosure, such as 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
- polypeptide and polypeptide sequences variants thereof, and the structural relationships of these sequences can be described by the terms “homology”, “homologous”, “substantially identical”, “substantially similar” and “corresponding substantially” which are used interchangeably herein. These refer to polypeptide or nucleic acid sequences wherein changes in one or more amino acids or nucleotide bases do not affect the function of the molecule, such as the ability to mediate gene expression or to produce a certain phenotype. These terms also refer to modification(s) of nucleic acid sequences that do not substantially alter the functional properties of the resulting nucleic acid relative to the initial, unmodified nucleic acid.
- modifications include deletion, substitution, and/or insertion of one or more nucleotides in the nucleic acid fragment, the association of an atom or a molecule to an existing nucleotide in a polynucleotide (for example but not limited to: a covalent addition of a methyl group, or an ionic interaction with a metal ion), the chemical alteration of at least one nucleotide, or any combination of the preceding.
- Substantially similar nucleic acid sequences encompassed may be defined by their ability to hybridize (under moderately stringent conditions, e.g., 0.5X SSC, 0.1% SDS, 60°C) with the sequences exemplified herein, or to any portion of the nucleotide sequences disclosed herein and which are functionally equivalent to any of the nucleic acid sequences disclosed herein.
- Stringency conditions can be adjusted to screen for moderately similar fragments, such as homologous sequences from distantly related organisms, to highly similar fragments, such as genes that duplicate functional enzymes from closely related organisms. Post-hybridization washes determine stringency conditions.
- a centimorgan is the distance between two polynucleotide sequences, linked genes, markers, target sites, loci, or any pair thereof, wherein 1% of the products of meiosis are recombinant.
- a centimorgan is equivalent to a distance equal to a 1% average recombination frequency between the two linked genes, markers, target sites, loci, or any pair thereof.
- nucleic acid molecule substantially or essentially free from
- an isolated or purified polynucleotide or polypeptide or protein is substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized.
- an "isolated" polynucleotide is free of sequences (optimally protein encoding sequences) that naturally flank the polynucleotide (i.e., sequences located at the 5' and 3' ends of the polynucleotide) in the genomic DNA of the organism from which the polynucleotide is derived.
- the isolated polynucleotide can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb, or 0.1 kb of nucleotide sequence that naturally flank the polynucleotide in genomic DNA of the cell from which the polynucleotide is derived.
- Isolated polynucleotides may be purified from a cell in which they naturally occur. Conventional nucleic acid purification methods known to skilled artisans may be used to obtain isolated polynucleotides.
- the term also embraces recombinant polynucleotides and chemically synthesized polynucleotides.
- fragment refers to a contiguous set of polynucleotides or polypeptides.
- a fragment is 2, 3, 4, 5, 6, 7 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or greater than 20 contiguous polynucleotides. In one embodiment, a fragment is 2, 3, 4, 5, 6, 7 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or greater than 20 contiguous polypeptides. A fragment may or may not exhibit the function of a sequence sharing some percent identity over the length of said fragment.
- fragment that is functionally equivalent and “functionally equivalent fragment” are used interchangeably herein. These terms refer to a portion or subsequence of an isolated nucleic acid fragment or polypeptide that displays the same activity or function as the longer sequence from which it derives. In one example, the fragment retains the ability to alter gene expression or produce a certain phenotype whether or not the fragment encodes an active protein. For example, the fragment can be used in the design of genes to produce the desired phenotype in a modified plant. Genes can be designed for use in suppression by linking a nucleic acid fragment, whether or not it encodes an active enzyme, in the sense or antisense orientation relative to a promoter sequence.
- a variant comprises a deletion and/or addition of one or more nucleotides at one or more sites within the native polynucleotide and/or a substitution of one or more nucleotides at one or more sites in the native polynucleotide.
- a "native" or “wild type" polynucleotide or polypeptide comprises a naturally occurring nucleotide sequence or amino acid sequence, respectively.
- conservative variants include those sequences that, because of the degeneracy of the genetic code, encode the amino acid sequence of a polypeptide disclosed herein.
- Naturally occurring allelic variants such as these can be identified with the use of well-known molecular biology techniques, as, for example, with polymerase chain reaction (PCR) and hybridization techniques as outlined below.
- Variant polynucleotides also include synthetically derived polynucleotides, such as those generated, for example, by using site- directed mutagenesis, and which may encode a polypeptide.
- variants of a particular polynucleotide disclosed herein will have at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to that particular polynucleotide (e.g., to the ACR sequences of SEQ ID NOs: 1, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, and 99-374) as determined by sequence alignment programs and parameters described elsewhere herein or known in the art.
- variant protein is intended to mean a protein derived from the native protein by deletion or addition of one or more amino acids at one or more sites in the native protein and/or substitution of one or more amino acids at one or more sites in the native protein.
- a variant proteins disclosed herein include those that are biologically active, that is they continue to possess biological activity of the native protein. Such variants are referred to as “functional variants", “biologically active variant” or “active variant” interchangeably herein, and may result from, for example, genetic polymorphism or human manipulation.
- Gene includes a nucleic acid fragment that expresses a functional molecule such as, but not limited to, a specific protein, including regulatory sequences preceding (5' non- coding sequences) and following (3' non-coding sequences) the coding sequence.
- “Native gene” refers to a gene as found in its natural endogenous location with its own regulatory sequences.
- endogenous it is meant a sequence or other molecule that naturally occurs in a cell or organism.
- an endogenous polynucleotide is normally found in the genome of the cell from which it is obtained; that is, not heterologous.
- An "allele” is one of several alternative forms of a gene occupying a given locus on a chromosome. When all the alleles present at a given locus on a chromosome are the same, that plant is homozygous at that locus. If the alleles present at a given locus on a chromosome differ, that plant is heterozygous at that locus.
- Coding sequence refers to a polynucleotide sequence that may be transcribed into an RNA molecule and optionally further translated into a polypeptide.
- regulatory sequences refer to nucleotide sequences located upstream (5' non-coding sequences), within, or downstream (3' non-coding sequences) of a coding sequence, and which influence the transcription, RNA processing or stability, or translation of the associated coding sequence. Regulatory sequences include, but are not limited to, promoters, translation leader sequences, 5' untranslated sequences, 3' untranslated sequences, introns, polyadenylation target sequences, RNA processing sites, effector binding sites, and stem-loop structures.
- a "mutated gene” is a gene that has been altered through human intervention.
- Such a “mutated gene” has a sequence that differs from the sequence of the corresponding non- mutated gene by at least one nucleotide addition, deletion, or substitution.
- the mutated gene comprises an alteration that results from a guide polynucleotide/Cas endonuclease system as disclosed herein.
- a mutated plant is a plant comprising a mutated gene.
- a "targeted mutation” is a mutation in a gene (referred to as the target gene), including a native gene, that was made by altering a target sequence within the target gene using any method known to one skilled in the art, including a method involving a guided Cas endonuclease system as disclosed herein.
- knock-out represents a DNA sequence of a cell that has been rendered partially or completely inoperative by targeting with a Cas protein; for example, a DNA sequence prior to knock-out could have encoded an amino acid sequence, or could have had a regulatory function (e.g., promoter).
- knock-in represents the replacement or insertion of a DNA sequence at a specific DNA sequence in ceil by targeting with a Cas protein (for example by homologous recombination (HR), wherein a suitable donor DNA polynucleotide is also used).
- a suitable donor DNA polynucleotide for example by homologous recombination (HR), wherein a suitable donor DNA polynucleotide is also used.
- knock-ins are a specific insertion of a heterologous amino acid coding sequence in a coding region of a gene, or a specific insertion of a transcriptional regulatory element in a genetic locus.
- domain it is meant a contiguous stretch of nucleotides (that can be RNA,
- the term "conserved domain” or "motif means a set of polynucleotides or amino acids conserved at specific positions along an aligned sequence of evoluttonanly related proteins. While amino acids at other positions can vary between homologous proteins, amino acids that are highly conserved at specific positions indicate amino acids that are essential to the structure, the stability, or the activity of a protein. Because they are identified by their high degree of conservation in aligned sequences of a family of protein homologues, they can be used as identifiers, or "signatures", to determine if a protein with a newly determined sequence belongs to a previously identified protein family.
- a "codon-modified gene” or “codon-preferred gene” or “codon-optimized gene” is a gene having its frequency of codon usage designed to mimic the frequency of preferred codon usage of the host cell.
- An “optimized” polynucleotide is a sequence that has been optimized for improved expression or function in a particular heterologous host cell.
- a "plant-optimized nucleotide sequence” is a nucleotide sequence that has been optimized for expression or function in plants, particularly for increased expression in plants.
- a plant-optimized nucleotide sequence includes a codon-optimized gene.
- a plant-optimized nucleotide sequence can be synthesized by modifying a nucleotide sequence encoding a protein such as, for example, a Cas endonuclease as disclosed herein, using one or more plant-preferred codons for improved expression. See, for example, Campbell and Gowri (1990) Plant Physiol. 92:1-11 for a discussion of host-preferred codon usage.
- a "promoter” is a region of DNA involved in recognition and binding of RNA polymerase and other proteins to initiate transcription.
- the promoter sequence consists of proximal and more distal upstream elements, the latter elements often referred to as enhancers.
- An “enhancer” is a DNA sequence that can stimulate promoter activity, and may be an innate element of the promoter or a heterologous element inserted to enhance the level or tissue- specificity of a promoter. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from different promoters found in nature, and/or comprise synthetic DNA segments.
- promoters may direct the expression of a gene in different tissues or cell types, or at different stages of development, or in response to different environmental conditions. It is further recognized that since in most cases the exact boundaries of regulatory sequences have not been completely defined, DNA fragments of some variation may have identical promoter activity.
- inducible promoter refers to a promoter that selectively express a coding sequence or functional RNA in response to the presence of an endogenous or exogenous stimulus, for example by chemical compounds (chemical inducers) or in response to environmental, hormonal, chemical, and/or developmental signals, inducible or regulated promoters include, for example, promoters induced or regulated by light, heat, stress, flooding or drought, salt stress, osmotic stress, phytohormones, wounding, or chemicals such as ethanol, abscisic acid (ABA), jasmonate, salicylic acid, or safeners.
- ABA abscisic acid
- Translation leader sequence refers to a polynucleotide sequence located between the promoter sequence of a gene and the coding sequence.
- the translation leader sequence is present in the mRNA upstream of the translation start sequence.
- the translation leader sequence may affect processing of the primary transcript to mRNA, mRNA stability or translation efficiency. Examples of translation leader sequences have been described (e.g., Turner and Foster, (1995) Mol Biotechnol 3:225-236).
- 3' non-coding sequences refer to DNA sequences located downstream of a coding sequence and include polyadenylation recognition sequences and other sequences encoding regulatory signals capable of affecting mRNA processing or gene expression.
- the polyadenylation signal is usually characterized by affecting the addition of polyadenylic acid tracts to the 3' end of the mRNA precursor.
- the use of different 3' non-coding sequences is exemplified by Ingelbrecht et ah, (1989) Plant Cell 1 :671-680.
- RNA transcript refers to the product resulting from RNA poiymerase-catalyzed transcription of a DNA sequence. When the RNA transcript is a perfect complimentary copy of the DNA sequence, it is referred to as the primary transcript or pre-mRNA. A RNA transcript is referred to as the mature RNA or mRNA when it is a RNA sequence derived from post- transcriptionai processing of the primary transcript pre-mRNA. "Messenger RNA” or “mRNA” refers to the RNA that is without introns and that can be translated into protein by the cell.
- cDNA refers to a DNA that is complementary to, and synthesized from, an mRNA template using the enzyme reverse transcriptase.
- the cDNA can be single-stranded or converted into double-stranded form using the Klenow fragment of DNA polymerase I.
- Sense RNA refers to RNA transcript that includes the mRNA and can be translated into protein within a cell or in vitro.
- Antisense RNA refers to an RNA transcript that is complementary to all or part of a target primary transcript or mRNA, and that blocks the expression of a target gene (see, e.g., U.S. Patent No. 5, 107,065).
- the complementarity of an antisense RNA may be with any part of the specific gene transcript, i.e., at the 5' non-coding sequence, 3' non-coding sequence, introns, or the coding sequence.
- “Functional RNA” refers to antisense RNA, ribozyme RNA, or other RNA that may not be translated yet has an effect on cellular processes.
- the terms "complement” and “reverse complement” are used interchangeably herein with respect to mRNA transcripts, and are meant to define the antisense RNA of the message.
- genomic refers to the entire complement of genetic material (genes and non-coding sequences) that is present in each cell of an organism, or virus or organelle; and/or a complete set of chromosomes inherited as a (haploid) unit from one parent.
- operably linked refers to the association of nucleic acid sequences on a single nucleic acid fragment so that the function of one is regulated by the other.
- a promoter is operabiy linked with a coding sequence when it is capable of regulating the expression of that coding sequence (i.e., the coding sequence is under the transcriptional control of the promoter).
- Coding sequences can be operably linked to regulatory sequences in a sense or antisense orientation.
- the complementary RNA regions can be operably linked, either directly or indirectly, 5' to the target mRNA, or 3' to the target mRNA, or within the target mRNA, or a first complementary region is 5' and its complement is 3 ' to the target mRNA.
- "Introducing" is intended to mean presenting to the organism, such as a cell or organism, the polynucleotide or polypeptide or a poiynucleotide-protein complex (e.g. an engineered CRISPR-Cas complex), in such a manner that the component(s) gains access to the interior of a ceil of the organism or to the ceil itself.
- the methods and compositions do not depend on a particular method for introducing a sequence into an organism or cell, only that the polynucleotide or polypeptide gains access to the interior of at least one ceil of the organism.
- Introducing includes reference to the incorporation of a nucleic acid into a eukaryotic or prokaryotic cell where the nucleic acid may be incoiporated into the genome of the cell, and includes reference to the transient (direct) provision of a polynucleotide or polypeptide to the cell.
- a heterologous component polynucleotide, polypeptide, other molecule, cell
- a “host cell” refers to an in vivo or in vitro eukaryotic cell, prokaryotic cell (e.g., bacterial or archaeal cell), or cell from a multicellular organism (e.g., a cell line) cultured as a unicellular entity, into which a heterologous polynucleotide or polypeptide has been introduced.
- the cell is selected from the group consisting of: an archaea!
- the cell a bacterial cell, a eukaryotic cell, a eukaryotic single-cell organism, a somatic ceil, a germ cell, a stem cell, a plant cell, an algal cell, an animal cell, in invertebrate cell, a vertebrate cell, a fish cell, a frog cell, a bird cell, an insect cell, a mammalian cell, a pig cell, a cow cell, a goat cell, a sheep cell, a rodent cell, a rat cell, a mouse cell, a non-human primate cell, and a human cell.
- the cell is in vitro. In some cases, the cell is in vivo.
- the term "recombinant” refers to an artificial combination of two otherwise separated segments of sequence, e.g., by chemical synthesis, or manipulation of isolated segments of nucleic acids by genetic engineering techniques.
- Plasmid refers to a linear or circular extra chromosomal element often carrying genes that are not part of the central metabolism of the cell, and usually in the form of double-stranded DNA.
- Such elements may be autonomously replicating sequences, genome integrating sequences, phage, or nucleotide sequences, in linear or circular form, of a single- or double-stranded DNA or RNA, derived from any source, in which a number of nucleotide sequences have been joined or recombined into a unique construction which is capable of introducing a polynucleotide of interest into a cell.
- Transformation cassette refers to a specific vector comprising a gene and having elements in addition to the gene that facilitates transformation of a particular host ceil.
- Expression cassette refers to a specific vector comprising a gene and having elements in addition to the gene that allow for expression of that gene in a host.
- a recombinant DNA construct comprises an artificial combination of nucleic acid sequences, e.g., regulatory and coding sequences that are not all found together in nature.
- a recombinant DNA construct may comprise regulatory sequences and coding sequences that are derived from different sources, or regulatory sequences and coding sequences derived from the same source, but arranged in a manner different than that found in nature.
- Such a construct may be used by itself or may be used in conjunction with a vector. If a vector is used, then the choice of vector is dependent upon the method that will be used to introduce the vector into the host cells as is well known to those skilled in the art.
- a plasmid vector can be used.
- the skilled artisan is well aware of the genetic elements that must be present on the vector in order to successfully transform, select and propagate host cells.
- the skilled artisan will also recognize that different independent transformation events may result in different levels and patterns of expression (Jones et al, (1985) EMBO J 4:2411 -2418; De Almeida et al., (1989) Mol Gen Genetics 218:78-86), and thus that multiple events are typically screened in order to obtain lines displaying the desired expression level and pattern.
- Such screening may be accomplished standard molecular biological, biochemical, and other assays including Southern analysis of DNA, Northern analysis of mRNA expression, PCR, reai time quantitative PCR (qPCR), reverse transcription PCR (RT-PCR), immunoblotting analysis of protein expression, enzyme or activity assays, and/or phenotypic analysis.
- Southern analysis of DNA Northern analysis of mRNA expression
- PCR reai time quantitative PCR
- RT-PCR reverse transcription PCR
- immunoblotting analysis of protein expression enzyme or activity assays, and/or phenotypic analysis.
- Non-limiting examples include differences in taxonomic derivation (e.g., a polynucleotide sequence obtained from Zea mays would be heterologous if inserted into the genome of an Oiyza sativa plant, or of a different variety or cultivar of Zea mays; or a polynucleotide obtained from a bacterium was introduced into a cell of a plant), or sequence (e.g., a polynucleotide sequence obtained from Zea mays, isolated, modified, and re-introduced into a maize plant).
- heterologous in reference to a sequence can refer to a sequence that originates from a different species, variety, foreign species, or, if from the same species, is substantially modified from its native form in composition and/or genomic locus by deliberate human intervention.
- a promoter operably linked to a heterologous polynucleotide is from a species different from the species from which the polynucleotide was derived, or, if from the same/analogous species, one or both are substantially modified from their original form and/or genomic locus, or the promoter is not the native promoter for the operably linked polynucleotide.
- one or more regulatory region(s) and/or a polynucleotide provided herein may be entirely synthetic.
- expression refers to the production of a functional end-product (e.g., an mRNA, guide RNA, or a protein) in either precursor or mature form.
- a functional end-product e.g., an mRNA, guide RNA, or a protein
- a "mature" protein refers to a post-translationally processed polypeptide (i.e., one from which any pre- or propeptides present in the primary translation product have been removed).
- Precursor protein refers to the primary product of translation of mRNA (i.e., with pre- and propeptides still present). Pre- and propeptides may be but are not limited to intracellular localization signals.
- CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
- a CR1SPR locus can consist of a CRISPR array, comprising short direct repeats (CRISPR repeats) separated by short variable DNA sequences (called spacers), which can be flanked by diverse Cas (CRISPR-associated) genes.
- an "effector” or “effector protein” is a protein that encompasses an activity including recognizing, binding to, and/or cleaving or nicking a polynucleotide target.
- the "effector complex" of a CRISPR system includes Cas proteins involved in crRNA and target recognition and binding. Some of the component Cas proteins may additionally comprise domains involved in target polynucleotide cleavage.
- Cas protein refers to a polypeptide encoded by a Cas (CRISPR- associated) gene.
- a Cas protein includes but is not limited to: the novel Cas9 orthologs disclosed herein, a Cas9 protein, a Cpfl (Cas 12) protein, a C2cl protein, a C2c2 protein, a C2c3 protein, Cas3, Cas3-HD, Cas 5, Cas7, Cas8, Casl O, or combinations or complexes of these.
- a Cas protein may be a "Cas endonuclease" , that when in complex with a suitable polynucleotide component, is capable of recognizing, binding to, and optionally nicking or cleaving all or part of a specific polynucleotide target sequence.
- a Cas endonuclease described herein comprises one or more nuclease domains.
- a Cas protein is further defined as a functional fragment or functional variant of a native Cas protein, or a protein that shares at least 50%, between 50% and 55%, at least 55%, between 55% and 60%, at least 60%, between 60% and 65%, at least 65%, between 65% and 70%, at least 70%, between 70% and 75%, at least 75%, between 75% and 80%, at least 80%, between 80% 85, and 99-374%, at least 85%, between 85% and 90%, at least 90%, between 90% and 95%, at least 95%, between 95% and 96%, at least 96%, between 96% and 97%, at least 97%, between 97% and 98%, at least 98%, between 98% and 99%, at least 99%, between 99% and 100%, or 100% sequence identity with at least 50, between 50 and 100, at least 100, between 100 and 150, at least 150, between 150 and 200, at least 200, between 200 and 250, at least 250, between 250 and 300, at least 300, between 300 and 350, at least 350, between 350
- “functionally equivalent fragment” of a Cas endonuclease are used interchangeably herein, and refer to a portion or subsequence of the Cas endonuclease of the present disclosure in which the ability to recognize, bind to, and optionally unwind, nick or cleave (introduce a single or double- strand break in) the target site is retained.
- the portion or subsequence of the Cas endonuclease can comprise a complete or partial (functional) peptide of any one of its domains such as for example, but not limiting to a complete or functional part of a HD domain, a complete or functional part of a helicase domain, a complete or functional part of an endonuclease domain, a complete or functional part of a PAM-interacting domain, a complete or functional part of a Wedge domain, a complete or functional part of an RuvC domain, a complete or functional part of a zinc-finger domain, or a complete or functional part of a Cas protein (such as but not limiting to a Cas9, Cpfl, Cas5, Cas5d, Cas7, Cas8b l, Casl, Cas2, Cas4, or Cas9 ortholog).
- a Cas protein such as but not limiting to a Cas9, Cpfl, Cas5, Cas5d, Cas7, Cas8b
- “functionally equivalent variant” of a Cas endonuclease or Cas endonuclease, including Cas9 ortholog described herein, are used interchangeably herein, and refer to a variant of the Cas endonuclease disclosed herein in which the ability to recognize, bind to, and optionally unwind, nick or cleave all or part of a target sequence is retained.
- a functional fragment or functional variant retains about the same level and type (e.g., target polynucleotide recognition, binding, and cleavage) of activity as the parental molecule from which it was derived.
- a functional fragment or functional variant displays improved activity of the same type (e.g., increased specificity of target polynucleotide recognition) as the parental molecule from which it was derived.
- a functional fragment or functional variant displays reduced activity of the same type (e.g., lower target polynucleotide binding affinity) as the parental molecule from which it was derived.
- a functional fragment or functional variant displays partial activity (e.g.
- a functional fragment or functional variant displays a different type of activity (e.g., creation of a single-strand nick on a target polynucleotide vs. a double strand break) than the parental molecule from which it was derived. Any similarity or difference in type or level of activity may be chosen as a desired outcome, according to the needs of the practitioner.
- a Cas endonuclease may also include a multifunctional Cas endonuclease.
- multifunctional Cas endonuclease and “multifunctional Cas endonuclease polypeptide” are used interchangeably herein and includes reference to a single polypeptide that has Cas endonuclease functionality (comprising at least one protein domain that can act as a Cas endonuclease) and at least one other functionality, such as but not limited to, the functionality to form a cascade (comprises at least a second protein domain that can form a cascade with other proteins).
- the multifunctional Cas endonuclease comprises at least one additional protein domain relative (either internally, upstream (5') t downstream (3'), or both internally 5' and 3', or any combination thereof) to those domains typical of a Cas endonuclease.
- guide polynucleotide relates to a polynucleotide sequence that can form a complex with a Cas endonuclease, including the Cas endonuclease described herein, and enables the Cas endonuclease to recognize, optionally bind to, and optionally cleave a DNA target site.
- the guide polynucleotide sequence can be a RNA sequence, a DNA sequence, or a combination thereof (a RNA-DNA combination sequence).
- RNA, crRNA or tracrRNA, respectively refer to a portion or subsequence of the guide RNA, crRNA or tracrRNA, respectively, of the present disclosure in which the ability to function as a guide RNA, crRNA or tracrRNA, respectively, is retained.
- RNA, crRNA or tracrRNA are used interchangeably herein, and refer to a variant of the guide RNA, crRNA or tracrRNA, respectively, of the present disclosure in which the ability to function as a guide RNA, crRNA or tracrRNA, respectively, is retained.
- single guide RNA and “sgRNA” are used interchangeably herein and relate to a synthetic fusion of two RNA molecules, a crRNA (CRISPR RNA) comprising a variable targeting domain (linked to a tracr mate sequence that hybridizes to a tracrRNA), fused to a tracrRNA (trans-activating CRISPR RNA).
- CRISPR RNA crRNA
- variable targeting domain linked to a tracr mate sequence that hybridizes to a tracrRNA
- trans-activating CRISPR RNA trans-activating CRISPR RNA
- the single guide RNA can comprise a crRNA or crRNA fragment and a tracrRNA or tracrRNA fragment of the type II CRISPR/Cas system that can form a complex with a type II Cas endonuclease, wherein said guide RNA/Cas endonuclease complex can direct the Cas endonuclease to a DNA target site, enabling the Cas endonuclease to recognize, optionally bind to, and optionally nick or cleave (introduce a single or double-strand break) the DNA target site.
- variable targeting domain or "VT domain” is used interchangeably herein and includes a nucleotide sequence that can hybridize (is complementary) to one strand (nucleotide sequence) of a double strand DNA target site.
- the percent complementation between the first nucleotide sequence domain (VT domain) and the target sequence can be at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 63%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- variable targeting domain can be at least 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 nucleotides in length. In some embodiments, the variable targeting domain comprises a contiguous stretch of 12 to 30 nucleotides.
- the variable targeting domain can be composed of a DNA sequence, a RNA sequence, a modified DNA sequence, a modified RNA sequence, or any combination thereof.
- CER domain of a guide polynucleotide
- CER domain includes a nucleotide sequence that interacts with a Cas endonuclease polypeptide.
- a CER domain comprises a (trans-acting) tracrNucieotide mate sequence followed by a tracrNucieotide sequence.
- the CER domain can be composed of a DNA sequence, a RNA sequence, a modified DNA sequence, a modified RNA sequence (see for example US201500590 lOAl, published 26 February 2015), or any combination thereof.
- guide polynucleotide/Cas endonuclease system guide polynucleotide/Cas complex
- guide polynucleotide/Cas system and “guided Cas system”
- polynucleotide-guided endonuclease and “PGEN” are used interchangeably herein and refer to at least one guide polynucleotide and at least one Cas endonuclease, that are capable of forming a complex
- said guide polynucleotide/Cas endonuclease complex can direct the Cas endonuclease to a DNA target site, enabling the Cas endonuclease to recognize, bind to, and optionally nick or cleave (introduce a single or double-strand break) the DNA target site.
- a guide polynucleotide/Cas endonuclease complex herein can comprise Cas protein(s) and suitable polynucleotide component(s) of any of the known CRISPR systems (Horvath and Barrangou, 2010, Science 327: 167-170; Makarova et al. 2015, Nature Reviews Microbiology Vol. 13:1-15; Zetsche et al, 2015, Cell 163, 1-13;
- guide RNA/Cas endonuclease complex refers to at least one RNA component and at least one Cas endonuclease that are capable of forming a complex , wherein said guide RNA/Cas endonuclease complex can direct the Cas endonuclease to a DNA target site, enabling the Cas endonuclease to recognize, bind to, and optionally nick or cleave (introduce a single or double-strand break) the DNA target site.
- the components are provided as a nbonu
- target site refers to a polynucleotide sequence such as, but not limited to, a nucleotide sequence on a chromosome, episome, a locus, or any other DNA molecule in the genome (including chromosomal, chloroplastic, mitochondrial DNA, p!asmid DNA) of a cell, at which a guide polynucleotide/Cas endonuclease complex can recognize, bind to, and optionally nick or cleave .
- the target site can be an endogenous site in the genome of a cell, or alternatively, the target site can be heterologous to the cell and thereby not be naturally occurring in the genome of the cell, or the target site can be found in a heterologous genomic location compared to where it occurs in nature.
- endogenous target sequence and “native target sequence” are used
- an "artificial target site” or “artificial target sequence” are used interchangeably herein and refer to a target sequence that has been introduced into the genome of a cell.
- Such an artificial target sequence can be identical in sequence to an endogenous or native target sequence in the genome of a cell but be located in a different position a non-endogenous or non-native position) in the genome of a cell.
- a "protospacer adjacent motif (PAM) herein refers to a short nucleotide sequence adjacent to a target sequence (protospacer) that is recognized (targeted) by a guide polynucleotide/Cas endonuclease system described herein.
- PAM protospacer adjacent motif
- the endonuclease may not successfully recognize a target DNA sequence if the target DNA sequence is not adjacent to, or near, a PAM sequence.
- the PAM precedes the target sequence (e.g. Casl2a).
- the PAM follows the target sequence (e.g. S. pyogenes Cas9).
- the sequence and length of a PAM herein can differ depending on the Cas protein or Cas protein complex used.
- the PAM sequence can be of any length but is typically 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 nucleotides long.
- modified target sequence are used interchangeably herein and refer to a target sequence as disclosed herein that comprises at least one alteration when compared to non-altered target sequence.
- Such "alterations” include, for example: modifications include deletion, substitution, and/or insertion of one or more nucleotides in the nucleic acid fragment, the association of an atom or a molecule to an existing nucleotide in a polynucleotide (for example but not limited to: a covalent addition of a methyl group, or an ionic interaction with a metal ion), the chemical alteration of at least one nucleotide, or any combination of the preceding.
- a "modified nucleotide” or “edited nucleotide” refers to a nucleotide sequence of interest that comprises at least one alteration when compared to its non-modified nucleotide sequence.
- Such "alterations” include, for example: modifications include deletion, substitution, and/or insertion of one or more nucleotides in the nucleic acid fragment, the association of an atom or a molecule to an existing nucleotide in a polynucleotide (for example but not limited to: a covalent addition of a methyl group, or an ionic interaction with a metal ion), the chemical alteration of at least one nucleotide, or any combination of the preceding.
- Methods for "modifying a target site” and “altering a target site” are used interchangeably herein and refer to methods for producing an altered target site.
- donor DNA is a DNA construct that comprises a polynucleotide of interest to be inserted into the target site of a Cas endonuclease.
- polynucleotide modification template includes a polynucleotide that comprises at least one nucleotide modification when compared to the nucleotide sequence to be edited.
- a nucleotide modification can be at least one nucleotide substitution, addition or deletion.
- the polynucleotide modification template can further comprise homologous nucleotide sequences flanking the at least one nucleotide modification, wherein the flanking homologous nucleotide sequences provide sufficient homology to the desired nucleotide sequence to be edited.
- eukaryote or “eukaryotic” refers to organisms or cells or tissues derived therefrom belonging to the phybgenetic domain Eukarya such as animals (e.g., mammals, insects, reptiles, and birds), ciliates, plants (e.g., monocots, dicots, and aigae), fungi, yeasts, flagellates, microsporidia, and protists.
- Eukaryotic cells include, but are not limited to, human, non-human, animal, mammalian, bacterial, fungal, insect, yeast, and plant cells as well as plants and seeds produced by the methods described herein.
- plant-optimized Cas endonuciease refers to a Cas protein, including a multifunctional Cas protein, encoded by a nucleotide sequence that has been optimized for expression in a plant cell or plant.
- a "plant-optimized nucleotide sequence encoding a Cas endonuciease", "plant- optimized construct encoding a Cas endonuciease” and a “plant-optimized polynucleotide encoding a Cas endonuciease” are used interchangeably herein and refer to a nucleotide sequence encoding a Cas protein, or a variant or functional fragment thereof, that has been optimized for expression in a plant cell or plant.
- a plant comprising a plant-optimized Cas endonuciease includes a plant comprising the nucleotide sequence encoding for the Cas sequence and/or a plant comprising the Cas endonuciease protein.
- the plant-optimized Cas endonuciease nucleotide sequence is a maize-optimized, rice-optimized, wheat-optimized, soybean-optimized, cotton-optimized, or canola-optimized Cas endonuciease.
- Plant generically includes whole plants, plant organs, plant tissues, seeds, plant cells, seeds and progeny of the same.
- Plant cells include, without limitation, cells from seeds, suspension cultures, embryos, meristematic regions, callus tissue, leaves, roots, shoots, gametophytes, sporophytes, pollen and microspores.
- a "plant element” is intended to reference either a whole plant or a plant component, which may comprise differentiated and/or undifferentiated tissues, for example but not limited to plant tissues, parts, and cell types, hi one embodiment, a plant element is one of the following: whole plant, seedling, meristematic tissue, ground tissue, vascular tissue, dermal tissue, seed, leaf, root, shoot, stem, flower, fruit, stolon, bulb, tuber, corm, keiki, shoot, bud, tumor tissue, and various forms of cells and culture (e.g., single cells, protoplasts, embryos, callus tissue).
- plant organ refers to plant tissue or a group of tissues that constitute a morphologically and functionally distinct part of a plant.
- a "plant element” is synonymous to a "portion" of a plant, and refers to any part of the plant, and can include distinct tissues and/or organs, and may be used interchangeably with the term “tissue” throughout.
- a "plant reproductive element” is intended to generically reference any part of a plant that is able to initiate other plants via either sexual or asexual reproduction of that plant, for example but not limited to: seed, seedling, root, shoot, cutting, scion, graft, stolon, bulb, tuber, corm, keiki, or bud.
- the plant element may be in plant or in a plant organ, tissue culture, or ceil culture.
- Progeny comprises any subsequent generation of a plant.
- plant part refers to plant ceils, plant protoplasts, plant cell tissue cultures from which plants can be regenerated, plant calli, plant clumps, and plant cells that are intact in plants or parts of plants such as embryos, pollen, ovules, seeds, leaves, flowers, branches, fruit, kernels, ears, cobs, husks, stalks, roots, root tips, anthers, and the like, as well as the parts themselves.
- Grain is intended to mean the mature seed produced by commercial growers for purposes other than growing or reproducing the species.
- Progeny, variants, and mutants of the regenerated plants are also included within the scope of the invention, provided that these parts comprise the introduced polynucleotides.
- the term "monocotyledonous” or “monocot” refers to the subclass of angiosperm plants also known as “monocotyiedoneae", whose seeds typically comprise only one embryonic leaf, or cotyledon.
- the term includes references to whole plants, plant elements, plant organs (e.g., leaves, stems, roots, etc.), seeds, plant ceils, and progeny of the same.
- dicotyledonous or “dicot” refers to the subclass of angiosperm plants also knows as “dicotyledoneae”, whose seeds typically comprise two embryonic leaves, or cotyledons.
- the term includes references to whole plants, plant elements, plant organs (e.g., leaves, stems, roots, etc.), seeds, plant cells, and progeny of the same.
- isoline is a comparative term, and references organisms that are genetically identical, but differ in treatment.
- two genetically identical maize plant embryos may be separated into two different groups, one receiving a treatment (such as the introduction of a CRISPR-Cas effector endonuclease) and one control that does not receive such treatment.
- "isoline” refers to two cells or organisms that are genetically identical except for the presence of a heterologous polynucleotide or polypeptide that has been introduced as part of an experiment. Any phenotypic differences between the two groups may thus be attributed solely to the treatment or presence of the heterologous molecule, and not to any inherent property of the organism's endogenous genetic makeup.
- "Introducing" is intended to mean presenting to a target, such as a cell or organism, a polynucleotide or polypeptide or polynucleotide-protein complex, in such a manner that the component(s) gains access to the interior of a cell of the organism or to the cell itself.
- a "polynucleotide of interest” includes any nucleotide sequence encoding a protein or polypeptide that improves desirability of crops.
- Polynucleotides of interest include, but are not limited to, polynucleotides encoding important traits for agronomics, herbicide- resistance, insecticidal resistance, disease resistance, nematode resistance, herbicide resistance, microbial resistance, fungal resistance, viral resistance, fertility or sterility, grain characteristics, commercial products, phenotypic marker, or any other trait of agronomic or commerciai importance.
- a polynucleotide of interest may additionally be utilized in either the sense or anti- sense orientation. Further, more than one polynucleotide of interest may be utilized together, or "stacked", to provide additional benefit.
- nucleic acid molecule substantially or essentially free from
- an isolated or purified polynucleotide or polypeptide or protein is substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized.
- an "isolated" polynucleotide is free of sequences (optimally protein encoding sequences) that naturally flank the polynucleotide (i.e., sequences located at the 5' and 3' ends of the polynucleotide) in the genomic DNA of the organism from which the polynucleotide is derived.
- the isolated polynucleotide can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb, or 0.1 kb of nucleotide sequence that naturally flank the polynucleotide in genomic DNA of the cell from which the polynucleotide is derived.
- Isolated polynucleotides may be purified from a host cell in which they naturally occur. Conventional nucleic acid purification methods known to skilled artisans may be used to obtain isolated polynucleotides.
- the term also embraces recombinant polynucleotides and chemically synthesized polynucleotides.
- a protein that is substantially free of cellular material includes preparations of protein having less than about 30%, 20%, 10%, 5%, or 1% (by dry weight) of contaminating protein.
- optimally culture medium represents less than about 30%, 20%, 10%, 5%, or 1% (by dry weight) of chemical precursors or non-protein-of-interest chemicals.
- compositions and methods herein may provide for an improved "agronomic trait” or “trait of agronomic importance” or “trait of agronomic interest” to a plant, which may include, but not be limited to, the following: disease resistance, drought tolerance, heat tolerance, cold tolerance, salinity tolerance, metal tolerance, herbicide tolerance, improved water use efficiency, improved nitrogen utilization, improved nitrogen fixation, pest resistance, herbivore resistance, pathogen resistance, yield improvement, health enhancement, vigor improvement, growth improvement, photosynthetic capability improvement, nutrition enhancement, altered protein content, altered oil content, increased biomass, increased shoot length, increased root length, improved root architecture, modulation of a metabolite, modulation of the proteome, increased seed weight, altered seed carbohydrate composition, altered seed oil composition, altered seed protein composition, altered seed nutrient composition, as compared to an isoline plant not comprising a modification derived from the methods or compositions herein.
- Agronomic trait potential is intended to mean a capability of a plant element for exhibiting a phenotype, preferably an improved agronomic trait, at some point during its life cycle, or conveying said phenotype to another plant element with which it is associated in the same plant.
- a decrease in a characteristic may be at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, between 5% and 10%, at least 10%, between 10% and 20%, at least 15%, at least 20%, between 20% and 30%, at least 25%, at least 30%, between 30% and 40%, at least 35%, at least 40%, between 40% and 50%, at least 45%, at least 50%, between 50% and 60%, at least 60%, between 60% and 70%, between 70% and 80%, at least 75%, at least 80%, between 80% and 90%, at least 90%, between 90% and 100%, at least 100%, between 100% and 200%, at least 200%, at least 300%, at least 400%) or more lower than the untreated control and an increase may be at least 1%, at least 2%, at least 3%, at least 4%, at least 5%, between 5% and
- the term "before”, in reference to a sequence position, refers to an occurrence of one sequence upstream, or 5', to another sequence.
- a CR1SPR system is characterized by elements that promote the formation of a CRISPR complex (comprising a Cas protein (e.g. a Cas9 protein), a tracr and a crRNA (having a repeat sequence and a spacer, or guide, sequence)) at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system).
- a Cas protein e.g. a Cas9 protein
- tracr e.g. a Cas9 protein
- crRNA having a repeat sequence and a spacer, or guide, sequence
- a target sequence also referred to as a protospacer in the context of an endogenous CRISPR system.
- the natural spacer sequence has been replaced with a sequence designed to be complementary to a target sequence, for example, a target sequence in a eukaryotic cell.
- target sequence refers to a sequence to which a guide sequence is designed to have complementarity.
- a target sequence can be any polynucleotide, such as DNA or RNA polynucleotides.
- a target sequence is located in the nucleus or cytoplasm of a cell.
- CRISPR-Cas systems have been classified according to sequence and structural analysis of components. Multiple CRISPR/Cas systems have been described including Class 1 systems, with multisubunit effector complexes (comprising type I, type III, and type IV), and Class 2 systems, with single protein effectors (comprising type II, type V, and type VI)
- a CRISPR-Cas system comprises, at a minimum, a CRISPR RNA (crRNA) molecule and at least one CRISPR-associated (Cas) protein to form crRNA ribonucleoprotein (crRNP) effector complexes.
- CRISPR-Cas loci comprise an array of identical repeats interspersed with DNA-targeting spacers that encode the crRNA components and an operon-like unit of cas genes encoding the Cas protein components.
- the resulting ribonucleoprotein complex is called a Cascade, that recognizes a polynucleotide in a sequence-specific manner (Jore et al, Nature Structural & Molecular Biology 18, 529-536 (2011)).
- the crRNA serves as a guide RNA for sequence specific binding of the effector (protein or complex) to double strand DNA sequences, by forming base pairs with the complementary DNA strand while displacing the noncomplementary strand to form a so-called R-loop.
- the Cas endonuclease is guided by a single CRISPR RNA (crRNA) through direct RNA-DNA base-pairing to recognize a DNA target site that is in close vicinity to a protospacer adjacent motif (PAM) (Jore, M.M. et al, 2011, Nat. Struct. Mol. Biol 18:529-536, Westra, E.R. et al, 2012, Molecular Cell 46:595-605, and Sinkunas, T. et al, 2013, EMBO J. 32:385-394).
- Class 1 CRISPR-Cas systems comprise Types I, III, and IV.
- Class I systems A characteristic feature of Class I systems is the presence of an effector endonuclease complex instead of a single protein.
- Class 2 CRISPR-Cas systems comprise Types II, V, and VI.
- a characteristic feature of Class 2 systems is the presence of a single Cas protein instead of an effector module
- Types II and V Cas proteins comprise an RuvC-like endonuclease domain that adopts the RNase H fold,
- Class 2 Type II CRISPR/Cas systems employ a crRNA and tracrRNA (trans- activating CRISPR RNA) to guide the Cas endonuclease to its DNA target.
- the crRNA comprises a spacer region complementary to one strand of the double strand DNA target and a region that base pairs with the tracrRNA (trans-activating CRISPR RNA) forming a RNA duplex that directs the Cas endonuclease to cleave the DNA target.
- the cleavage leaves a blunt end.
- Type II CRISR-Cas loci can encode a tracrRNA, which is partially complementary to the repeats within the respective CRISPR array, and can comprise other proteins.
- Cas endonucleases can be used for targeted genome editing (via simplex and multiplex double-strand breaks and nicks) and targeted genome regulation (via tethering of epigenetic effector domains to either the Cas protein or gRNA.
- a Cas endonuclease can also be engineered to function as an RNA-guided recombinase, and via RNA tethers could serve as a scaffold for the assembly of multiprotein and nucleic acid complexes (Mali et al, 2013, Nature Methods Vol. 10: 957-963).
- Class I Cas endonucleases comprise multisubunit effector complexes (Types I, III, and IV), while Class 2 systems comprise single protein effectors (Types II, V, and VI) (Makarova et al. 2015, Nature Reviews Microbiology Vol. 13:1-15; Zetsche et al., 2015, Cell 163, 1-13; Shmakov et al, 2015, Molecular Cell 60, 1-13; Haft et al, 2005,
- the Cas endonuclease acts in complex with a guide RNA (gRNA) that directs the Cas endonuclease to cleave the DNA target to enable target recognition, binding, and cleavage by the Cas endonuclease.
- gRNA guide RNA
- the gRNA comprises a Cas endonuclease recognition (CER) domain that interacts with the Cas endonuclease, and a Variable Targeting (VT) domain that hybridizes to a nucleotide sequence in a target DNA .
- CER Cas endonuclease recognition
- VT Variable Targeting
- the gRNA comprises a CRISPR RNA (crRNA) and a trans-activating CRISPR RNA (tracrRNA) to guide the Cas endonuclease to its DNA target.
- the crRNA comprises a spacer region complementary to one strand of the double strand DNA target and a region that base pairs with the tracrRNA, forming an RNA duplex.
- the gRNA is a "single guide RNA" (sgRNA) that comprises a synthetic fusion of crRNA and tracrRNA.
- sgRNA single guide RNA
- the Cas endonuc lease-guide polynucleotide complex recognizes a short nucleotide sequence adjacent to the target sequence (protospacer), called a "protospacer adjacent motif (PAM).
- Examples of a Cas endonuclease include but are not limited to Cas9 and Cpfl.
- Cas9 (formerly referred to as Cas5, Csnl, or Csxl2) is a Class 2 Type II Cas endonuclease (Makarova et al. 2015, Nature Reviews Microbiology Vol. 13:1-15).
- a Cas9-gRNA complex recognizes a 3' PAM sequence (NGG for the S. pyogenes Cas9) at the target site, permitting the spacer of the guide RNA to invade the double-stranded DNA target, and, if sufficient homology between the spacer and protospacer exists, generate a double-strand break cleavage.
- Cas9 endonucleases comprise RuvC and HNH domains that together produce double strand breaks, and separately can produce single strand breaks. For the S.
- Cpfl is a Class 2 Type V Cas endonuciease, and comprises nuclease RuvC domain but lacks an HNH domain (Yamane et al., 2016, Cell 165:949- 962). Cpfl endonucleases create "sticky" overhang ends.
- Cas9 orthologs are known in the art as well as their associated tracrRNA and ciRNA components (see, e.g., "Supplementary Table S2. List of bacterial strains with identified Cas9 orthologs," Fonfara, Ines, et al., "Phylogeny of Cas9 Determines Functional Exchangeability of Dual -RNA and Cas9 among Orthologous Type II CRISPR/Cas Systems," Nucleic Acids Research 42.4 (2014): 2577-2590, including all Supplemental Data; Chylinski K., et al., “Classification and evolution of type II CRISPR-Cas systems," Nucleic Acids Research, 2014; 42(10):6091-6105, including all Supplemental Data; Kevin M Esvelt, K.
- the Cas endonuciease is identified from a Type II-A CRISPR complex, such as those derived from Streptococcus thermophilic, or Streptococcus pyogenes.
- a "polynucleotide modification template” is provided that comprises at least one nucleotide modification when compared to the nucleotide sequence to be edited.
- a nucleotide modification can be at least one nucleotide substitution, addition, deletion, or chemical alteration.
- the polynucleotide modification template can further comprise homologous nucleotide sequences flanking the at least one nucleotide modification, wherein the flanking homologous nucleotide sequences provide sufficient homology to the desired nucleotide sequence to be edited.
- a polynucleotide of interest is inserted at a target site and provided as part of a "donor DMA" molecule.
- donor DNA is a DNA construct that comprises a polynucleotide of interest to be inserted into the target site of a Cas
- the donor DNA construct further comprises a first and a second region of homology that flank the polynucleotide of interest.
- the first and second regions of homology of the donor DNA share homology to a first and a second genomic region, respectively, present in or flanking the target site of the cell or organism genome.
- the donor DNA can be tethered to the guide polynucleotide. Tethered donor DNAs can allow for co-locaiizing target and donor DNA, useful in genome editing, gene insertion, and targeted genome regulation, and can also be useful in targeting post-mitotic cells where function of endogenous HR machinery is expected to be highly diminished (Mali et at, 2013, Nature Methods Vol. 10: 957-963).
- the amount of homology or sequence identity shared by a target and a donor polynucleotide can vary and includes total lengths and/or regions.
- the gene comprising the Cas endonuclease may be optimized as described in WO2016186953 published 24 November 2016, and then delivered into cells as DNA expression cassettes by methods known in the art.
- the Cas endonuclease is provided as a polypeptide. In some aspects, the Cas endonuclease is provided as a polynucleotide encoding a polypeptide. In some aspects, the guide RNA is provided as a DNA molecule encoding one or more RNA molecules. In some aspects, the guide RNA is provide as RNA or chemically-modified RNA, In some aspects, the Cas endonuclease protein and guide RNA are provided as a nbonucleoprotein complex (RNP).
- RNP nbonucleoprotein complex
- Cas endonuclease variants that have a reduced activity towards off-target sequences.
- Such Cas endonuclease variants include those disclosed, for example, in WO2016 205 613. Such combinations may provide for an even greater reduction in off-target activity.
- CRISPR-Cas-mediated genome editing composition refers to the elements of a CRISPR system needed to carry out CRISPR-Cas-mediated genome editing in a host cell, such as a eukaryotic cell.
- Engineered CRISPR-Cas complex compositions typically include one or more nucleic acids comprising a crRNA, a tracrRNA (or chimeric thereof also referred to a guide RNA or single guide RNA) and a Cas enzyme, for example, Cas9.
- the crRNA and tracrRNAs of engineered -Cas complex compositions can also be provided to the system indirectly by nucleic acids encoding the crRNA, tracrRNA and/or guide RNA.
- the CRISPR/Cas-mediated genome editing composition can optionally include a donor polynucleotide that can be recombined into the target cell's genome at or adjacent to the target site (e.g., the site of single or double stand break induced by the Cas9).
- Examples of engineered CRISPR-Cas complexes include those disclosed in U.S. Publication No. 2015/0045546 and International Application publication number WO 2013/176772.
- Cas9-gRNA systems at a genomic target site include but are not limited to insertions, deletions, substitutions, or modifications of one or more nucleotides at the target site; modifying or replacing nucleotide sequences of interest (such as a regulatory elements); insertion of polynucleotides of interest; gene knock-out; gene-knock in; modification of splicing sites and/or intiOducing alternate splicing sites; modifications of nucleotide sequences encoding a protein of interest; amino acid and/or protein fusions; and gene silencing by expressing an inverted repeat into a gene of interest.
- the process for editing a genomic sequence at a Cas9-gRNA double-strand-break site with a modification template generally comprises: providing a host cell with a Cas9-gRNA complex that recognizes a target sequence in the genome of the host cell and is able to induce a double-strand-break in the genomic sequence, and at least one polynucleotide modification template comprising at least one nucleotide alteration when compared to the nucleotide sequence to be edited.
- the polynucleotide modification template can further comprise nucleotide sequences flanking the at least one nucleotide alteration, in which the flanking sequences are substantially homologous to the chromosomal region flanking the double-strand break.
- Genome editing using double-strand-break-inducing agents such as Cas9-gRNA complexes, has been described, for example in US20150082478 published on 19 March 2015, WO2015026886 published on 26 February 2015, WO2016007347 published 14 January 2016, and
- the gene comprising the Cas endonuclease may be optimized as described in WO2016186953 published 24 November 2016, and then delivered into ceils as DNA expression cassettes by methods known in the art.
- the Cas endonuclease is provided as a polypeptide.
- the Cas endonuclease is provided as a polynucleotide encoding a polypeptide.
- the guide RNA is provided as a DNA molecule encoding one or more RNA molecules.
- the guide RNA is provide as RNA or chemically-modified RNA.
- the Cas endonuclease protein and guide RNA are provided as a ribonucleoprotein complex (RNP).
- compositions disclosed herein include isolated polynucleotides and polypeptides encoding anti-CRISPR ("ACR") proteins.
- ACR anti-CRISPR
- polypeptides are capable of reducing or inhibiting the ability of Cas endonuclease, for example but not limited to a Cas9 protein, to recognize, bind, and optionally modify, nick, or cleave a target polynucleotide.
- polynucleotides and polynucleotide encoding polypeptides are provided which reduce and/or inhibit Cas9 activity against a target DNA molecule.
- polypeptides that reduce and/or inhibit the activity of Type li-A Cas9 proteins are provided.
- isolated or recombinant polynucleotides which comprise a nucleotide sequence set forth in SEQ ID NOs: 1, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, and 99-374), or functional fragments or variants thereof.
- polypeptides having a sequence set forth in SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, and 375-650, or functional fragments or variants thereof.
- isolated or recombinant polypeptides which comprise an amino acid sequence set forth in SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, and 375-650), or functional fragments or variants thereof.
- the ACR polynucleotides and polypeptides disclosed herein include both the naturally occurring sequences as well as nucleic acid variants. Likewise, the polypeptides and proteins encompass both naturally occurring polypeptides as well as variations and modified forms thereof. Such polynucleotide and polypeptide variants may continue to possess the desired activity, in which case the mutations that will be made in the DNA encoding the variant will not place the sequence out of reading frame.
- polypeptides provided in SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, and 375-650).
- Functional variants of a protein disclosed herein may also have at least about 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%), 98%, 99% or more sequence identity to the amino acid sequence for the native protein (e.g. the polypeptides provided in SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, and 26) and have a coiled-coil motif.
- a functional variant of a protein disclosed herein may differ from that protein by as few as 1-15 amino acid residues, as few as 1-10, such as 6-10, as few as 5, as few as 4, 3, 2, or even 1 amino acid residue.
- the ACR polypeptides include those that contain a coiled coil motif.
- coiled coil motifs of the ACR proteins include those polypeptide sequences that contain a repeated pattern of amino acids, hxxhcxc, of hydrophobic (h) and charged (c) amino acids, also sometimes referred to as a heptad repeat.
- the coiled coil motif includes the polypeptide sequences
- KQRREYAQEMDRLEKAFENLD and/or ENKLDKIIEKIDKL those that contain 70%, 75%, 80%, 85%, 90%, 90%, 95%, 96%, 97%, 98%, and 99% sequence identity to SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, and 26. and retain the coiled coil structure.
- proteins disclosed herein may be altered in various ways including amino acid substitutions, deletions, truncations, and insertions. Methods for such manipulations are generally known in the art. For example, amino acid sequence variants and fragments of polypeptides can be prepared by mutations in the DNA. Methods for mutagenesis and polynucleotide alterations are well known in the art. See, for example, Kunkel (1985) Proc. Nail. Acad. Sci. USA 82:488-492; Kunkel et al. (1987) Methods in Enzymol. 154:367-382; U.S. Patent No. 4,873,192; Walker and Gaastra, eds.
- an "active" polypeptide, or fragments thereof retains a biological activity of the native or naturally-occurring counterpart of the active polypeptide.
- Biological activity refers to a function mediated by the native or naturally-occurring counterpart of the active polypeptide. For example, binding or protein-protein interaction constitutes a biological activity.
- certain deletions, insertions, and substitutions of the protein sequences encompassed herein are not expected to produce radical changes in the characteristics of the protein. However, when it is difficult to predict the exact effect of the substitution, deletion, or insertion in advance of doing so, one skilled in the art will appreciate that the effect may be evaluated by screening assays, such as those described herein.
- Variant functional polynucleotides and proteins also encompass sequences and proteins derived from a mutagenic and recombinogenic procedure such as DNA shuffling. With such a procedure, one or more different sequences can be manipulated to create a new
- polynucleotides are generated from a population of related sequence polynucleotides comprising sequence regions that have substantial sequence identity and can be homologously recombined in vitro or in vivo. For example, using this approach, sequence motifs encoding a domain of interest may be shuffled between the polynucleotides disclosed herein and other known polynucleotides to obtain a new gene coding for a protein with an improved property of interest, such as an increased K m in the case of an enzyme. Strategies for such DNA shuffling are known in the art. See, for example, Stemmer (1994) Proc. Natl Acad. Sci. USA 91:10747-10751 ;
- Fragments and variants of the disclosed polynucleotides and proteins encoded thereby are also provided.
- fragment is intended a portion of the polynucleotide or a portion of the amino acid sequence and hence protein encoded thereby.
- Fragments of a polynucleotide may encode protein fragments that retain the biological activity of the native protein, or fragments of a polynucleotide, may retain the biological activity of the full size polynucleotide; these fragments are referred to herein as "functional fragments".
- the terms "functional fragments" are referred to herein as "functional fragments".
- a functional fragment of a polynucleotide that encodes a biologically active portion of an ACR polypeptide will encode at least 15, 25, 30, 50, 100, or 125 contiguous amino acids, or up to the total number of amino acids present in a full-length ACR polypeptide (e.g. the polypeptides provided in SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, and 375-650).
- Such functional fragments of SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, and 26 may optionally include a coiled-coil motif.
- Functional fragments of ACR proteins of the present disclosure include fragments comprising 50-130, 60-120, 70-110, 80-100 amino acids of an ACR protein and retain activity. Functional fragments of ACR proteins of the present disclosure can also include fragments comprising 50-130, 60-120, 70-110, 80-100 amino acids of an ACR protein and have a coiled- coil motif.
- a biologically active portion of a polypeptide can be prepared by isolating a portion of one of the polynucleotides disclosed herein, expressing the encoded portion of the protein (e.g., by recombinant expression in vitro), and assessing the activity of the encoded portion of the polypeptide.
- Polynucleotides that are functional fragments of a polynucleotide encoding an ACR protein comprise at least 50, 75, 100, 150, 200, 250, 300, 350, or 400 nucleotides, or up to the number of nucleotides present in a full-length polynucleotide disclosed herein.
- the ACR compositions provided herein, as well as any of the CRISPR-Cas compositions, may be provided as part of a recombinant construct.
- the recombinant construct may be part of an expression cassette for use in transforming a heterologous host cell with said compositions.
- Standard recombinant DNA and molecular cloning techniques used herein are well known in the art and are described more fully in Sambrook et al, Molecular Cloning: A Laboratory Manual; Cold Spring Harbor Laboratory: Cold Spring Harbor, NY (1989).
- a recombinant DNA construct may comprise regulatory sequences and coding sequences that are derived from different sources. Such a construct may be used by itself or may be used in conjunction with a vector. If a vector is used, then the choice of vector is dependent upon the method that will be used to introduce the vector into the host cells as is well known to those skilled in the art. For example, a plasmid vector can be used. The skilled artisan is well aware of the genetic elements that must be present on the vector in order to successfully transform, select and propagate host cells.
- the recombinant DNA construct includes heterologous 5' and 3' regulatory sequences operably linked to an ACR polynucleotide as disclosed herein.
- These regulatory sequences include but are not limited to a transcriptional and translational initiation region (i.e., a promoter), a nuclear localization signal, and a transcriptional and translational termination region (i.e., termination region) functional in the host cell (such as eukaryotic cell).
- the recombinant DNA construct comprises a DNA encoding an
- ACR protein described herein wherein the ACR protein is operably linked to or comprises a heterologous regulatory element such as a nuclear localization sequence (NLS).
- a heterologous regulatory element such as a nuclear localization sequence (NLS).
- the ACR vectors can be combined with expression cassettes for the expression of one more components of an engineered CRISPR-Cas complex.
- one or more constructs are provided thai comprise an expression cassette having a promoter functional in a eukaryotic cell operably linked to a polynucleotide encoding an ACR protein as disclosed herein, a second cassette having a promoter functional in a eukaryotic cell operably linked to a single-guide sequence and a third cassette comprising a promoter functional in a eukaryotic cell operably linked to a Cas9 protein, where the guide and the Cas9 are capable of forming a complex that can modify a target DNA molecule.
- the cassettes may be provided on a single recombinant construct or on multiple recombinant constructs, which can be used for introduction into host cells either simultaneously or sequentially.
- the ACR polynucleotides disclosed herein can be provided in an expression cassette (also referred to as DNA construct) for expression of the ACR polypeptides in a host cell.
- the cassette can include 5' and 3' regulatory sequences operably linked to a polynucleotide as disclosed herein.
- "Operably linked" is intended to mean a functional linkage between two or more elements.
- an operable linkage between a polynucleotide of interest and a regulatory sequence e.g., a promoter
- Operably linked elements may be contiguous or non-contiguous. When used to refer to the joining of two protein coding regions, by operably linked is intended that the coding regions are in the same reading frame.
- the ACR polynucleotides may be optimized for increased expression in the transformed or targeted host cell.
- the polynucleotides can be synthesized or altered to use mammalian-preferred or plant-preferred codons for improved expression. See, for example, Campbell and Gowri (1990) Plant Physiol 92; 1-1 1 for a discussion of host-preferred codon usage. Methods are available in the art for synthesizing plant-preferred genes. See, for example, U.S. Patent Nos. 5,380,831, and 5,436,391, and Murray et al. (1989) Nucleic Acids Res. 17:477-498.
- the expression cassettes disclosed herein may include in the 5'-3' direction of transcription, a transcriptional and translational initiation region (i.e., a promoter), an ACR polynucleotide, and a transcriptional and translational termination region (i.e., termination region) functional in the host cell (e.g., a eukaryotic cell).
- Expression cassettes are also provided with a plurality of restriction sites and/or recombination sites for insertion of the polynucleotide to be under the transcriptional regulation of the regulatory regions described elsewhere herein.
- the regulatory regions (i.e., promoters, transcriptional regulatory regions, and translational termination regions) and/or the polynucleotide of interest may be native/analogous to the host cell or to each other.
- the regulatory regions and/or the polynucleotide of interest may be heterologous to the host cell or to each other.
- heterologous in reference to a polynucleotide or polypeptide sequence is a sequence that originates from a foreign species, or, if from the same species, is substantially modified from its native form in composition and/or genomic locus by deliberate human intervention.
- a promoter operably linked to a heterologous polynucleotide is from a species different from the species from which the polynucleotide was derived, or, if from the same/analogous species, one or both are substantially modified from their original form and/or genomic locus, or the promoter is not the native promoter for the operably linked polynucleotide.
- a chimeric polynucleotide comprises a coding sequence operably linked to a transcription initiation region that is heterologous to the coding sequence.
- a nucleotide sequence encoding an ACR protein is operably linked to a control element, e.g., a transcriptional control element, such as a promoter.
- the transcriptional control element may be functional in either a eukaryotic cell, e.g., a plant or mammalian cell; or a prokaryotic ceil (e.g., bacterial or archaeal cell).
- an ACR nucleotide sequence encoding an ACR protein is operably linked to multiple control elements that allow expression of the nucleotide sequence encoding an ACR protein in both prokaryotic and eukaryotic cells.
- the recombinant construct, or expression cassette may further comprise a non- coding regulatory element for use in expressing the ACR and/or CRISPR components in a heterologous cell, particularly a plant cell.
- expression cassettes comprise a promoter functional in a eukaryotic cell operably linked to a polynucleotide encoding an ACR protein, variant or fragment thereof as disclosed herein.
- the expression cassettes may comprise a promoter operably linked to an ACR polynucleotide, along with a corresponding termination region.
- the termination region may be native to the transcriptional initiation region, may be native to the operably linked polynucleotide of interest or to the promoter sequences, may be native to the host cell, or may be derived from another source (i.e., foreign or heterologous).
- Convenient termination regions are available from the Ti-plasmid of A. tumefaciens, such as the octopine synthase and nopaline synthase termination regions. See also Guerineau et al. (1991) Mol. Gen. Genet.
- Non-limiting examples of suitable eukaryotic promoters include those from cytomegalovirus (CMV) immediate early, herpes simplex virus (HSV) thymidine kinase, early and late SV40, long terminal repeats (LTRs) from retrovirus, and mouse metallothionein-I.
- CMV cytomegalovirus
- HSV herpes simplex virus
- LTRs long terminal repeats
- the expression vector may also contain a ribosome binding site for translation initiation and a transcription terminator.
- the expression vector may also contain one or more nuclear localization sequences (NLS sequences) to direct the ACR protein to the nucleus in a eukaryotic cell.
- the expression vector may also include appropriate sequences for amplifying expression.
- the expression vector may also include nucleotide sequences encoding protein tags (e.g., 6x His tag, hemagglutinin tag, green fluorescent protein, etc.) that are fused to the ACR protein, thus resulting in a chimeric polypeptide.
- protein tags e.g., 6x His tag, hemagglutinin tag, green fluorescent protein, etc.
- plant promoters will find use in the constructs, it has been shown that certain promoters are able to direct RNA synthesis at a higher rate than others. These are called “strong promoters”. Certain other promoters have been shown to direct RNA synthesis at higher levels only in particular types of cells or tissues and are often referred to as “tissue specific promoters", or “tissue-preferred promoters”.
- a plant promoter includes a promoter capable of initiating transcription in a plant cell.
- a promoter capable of initiating transcription in a plant cell see, Potenza et al, 2004, In Vitro Cell Dev Biol 40: 1 -22; Porto et al., 2014, Molecular Biotechnology (2014), 56(1), 38-49.
- Constitutive promoters include, for example, the core CaMV 35 S promoter
- Tissue-preferred promoters can be utilized to target enhanced expression within a particular plant tissue.
- Tissue-preferred promoters include, for example, WO2013/103367 published on 1 1 July 2013, Kawamata et al, (1997) Plant Cell Physiol 38:792-803; Hansen et al, (1997) Mol Gen Genet 254:337-43; Russell et al, (1997) Transgenic Res 6:157-68; Rinehart et al, (1996) Plant Physiol 112:1331-41; Van Camp et al, (1996) Plant Physiol 112:525-35; Canevascini et al, (1996) Plant Physiol 112:513-524; Lam, (1994) Results Probl Cell Differ 20:181-96; and Guevara-Garcia et al, (1993) Plant J 4:495-505.
- Leaf-preferred promoters include, for example, Yamamoto et al., (1997) Plant J 12:255-65; Kwon et al, (1994) Plant Physiol 105:357-67; Yamamoto et al, (1994) Plant Cell Physiol 35:773-8; Gotor et al, (1993) Plant J 3:509-18; Orozco et al. , (1993) Plant Mol Biol 23: 1129-38; Matsuoka et al. , (1993) Proc. Natl. Acad. Sci. USA 90:9586-90; Simpson et al, (1958) EMBO J 4:2723-9; Timko et al, (1988) Nature 318:57-8.
- Root-preferred promoters include, for example, Hire et al, (1992) Plant Mol Biol 20:207-18 (soybean root-specific glutamine synthase gene); Miao et al, (1991) Plant Cell 3:11-22 (cytosolic glutamine synthase (GS)); Keller and Baumgartner, (1991) Plant Cell 3:1051- 61 (root-specific control element in the GRP 1.8 gene of French bean); Sanger et al, (1990) Plant Mol Biol 14:433-43 (root-specific promoter of A. tumefaciens mannopine synthase
- VfENOD-GRP3 gene promoter (Kuster et al, (1995) Plant Mol Biol 29:759-72); and rolB promoter (Capana et al, (1994) Plant Mol Biol 25:681-91 ; phaseolin gene (Murai et al, (1983) Science 23:476-82; Sengopta-Gopalen et al, (1988) Proc. Natl. Acad. Sci. USA 82:3320-4).
- Seed-preferred promoters include both seed-specific promoters active during seed development, as well as seed-germinating promoters active during seed germination. See, Thompson et al, (1989) BioEssays 10: 108. Seed-preferred promoters include, but are not limited to, Ciml (cytokinin-induced message); cZ19Bl (maize 19 kDa zein); and milps (myo-inositol-1- phosphate synthase); (WOOO/1 1177; and U.S. Patent 6,225,529).
- seed-preferred promoters include, but are not limited to, bean ⁇ -phaseolin, napin, ⁇ -conglycinin, soybean lectin, cruciferin, and the like.
- seed-preferred promoters include, but are not limited to, maize 15 kDa zein, 22 kDa zein, 27 kDa gamma zein, waxy, shrunken 1, shrunken 2, globulin 1, oleosin, and nucl . See also, WO00/12733, where seed-preferred promoters from END1 and END2 genes are disclosed.
- inducible promoter refers to a promoter that selectively express a coding sequence or functional RNA in response to the presence of an endogenous or exogenous stimulus, for example by chemical compounds (chemical inducers) or in response to environmental, hormonal, chemical, and/or developmental signals.
- inducible or regulated promoters include, for example, promoters induced or regulated by light, heat, stress, flooding or drought, salt stress, osmotic stress, phytohormones, wounding, or chemicals such as ethanol, abscisic acid (ABA), jasmonate, salicylic acid, or safeners.
- Chemical inducible (regulated) promoters can be used to modulate the expression of a gene in a prokaryotic and eukaryotic cell or organism through the application of an exogenous chemical regulator.
- the promoter may be a chemical-inducible promoter, where application of the chemical induces gene expression, or a chemical-repressible promoter, where application of the chemical represses gene expression.
- Chemical-inducible promoters include, but are not limited to, the maize In2-2 promoter, activated by benzene sulfonamide herbicide safeners (De Veylder et al, (1997) Plant Cell Physiol 38:568-77), the maize GST promoter (GST-II-27, WO 93/01294), activated by hydrophobic electrophilic compounds used as pre- emergent herbicides, and the tobacco PR- la promoter (Ono et al, (2004) Biosci Biotechnol Biochem 68:803-7) activated by salicylic acid.
- steroid-responsive promoters see, for example, the glucocorticoid-inducible promoter (Schena et al., (1991) Proc. Nail. Acad. Sci. USA 88: 10421-5; McNellis et al, (1998) Plant J 14:247-257); tetracycline-inducible and tetracycline-repressible promoters (Gatz et al, (1991) Mol Gen Genet 227:229-37; U.S. Patent Nos. 5,814,618 and 5,789,156).
- Pathogen inducible promoters induced following infection by a pathogen include, but are not limited to those regulating expression of PR proteins, SAR proteins, beta-1 ,3- glucanase, chitinase, etc.
- a stress-inducible promoter includes the RD29A promoter (Kasuga et al. (1999)
- ZmCASl promoter Another example of an inducible promoter useful in plant cells, is the ZmCASl promoter, described in US patent application, US 2013-0312137A1, published on November 21, 2013, incorporated by reference herein.
- the expression cassettes may additionally contain 5' leader sequences.
- leader sequences can act to enhance translation.
- Translation leaders are known in the art and include: picornavirus leaders, for example, EMCV leader (Encephalomyocarditis 5' noncoding region) (Elroy-Stein et al. (1989) Proc. Natl Acad. Sci. USA 86:6126-6130); potyvirus leaders, for example, TEV leader (Tobacco Etch Virus) (Gallie et al. (1995) Gene 165(2):233-238), MDMV leader (Maize Dwarf Mosaic Virus) (Johnson et al.
- the ACR polynucleotides may be optimized for increased expression in the transformed or targeted host cell.
- the polynucleotides can be synthesized or altered to use mammalian-preferred or plant-preferred codons for improved expression. See, for example, Campbell and Gowri (1990) Plant Physiol. 92: 1-11 for a discussion of host-preferred codon usage. Methods are available in the art for synthesizing plant-preferred genes. See, for example, U.S. Patent Nos. 5,380,831, and 5,436,391, and Murray et al. (1989) Nucleic Acids Res. 17:477-498.
- Additional sequence modifications are known to enhance gene expression in a cellular host. These include elimination of sequences encoding spurious pojyadenylation signals, exon-intron splice site signals, transposon-like repeats, and other such well-characterized sequences that may be deleterious to gene expression.
- the G-C content of the sequence may be adjusted to levels average for a given cellular host, as calculated by reference to known genes expressed in the host cell. When possible, the sequence is modified to avoid predicted hairpin secondary mRNA structures.
- the various DNA fragments may be manipulated so as to provide for the DNA sequences in the proper orientation and, as appropriate, in the proper reading frame.
- adapters or linkers may be employed to join the DNA fragments or other manipulations may be involved to provide for convenient restriction sites, removal of superfluous DNA, removal of restriction sites, or the like.
- in vitro mutagenesis primer repair, restriction, annealing, resubstitutions, e.g., transitions and transversions, may be involved.
- polynucleotides, polypeptides or expression cassettes disclosed herein can be introduced into a host cell using any method available.
- Methods for introducing polynucleotides or polypeptides into a cell or organism include, but are not limited to, microinjection, electroporation, stable transformation methods, transient transformation methods, ballistic particle acceleration (particle bombardment), whiskers mediated transformation, transformation, direct gene transfer, viral- mediated introduction, transfection, transduction, cell-penetrating peptides, mesoporous silica nanoparticle (MSN)-mediated direct protein delivery, topical applications, sexual crossing, sexual breeding, and any combination thereof.
- Stable transformation is intended to mean that the nucleotide construct introduced into host cell integrates into a genome of the organism and is capable of being inherited by the progeny thereof.
- Transient transformation is intended to mean that a polynucleotide is introduced into the cell and does not integrate into a genome of the organism or a polypeptide is introduced into an organism. Transient transformation indicates that the introduced composition is only temporarily expressed or present in the organism.
- An ACR protein can be introduced into a ceil by directly introducing the ACR protein itself or an mRNA encoding the ACR protein.
- the ACR protein can also be introduced into a cell indirectly by introducing a recombinant DNA molecule that encodes the ACR protein.
- the ACR protein can be introduced into a cell transiently or can be incorporated into the genome of the host cell. Uptake of the ACR protein into the cell can be facilitated with a Cell Penetrating Peptide (CPP).
- CCPP Cell Penetrating Peptide
- Any promoter capable of expressing the ACR protein in a cell can be used and includes a heat shock /heat inducible promoter operably linked to a nucleotide sequence encoding the ACR protein.
- CRISPR-Cas complex components can be accompanied by direct delivery (co-delivery) of other mRNAs that can promote the enrichment and/or visualization of cells receiving the components.
- direct co-delivery of the ACR compositions or CRISPR-Cas complex components together with mRNA encoding phenotypic markers can enable the selection and enrichment of cells without the use of an exogenous selectable marker by restoring function to a non-functional gene product as described in PCT/US 16/57272 filed October 17, 2016 and PCT/US 16/57279, filed October 17, 2016.
- polynucleotides may be introduced into cells by contacting cells or organisms with a virus or viral nucleic acids.
- such methods involve incorporating a polynucleotide within a viral DNA or RNA molecule, in some examples a polypeptide of interest may be initially synthesized as part of a viral polyprotein, which is later processed by proteolysis in vivo or in vitro to produce the desired recombinant protein.
- Methods for introducing polynucleotides into plants and expressing a protein encoded therein, involving viral DNA or RNA molecules are known, see, for example, U.S. Patent Nos. 5,889, 191, 5,889, 190, 5,866,785, 5,589,367 and 5,316,931.
- the polynucleotide or recombinant DNA construct can be provided to or introduced into a prokaryotic and eukaryotic cell or organism using a variety of transient transformation methods.
- transient transformation methods include, but are not limited to, the introduction of the polynucleotide construct directly into the plant.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Virology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
Description
Claims
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| BR112019022201-4A BR112019022201A2 (en) | 2017-04-24 | 2018-04-24 | METHODS FOR MODULATING THE ACTIVITY OF A CAS ENDONUCLEASE, TO INCREASE THE SPECIFICITY OF A CAS ENDONUCLEASE AND POLYNUCLEOTIDE COMPLEX GUIDE, TO INCREASE THE FREQUENCY OF HOMOLOGICAL RECOMBINATION AND FOR GENE ACTIVATION OR REPRESSION, CELL AND CELL CELL |
| EP18721982.9A EP3615552A1 (en) | 2017-04-24 | 2018-04-24 | Methods and compositions of anti-crispr proteins for use in plants |
| US16/607,849 US11732251B2 (en) | 2017-04-24 | 2018-04-24 | Anti-CRISPR polynucleotides and polypeptides and methods of use |
| CN201880042315.9A CN110891965A (en) | 2017-04-24 | 2018-04-24 | Methods and compositions for anti-CRISPR proteins used in plants |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762488969P | 2017-04-24 | 2017-04-24 | |
| US201762488981P | 2017-04-24 | 2017-04-24 | |
| US62/488,981 | 2017-04-24 | ||
| US62/488,969 | 2017-04-24 | ||
| US201762510914P | 2017-05-25 | 2017-05-25 | |
| US201762510896P | 2017-05-25 | 2017-05-25 | |
| US62/510,914 | 2017-05-25 | ||
| US62/510,896 | 2017-05-25 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018197520A1 true WO2018197520A1 (en) | 2018-11-01 |
Family
ID=63919534
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2018/060510 Ceased WO2018197520A1 (en) | 2017-04-24 | 2018-04-24 | Methods and compositions of anti-crispr proteins for use in plants |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US11732251B2 (en) |
| EP (1) | EP3615552A1 (en) |
| CN (1) | CN110891965A (en) |
| BR (1) | BR112019022201A2 (en) |
| WO (1) | WO2018197520A1 (en) |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020059708A1 (en) * | 2018-09-17 | 2020-03-26 | 国立大学法人東京医科歯科大学 | METHOD FOR MODULATING ACTIVITY OF Cas PROTEIN |
| WO2020123512A1 (en) * | 2018-12-10 | 2020-06-18 | The Board Of Trustees Of The Leland Stanford Junior University | Anti-crispr-mediated control of genome editing and synthetic circuits in eukaryotic cells |
| WO2020176389A1 (en) * | 2019-02-25 | 2020-09-03 | Caribou Biosciences, Inc. | Plasmids for gene editing |
| US10934536B2 (en) | 2018-12-14 | 2021-03-02 | Pioneer Hi-Bred International, Inc. | CRISPR-CAS systems for genome editing |
| WO2022008466A1 (en) * | 2020-07-06 | 2022-01-13 | Wageningen Universiteit | Base editing tools |
| EP3940069A1 (en) | 2020-07-13 | 2022-01-19 | University of Copenhagen | Methods for modulating cas-effector activity |
| WO2023247773A1 (en) * | 2022-06-24 | 2023-12-28 | Meiogenix | Induction of meiotic recombination using a crispr system |
| US11999805B1 (en) * | 2020-05-06 | 2024-06-04 | National Technology & Engineering Solutions Of Sandia, Llc | Peptide inhibitors of CRISPR-Cas9 |
| US12084676B2 (en) | 2018-02-23 | 2024-09-10 | Pioneer Hi-Bred International, Inc. | Cas9 orthologs |
| US12297426B2 (en) | 2019-10-01 | 2025-05-13 | The Broad Institute, Inc. | DNA damage response signature guided rational design of CRISPR-based systems and therapies |
| US12378566B2 (en) | 2013-08-22 | 2025-08-05 | Pioneer Hi-Bred International, Inc. | Plant genome modification using guide RNA/Cas endonuclease systems and methods of use |
| WO2025250808A1 (en) | 2024-05-29 | 2025-12-04 | The Brigham And Women’S Hospital, Inc. | Anti-crispr delivery compositions and methods |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022072673A1 (en) * | 2020-10-02 | 2022-04-07 | Acrigen Biosciences, Inc. | Compositions and methods for enhanced nucleic acid targeting specificity |
| CN116514935B (en) * | 2021-03-04 | 2024-04-30 | 西部(重庆)科学城种质创制大科学中心 | Inhibitors AcrIIIA of RNA editing system 1IPLA35And applications thereof |
| CN116535473B (en) * | 2021-03-04 | 2024-04-30 | 西部(重庆)科学城种质创制大科学中心 | Effector AcrIIIA TEM to control CRISPR-Cas editing system123And applications thereof |
| CN115851665B (en) * | 2021-05-27 | 2025-01-24 | 中国科学院动物研究所 | Engineered Cas12i nuclease and its effector protein and use |
| CN117487831A (en) * | 2022-02-11 | 2024-02-02 | 中国科学院生物物理研究所 | Methods to identify AcrIIA31 protein and apply it to regulate CRISPR-Cas9 gene editing |
Citations (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4873192A (en) | 1987-02-17 | 1989-10-10 | The United States Of America As Represented By The Department Of Health And Human Services | Process for site specific mutagenesis without phenotypic selection |
| US5023179A (en) | 1988-11-14 | 1991-06-11 | Eric Lam | Promoter enhancer element for gene expression in plant roots |
| US5107065A (en) | 1986-03-28 | 1992-04-21 | Calgene, Inc. | Anti-sense regulation of gene expression in plant cells |
| US5110732A (en) | 1989-03-14 | 1992-05-05 | The Rockefeller University | Selective gene expression in plants |
| WO1993001294A1 (en) | 1991-07-02 | 1993-01-21 | Zeneca Limited | Plant-derived enzyme and dna sequences, and uses thereof |
| US5316931A (en) | 1988-02-26 | 1994-05-31 | Biosource Genetics Corp. | Plant viral vectors having heterologous subgenomic promoters for systemic expression of foreign genes |
| US5380831A (en) | 1986-04-04 | 1995-01-10 | Mycogen Plant Science, Inc. | Synthetic insecticidal crystal protein gene |
| US5401836A (en) | 1992-07-16 | 1995-03-28 | Pioneer Hi-Bre International, Inc. | Brassica regulatory sequence for root-specific or root-abundant gene expression |
| US5436391A (en) | 1991-11-29 | 1995-07-25 | Mitsubishi Corporation | Synthetic insecticidal gene, plants of the genus oryza transformed with the gene, and production thereof |
| US5459252A (en) | 1991-01-31 | 1995-10-17 | North Carolina State University | Root specific gene promoter |
| US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
| US5633363A (en) | 1994-06-03 | 1997-05-27 | Iowa State University, Research Foundation In | Root preferential promoter |
| US5659026A (en) | 1995-03-24 | 1997-08-19 | Pioneer Hi-Bred International | ALS3 promoter |
| US5750386A (en) | 1991-10-04 | 1998-05-12 | North Carolina State University | Pathogen-resistant transgenic plants |
| US5789156A (en) | 1993-06-14 | 1998-08-04 | Basf Ag | Tetracycline-regulated transcriptional inhibitors |
| US5814618A (en) | 1993-06-14 | 1998-09-29 | Basf Aktiengesellschaft | Methods for regulating gene expression |
| US5837458A (en) | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| US5837876A (en) | 1995-07-28 | 1998-11-17 | North Carolina State University | Root cortex specific gene promoter |
| US5889191A (en) | 1992-12-30 | 1999-03-30 | Biosource Technologies, Inc. | Viral amplification of recombinant messenger RNA in transgenic plants |
| WO2000011177A1 (en) | 1998-08-20 | 2000-03-02 | Pioneer Hi-Bred International, Inc. | Seed-preferred promoters |
| WO2000012733A1 (en) | 1998-08-28 | 2000-03-09 | Pioneer Hi-Bred International, Inc. | Seed-preferred promoters from end genes |
| WO2007025097A2 (en) | 2005-08-26 | 2007-03-01 | Danisco A/S | Use |
| US20110035836A1 (en) | 2007-06-07 | 2011-02-10 | Agriculture And Agri-Food Canada | Nanocarrier based plant transfection and transduction |
| WO2013103367A1 (en) | 2012-01-06 | 2013-07-11 | Pioneer Hi-Bred International, Inc. | Somatic ovule specific promoter and methods of use |
| US20130312137A1 (en) | 2012-05-18 | 2013-11-21 | Pioneer Hi-Bred International Inc | Inducible promoter sequences for regulated expression and methods of use |
| WO2013176772A1 (en) | 2012-05-25 | 2013-11-28 | The Regents Of The University Of California | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
| WO2014093479A1 (en) * | 2012-12-11 | 2014-06-19 | Montana State University | Crispr (clustered regularly interspaced short palindromic repeats) rna-guided control of gene regulation |
| EP2821486A1 (en) | 2012-02-27 | 2015-01-07 | Riken | Method of introducing nucleic acid into plant cells |
| US20150045546A1 (en) | 2012-03-20 | 2015-02-12 | Vilnius University | RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX |
| US20150059010A1 (en) | 2013-08-22 | 2015-02-26 | Pioneer Hi-Bred International Inc | Genome modification using guide polynucleotide/cas endonuclease systems and methods of use |
| WO2016007347A1 (en) | 2014-07-11 | 2016-01-14 | E. I. Du Pont De Nemours And Company | Compositions and methods for producing plants resistant to glyphosate herbicide |
| WO2016025131A1 (en) | 2014-08-13 | 2016-02-18 | E. I. Du Pont De Nemours And Company | Genetic targeting in non-conventional yeast using an rna-guided endonuclease |
| WO2016186953A1 (en) | 2015-05-15 | 2016-11-24 | Pioneer Hi Bred International Inc | Guide rna/cas endonuclease systems |
| WO2017070032A1 (en) | 2015-10-20 | 2017-04-27 | Pioneer Hi-Bred International, Inc. | Restoring function to a non-functional gene product via guided cas systems and methods of use |
| WO2017160689A1 (en) * | 2016-03-15 | 2017-09-21 | University Of Massachusetts | Anti-crispr compounds and methods of use |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101688241B (en) * | 2007-03-02 | 2015-01-21 | 杜邦营养生物科学有限公司 | Cultures with improved phage resistance |
| KR102170502B1 (en) * | 2013-12-11 | 2020-10-28 | 리제너론 파마슈티칼스 인코포레이티드 | Methods and compositions for the targeted modification of a genome |
| JP6793547B2 (en) * | 2013-12-12 | 2020-12-02 | ザ・ブロード・インスティテュート・インコーポレイテッド | Optimization Function Systems, methods and compositions for sequence manipulation with the CRISPR-Cas system |
| BR112016024945A2 (en) * | 2014-04-28 | 2017-10-24 | Recombinetics Inc | swine multiplex gene editing |
| US20160053272A1 (en) * | 2014-07-18 | 2016-02-25 | Whitehead Institute For Biomedical Research | Methods Of Modifying A Sequence Using CRISPR |
| TWI906646B (en) | 2015-06-18 | 2025-12-01 | 美商博得學院股份有限公司 | Crispr enzyme mutations reducing off-target effects |
| CN116555254A (en) | 2015-10-09 | 2023-08-08 | 孟山都技术公司 | Novel RNA-directed nucleases and uses thereof |
| WO2018197495A1 (en) | 2017-04-24 | 2018-11-01 | Dupont Nutrition Biosciences Aps | Novel anti-crispr genes and proteins and methods of use |
-
2018
- 2018-04-24 WO PCT/EP2018/060510 patent/WO2018197520A1/en not_active Ceased
- 2018-04-24 US US16/607,849 patent/US11732251B2/en active Active
- 2018-04-24 BR BR112019022201-4A patent/BR112019022201A2/en not_active Application Discontinuation
- 2018-04-24 CN CN201880042315.9A patent/CN110891965A/en active Pending
- 2018-04-24 EP EP18721982.9A patent/EP3615552A1/en active Pending
Patent Citations (41)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5107065A (en) | 1986-03-28 | 1992-04-21 | Calgene, Inc. | Anti-sense regulation of gene expression in plant cells |
| US5380831A (en) | 1986-04-04 | 1995-01-10 | Mycogen Plant Science, Inc. | Synthetic insecticidal crystal protein gene |
| US4873192A (en) | 1987-02-17 | 1989-10-10 | The United States Of America As Represented By The Department Of Health And Human Services | Process for site specific mutagenesis without phenotypic selection |
| US5889190A (en) | 1988-02-26 | 1999-03-30 | Biosource Technologies, Inc. | Recombinant plant viral nucleic acids |
| US5316931A (en) | 1988-02-26 | 1994-05-31 | Biosource Genetics Corp. | Plant viral vectors having heterologous subgenomic promoters for systemic expression of foreign genes |
| US5589367A (en) | 1988-02-26 | 1996-12-31 | Biosource Technologies, Inc. | Recombinant plant viral nucleic acids |
| US5866785A (en) | 1988-02-26 | 1999-02-02 | Biosource Technologies, Inc. | Recombinant plant viral nucleic acids |
| US5023179A (en) | 1988-11-14 | 1991-06-11 | Eric Lam | Promoter enhancer element for gene expression in plant roots |
| US5110732A (en) | 1989-03-14 | 1992-05-05 | The Rockefeller University | Selective gene expression in plants |
| US5459252A (en) | 1991-01-31 | 1995-10-17 | North Carolina State University | Root specific gene promoter |
| WO1993001294A1 (en) | 1991-07-02 | 1993-01-21 | Zeneca Limited | Plant-derived enzyme and dna sequences, and uses thereof |
| US5750386A (en) | 1991-10-04 | 1998-05-12 | North Carolina State University | Pathogen-resistant transgenic plants |
| US5436391A (en) | 1991-11-29 | 1995-07-25 | Mitsubishi Corporation | Synthetic insecticidal gene, plants of the genus oryza transformed with the gene, and production thereof |
| US5401836A (en) | 1992-07-16 | 1995-03-28 | Pioneer Hi-Bre International, Inc. | Brassica regulatory sequence for root-specific or root-abundant gene expression |
| US5889191A (en) | 1992-12-30 | 1999-03-30 | Biosource Technologies, Inc. | Viral amplification of recombinant messenger RNA in transgenic plants |
| US5814618A (en) | 1993-06-14 | 1998-09-29 | Basf Aktiengesellschaft | Methods for regulating gene expression |
| US5789156A (en) | 1993-06-14 | 1998-08-04 | Basf Ag | Tetracycline-regulated transcriptional inhibitors |
| US5837458A (en) | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
| US5633363A (en) | 1994-06-03 | 1997-05-27 | Iowa State University, Research Foundation In | Root preferential promoter |
| US5659026A (en) | 1995-03-24 | 1997-08-19 | Pioneer Hi-Bred International | ALS3 promoter |
| US5837876A (en) | 1995-07-28 | 1998-11-17 | North Carolina State University | Root cortex specific gene promoter |
| WO2000011177A1 (en) | 1998-08-20 | 2000-03-02 | Pioneer Hi-Bred International, Inc. | Seed-preferred promoters |
| US6225529B1 (en) | 1998-08-20 | 2001-05-01 | Pioneer Hi-Bred International, Inc. | Seed-preferred promoters |
| WO2000012733A1 (en) | 1998-08-28 | 2000-03-09 | Pioneer Hi-Bred International, Inc. | Seed-preferred promoters from end genes |
| WO2007025097A2 (en) | 2005-08-26 | 2007-03-01 | Danisco A/S | Use |
| US20110035836A1 (en) | 2007-06-07 | 2011-02-10 | Agriculture And Agri-Food Canada | Nanocarrier based plant transfection and transduction |
| WO2013103367A1 (en) | 2012-01-06 | 2013-07-11 | Pioneer Hi-Bred International, Inc. | Somatic ovule specific promoter and methods of use |
| EP2821486A1 (en) | 2012-02-27 | 2015-01-07 | Riken | Method of introducing nucleic acid into plant cells |
| US20150045546A1 (en) | 2012-03-20 | 2015-02-12 | Vilnius University | RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX |
| US20130312137A1 (en) | 2012-05-18 | 2013-11-21 | Pioneer Hi-Bred International Inc | Inducible promoter sequences for regulated expression and methods of use |
| WO2013176772A1 (en) | 2012-05-25 | 2013-11-28 | The Regents Of The University Of California | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
| WO2014093479A1 (en) * | 2012-12-11 | 2014-06-19 | Montana State University | Crispr (clustered regularly interspaced short palindromic repeats) rna-guided control of gene regulation |
| US20150059010A1 (en) | 2013-08-22 | 2015-02-26 | Pioneer Hi-Bred International Inc | Genome modification using guide polynucleotide/cas endonuclease systems and methods of use |
| WO2015026886A1 (en) | 2013-08-22 | 2015-02-26 | E. I. Du Pont De Nemours And Company | Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof |
| US20150082478A1 (en) | 2013-08-22 | 2015-03-19 | E I Du Pont De Nemours And Company | Plant genome modification using guide rna/cas endonuclease systems and methods of use |
| WO2016007347A1 (en) | 2014-07-11 | 2016-01-14 | E. I. Du Pont De Nemours And Company | Compositions and methods for producing plants resistant to glyphosate herbicide |
| WO2016025131A1 (en) | 2014-08-13 | 2016-02-18 | E. I. Du Pont De Nemours And Company | Genetic targeting in non-conventional yeast using an rna-guided endonuclease |
| WO2016186953A1 (en) | 2015-05-15 | 2016-11-24 | Pioneer Hi Bred International Inc | Guide rna/cas endonuclease systems |
| WO2017070032A1 (en) | 2015-10-20 | 2017-04-27 | Pioneer Hi-Bred International, Inc. | Restoring function to a non-functional gene product via guided cas systems and methods of use |
| WO2017160689A1 (en) * | 2016-03-15 | 2017-09-21 | University Of Massachusetts | Anti-crispr compounds and methods of use |
Non-Patent Citations (128)
| Title |
|---|
| "Techniques in Molecular Biology", 1983, MACMILLAN PUBLISHING COMPANY |
| AYARES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 5199 - 203 |
| BALLAS ET AL., NUCLEIC ACIDS RES., vol. 17, 1989, pages 7891 - 7903 |
| BASKERVILLE, S. ET AL., RNA, vol. 11, 2005, pages 241 - 247 |
| BLEUYARD ET AL., DNA REPAIR, vol. 5, 2006, pages 1 - 12 |
| BOGUSZ ET AL., PLANT CELL, vol. 2, 1990, pages 633 - 41 |
| BROWN ET AL., NAT. MED., vol. 12, 2006, pages 585 - 591 |
| BRUCE ET AL., THE PLANT CELL, vol. 12, 2000, pages 65 - 79 |
| BURSTEIN, D. ET AL.: "New CRISPR-Cas systems from uncultivated microbes", NATURE, 2016, Retrieved from the Internet <URL:http://dx.doi.org/10.1038/nature21059> |
| CAMPBELL; GOWRI, PLANT PHYSIOL., vol. 92, 1990, pages 1 - 11 |
| CANEVASCINI ET AL., PLANT PHYSIOL, vol. 112, 1996, pages 513 - 524 |
| CAPANA ET AL., PLANT MOL BIOL, vol. 25, 1994, pages 681 - 91 |
| CAPECCHI, M.R., SCIENCE, vol. 244, 1989, pages 1288 - 1292 |
| CHEN, C.Z. ET AL., SCIENCE, vol. 303, 2004, pages 83 - 86 |
| CHRISTENSEN ET AL., PLANT MOL BIOL, vol. 12, 1989, pages 619 - 32 |
| CHYLINSKI K. ET AL.: "Classification and evolution of type II CRISPR-Cas systems", NUCLEIC ACIDS RESEARCH, vol. 42, no. 10, 2014, pages 6091 - 6105, XP055484452, DOI: doi:10.1093/nar/gku241 |
| CRAMERI ET AL., NATURE BIOTECH., vol. 15, 1997, pages 436 - 438 |
| CRAMERI ET AL., NATURE, vol. 391, 1998, pages 288 - 291 |
| DAYHOFF ET AL.: "Atlas of Protein Sequence and Structure", 1978, NATL. BIOMED. RES. FOUND. |
| DE ALMEIDA, MOL GEN GENETICS, vol. 218, 1989, pages 78 - 86 |
| DE VEYLDER ET AL., PLANT CELL PHYSIOL, vol. 38, 1997, pages 568 - 77 |
| DELLA-CIOPPA ET AL., PLANT PHYSIOL., vol. 84, 1987, pages 965 - 968 |
| ELROY-STEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 6126 - 6130 |
| FONFARA, INES ET AL.: "Phylogeny of Cas9 Determines Functional Exchangeability of Dual-RNA and Cas9 among Orthologous Type II CRISPR/Cas Systems", NUCLEIC ACIDS RESEARCH, vol. 42.4, 2014, pages 2577 - 2590, XP055399937, DOI: doi:10.1093/nar/gkt1074 |
| FU, Y. ET AL., NAT. BIOLECHNOL., vol. 31, 2013, pages 822 - 826 |
| GALLIE ET AL., GENE, vol. 165, no. 2, 1995, pages 233 - 238 |
| GALLIE ET AL.: "Molecular Biology of RNA", 1989, LISS, pages: 237 - 256 |
| GATZ ET AZ., MOL GEN GENET, vol. 227, 1991, pages 229 - 37 |
| GOTOR ET AL., PLANT J, vol. 3, 1993, pages 509 - 18 |
| GUERINEAU, MOL. GEN. GENET., vol. 262, 1991, pages 141 - 144 |
| GUEVARA-GARCIA ET AL., PLANT J, vol. 4, 1993, pages 495 - 505 |
| HAFT ET AL.: "Computational Biology", P LOS COMPUT BIOL, vol. 1, no. 6, 2005, pages e60 |
| HAFT ET AL.: "Computational Biology", PLOS COMPUT BIOL, vol. 1, no. 6, 2005, pages e60 |
| HANSEN ET AL., MOL GEN GENET, vol. 254, 1997, pages 337 - 43 |
| HENIKOFF; HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915 |
| HEYER, W.D. ET AL., ANNU. REV. GENET., vol. 44, 2010, pages 113 - 139 |
| HIGGINS ET AL., COMPUT APPL BIOSCI, vol. 8, 1992, pages 189 - 191 |
| HIGGINS, COMPUT APPL BIOSCI, vol. 8, 1992, pages 189 - 191 |
| HIGGINS; SHARP, CABIOS, vol. 5, 1989, pages 151 - 153 |
| HIRE ET AL., PLANT MOL BIOL, vol. 20, 1992, pages 207 - 18 |
| HORVATH; BARRANGOU, SCIENCE, vol. 327, 2010, pages 167 - 170 |
| HSU, P.D. ET AL., CELL, vol. 157, 2014, pages 1262 - 1278 |
| HYNES ALEXANDER P ET AL: "An anti-CRISPR from a virulent streptococcal phage inhibitsStreptococcus pyogenesCas9", NATURE MICROBIOLOGY, NATURE PUBLISHING GROUP UK, LONDON, vol. 2, no. 10, 7 August 2017 (2017-08-07), pages 1374 - 1380, XP036429527, DOI: 10.1038/S41564-017-0004-7 * |
| INGELBRECHT ET AL., PLANT CELL, vol. 1, 1989, pages 671 - 680 |
| JAMES K NUÑEZ ET AL: "Chemical and Biophysical Modulation of Cas9 for Tunable Genome Engineering", ACS CHEMICAL BIOLOGY, ACS PUBLICATIONS, USA, vol. 11, no. 3, 18 March 2016 (2016-03-18), pages 681 - 688, XP002758943, ISSN: 1554-8937, [retrieved on 20160209], DOI: 10.1021/ACSCHEMBIO.5B01019 * |
| JOBLING ET AL., NATURE, vol. 325, 1987, pages 622 - 625 |
| JOHNSON ET AL., VIROLOGY, vol. 154, 1986, pages 9 - 20 |
| JONES ET AL., EMBO J, vol. 4, 1985, pages 2411 - 2418 |
| JORE ET AL., NATURE STRUCTURAL & MOLECULAR BIOLOGY, vol. 18, 2011, pages 529 - 536 |
| JORE, M.M. ET AL., NAT. STRUCT. MOL. BIOL., vol. 18, 2011, pages 529 - 536 |
| JOSHI ET AL., NUCLEIC ACIDS RES., vol. 15, 1987, pages 9627 - 9639 |
| KASUGA ET AL., NATURE BIOTECHNOL., vol. 17, 1999, pages 287 - 91 |
| KAWAMATA ET AL., PLANT CELL PHYSIOL, vol. 38, 1997, pages 792 - 803 |
| KELLER; BAUMGARTNER, PLANT CELL, vol. 3, 1991, pages 1051 - 61 |
| KEVIN M ESVELT, K. M. ET AL.: "Orthogonal Cas9 proteins for RNA-guided gene regulation and editing", NATURE METHODS, vol. 10, 2013, pages 1116 - 1121, XP055128928, DOI: doi:10.1038/nmeth.2681 |
| KOONIN ET AL., CURR OPINION MICROBIOLOGY, vol. 37, 2017, pages 67 - 78 |
| KUNKEL ET AL., METHODS IN ENZYMOL., vol. 154, 1987, pages 367 - 382 |
| KUNKEL, PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 488 - 492 |
| KUSTER ET AL., PLANT MOL BIOL, vol. 29, 1995, pages 759 - 72 |
| KWON ET AL., PLANT PHYSIOL, vol. 105, pages 357 - 67 |
| LAGOS-QUINTANA, M. ET AL., CURR. BIOL., vol. 12, 2002, pages 735 - 739 |
| LAGOS-QUINTANA, M. ET AL., SCIENCE, vol. 294, 2001, pages 853 - 858 |
| LAM, RESULTS PROBL CELL DIFFER, vol. 20, 1994, pages 181 - 96 |
| LEACH; AOYAGI, PLANT SCI, vol. 79, 1991, pages 69 - 76 |
| LISKAY, GENETICS, vol. 115, 1987, pages 161 - 7 |
| LOMMEL ET AL., VIROLOGY, vol. 81, 1991, pages 382 - 385 |
| LU, J. ET AL., NATURE, vol. 435, 2005, pages 834 - 838 |
| MACEJAK ET AL., NATURE, vol. 353, 1991, pages 90 - 94 |
| MAKAROVA ET AL., NATURE REVIEWS MICROBIOLOGY, vol. 13, 2015, pages 1 - 15 |
| MAKAROVA ET AL.: "Nature Reviews Microbiology", vol. I, 28 September 2015, AOP |
| MAKAROVA, NATURE REVIEWS MICROBIOLOGY, vol. 13, 2015, pages 1 - 15 |
| MALI ET AL., NATURE METHODS, vol. 10, 2013, pages 957 - 963 |
| MATSUOKA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 9586 - 90 |
| MCELROY ET AL., PLANT CELL, vol. 2, 1990, pages 163 - 71 |
| MCNELLIS ET AL., PLANT J, vol. 14, 1998, pages 247 - 257 |
| MIAO ET AL., PLANT CELL, vol. 3, 1991, pages 11 - 22 |
| MIKI, B., J BIOTECHNOL., vol. 107, 2004, pages 193 - 232 |
| MOE HIROSAWA ET AL: "Cell-type-specific genome editing with a microRNA-responsive CRISPR-Cas9 switch", NUCLEIC ACIDS RESEARCH, vol. 45, no. 13, 19 May 2017 (2017-05-19), pages e118 - e118, XP055444821, ISSN: 0305-1048, DOI: 10.1093/nar/gkx309 * |
| MOGEN ET AL., PLANT CELL, vol. 2, 1990, pages 1261 - 1272 |
| MOORE ET AL., J. MOL. BIOI., vol. 272, 1997, pages 336 - 347 |
| MUNROE ET AL., GENE, vol. 91, 1990, pages 151 - 158 |
| MURAI ET AL., SCIENCE, vol. 23, 1983, pages 476 - 82 |
| MURRAY ET AL., NUCLEIC ACIDS RES., vol. 17, 1989, pages 477 - 498 |
| NEEDLEMAN; WUNSCH, JMOL BIOL, vol. 48, 1970, pages 443 - 53 |
| NISHITANI, H. ET AL., NATURE, vol. 404, 2000, pages 625 - 628 |
| ODELL ET AL., NATURE, vol. 313, 1985, pages 810 - 2 |
| OKAMURO; GOLDBERG: "The Biochemistry of Plants", vol. 115, 1989, ACADEMIC PRESS, pages: 1 - 82 |
| ONO ET AL., BIOSCI BIOTECHNOL BIOCHEM, vol. 68, 2004, pages 803 - 7 |
| OROZCO ET AL., PLANT MOL BIOL, vol. 23, 1993, pages 1129 - 38 |
| PACHER ET AL., GENETICS, vol. 175, 2007, pages 21 - 9 |
| PAWLUK APRIL ET AL: "Naturally Occurring Off-Switches for CRISPR-Cas9", CELL, CELL PRESS, AMSTERDAM, NL, vol. 167, no. 7, 8 December 2016 (2016-12-08), pages 1829, XP029850707, ISSN: 0092-8674, DOI: 10.1016/J.CELL.2016.11.017 * |
| PORTO ET AL., MOLECULAR BIOTECHNOLOGY, vol. 56, no. 1, 2014, pages 38 - 49 |
| POTENZA ET AL., IN VITRO CELL DEV BIOL, vol. 40, 2004, pages 1 - 22 |
| PROUDFOOT, CELL, vol. 64, 1991, pages 671 - 674 |
| RAUCH BENJAMIN J ET AL: "Inhibition of CRISPR-Cas9 with Bacteriophage Proteins", CELL, CELL PRESS, AMSTERDAM, NL, vol. 168, no. 1, 29 December 2016 (2016-12-29), pages 150, XP029882136, ISSN: 0092-8674, DOI: 10.1016/J.CELL.2016.12.009 * |
| RAUCH, CELL, vol. 168, 2017, pages 150 - 158 |
| RINEHART ET AL., PLANT PHYSIOL, vol. 112, 1996, pages 1331 - 41 |
| RUBNITZ; SUBRAMANI, MOL CELL BIOL, vol. 4, 1984, pages 2253 - 8 |
| RUSSELL ET AL., TRANSGENIC RES, vol. 6, 1997, pages 157 - 68 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY |
| SANFACON ET AL., GENES DEV., vol. 5, 1991, pages 141 - 149 |
| SANGER ET AL., PLANT MOL BIOL, vol. 14, 1990, pages 433 - 43 |
| SCHENA, PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 10421 - 5 |
| SENGOPTA-GOPALEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1988, pages 3320 - 4 |
| SHEN; HUANG, GENETICS, vol. 112, 1986, pages 441 - 57 |
| SHMAKOV ET AL., MOLECULAR CELL, vol. 60, 2015, pages 1 - 13 |
| SIEBERT; PUCHTA, PLANT CELL, vol. 14, 2002, pages 1121 - 31 |
| SIMPSON ET AL., EMBO J, vol. 4, 1958, pages 2723 - 9 |
| SINGER ET AL., CELL, vol. 31, 1982, pages 25 - 33 |
| SINKUNAS, T. ET AL., EMBO J., vol. 32, 2013, pages 385 - 394 |
| STEMMER, NATURE, vol. 370, 1994, pages 389 - 391 |
| STEMMER, PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 10747 - 10751 |
| SUGAWARA; HABER, MOL CELL BIOL, vol. 12, 1992, pages 563 - 75 |
| SZYMCZAK, A.L. ET AL., NATURE BIOTECH., vol. 22, 2004, pages 589 - 594 |
| TEERI ET AL., EMBO J, vol. 8, 1989, pages 343 - 50 |
| THOMPSON ET AL., BIOESSAYS, vol. 10, 1989, pages 108 |
| TIMKO ET AL., NATURE, vol. 318, 1988, pages 57 - 8 |
| TURNER; FOSTER, MOL BIOTECHNOL, vol. 3, 1995, pages 225 - 236 |
| VAN CAMP ET AL., PLANT PHYSIOL, vol. 112, 1996, pages 525 - 35 |
| WATT ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 4768 - 72 |
| WESTRA, E.R. ET AL., MOLECULAR CELL, vol. 46, 2012, pages 595 - 605 |
| Y BILL KIM ET AL: "Increasing the genome-targeting scope and precision of base editing with engineered Cas9-cytidine deaminase fusions", NATURE BIOTECHNOLOGY, vol. 35, no. 4, 13 February 2017 (2017-02-13), US, pages 371 - 376, XP055484491, ISSN: 1087-0156, DOI: 10.1038/nbt.3803 * |
| YAMAMOTO ET AL., PLANT CELL PHYSIOL, vol. 35, 1994, pages 773 - 8 |
| YAMAMOTO ET AL., PLANT J, vol. 12, 1997, pages 255 - 65 |
| YAMANE ET AL., CELL, vol. 165, 2016, pages 949 - 962 |
| ZETSCHE ET AL., CELL, vol. 163, 2015, pages 1 - 13 |
| ZETSCHE, CELL, vol. 163, 2015, pages 1 - 13 |
| ZHANG ET AL., PROC. NATL. AEAD. SCI. USA, vol. 94, 1997, pages 4504 - 4509 |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12428645B2 (en) | 2013-08-22 | 2025-09-30 | Pioneer Hi-Bred International, Inc. | Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof |
| US12378566B2 (en) | 2013-08-22 | 2025-08-05 | Pioneer Hi-Bred International, Inc. | Plant genome modification using guide RNA/Cas endonuclease systems and methods of use |
| US12084676B2 (en) | 2018-02-23 | 2024-09-10 | Pioneer Hi-Bred International, Inc. | Cas9 orthologs |
| WO2020059708A1 (en) * | 2018-09-17 | 2020-03-26 | 国立大学法人東京医科歯科大学 | METHOD FOR MODULATING ACTIVITY OF Cas PROTEIN |
| WO2020123512A1 (en) * | 2018-12-10 | 2020-06-18 | The Board Of Trustees Of The Leland Stanford Junior University | Anti-crispr-mediated control of genome editing and synthetic circuits in eukaryotic cells |
| US10934536B2 (en) | 2018-12-14 | 2021-03-02 | Pioneer Hi-Bred International, Inc. | CRISPR-CAS systems for genome editing |
| US11807878B2 (en) | 2018-12-14 | 2023-11-07 | Pioneer Hi-Bred International, Inc. | CRISPR-Cas systems for genome editing |
| US12365888B2 (en) | 2018-12-14 | 2025-07-22 | Pioneer Hi-Bred International, Inc. | CRISPR-Cas systems for genome editing |
| US12215364B2 (en) | 2018-12-14 | 2025-02-04 | Pioneer Hi-Bred International, Inc. | CRISPR-cas systems for genome editing |
| WO2020176389A1 (en) * | 2019-02-25 | 2020-09-03 | Caribou Biosciences, Inc. | Plasmids for gene editing |
| US12297426B2 (en) | 2019-10-01 | 2025-05-13 | The Broad Institute, Inc. | DNA damage response signature guided rational design of CRISPR-based systems and therapies |
| US11999805B1 (en) * | 2020-05-06 | 2024-06-04 | National Technology & Engineering Solutions Of Sandia, Llc | Peptide inhibitors of CRISPR-Cas9 |
| WO2022008466A1 (en) * | 2020-07-06 | 2022-01-13 | Wageningen Universiteit | Base editing tools |
| WO2022013133A1 (en) | 2020-07-13 | 2022-01-20 | University Of Copenhagen | Methods for modulating cas-effector activity |
| EP3940069A1 (en) | 2020-07-13 | 2022-01-19 | University of Copenhagen | Methods for modulating cas-effector activity |
| WO2023247773A1 (en) * | 2022-06-24 | 2023-12-28 | Meiogenix | Induction of meiotic recombination using a crispr system |
| WO2025250808A1 (en) | 2024-05-29 | 2025-12-04 | The Brigham And Women’S Hospital, Inc. | Anti-crispr delivery compositions and methods |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3615552A1 (en) | 2020-03-04 |
| CN110891965A (en) | 2020-03-17 |
| US20200190492A1 (en) | 2020-06-18 |
| US11732251B2 (en) | 2023-08-22 |
| BR112019022201A2 (en) | 2020-05-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11732251B2 (en) | Anti-CRISPR polynucleotides and polypeptides and methods of use | |
| US12173294B2 (en) | Generation of site specific integration sites for complex trait loci in corn and soybean, and methods of use | |
| AU2022203961B2 (en) | Wheat ms1 polynucleotides, polypeptides, and methods of use | |
| US10676754B2 (en) | Compositions and methods for producing plants resistant to glyphosate herbicide | |
| AU2023200211B2 (en) | Manipulation of dominant male sterility | |
| KR20190016970A (en) | Use of CPF1 endonuclease for plant genomic modification | |
| CN107406858A (en) | Compositions and methods for directing regulated expression of RNA/CAS endonuclease complexes | |
| AU2025200029A1 (en) | Compositions and methods comprising male fertility sequences | |
| CN114008203A (en) | Methods and compositions for generating dominant alleles using genome editing | |
| CN113924367B (en) | Methods for increasing rice grain yield | |
| AU2020357916B2 (en) | Plants having a modified lazy protein | |
| WO2022055750A1 (en) | Plastid transformation by complementation of plastid mutations | |
| EP4158033A2 (en) | Large scale genome manipulation | |
| CN110959043A (en) | Methods for improving plant agronomic traits using BCS1L gene and guide RNA/CAS endonuclease system | |
| WO2025062150A1 (en) | Methods of producing homoplasmic modified plants or parts thereof | |
| KR20220149324A (en) | Method for screening herbicide-resistant plant | |
| Roberts | Controlling transpositon in the male gametophyte of transgenic plants | |
| CN108513583A (en) | Recombinant maize B chromosome sequence and its use |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18721982 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019022201 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2018721982 Country of ref document: EP Effective date: 20191125 |
|
| ENP | Entry into the national phase |
Ref document number: 112019022201 Country of ref document: BR Kind code of ref document: A2 Effective date: 20191023 |