WO2018178074A1 - Trimeric antigen binding molecules specific for a costimulatory tnf receptor - Google Patents
Trimeric antigen binding molecules specific for a costimulatory tnf receptor Download PDFInfo
- Publication number
- WO2018178074A1 WO2018178074A1 PCT/EP2018/057767 EP2018057767W WO2018178074A1 WO 2018178074 A1 WO2018178074 A1 WO 2018178074A1 EP 2018057767 W EP2018057767 W EP 2018057767W WO 2018178074 A1 WO2018178074 A1 WO 2018178074A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- acid sequence
- antigen binding
- cdr
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
Definitions
- Trimeric antigen binding molecules specific for a costimulatory TNF receptor Trimeric antigen binding molecules specific for a costimulatory TNF receptor
- the invention relates to novel trimeric antigen binding molecules comprising three fusion polypeptides, each of the three fusion polypeptides comprising (a) a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain, in particular a trimerization domain derived from human cartilage matrix protein (hCMP, SEQ ID NO: 1), and (c) a moiety capable of specific binding to a target cell antigen, and to methods of producing these molecules and to methods of using the same.
- the invention further relates to methods of producing these molecules and to methods of using the same.
- TNFR tumor necrosis factor receptor
- T cell activation to sustain T cell responses and thus have pivotal roles in the organization and function of the immune system.
- CD27, 4-1BB (CD137), OX40 (CD134), HVEM, CD30, and GITR can have costimulatory effects on T cells, meaning that they sustain T-cell responses after initial T cell activation (Watts T.H. (2005) Annu. Rev. Immunol. 23, 23-68).
- the effects of these costimulatory TNFR family members can often be functionally, temporally, or spatially segregated from those of CD28 and from each other.
- the sequential and transient regulation of T cell activation/survival signals by different costimulators may function to allow longevity of the response while maintaining tight control of T cell survival.
- stimulation via costimulatory TNF family members can exacerbate or ameliorate disease.
- TNFR family costimulators shows promise for several therapeutic applications, including cancer, infectious disease, transplantation, and autoimmunity.
- the tumor necrosis factor (TNF) receptor family member OX40 (CD 134) plays a key role in the survival and homeostasis of effector and memory T cells (Croft M. et al. (2009), Immunological Reviews 229, 173-191).
- OX40 (CD134) is expressed in several types of cells and regulates immune responses against infections, tumors and self-antigens and its expression has been demonstrated on the surface of T-cells, NKT-cells and NK-cells as well as neutrophils (Baumann R. et al. (2004), Eur. J. Immunol. 34, 2268-2275) and shown to be strictly inducible or strongly upregulated in response to various stimulatory signals.
- This effect is likely to be responsible, at least in part, for the enhancing activity of OX40 on anti-tumor or anti-microbial immune responses.
- OX40 engagement can expand T- cell populations, promote cytokine secretion, and support T-cell memory
- agonists including antibodies and soluble forms of the ligand OX40L have been used successfully in a variety of preclinical tumor models (Weinberg et al. (2000), J. Immunol. 164, 2160-2169).
- 4-1BB (CD137), a member of the TNF receptor superfamily, has been first identified as a molecule whose expression is induced by T-cell activation (Kwon Y.H. and Weissman S.M. (1989), Proc. Natl. Acad. Sci. USA 86, 1963-1967). Subsequent studies demonstrated expression of 4-1BB in T- and B-lymphocytes (Snell L.M. et al. (2011) Immunol. Rev. 244, 197-217 or Zhang X.et al. (2010), J. Immunol. 184, 787-795), NK-cells (Lin W. et al. (2008), Blood 112, 699-707, NKT-cells (Kim D.H.
- TCR T-cell receptor
- B-cell receptor triggering signaling induced through co-stimulatory molecules or receptors of pro-inflammatory cytokines
- CD 137 signaling is known to stimulate IFNy secretion and proliferation of NK cells (Buechele C. et al. (2012), Eur. J. Immunol. 42, 737-748; Lin W. et al. (2008), Blood 112, 699- 707; Melero I. et al. (1998), Cell Immunol. 190, 167-172) as well as to promote DC activation as indicated by their increased survival and capacity to secret cytokines and upregulate co- stimulatory molecules (Choi B. K. et al. (2009), J. Immunol. 182, 4107-4115; Futagawa T. et al. (2002), Int. Immunol. 14, 275-286; Wilcox R. A. et al.
- CD 137 is best characterized as a co-stimulatory molecule which modulates TCR- induced activation in both the CD4 + and CD8 + subsets of T-cells.
- agonistic 4-lBB-specific antibodies enhance proliferation of T-cells, stimulate lymphokine secretion and decrease sensitivity of T-lymphocytes to activation- induced cells death (Snell L.M. et al. (2011) Immunol. Rev. 244, 197-217).
- CD8 + T-cells play the most critical role in anti-tumoral effect of 4-lBB-specific antibodies.
- contributions of other types of cells such as DCs, NK-cells or CD4 + T-cells have been reported (Murillo O. et al. (2009), Eur. J. Immunol. 39, 2424-2436; Stagg J. et al. (2011), Proc. Natl. Acad. Sci. USA 108, 7142-7147).
- 4- IBB agonists can also induce infiltration and retention of activated T-cells in the tumor through 4-lBB-mediated upregulation of intercellular adhesion molecule 1 (ICAM1) and vascular cell adhesion molecule 1 (VCAM1) on tumor vascular endothelium (Palazon A. et al. (2011), Cancer Res. 71, 801-811).
- IMM1 intercellular adhesion molecule 1
- VCAM1 vascular cell adhesion molecule 1
- 4- IBB triggering may also reverse the state of T-cell anergy induced by exposure to soluble antigen that may contribute to disruption of immunological tolerance in the tumor micro- environment or during chronic infections (Wilcox R.A. et al. (2004), Blood 103, 177-184).
- fusion proteins usually has a large molecular weight and/or that the trimerization is rather inefficient.
- WO 2007/014744, WO 2009/000538 and Wyzgol et al. (2009) disclose fusion proteins comprising a TNF cytokine and a trimerization domain from the chicken protein tenascin. Biological activity could be strongly enhanced.
- huCMP Human cartilage matix protein
- GITR ligands and OX40 ligands respectively, that are fused to a trimerization domain which is connected to a Fc domain.
- these molecules lack the "tumor-targeting" through a moiety capable of binding to tumor-specific target and thus could lead to unspecific immune reactions.
- the available pre-clinical and clinical data clearly demonstrate that there is a high clinical need for effective agonists of costimulatory TNFR family members such as OX40 and 4- IBB that are able to induce and enhance effective endogenous immune responses to cancer.
- the antigen binding molecules of the invention combine a moiety capable of preferred binding to tumor-specific or tumor-associated targets with a moiety capable of agonistic binding to costimulatory TNF receptors.
- the antigen binding molecules of this invention may be able to trigger TNF receptors not only effectively, but also very selectively at the desired site thereby reducing undesirable side effects.
- the present invention provides a trimeric antigen binding molecule comprising three fusion polypeptides, each of the three fusion polypeptides comprising
- novel trimeric antigen binding molecules of the present invention are stable, as the fusion polypeptides associate with each other through the huCMP trimerization domain.
- the stable antigen binding molecule trimers are able to trigger TNF receptors highly effectively due to their trimeric structure, but also very selectively at the site where the target cell antigen is expressed, due to their binding capability towards a target cell antigen. Side effects may therefore be drastically reduced.
- the trimeric antigen binding molecule comprises three fusion polypeptides, each of the three fusion polypeptides comprising a trimerization domain comprising an amino acid sequence having at least 95% identity to SEQ ID NO:2. More particularly, the trimerization domain comprises the amino acid sequence of SEQ ID NO:2.
- the three fusion polypeptides are linked by disulphide bonds. In some embodiments, the three fusion polypeptides are linked by disulphide bonds formed between the trimerization domains of the fusion polypeptides.
- the costimulatory TNF receptor family member is selected from OX40 and 4-lBB.
- the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:3.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety comprises a heavy chain variable domain (VH) comprising
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14,
- VL light chain variable domain
- a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16 and SEQ ID NO: 17,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 18, SEQ ID NO:19 and SEQ ID NO:20, and
- a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 , SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 and SEQ ID NO:26.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises a heavy chain variable domain (VH) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:27, SEQ ID NO: 29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37 and SEQ ID NO:39 and a light chain variable domain (VL) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:28, SEQ ID NO: 30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38 and SEQ ID NO:40.
- VH heavy chain variable domain
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises (i) a heavy chain variable domain (VH) comprising the amino acid sequence of SEQ ID NO:27 and light chain variable domain (VL) comprising the amino acid sequence of SEQ ID NO:28,
- VH comprising the amino acid sequence of SEQ ID NO:37 and a VL comprising the amino acid sequence of SEQ ID NO:38, or
- the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:41.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4- IBB, wherein the moiety comprises a VH comprising
- a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:44 and SEQ ID NO:45
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50
- VL comprising
- a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:51 and SEQ ID NO:52,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:53 and SEQ ID NO:54, and
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises a VH comprising an amino acid sequence that is at least about 95%, 96%>, 97%, 98%, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66 and SEQ ID NO:68 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67 and SEQ ID
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises (i) a VH comprising the amino acid sequence of SEQ ID NO: 60 and a VL comprising the amino acid sequence of SEQ ID NO:61,
- VH comprising the amino acid sequence of SEQ ID NO: 66 and a VL comprising the amino acid sequence of SEQ ID NO:67, or
- a VH comprising the amino acid sequence of SEQ ID NO:68 and a VL comprising the amino acid sequence of SEQ ID NO:69.
- the moiety capable of specific binding to a costimulatory TNF receptor family member is fused at the C-terminal amino acid to the N-terminal amino acid of the trimerization domain, optionally through a peptide linker.
- the moiety capable of specific binding to a costimulatory TNF receptor family member is a Fab fragment or a scFv.
- the target cell antigen is selected from the group consisting of Fibroblast Activation Protein (FAP), Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), Carcinoembryonic Antigen (CEA), CD 19, CD20 and CD33.
- FAP Fibroblast Activation Protein
- MCSP Melanoma-associated Chondroitin Sulfate Proteoglycan
- EGFR Epidermal Growth Factor Receptor
- CEA Carcinoembryonic Antigen
- CD 19, CD20 and CD33 CD19
- the target cell antigen is FAP or CEA.
- the target cell antigen is FAP.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises a VH comprising
- a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:70 and SEQ ID NO:76,
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:71 and SEQ ID NO:77, and
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:72 and SEQ ID NO:78,
- a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:73 and SEQ ID NO:79,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:74 and SEQ ID NO:80, and
- a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:75 and SEQ ID NO:81.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises a heavy chain variable domain (VH) comprising an amino acid sequence that is at least about 95%, 96%o, 97%), 98%o, 99%> or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 82 and SEQ ID NO: 84 and a light chain variable domain (VL) comprising an amino acid sequence that is at least about 95%>, 96%>, 97%>, 98%>, 99%. or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 83 and SEQ ID NO:85.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises
- VH comprising the amino acid sequence of SEQ ID NO: 82 and a VL comprising the amino acid sequence of SEQ ID NO:83, or
- a VH comprising the amino acid sequence of SEQ ID NO: 84 and a VL comprising the amino acid sequence of SEQ ID NO:85.
- the moiety capable of specific binding to a target cell antigen is fused at the N-terminal amino acid to the C-terminal amino acid of the trimerization domain, optionally through a peptide linker.
- three fusion polypeptides are identical.
- the present invention also provides a fusion polypeptide comprising (a) a VH and/or VL of a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) comprising the amino acid sequence of SEQ ID NO:2, wherein the trimerization domain is capable of mediating stable association of the fusion polypeptide with two further such fusion polypeptides and (c) a VH and/or VL of a moiety capable of specific binding to a target cell antigen.
- huCMP human cartilage matrix protein
- the fusion polypeptide comprises a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises a VH comprising
- a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:70 and SEQ ID NO:76,
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:71 and SEQ ID NO:77, and
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:72 and SEQ ID NO:78,
- a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:73 and SEQ ID NO:79,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:74 and SEQ ID NO:80, and
- a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:75 and SEQ ID NO:81.
- the fusion polypeptide comprises a VH of a moiety capable of specific binding to OX40, wherein the VH comprises
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
- the fusion polypeptide comprises a VH of a moiety capable of specific binding to 4- IBB, wherein the VH comprises
- a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50.
- the present invention also provides a polynucleotide encoding the trimeric antigen binding molecule of the invention, or the fusion polypeptide of the invention.
- the present invention also provides a vector, e.g. an expression vector, comprising the polynucleotide of the invention.
- the present invention also provides a host cell comprising the polynucleotide of the invention or the expression vector of the invention.
- the host cell is a eukaryotic cell, particularly a mammalian cell.
- the present invention also provides a method of producing a trimeric antigen binding molecule, comprising culturing the host cell of the invention under conditions suitable for the expression of the trimeric antigen binding molecule, and isolating the trimeric antigen binding molecule.
- the invention also encompasses a trimeric antigen binding molecule produced by the method of the invention.
- the present invention also provides a pharmaceutical composition comprising the trimeric antigen binding molecule of the invention and at least one pharmaceutically acceptable excipient.
- the present invention also provides the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, for use as a medicament.
- the present invention also provides the trimeric antigen binding molecule as described herein before, or the pharmaceutical composition of the invention, for use
- the present invention also provides the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, for use in the treatment of a disease in an individual in need thereof. Also provided is the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, for use in the treatment of cancer.
- the present invention also provides the use of the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, in the manufacture of a disease in an individual in need thereof, in particular for the manufacture of a medicament for the treatment of cancer.
- the present invention also provides a method of treating a disease in an individual, comprising administering to the individual a therapeutically effective amount of a composition comprising the trimeric antigen binding molecule of the invention in a pharmaceutically acceptable form. Also provided is a method of treating an individual having cancer, said method comprising administering to the individual an effective amount of the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention.
- the present invention also provides the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, for use in up-regulating or prolonging cytotoxic T cell activity. Also provided is the use of the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, in the manufacture of a medicament for up-regulating or prolonging cytotoxic T cell activity. Also provided is a method of up-regulating or prolonging cytotoxic T cell activity in an individual having cancer, comprising administering to the individual an effective amount of the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention.
- the individual is a mammal, particularly a human.
- FIG. 1 shows the monomeric form of Fc-linked TNF receptor antigen that was used for the preparation of TNF receptor antibodies.
- Figure 2A shows a schematic representation of the trimeric, bispecific, antigen binding molecules comprising three anti-OX40 Fab, and three scFv capable of specific binding to FAP.
- Figure 2B shows the trimeric, bispecific antigen binding molecules comprising three anti-4-lBB Fab, and three scFv capable of specific binding to FAP.
- Figure 3A shows a schematic representation of the set up of the surface plasmon resonance assays for simultaneous binding of human OX40 and human FAP by the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules.
- Figure 3B shows a schematic representation of the set up of the surface plasmon resonance assays for simultaneous binding of human 4- IBB and human FAP by the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules.
- Figures 4A to 4E show the binding of the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules to recombinant OX40 Fc (kih) receptor and human FAP protein, as assessed by surface plasmon resonance.
- Figure 4A shows binding of molecules comprising anti-OX40 clone 8H9
- Figure 4B shows binding of molecules comprising anti-OX40 clone 1G
- Figure 4C shows binding of molecules comprising anti-OX40 clone 49B
- Figure 4D shows binding of molecules comprising anti-OX40 clone 21H
- Figure 4E shows binding of molecules comprising anti-OX40 clone CLC-563.
- Figures 5A to 5C show the binding of the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules to resting and activated human CD4+ and CD 8+ T cells.
- Figure 5 A shows binding to resting CD4+ T cells
- Figure 5B shows binding to activated CD4+ T cells
- Figure 5C shows binding to resting CD8+ T cells
- Figure 5D shows binding to activated CD8+ T cells. Binding is shown as the median of fluorescence intensity (MFI) of FITC conjugated anti- human IgG F(ab') 2 -fragment-specific goat IgG F(ab")2 fragment, which is used as secondary detection antibody.
- MFI was measured by flow cytometry and baseline corrected by subtracting the MFI of the blank control.
- the x-axis shows the concentration of the antigen binding molecules. All OX40 clones bind to activated, OX40 expressing human CD4+ T cells, and to a lower extent to activated human CD8+ T cells. OX40 is not expressed on resting human PBMCs ( Figure 5A and 5C). After activation, OX40 is up-regulated on CD4+ and CD8+ T cells ( Figure 5B and 5D). OX40 expression on human CD8+ T cells is lower than on CD4+ T cells. The clones vary in the strength of binding (EC50 values as well as signal strength) to OX40 positive cells.
- Figures 6A and 6B show the binding of the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules to tumor cells which do not express FAP (FAP-), or which express FAP (FAP+).
- Figure 6 A shows binding to CHO cells, which are negative for FAP.
- Figure 6B shows binding to WM266-4 cells, which express high levels of human fibroblast activation protein (huFAP). Binding is shown as the median of fluorescence intensity (MFI) of FITC conjugated anti-human IgG F(ab') 2 -fragment-specific goat IgG F(ab " )2 fragment, which is used as secondary detection antibody. MFI was measured by flow cytometry. The x-axis shows the concentration of antibody constructs. The molecules are shown to bind to FAP-expressing WM266-4 cells ( Figure 6B), but not to FAP-negative CHO cells ( Figure 6A).
- MFI median of fluorescence intensity
- Figures 7A to 7E show activation of NFKB by the trimeric, bispecific anti-OX40, anti- FAP antigen binding molecules, in the presence or absence of crosslinking by FAP -positive cells.
- Figure 7 A shows NFKB activation by molecules comprising anti-OX40 clone 49B4
- Figure 7B shows NFKB activation by molecules comprising anti-OX40 clone 1G4
- Figure 7C shows NFKB activation by molecules comprising anti-OX40 clone CLC-563
- Figure 7D shows NFKB activation by molecules comprising anti-OX40 clone 8H9
- Figure 7E shows NFKB activation by molecules comprising anti-OX40 clone 21H4.
- NF-KB-mediated luciferase activity was characterized by plotting the units of released light (URL), measured during 0.5 s, versus the concentration of the antigen binding molecule (in nM). URLs are emitted due to luciferase- mediated oxidation of luciferin to oxyluciferin. The values were baseline-corrected by
- Figures 8A to 8D show activation of NFKB by the trimeric, bispecific anti-OX40, anti- FAP antigen binding molecules, in the presence or absence of crosslinking by FAP -positive cells.
- Figure 8A shows activation of NFKB by molecules comprising anti-OX40 clones 49B4, 1G4, CLC-356, 21H4 and 8H9, or DP47 hulgGI P329GLALA (isotype control), following hyper- crosslinking by culture in the presence of FAP-expressing NIH/3T3-huFAP clone 39 cells (2: 1 ratio of FAP + tumor cells to reporter cells),
- Figure 8B shows activation of NFKB by molecules comprising anti-OX40 clones 49B4, 1G4, CLC-356, 21H4 and 8H9 in the absence of hyper- crosslinking.
- NF-KB-mediated luciferase activity was characterized by plotting the units of released light (URL), measured during 0.5 s, versus the concentration of the antigen binding molecule (in nM). URLs are emitted due to luciferase-mediated oxidation of luciferin to oxyluciferin. The values are baseline-corrected by subtracting the URLs for a 'blank control' condition. Limited, dose-dependent NFkB activation observed in the absence of FAP+ cells, in line with the observation that the trimeric OX40L naturally engages three OX40 receptors on the cell surface to form the basic signaling unit.
- a drop in bioactivity was observed after an initial increase; it may be that at high concentration, efficient hyper- crosslinking is limited by insufficient FAP molecules at the cell surface, or by steric hindrance.
- Figure 8C shows NFKB activation in the presence of hyper-crosslinking (Figure 8A) minus NFKB activation in the absence of hyper-crosslinking (Figure 8B).
- Figure 8D shows the data of Figure 8C represented as area under the curve (AUC).
- Figures 9A to 9D show rescue of suboptimal TCR restimulation of preactivated CD4 T cells with plate-immobilized trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules.
- Suboptimally PHA-L pre-activated CFSE-labeled human CD4 T cells were cultured for four days on plates pre-coated with mouse IgG Fey-specific antibodies (2 ug/mL), human IgG Fab specific antibodies (2 ug/mL), mouse anti- human CD3 antibodies (clone OKT3, [3 ng/mL]) and titrated trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules, or DP47 hulgGI P329GLALA (isotype control).
- FIG. 9A shows the number of events
- Figure 9B shows the percentage of proliferating (i.e. CFSElow) cells
- Figure 9C shows the percentage of effector T cells (i.e. CD1271ow)
- Figure 9D shows the percentage of cells with an activated phenotype (Tim-3 positive cells). All of the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules were able to rescue suboptimal TCR stimulation of preactivated, OX40+ CD4 T cells when coated to plate.
- Figure 10 shows the EC50 values of the plate-immobilized trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules for rescuing suboptimal TCR stimulation, as calculated from the data of Figure 9A to 9D.
- Event count, the percentage of proliferating (CFSElow) cells, the percentage of CD1271ow and Tim-3 positive cells at day 4 were plotted against the antigen binding molecule concentration concentration, and EC50 values as measure for agonistic strength were calculated using the inbuilt sigmoidal dose response quotation in Prism4
- Figures 11A to 11D show rescue of suboptimal TCR restimulation of preactivated CD4 T cells with plate-immobilized trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules, in the presence or absence of crosslinking by FAP-positive cells.
- CFSE-labeled human PBMCs were activated with anti- human CD3 antibodies (clone V9, human IgGl; 2 nM) and trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules or non-targeted trivalent OX40 antigen binding molecules, at the indicated concentrations, for four days.
- Cells were activated with anti- human CD3 antibodies (clone V9, human IgGl; 2 nM) and trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules or non-targeted trivalent OX40 antigen binding molecules, at the indicated concentrations, for four days. Cells were
- Figures 11A and llC show the MFI of CD25 (as a marker of activation) on vital CD4+ T cells.
- Figures 11B and 11D show the percentage of CD4+ T cells which were CD4+ CD25+ T cells. Only constructs containing FAP binding moiety were able to rescue suboptimal TCR stimulation of preactivated, OX40 + CD4 T cells when crosslinking was provided by FAP positive cells.
- the high affinity clone 8H9 ( Figures 11A and 11B), showed peak activity at concentration of -0.1-1 nM, and a reduced activity at higher concentration.
- Figures 12A and 12B show the correlation between the strength of binding to cells, and the strength of NFKB activation (as determined as AUC for NFKB activation; Figure 12A) and the strength of T cell activation (Figure 12B) shown for trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules.
- the binding strength is the MFI of at the highest concentration (see Figure 5) for each clone.
- the AUC of bioactivity is the AUC calculated for NFkB activation as in Figure 8D.
- the AUC of T cell bioactivity was calculated from dose response curves shown in Figure 11. A negative correlation between binding strength to OX40 and agonism of bioactivity was observed.
- Figures 13 A to 13C show the binding of the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules to recombinant 4- IBB Fc (kih) receptor and human FAP protein, as assessed by surface plasmon resonance.
- Figure 13A shows binding of molecules comprising anti-4-lBB clone 25G7
- Figure 13B shows binding of molecules comprising anti-4-lBB clone 12B3
- Figure 13C shows binding of molecules comprising anti-4-lBB clone 9B11.
- Figures 14A to 14D show the binding of the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules; trimeric, bispecific isotype control DP47, anti-FAP antigen binding molecules; trimeric, monospecific anti-4-lBB antigen binding molecules; and isotype control DP47 hulgG P329G LALA molecules, to resting (naive) and activated human CD4+ and CD8+ T cells.
- Figure 14A shows binding to naive CD8+ T cells
- Figure 14B shows binding to naive CD4+ T cells
- Figure 14C shows binding to activated CD8+ T cells
- Figure 14D shows binding to activated CD4+ T cells.
- Binding is shown as the median of fluorescence intensity (MFI) of PE conjugated anti- human IgG F(ab') 2 -fragment-specific goat IgG F(ab " )2 fragment, which is used as secondary detection antibody. MFI was measured by flow cytometry and baseline corrected by subtracting the MFI of the blank control. The x-axis shows the
- Figure 15 shows the binding of the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules; trimeric, bispecific anti-4-lBB, isotype control DP47 antigen binding molecules; and monospecific, anti-4-lBB hulgGI P329G LALA antigen binding molecules to FAP-expressing NIH/3T3-huFAP clone 39 cells.
- the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules are efficiently targeted to FAP, whereas the molecules lacking anti- FAP scFv did not bind to FAP-expressing NHI/3T3-huFAP clone 39 cells.
- Figures 16A and 16B show activation of NFKB by the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules, in the presence of crosslinking by FAP -positive cells.
- NF- ⁇ -mediated luciferase activity was characterized by plotting the units of released light (URL), measured during 0.5 s, versus the concentration of the antigen binding molecule (in nM). URLs are emitted due to luciferase-mediated oxidation of luciferin to oxyluciferin ( Figure 16A). The values were baseline-corrected by subtracting the URLs for a 'blank control' condition.
- Figure 16B shows that the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules (clone 25G7, filled diamonds and clone 12B3, filled squares) induced NFkB activation in human 4- lBB-positive HeLa reporter cells, but the control monospecific anti-4-lBB hulgGI P329G LALA and trimeric monospecific anti-4-lBB antigen binding molecules lacking anti-FAP scFv did not trigger activation of NFKB.
- antigen binding molecule refers in its broadest sense to a molecule that specifically binds an antigenic determinant.
- antigen binding molecules are antibodies, antibody fragments and scaffold antigen binding proteins.
- moiety capable of specific binding to a target cell antigen or
- antigen binding domain capable of specific binding refers to a polypeptide molecule that specifically binds to an antigenic determinant.
- the antigen binding moiety is able to activate signaling through its target cell antigen.
- the antigen binding moiety is able to direct the entity to which it is attached to a target site, for example to a specific type of tumor cell or tumor stroma bearing the antigenic determinant.
- Moieties capable of specific binding to a target cell antigen include antibodies and fragments thereof as further defined herein.
- a "moiety capable of specific binding to a target cell antigen” is an antigen binding domain comprising an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH) capable of specific binding to a target cell antigen.
- the "moiety capable of specific binding to a costimulatory TNF receptor family member” may be a Fab fragment, a cross-Fab fragment or a scFv.
- moieties capable of specific binding to a target cell antigen include scaffold antigen binding proteins as further defined herein, e.g. binding domains which are based on designed repeat proteins or designed repeat domains (see e.g. WO 2002/020565).
- the term "moiety capable of specific binding to a target cell antigen” refers to the part of the molecule that comprises the area which specifically binds to and is complementary to part or all of an antigen.
- a moiety capable of specific antigen binding may be provided, for example, by one or more antibody variable domains (also called antibody variable regions).
- a moiety capable of specific antigen binding comprises an antibody light chain variable domain (VL) and an antibody heavy chain variable domain (VH).
- VL antibody light chain variable domain
- VH antibody heavy chain variable domain
- the "moiety capable of specific binding to a target cell antigen” may be a scFv, a Fab fragment or a cross-Fab fragment.
- moiety capable of specific binding to a costimulatory TNF receptor family member or "antigen binding domain capable of specific binding to a costimulatory TNF receptor family member” refers to a polypeptide molecule that specifically binds to a costimulatory TNF receptor family member.
- the antigen binding moiety is able to activate signaling through a costimulatory TNF receptor family member.
- Moieties capable of specific binding to a target cell antigen include antibodies and fragments thereof as further defined herein.
- moieties capable of specific binding to a costimulatory TNF receptor family member include scaffold antigen binding proteins as further defined herein, e.g. binding domains which are based on designed repeat proteins or designed repeat domains (see e.g.
- a moiety capable of specific binding to a costimulatory TNF receptor family member comprises an antibody light chain variable domain (VL) and an antibody heavy chain variable domain (VH).
- VL antibody light chain variable domain
- VH antibody heavy chain variable domain
- the "moiety capable of specific binding to a costimulatory TNF receptor family member” may be a Fab fragment, a cross-Fab fragment or a scFv.
- antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, monospecific and multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g. containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
- polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- the term "monospecific" antibody as used herein denotes an antibody that has one or more binding sites each of which bind to the same epitope of the same antigen.
- bispecific means that the antigen binding molecule is able to specifically bind to at least two distinct antigenic determinants.
- a bispecific antigen binding molecule comprises at least two antigen binding sites, each of which is specific for a different antigenic determinant.
- the bispecific antigen binding molecule is capable of simultaneously binding two antigenic determinants, particularly two antigenic determinants expressed on two distinct cells.
- the trimeric antigen binding molecules of the present invention are bispecific, comprising a moiety capable of specific binding to a costimulatory TNF receptor family member and a moiety capable of specific binding to a target cell antigen.
- valent denotes the presence of a specified number of binding sites in an antigen binding molecule.
- bivalent tetravalent
- hexavalent denote the presence of two binding sites, four binding sites, and six binding sites, respectively, in an antigen binding molecule.
- Valency of an antigen binding molecule may also be expressed in relation to the number of binding sites for a given antigenic determinant.
- the trimeric antigen binding molecules of the present invention are trivalent with respect to the target target cell antigen, and trivalent with respect to the
- the trimeric antigen binding molecules comprise six binding sites (3+3).
- full length antibody “intact antibody”, and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure.
- Native antibodies refer to naturally occurring immunoglobulin molecules with varying structures. For example, native IgG-class antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two light chains and two heavy chains that are disulfide-bonded.
- each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI, CH2, and CH3), also called a heavy chain constant region.
- VH variable heavy domain
- CH2 heavy chain variable domain
- each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a light chain constant domain (CL), also called a light chain constant region.
- the heavy chain of an antibody may be assigned to one of five types, called a (IgA), ⁇ (IgD), ⁇ (IgE), ⁇ (IgG), or ⁇ (IgM), some of which may be further divided into subtypes, e.g.
- the light chain of an antibody may be assigned to one of two types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequence of its constant domain.
- An "antibody fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
- antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies, triabodies, tetrabodies, cross-Fab fragments; linear antibodies; single-chain antibody molecules (e.g. scFv); and single domain antibodies.
- scFv single-chain antibody molecules
- Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific, see, for example, EP 404,097; WO 1993/01161; Hudson et al, Nat Med 9, 129-134 (2003); and Hollinger et al, Proc Natl Acad Sci USA 90, 6444-6448 (1993). Triabodies and tetrabodies are also described in Hudson et al, Nat Med 9, 129-134 (2003).
- Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
- a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, MA; see e.g. U.S. Patent No. 6,248,516 Bl).
- Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g. E. coli or phage), as described herein. Papain digestion of intact antibodies produces two identical antigen-binding fragments, called "Fab" fragments containing each the heavy- and light-chain variable domains and also the constant domain of the light chain and the first constant domain (CHI) of the heavy chain.
- Fab fragments containing each the heavy- and light-chain variable domains and also the constant domain of the light chain and the first constant domain (CHI) of the heavy chain.
- Fab fragment refers to an antibody fragment comprising a light chain fragment comprising a light chain variable domain (VL) and a constant domain of a light chain (CL), and a heavy chain variable domain (VH) and a first constant domain (CHI) of a heavy chain.
- Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHI domain including one or more cysteins from the antibody hinge region.
- Fab'-SH are Fab' fragments in which the cysteine residue(s) of the constant domains bear a free thiol group. Pepsin treatment yields an F(ab') 2 fragment that has two antigen-combining sites (two Fab fragments) and a part of the Fc region.
- cross-Fab fragment or "xFab fragment” or “crossover Fab fragment” refers to a Fab fragment, wherein either the variable regions or the constant regions of the heavy and light chain are exchanged.
- Two different chain compositions of a crossover Fab molecule are possible and comprised in the bispecific antibodies of the invention: On the one hand, the variable regions of the Fab heavy and light chain are exchanged, i.e. the crossover Fab molecule comprises a peptide chain composed of the light chain variable region (VL) and the heavy chain constant region (CHI), and a peptide chain composed of the heavy chain variable region (VH) and the light chain constant region (CL).
- This crossover Fab molecule is also referred to as CrossFab (VLVH).
- the crossover Fab molecule comprises a peptide chain composed of the heavy chain variable region (VH) and the light chain constant region (CL), and a peptide chain composed of the light chain variable region (VL) and the heavy chain constant region (CHI).
- This crossover Fab molecule is also referred to as CrossFab (CLCHI).
- a “single chain Fab fragment” or “scFab” is a polypeptide consisting of an antibody heavy chain variable domain (VH), an antibody constant domain 1 (CHI), an antibody light chain variable domain (VL), an antibody light chain constant domain (CL) and a linker, wherein said antibody domains and said linker have one of the following orders in N-terminal to C-terminal direction: a) VH-CH1 -linker- VL-CL, b) VL-CL-linker-VH-CHl, c) VH-CL-linker-VL-CHl or d) VL-CH1 -linker- VH-CL; and wherein said linker is a polypeptide of at least 30 amino acids, preferably between 32 and 50 amino acids.
- Said single chain Fab fragments are stabilized via the natural disulfide bond between the CL domain and the CHI domain.
- these single chain Fab molecules might be further stabilized by generation of interchain disulfide bonds via insertion of cysteine residues (e.g. position 44 in the variable heavy chain and position 100 in the variable light chain according to Kabat numbering).
- a “crossover single chain Fab fragment” or “x-scFab” is a is a polypeptide consisting of an antibody heavy chain variable domain (VH), an antibody constant domain 1 (CHI), an antibody light chain variable domain (VL), an antibody light chain constant domain (CL) and a linker, wherein said antibody domains and said linker have one of the following orders in N- terminal to C-terminal direction: a) VH-CL-linker-VL-CHl and b) VL-CH1 -linker- VH-CL; wherein VH and VL form together an antigen-binding site which binds specifically to an antigen and wherein said linker is a polypeptide of at least 30 amino acids.
- these x-scFab molecules might be further stabilized by generation of interchain disulfide bonds via insertion of cysteine residues (e.g. position 44 in the variable heavy chain and position 100 in the variable light chain according to Kabat numbering).
- a "single-chain variable fragment (scFv)" is a fusion protein of the variable regions of the heavy (V H ) and light chains (V L ) of an antibody, connected with a short linker peptide of ten to about 25 amino acids.
- the linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the V H with the C-terminus of the V L , or vice versa.
- This protein retains the specificity of the original antibody, despite removal of the constant regions and the introduction of the linker.
- scFv antibodies are, e.g. described in Houston, J.S., Methods in Enzymol. 203 (1991) 46-96).
- antibody fragments comprise single chain polypeptides having the characteristics of a VH domain, namely being able to assemble together with a VL domain, or of a VL domain, namely being able to assemble together with a VH domain to a functional antigen binding site and thereby providing the antigen binding property of full length antibodies.
- fibronectin and designed ankyrin repeat proteins have been used as alternative scaffolds for antigen- binding domains, see, e.g., Gebauer and Skerra, Engineered protein scaffolds as next-generation antibody therapeutics. Curr Opin Chem Biol 13:245-255 (2009) and Stumpp et al., Darpins: A new generation of protein therapeutics. Drug Discovery Today 13: 695-701 (2008).
- a scaffold antigen binding protein is selected from the group consisting of CTLA-4 (Evibody), Lipocalins (Anticalin), a Protein A-derived molecule such as Z-domain of Protein A (Affibody), an A-domain (Avimer/Maxibody), a serum transferrin (trans-body); a designed ankyrin repeat protein (DARPin), a variable domain of antibody light chain or heavy chain (single-domain antibody, sdAb), a variable domain of antibody heavy chain (nanobody, aVH), V NAR fragments, a fibronectin (AdNectin), a C-type lectin domain (Tetranectin); a variable domain of a new antigen receptor beta-lactamase (V NAR fragments), a human gamma- crystallin or ubiquitin (Affilin molecules); a kunitz type domain of human protease inhibitors, microbodies such as the proteins from the knot
- CTLA-4 Cytotoxic T Lymphocyte-associated Antigen 4
- CTLA-4 is a CD28-family receptor expressed on mainly CD4+ T-cells. Its extracellular domain has a variable domain- like Ig fold. Loops corresponding to CDRs of antibodies can be substituted with heterologous sequence to confer different binding properties.
- CTLA-4 molecules engineered to have different binding specificities are also known as Evibodies (e.g. US7166697B1). Evibodies are around the same size as the isolated variable region of an antibody (e.g. a domain antibody). For further details see Journal of Immunological Methods 248 (1-2), 31-45 (2001).
- Lipocalins are a family of extracellular proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids and lipids. They have a rigid beta-sheet secondary structure with a number of loops at the open end of the conical structure which can be engineered to bind to different target antigens. Anticalins are between 160-180 amino acids in size, and are derived from lipocalins. For further details see Biochim Biophys Acta 1482: 337-350 (2000), US7250297B1 and US20070224633.
- An affibody is a scaffold derived from Protein A of Staphylococcus aureus which can be engineered to bind to antigen.
- the domain consists of a three-helical bundle of approximately 58 amino acids. Libraries have been generated by randomization of surface residues. For further details see Protein Eng. Des. Sel. 17, 455-462 (2004) and EP 1641818A1.
- Avimers are multidomain proteins derived from the A-domain scaffold family.
- the native domains of approximately 35 amino acids adopt a defined disulfide bonded structure. Diversity is generated by shuffling of the natural variation exhibited by the family of A-domains. For further details see Nature Biotechnology 23(12), 1556 - 1561 (2005) and Expert Opinion on Investigational Drugs 16(6), 909-917 (June 2007).
- a transferrin is a monomeric serum transport glycoprotein. Transferrins can be engineered to bind different target antigens by insertion of peptide sequences in a permissive surface loop. Examples of engineered transferrin scaffolds include the Trans-body. For further details see J. Biol. Chem 274, 24066-24073 (1999). Designed Ankyrin Repeat Proteins (DARPins) are derived from Ankyrin which is a family of proteins that mediate attachment of integral membrane proteins to the cytoskeleton. A single ankyrin repeat is a 33 residue motif consisting of two alpha- helices and a beta-turn.
- DARPins Designed Ankyrin Repeat Proteins
- a single-domain antibody is an antibody fragment consisting of a single monomeric variable antibody domain.
- the first single domains were derived from the variable domain of the antibody heavy chain from came lids (nanobodies or V H H fragments).
- the term single-domain antibody includes an autonomous human heavy chain variable domain (aVH) or VN AR fragments derived from sharks.
- Fibronectin is a scaffold which can be engineered to bind to antigen.
- Adnectins consists of a backbone of the natural amino acid sequence of the 10th domain of the 15 repeating units of human fibronectin type III (FN3). Three loops at one end of the .beta. -sandwich can be engineered to enable an Adnectin to specifically recognize a therapeutic target of interest.
- Peptide aptamers are combinatorial recognition molecules that consist of a constant scaffold protein, typically thioredoxin (TrxA) which contains a constrained variable peptide loop inserted at the active site. For further details see Expert Opin. Biol. Ther. 5, 783-797 (2005).
- Microbodies are derived from naturally occurring microproteins of 25-50 amino acids in length which contain 3-4 cysteine bridges - examples of microproteins include KalataBI and conotoxin and knottins.
- the microproteins have a loop which can beengineered to include upto 25 amino acids without affecting the overall fold of the microprotein.
- engineered knottin domains see WO2008098796.
- an "antigen binding molecule that binds to the same epitope" as a reference molecule refers to an antigen binding molecule that blocks binding of the reference molecule to its antigen in a competition assay by 50% or more, and conversely, the reference molecule blocks binding of the antigen binding molecule to its antigen in a competition assay by 50% or more.
- an antigen binding domain refers to the part of an antigen binding molecule that comprises the area which specifically binds to and is complementary to part or all of an antigen. Where an antigen is large, an antigen binding molecule may only bind to a particular part of the antigen, which part is termed an epitope.
- An antigen binding domain may be provided by, for example, one or more variable domains (also called variable regions).
- an antigen binding domain comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH).
- antigenic determinant is synonymous with “antigen” and “epitope,” and refers to a site (e.g. a contiguous stretch of amino acids or a conformational configuration made up of different regions of non-contiguous amino acids) on a polypeptide macromolecule to which an antigen binding moiety binds, forming an antigen binding moiety- antigen complex.
- Useful antigenic determinants can be found, for example, on the surfaces of tumor cells, on the surfaces of virus-infected cells, on the surfaces of other diseased cells, on the surface of immune cells, free in blood serum, and/or in the extracellular matrix (ECM).
- ECM extracellular matrix
- the proteins useful as antigens herein can be any native form the proteins from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g. mice and rats), unless otherwise indicated.
- the antigen is a human protein.
- the term encompasses the "full-length", unprocessed protein as well as any form of the protein that results from processing in the cell.
- the term also encompasses naturally occurring variants of the protein, e.g. splice variants or allelic variants.
- ELISA enzyme-linked immunosorbent assay
- SPR Surface Plasmon Resonance
- the extent of binding of an antigen binding molecule to an unrelated protein is less than about 10% of the binding of the antigen binding molecule to the antigen as measured, e.g. by SPR.
- an molecule that binds to the antigen has a dissociation constant (Kd) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 ⁇ 8 M or less, e.g. from 10 ⁇ 8 M to 10 "13 M, e.g. from 10 "9 M to 10 "13 M).
- Binding affinity refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g. an antibody) and its binding partner (e.g. an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g.
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd), which is the ratio of dissociation and association rate constants (koff and kon, respectively).
- Kd dissociation constant
- equivalent affinities may comprise different rate constants, as long as the ratio of the rate constants remains the same.
- Affinity can be measured by common methods known in the art, including those described herein. A particular method for measuring affinity is Surface Plasmon Resonance (SPR).
- target cell antigen refers to an antigenic determinant presented on the surface of a target cell, for example a cell in a tumor such as a cancer cell or a cell of the tumor stroma.
- the target cell antigen is an antigen on the surface of a tumor cell.
- target cell antigen is selected from the group consisting of Fibroblast Activation Protein (FAP), Carcinoembryonic Antigen (CEA), Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), CD 19, CD20 and CD33.
- FAP Fibroblast Activation Protein
- CEA Carcinoembryonic Antigen
- MCSP Melanoma-associated Chondroitin Sulfate Proteoglycan
- EGFR Epidermal Growth Factor Receptor
- CD 19, CD20 and CD33 CD19
- the target cell antigen is Fibroblast Activation Protein (FAP).
- FAP Fibroblast activation protein
- Prolyl endopeptidase FAP or Seprase EC 3.4.21
- FAP Fibroblast activation protein
- mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the term encompasses "full-length,” unprocessed FAP as well as any form of FAP that results from processing in the cell.
- the term also encompasses naturally occurring variants of FAP, e.g., splice variants or allelic variants.
- the antigen binding molecule of the invention is capable of specific binding to human, mouse and/or cynomolgus FAP.
- the amino acid sequence of human FAP is shown in UniProt (www.uniprot.org) accession no. Q12884 (version 149, SEQ ID NO:86), or NCBI (www.ncbi.nlm.nih.gov/) RefSeq NP 004451.2.
- the extracellular domain (ECD) of human FAP extends from amino acid position 26 to 760.
- the amino acid and nucleotide sequences of a His- tagged human FAP ECD is shown in SEQ ID NOs 87 and 88, respectively.
- mouse FAP The amino acid sequence of mouse FAP is shown in UniProt accession no. P97321 (version 126, SEQ ID NO:89), or NCBI RefSeq NP 032012.1.
- the extracellular domain (ECD) of mouse FAP extends from amino acid position 26 to 761.
- SEQ ID NOs 90 and 91 show the amino acid and nucleotide sequences, respectively, of a His-tagged mouse FAP ECD.
- SEQ ID NOs 92 and 93 show the amino acid and nucleotide sequences, respectively, of a His-tagged cynomolgus FAP ECD.
- an anti-FAP binding molecule of the invention binds to the extracellular domain of FAP. Exemplary anti-FAP binding molecules are described in International Patent Application No. WO 2012/020006 A2.
- CEA Carcinoembryonic antigen-related cell adhesion molecule 5
- CEACAM5 Carcinoembryonic antigen- related cell adhesion molecule 5
- CEA cynomolgus monkeys
- rodents e.g. mice and rats
- the amino acid sequence of human CEA is shown in UniProt accession no. P06731 (version 151, SEQ ID NO: 94).
- CEA has long been identified as a tumor-associated antigen (Gold and Freedman, J Exp Med., 121 :439-462, 1965; Berinstein N. L., J Clin Oncol, 20:2197-2207, 2002). Originally classified as a protein expressed only in fetal tissue, CEA has now been identified in several normal adult tissues.
- tumors of epithelial origin contain CEA as a tumor associated antigen. While the presence of CEA itself does not indicate transformation to a cancerous cell, the distribution of CEA is indicative. In normal tissue, CEA is generally expressed on the apical surface of the cell (Hammarstrom S., Semin Cancer Biol.
- CEA tends to be expressed over the entire surface of cancerous cells (Hammarstrom S., Semin Cancer Biol. 9(2):67-81 (1999)). This change of expression pattern makes CEA accessible to antibody binding in cancerous cells.
- CEA expression increases in cancerous cells.
- increased CEA expression promotes increased intercellular adhesions, which may lead to metastasis (Marshall J., Semin Oncol, 30(a Suppl. 8):30-6, 2003).
- the prevalence of CEA expression in various tumor entities is generally very high.
- CEA colorectal carcinoma
- NSCLC non-small cell lung cancer
- HER3 non-small cell lung cancer
- HER3 non-small cell lung cancer
- breast cancer low expression was found in small cell lung cancer and glioblastoma.
- CEA is readily cleaved from the cell surface and shed into the blood stream from tumors, either directly or via the lymphatics. Because of this property, the level of serum CEA has been used as a clinical marker for diagnosis of cancers and screening for recurrence of cancers, particularly colorectal cancer (Goldenberg D M., The International Journal of Biological
- MCSP Chondroitin Sulfate Proteoglycan
- CSPG4 Chondroitin Sulfate Proteoglycan 4
- the amino acid sequence of human MCSP is shown in UniProt accession no. Q6UVK1 (version 103, SEQ ID NO:95).
- Epidermal Growth Factor Receptor also named Proto- oncogene c-ErbB-1 or Receptor tyro sine-protein kinase erbB-1, refers to any native EGFR from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the amino acid sequence of human EGFR is shown in UniProt accession no. P00533 (version 211, SEQ ID NO:96).
- CD19 refers to B-lymphocyte antigen CD19, also known as B-lymphocyte surface antigen B4 or T-cell surface antigen Leu- 12 and includes any native CD 19 from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the amino acid sequence of human CD19 is shown in Uniprot accession no. P15391 (version 160, SEQ ID NO:97). The term encompasses "full-length" unprocessed human CD19 as well as any form of human CD 19 that results from processing in the cell as long as the antibody as reported herein binds thereto.
- CD 19 is a structurally distinct cell surface receptor expressed on the surface of human B cells, including, but not limited to, pre-B cells, B cells in early development ⁇ i.e., immature B cells), mature B cells through terminal differentiation into plasma cells, and malignant B cells.
- CD 19 is expressed by most pre-B acute lymphoblastic leukemias (ALL), non- Hodgkin's lymphomas, B cell chronic lymphocytic leukemias (CLL), pro-lymphocytic leukemias, hairy cell leukemias, common acute lymphocytic leukemias, and some Null-acute lymphoblastic leukemias.
- ALL pre-B acute lymphoblastic leukemias
- CLL B cell chronic lymphocytic leukemias
- pro-lymphocytic leukemias pro-lymphocytic leukemias
- hairy cell leukemias common acute lymphocytic leukemias
- CD 19 on plasma cells further suggests it may be expressed on differentiated B cell tumors such as multiple myeloma. Therefore, the CD 19 antigen is a target for immunotherapy in the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
- CD20 refers to B-lymphocyte antigen CD20, also known as membrane-spanning 4- domains subfamily A member 1 (MS4A1), B-lymphocyte surface antigen Bl or Leukocyte surface antigen Leu- 16, and includes any native CD20 from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the amino acid sequence of human CD20 is shown in Uniprot accession no. PI 1836 (version 149, SEQ ID NO:98).
- CD33 refers to Myeloid cell surface antigen CD33, also known as SIGLEC3 or gp67, and includes any native CD33 from any vertebrate source, including mammals such as primates (e.g. humans) non- human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the amino acid sequence of human CD33 is shown in Uniprot accession no. P20138 (version 157, SEQ ID NO:99).
- variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antigen binding molecule to antigen.
- the variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs). See, e.g., Kindt et al, Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007). A single VH or VL may be sufficient to confer antigen-binding specificity.
- hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops ("hypervariable loops").
- native four-chain antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
- HVRs generally comprise amino acid residues from the hypervariable loops and/or from the "complementarity determining regions" (CDRs), the latter being of highest sequence variability and/or involved in antigen recognition.
- CDRs complementarity determining regions
- Exemplary hypervariable loops occur at amino acid residues 26-32 (LI), 50- 52 (L2), 91-96 (L3), 26-32 (HI), 53-55 (H2), and 96-101 (H3).
- Exemplary CDRs CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3 occur at amino acid residues 24-34 of LI, 50-56 of L2, 89-97 of L3, 31-35B of HI, 50-65 of H2, and 95-102 of H3.
- Kabat et al. Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991).
- Hypervariable regions are also referred to as complementarity determining regions (CDRs), and these terms are used herein interchangeably in reference to portions of the variable region that form the antigen binding regions. This particular region has been described by Kabat et al, U.S. Dept. of Health and Human Services, "Sequences of Proteins of Immunological Interest” (1983) and by Chothia et al, J. Mol. Biol. 196:901-917 (1987), where the definitions include overlapping or subsets of amino acid residues when compared against each other.
- Kabat et al. also defined a numbering system for variable region sequences that is applicable to any antibody.
- Kabat et al. also defined a numbering system for variable region sequences that is applicable to any antibody.
- One of ordinary skill in the art can unambiguously assign this system of "Kabat numbering” to any variable region sequence, without reliance on any experimental data beyond the sequence itself.
- Kabat numbering refers to the numbering system set forth by Kabat et al, U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest” (1983). Unless otherwise specified, references to the numbering of specific amino acid residue positions in an antibody variable region are according to the Kabat numbering system.
- CDRs generally comprise the amino acid residues that form the hypervariable loops.
- CDRs also comprise "specificity determining residues,” or "SDRs,” which are residues that contact antigen. SDRs are contained within regions of the CDRs called abbreviated-CDRs, or a-CDRs.
- Exemplary a-CDRs (a-CDR-Ll, a-CDR-L2, a-CDR-L3, a- CDR-H1 , a-CDR-H2, and a-CDR-H3) occur at amino acid residues 31-34 of LI , 50-55 of L2, 89-96 of L3, 31-35B of HI, 50-58 of H2, and 95-102 of H3.
- HVR residues and other residues in the variable domain are numbered herein according to Kabat et al., supra.
- affinity matured in the context of antigen binding molecules (e.g., antibodies) refers to an antigen binding molecule that is derived from a reference antigen binding molecule, e.g., by mutation, binds to the same antigen, preferably binds to the same epitope, as the reference antibody; and has a higher affinity for the antigen than that of the reference antigen binding molecule.
- Affinity maturation generally involves modification of one or more amino acid residues in one or more CDRs of the antigen binding molecule.
- the affinity matured antigen binding molecule binds to the same epitope as the initial reference antigen binding mo lecule .
- FR Framework
- HVR hypervariable region residues
- the FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
- An "acceptor human framework” for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below.
- an acceptor human framework "derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less. In some embodiments, the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
- the term "chimeric" antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
- the "class" of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
- the heavy chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ respectively.
- a “humanized” antibody refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non- human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
- a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
- a "humanized form" of an antibody, e.g., a non-human antibody refers to an antibody that has undergone humanization.
- Other forms of "humanized antibodies” encompassed by the present invention are those in which the constant region has been additionally modified or changed from that of the original antibody to generate the properties according to the invention, especially in regard to Clq binding and/or Fc receptor (FcR) binding.
- a "human” antibody is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non- human antigen-binding residues.
- Fc domain or "Fc region” herein is used to define a C-terminal region of an antibody heavy chain that contains at least a portion of the constant region.
- the term includes native sequence Fc regions and variant Fc regions.
- An IgG Fc region comprises an IgG CH2 and an IgG CH3 domain.
- the "CH2 domain” of a human IgG Fc region usually extends from an amino acid residue at about position 231 to an amino acid residue at about position 340.
- a carbohydrate chain is attached to the CH2 domain.
- the CH2 domain herein may be a native sequence CH2 domain or variant CH2 domain.
- the "CH3 domain” comprises the stretch of residues C-terminal to a CH2 domain in an Fc region (i.e.
- the CH3 region herein may be a native sequence CH3 domain or a variant CH3 domain (e.g. a CH3 domain with an introduced "protuberance” ("knob”) in one chain thereof and a corresponding introduced “cavity” ("hole”) in the other chain thereof; see US Patent No. 5,821,333, expressly incorporated herein by reference).
- a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
- the C-terminal lysine (Lys447) of the Fc region may or may not be present.
- numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
- the "knob-into-hole" technology is described e.g. in US 5,731,168; US 7,695,936;
- the method involves introducing a protuberance ("knob”) at the interface of a first polypeptide and a corresponding cavity ("hole”) in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation.
- Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g. tyrosine or tryptophan).
- Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine).
- the protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g. by site-specific mutagenesis, or by peptide synthesis.
- a knob modification comprises the amino acid substitution T366W in one of the two subunits of the Fc domain
- the hole modification comprises the amino acid substitutions T366S, L368A and Y407V in the other one of the two subunits of the Fc domain.
- the subunit of the Fc domain comprising the knob modification additionally comprises the amino acid substitution S354C
- the subunit of the Fc domain comprising the hole modification additionally comprises the amino acid substitution Y349C. Introduction of these two cysteine residues results in the formation of a disulfide bridge between the two subunits of the Fc region, thus further stabilizing the dimer (Carter, J Immunol Methods 248, 7-15 (2001)).
- a "region equivalent to the Fc region of an immunoglobulin" is intended to include naturally occurring allelic variants of the Fc region of an immunoglobulin as well as variants having alterations which produce substitutions, additions, or deletions but which do not decrease substantially the ability of the immunoglobulin to mediate effector functions (such as antibody- dependent cellular cytotoxicity).
- one or more amino acids can be deleted from the N-terminus or C-terminus of the Fc region of an immunoglobulin without substantial loss of biological function.
- Such variants can be selected according to general rules known in the art so as to have minimal effect on activity (see, e.g., Bowie, J. U. et al, Science 247: 1306-10 (1990)).
- effector functions refers to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype.
- antibody effector functions include: Clq binding and complement dependent cytotoxicity (CDC), Fc receptor binding, antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune complex-mediated antigen uptake by antigen presenting cells, down regulation of cell surface receptors (e.g. B cell receptor), and B cell activation.
- Fc receptor binding dependent effector functions can be mediated by the interaction of the Fc-region of an antibody with Fc receptors (FcRs), which are specialized cell surface receptors on hematopoietic cells.
- Fc receptors belong to the immunoglobulin superfamily, and have been shown to mediate both the removal of antibody-coated pathogens by phagocytosis of immune complexes, and the lysis of erythrocytes and various other cellular targets (e.g. tumor cells) coated with the corresponding antibody, via antibody dependent cell mediated cytotoxicity (ADCC) (see e.g. Van de Winkel, J.G. anderson, C.L., J. Leukoc. Biol. 49 (1991) 511-524).
- ADCC antibody dependent cell mediated cytotoxicity
- FcRs are defined by their specificity for immunoglobulin isotypes: Fc receptors for IgG antibodies are referred to as FcyR. Fc receptor binding is described e.g. in Ravetch, J.V.
- FcyR Fc-region of IgG antibodies
- FcyRI binds monomeric IgG with high affinity and is expressed on macrophages, monocytes, neutrophils and eosinophils.
- Modification in the Fc-region IgG at least at one of the amino acid residues E233-G236, P238, D265, N297, A327 and P329 (numbering according to EU index of Kabat) reduce binding to FcyRI.
- FcyRII A is found on many cells involved in killing (e.g. macrophages, monocytes, neutrophils) and seems able to activate the killing process.
- FcyRIIB seems to play a role in inhibitory processes and is found on B cells, macrophages and on mast cells and eosinophils. On B-cells it seems to function to suppress further immunoglobulin production and isotype switching to, for example, the IgE class.
- FcyRIIB acts to inhibit phagocytosis as mediated through FcyRIIA.
- the B-form may help to suppress activation of these cells through IgE binding to its separate receptor.
- Reduced binding for FcyRIIA is found e.g. for antibodies comprising an IgG Fc-region with mutations at least at one of the amino acid residues E233- G236, P238, D265, N297, A327, P329, D270, Q295, A327, R292, and K414 (numbering according to EU index of Kabat).
- FcyRIII (CD 16) binds IgG with medium to low affinity and exists as two types.
- FcyRIIIA is found on NK cells, macrophages, eosinophils and some monocytes and T cells and mediates ADCC.
- Fc ⁇ RIIIB is highly expressed on neutrophils. Reduced binding to FcyRIIIA is found e.g.
- antibodies comprising an IgG Fc-region with mutation at least at one of the amino acid residues E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, S239, E269, E293, Y296, V303, A327, K338 and D376 (numbering according to EU index of Kabat).
- ADCC antibody-dependent cellular cytotoxicity
- ADCC is investigated by measuring their binding to Fey receptors expressing cells, such as cells, recombinantly expressing FcyRI and/or FcyRIIA or NK cells (expressing essentially FcyRIIIA). In particular, binding to FcyR on NK cells is measured.
- an “activating Fc receptor” is an Fc receptor that following engagement by an Fc region of an antibody elicits signaling events that stimulate the receptor-bearing cell to perform effector functions.
- Activating Fc receptors include FcyRIIIa (CD 16a), FcyRI (CD64), FcyRIIa (CD32), and FcaRI (CD89).
- a particular activating Fc receptor is human FcyRIIIa (see UniProt accession no. P08637, version 141).
- TNF receptor superfamily or "TNF receptor superfamily” currently consists of 27 receptors. It is a group of cytokine receptors characterized by the ability to bind tumor necrosis factors (TNFs) via an extracellular cysteine-rich domain (CRD). These pseudorepeats are defined by intrachain disulphides generated by highly conserved cysteine residues within the receptor chains. With the exception of nerve growth factor (NGF), all TNFs are homologous to the archetypal TNF-alpha. In their active form, the majority of TNF receptors form trimeric complexes in the plasma membrame. Accordingly, most TNF receptors contain transmembrane domains (TMDs).
- TNFs transmembrane domains
- TNF superfamily receptors that recruit caspase-interacting proteins following ligand binding to initiate the extrinsic pathway of caspase activation.
- Other TNF superfamily receptors that lack death domains bind TNF receptor-associated factors and activate intracellular signaling pathways that can lead to proliferation or differentiation. These receptors can also initiate apoptosis, but they do so via indirect mechanisms.
- TNF superfamily receptors are involved in regulating immune cell functions such as B cell homeostasis and activation, natural killer cell activation, and T cell co-stimulation.
- TNF superfamily receptors are involved in regulating immune cell functions such as B cell homeostasis and activation, natural killer cell activation, and T cell co-stimulation.
- TNF type-specific responses such as hair follicle development and osteoclast development.
- TNF receptor superfamily include the following: Tumor necrosis factor receptor 1 (1 A) (TNFRSF1A, CD120a), Tumor necrosis factor receptor 2 (IB) (TNFRSF1B, CD120b), Lymphotoxin beta receptor (LTBR, CD 18), OX40 (TNFRSF4, CD 134), CD40 (Bp50), Fas receptor (Apo-1, CD95, FAS), Decoy receptor 3 (TR6, M68, TNFRSF6B), CD27 (S152, Tp55), CD30 (Ki-1, TNFRSF8), 4- IBB (CD137, TNFRSF9), DR4 (TRAILR1, Apo-2, CD261, TNFRSF10A), DR5 (TRAILR2, CD262, TNFRSF10B), Decoy Receptor 1 (TRAILR3, CD263, TNFRSF10C), Decoy Receptor 2 (TRAILR4, CD264, TNFRSF10D), RANK (CD265,
- TNFRSF11A Osteoprotegerin
- OCIF Osteoprotegerin
- TR1, TNFRSF1 IB TWEAK receptor
- Fnl4 CD266, TNFRSF12A
- TACI CD267, TNFRSF13B
- BAFF receptor CD268, TNFRSF13C
- HVEM Herpesvirus entry mediator
- p75NTR Nerve growth factor receptor
- p75NTR B-cell maturation antigen
- B-cell maturation antigen CD269, TNFRSF17
- Glucocorticoid- induced TNFR-related GITR, AITR, CD357, TNFRSF18
- TROY TNFRSF19
- DR6 CD358, TNFRSF21
- DR3 Apo-3, TRAMP, WS-1, TNFRSF25
- Ectodysplasin A2 receptor XEDAR, EDA2R
- costimulatory TNF receptor family member or “costimulatory TNF family receptor” refers to a subgroup of TNF receptor family members, which are able to costimulate proliferation and cytokine production of T-cells.
- the term refers to any native TNF family receptor from any vertebrate source, including mammals such as primates (e.g. humans), non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- costimulatory TNF receptor family members are selected from the group consisting of OX40 (CD134), 4-1BB (CD137), CD27, HVEM (CD270), CD30, and GITR, all of which can have costimulatory effects on T cells. More particularly, the costimulatory TNF receptor family member is selected from the group consisting of OX40 and 4- IBB.
- sequences, of the TNF receptor family members may be obtained from publically accessible databases such as Uniprot (www.uniprot.org).
- the human costimulatory TNF receptors have the following amino acid sequences: human OX40 (UniProt accession no. P43489, SEQ ID NO: 100), human 4-1BB (UniProt accession no.
- OX40 refers to any native OX40 from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated.
- the term encompasses "full-length,” unprocessed OX40 as well as any form of OX40 that results from processing in the cell.
- the term also encompasses naturally occurring variants of OX40, e.g., splice variants or allelic variants.
- the amino acid sequence of an exemplary human OX40 is shown in SEQ ID NO: 100 (Uniprot P43489, version 112) and the amino acid sequence of an exemplary murine OX40 is shown in SEQ ID NO: 106 (Uniprot P47741, version 101).
- an antibody that specifically binds to OX40 refers to an antibody that is capable of binding OX40 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting OX40.
- the extent of binding of an anti-OX40 antibody to an unrelated, non- OX40 protein is less than about 10% of the binding of the antibody to OX40 as measured, e.g., by a radioimmunoassay (RIA) or flow cytometry (FACS).
- an antibody that binds to OX40 has a dissociation constant ( K D ) of ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM,
- nM ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 "6 M or less, e.g. from 10 ⁇ 68 M to 10 "13 M, e.g., from 10 ⁇ 8 M to 10 "10 M).
- 4-lBB refers to any native 4-lBB from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated.
- the term encompasses "full-length,” unprocessed 4- IBB as well as any form of 4- IBB that results from processing in the cell.
- the term also encompasses naturally occurring variants of 4-lBB, e.g., splice variants or allelic variants.
- the amino acid sequence of an exemplary human 4- IBB is shown in SEQ ID NO: 101 (Uniprot accession no.
- amino acid sequence of an exemplary murine 4- IBB is shown in SEQ ID NO: 107 (Uniprot accession no. P20334) and the amino acid sequence of an exemplary cynomolgous 4-lBB (from Macaca mulatta) is shown in SEQ ID NO: 108 (Uniprot accession no. F6W5G6).
- anti-4-lBB antibody refers to an antibody that is capable of binding 4- IBB with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting 4- IBB.
- the extent of binding of an anti-4-lBB antibody to an unrelated, non- 4-1BB protein is less than about 10% of the binding of the antibody to 4-lBB as measured, e.g., by a radioimmunoassay (RIA) or flow cytometry (FACS).
- an antibody that binds to 4- IBB has a dissociation constant ( K D ) of ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM,
- nM ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 "6 M or less, e.g. from 10 ⁇ 68 M to 10 "13 M, e.g., from 10 ⁇ 8 M to 10 ⁇ 10 M).
- peptide linker refers to a peptide comprising one or more amino acids, typically about 2 to 20 amino acids.
- Peptide linkers are known in the art or are described herein.
- Suitable, non-immunogenic linker peptides are, for example, (G 4 S) n , (SG 4 ) n or G 4 (SG 4 ) n peptide linkers, wherein "n” is generally a number between 1 and 10, typically between 1 and 4, in particular 2, i.e.
- GGGGS GGGGGGS
- GGGGSGGGGS SEQ ID NO: 110
- SGGGGSGGGG SEQ ID NO: 111
- G 4 S 3 or GGGGSGGGGSGGGGS
- GGGGGGGGGG or G4(SG4) 2 SEQ ID NO: 113
- G 4 S 4 or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 114)
- GSPGSSSSGS SEQ ID NO: 115
- GSGSGS SEQ ID NO: 116
- GSGSGNGS SEQ ID NO: 117
- GGSGSGSG SEQ ID NO: 118
- GGSGSG SEQ ID NO: 119
- GGSG SEQ ID NO: 120
- GGSGNGSG SEQ ID NO: 121
- GGNGSGSGSG SEQ ID NO:122
- GGNGSG SEQ ID NO:
- amino acid denotes the group of naturally occurring carboxy a-amino acids comprising alanine (three letter code: ala, one letter code: A), arginine (arg, R), asparagine (asn, N), aspartic acid (asp, D), cysteine (cys, C), glutamine (gin, Q), glutamic acid (glu, E), glycine (gly, G), histidine (his, H), isoleucine (ile, I), leucine (leu, L), lysine (lys, K), methionine (met, M), phenylalanine (phe, F), proline (pro, P), serine (ser, S), threonine (thr, T), tryptophan (trp, W), tyrosine (tyr, Y), and valine (val, V).
- a “fusion polypeptide” as used herein refers to a single chain polypeptide comprising a heavy chain variable domain (VH) and/or light chain variable domain (VL) of a moiety capable of specific binding to a costimulatory TNF receptor family member, fused to a trimerization domain.
- the fusion polypeptide further comprises a VH and/or VL of a moiety capable of specific binding to a target cell antigen.
- the fusion may occur by direc linking of the N- or C-terminal amino acids of the respective domains via a peptide linker.
- fused or “connected” it is meant that the components are linked by peptide bonds, either directly or via one or more peptide linkers.
- the fusion polypeptide comprises a scFv fragment capable of specific binding to a costimulatory TNF receptor family member (i.e. the VH and VL domains of a scFv fragment). In some embodiments, the fusion polypeptide comprises the VH and CHI domains of a Fab fragment capable of binding to a costimulatory TNF receptor family member. In some embodiments, the fusion polypeptide comprises the VL and CL domains of a Fab fragment capable of binding to a costimulatory TNF receptor family member. In some embodiments, the fusion polypeptide comprises a scFv fragment capable of specific binding to a target cell antigen (i.e. the VH and VL domains of a scFv fragment). In some embodiments, the fusion polypeptide comprises the VH and CHI domains of a Fab fragment capable of binding to a target cell antigen. In some embodiments, the fusion polypeptide comprises the fusion polypeptide comprises the VH and CHI domain
- polypeptide comprises the VL and CL domains of a Fab fragment capable of binding to a target cell antigen.
- trimerization domain refers to an amino acid sequence within a polypeptide that promotes self-assembly by associating with two other trimerization domains to form a trimer. The term is also use to refer to the polynucleotide encoding said amino acid sequence.
- the trimerization domain comprises an amino acid sequence able to form an alpha-helicial coiled-coil domain or an isoleucine zipper domain. Suitable trimerization domains include
- TRAF2 (UniProt accession no. Q12933, SEQ ID NO: 124), in particular amino acids 299 to 348 or amino acids 310 to 349), Thrombospondin 1 (UniProt accession no. P07996, SEQ ID NO: 124
- Matrilin-4 (UniProt accession no. 095460, SEQ ID NO: 126), in particular amino acids 594 to 618; CMP (matrilin-1) (Uniprot accession No. P21941, SEQ ID NO: l), in particular amino acids 454 to 496, and Cubilin (UniProt accession no. 060494, SEQ ID NO: 127), in particular amino acids 104 to 138.
- An exemplary isoleucine zipper domain is the engineered yeast GCN4 isoleucine variant described by Harbury et al. (1993) Science 262, 1401- 1407 comprising the amino acid sequence of SEQ ID NO: 128.
- a particular trimerization domain is "huCMP” or “CMP” or "human cartilage matrix protein", a protein that is also known as matrilin-1 or MATN1 or CRTM (UniProt accession no. P21941, SEQ ID NO: l).
- the term “huCMP trimerization domain” or “trimerization domain derived from human cartilage matrix protein (CMP)” refers to a polypeptide structure capable of associating with two similar or identical polypeptides to form a stable trimer. The trimerisation is mediated through ionic bonds and other non-covalent bonds formed between adjacent charged amino acids of the polypeptide chains.
- the huCMP trimerization domain has been described e.g. in Beck et al (1996), J.
- a huCMP trimerization domain of particular context comprises a sequence having at least 95% identity and most preferably at least 98% identity to SEQ ID NO 2.
- said trimerization domain comprises the sequence of SEQ ID NO. 2. "Percent (%) amino acid sequence identity" with respect to a reference polypeptide
- protein sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN. SAWI or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
- the ALIGN- 2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code.
- the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
- amino acid sequence variants of the trimeric antigen binding molecules are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the trimeric antigen binding molecules.
- Amino acid sequence variants of the trimeric antigen binding molecules may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the molecules, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen-binding.
- Sites of interest for substitutional mutagenesis include the HVRs and Framework (FRs). Conservative substitutions are provided in Table B under the heading "Preferred Substitutions" and further described below in reference to amino acid side chain classes (1) to (6). Amino acid substitutions may be introduced into the molecule of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC. Table B.
- Amino acids may be grouped according to common side-chain properties:
- amino acid sequence variants includes substantial variants wherein there are amino acid substitutions in one or more hypervariable region residues of a parent antigen binding molecule (e.g. a humanized or human antibody).
- a parent antigen binding molecule e.g. a humanized or human antibody.
- the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antigen binding molecule and/or will have substantially retained certain biological properties of the parent antigen binding molecule.
- An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antigen binding molecules displayed on phage and screened for a particular biological activity (e.g. binding affinity). In certain embodiments, substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antigen binding molecule to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs.
- a useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells (1989) Science, 244: 1081-1085.
- a residue or group of target residues e.g., charged residues such as Arg, Asp, His, Lys, and Glu
- a neutral or negatively charged amino acid e.g., alanine or polyalanine
- Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions.
- a crystal structure of an antigen-antigen binding molecule complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution.
- Variants may be screened to determine whether they contain the desired properties.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include the fusion to the N- or C-terminus to a polypeptide which increases the serum half-life of the trimeric antigen binding molecules.
- the trimeric antigen binding molecules provided herein are altered to increase or decrease the extent to which the antibody is glycosylated. Glycosylation variants of the molecules may be conveniently obtained by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
- the trimeric antigen binding molecules provided herein may be further modified to contain additional non-proteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the antigen binding molecule include but are not limited to water soluble polymers.
- Non- limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-l,3,6-trioxane,
- polyethylene/maleic anhydride copolymer ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof.
- Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- polynucleotide refers to an isolated nucleic acid molecule or construct, e.g. messenger RNA (mRNA), virally-derived RNA, or plasmid DNA (pDNA).
- mRNA messenger RNA
- pDNA virally-derived RNA
- a polynucleotide may comprise a conventional phosphodiester bond or a non-conventional bond (e.g. an amide bond, such as found in peptide nucleic acids (PNA).
- nucleic acid molecule refers to any one or more nucleic acid segments, e.g. DNA or RNA fragments, present in a polynucleotide.
- isolated nucleic acid molecule or polynucleotide is intended a nucleic acid molecule,
- DNA or RNA which has been removed from its native environment.
- DNA or RNA which has been removed from its native environment.
- recombinant polynucleotide encoding a polypeptide contained in a vector is considered isolated for the purposes of the present invention.
- Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in solution.
- An isolated polynucleotide includes a polynucleotide molecule contained in cells that ordinarily contain the polynucleotide molecule, but the polynucleotide molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
- Isolated RNA molecules include in vivo or in vitro RNA transcripts of the present invention, as well as positive and negative strand forms, and double-stranded forms. Isolated polynucleotides or nucleic acids according to the present invention further include such molecules produced synthetically.
- a polynucleotide or a nucleic acid may be or may include a regulatory element such as a promoter, ribosome binding site, or a transcription terminator.
- nucleic acid or polynucleotide having a nucleotide sequence at least, for example, 95% "identical" to a reference nucleotide sequence of the present invention it is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence.
- a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence.
- These alterations of the reference sequence may occur at the 5' or 3' terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
- any particular polynucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence of the present invention can be determined conventionally using known computer programs, such as the ones discussed above for polypeptides (e.g.
- expression cassette refers to a polynucleotide generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell.
- the recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment.
- the recombinant expression cassette portion of an expression vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter.
- the expression cassette of the invention comprises polynucleotide sequences that encode bispecific antigen binding molecules of the invention or fragments thereof.
- vector or "expression vector” is synonymous with "expression construct” and refers to a DNA molecule that is used to introduce and direct the expression of a specific gene to which it is operably associated in a target cell.
- the term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
- the expression vector of the present invention comprises an expression cassette. Expression vectors allow transcription of large amounts of stable mRNA. Once the expression vector is inside the target cell, the ribonucleic acid molecule or protein that is encoded by the gene is produced by the cellular transcription and/or translation machinery.
- the expression vector of the invention comprises an expression cassette that comprises polynucleotide sequences that encode bispecific antigen binding molecules of the invention or fragments thereof.
- host cell refers to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
- Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
- a host cell is any type of cellular system that can be used to generate the bispecific antigen binding molecules of the present invention.
- Host cells include cultured cells, e.g.
- mammalian cultured cells such as CHO cells, HEK cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, yeast cells, insect cells, and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.
- An "effective amount" of an agent refers to the amount that is necessary to result in a physiological change in the cell or tissue to which it is administered.
- a “therapeutically effective amount” of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
- a therapeutically effective amount of an agent for example eliminates, decreases, delays, minimizes or prevents adverse effects of a disease.
- an “individual” or “subject” is a mammal. Mammals include, but are not limited to, domesticated animals (e.g. cows, sheep, cats, dogs, and horses), primates (e.g. humans and non- human primates such as monkeys), rabbits, and rodents (e.g. mice and rats). Particularly, the individual or subject is a human. In some embodiments, an individual or subject may be a patient.
- pharmaceutical composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
- a “pharmaceutically acceptable excipient” refers to an ingredient in a pharmaceutical composition, other than an active ingredient, which is nontoxic to a subject.
- a pharmaceutically acceptable excipient includes, but is not limited to, a buffer, a stabilizer, or a preservative.
- treatment and grammatical variations thereof such as “treat” or
- treating refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect
- the molecules of the invention are used to delay development of a disease or to slow the progression of a disease.
- cancer refers to proliferative diseases, such as lymphomas, lymphocytic leukemias, lung cancer, non-small cell lung (NSCL) cancer, bronchioloalviolar cell lung cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, gastric cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, cancer of the bladder, cancer of the
- the invention provides novel trimeric antigen binding molecules with particularly advantageous properties such as producibility, stability, binding affinity, biological activity, targeting efficiency and reduced toxicity.
- the present invention provides a trimeric antigen binding molecule comprising three fusion polypeptides, each of the three fusion polypeptides comprising
- a trimeric antigen binding molecule comprising three fusion polypeptides, each of the three fusion polypeptides comprising
- a trimerization domain can be derived from a polypeptide derived from a protein selected from the group consisting of human TRAF2, human thrombospondin 1, human matrilin-4, human cartilage matrix protein (huCMP) and human cubilin. It can also be an isoleucine zipper domain, for example the peptide with the amino acid sequence of SEQ ID NO: 128.
- a trimeric antigen binding molecule of the invention comprises a trimerization domain derived from human cartilage matrix protein (huCMP) of amino acid sequence of SEQ ID NO: 1.
- the trimerization domain derived from human cartilage matrix protein (huCMP) comprises at least a part of SEQ ID NO.: 1.
- the trimerization domain comprises an amino acid sequence having at least 95% identity and most preferably at least 98% identity to SEQ ID NO:2. More particularly, the trimerization domain comprises the amino acid sequence of SEQ ID NO:2.
- the trimerization domain derived from human cartilage matrix protein (CMP) is herein further referred to as "huCMP trimerization domain”.
- the trimeric antigen binding molecule according to the present invention may associate to form trimers through disulphide bonds formed between the trimerisation domains of the fusion polypeptides.
- the trimeric antigen binding molecule comprises three fusion polypeptides, each of the three fusion polypeptides comprising a trimerization domain comprising an amino acid sequence having at least 95% identity and in particular at least 98% identity to SEQ ID NO:2. More particularly, each of the three fusion polypeptides comprises one trimerization domain comprising the amino acid sequence of SEQ ID NO:2.
- the moiety capable of specific binding to a costimulatory TNF receptor family member is selected from the group consisting of is selected from the group consisting of an antibody, an antibody fragment and a scaffold antigen binding protein.
- the moiety capable of specific binding to a costimulatory TNF receptor family member is selected from the group consisting of an antibody fragment, a Fab molecule, a crossover Fab molecule, a single chain Fab molecule, a Fv molecule, a scFv molecule, a single domain antibody, an aVH and a scaffold antigen binding protein.
- the invention provides a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member is an antibody fragment.
- the antibody fragment is selected from the group consisting of a Fab molecule, a crossover Fab molecule, a single chain Fab molecule, a Fv molecule, a scFv molecule, a single domain antibody, and aVH.
- the moiety capable of specific binding to a target cell antigen is a single chain Fab molecule.
- the moiety capable of specific binding to a target cell antigen is a single domain antibody or an aVH.
- the invention provides a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member is a scaffold antigen binding protein.
- the moiety capable of specific binding to a costimulatory TNF receptor family member can be a specifically designed ankyrin repeat protein.
- the invention is concerned with a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member is a Fab molecule capable of specific binding to a costimulatory TNF receptor family member.
- the invention provides an antigen binding molecule comprising (a) a Fab molecule capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) of amino acid sequence of SEQ ID NO: 1 , and (c) a moiety capable of specific binding to a target cell antigen.
- said Fab molecule is fused at the C-terminal amino acid of the CHI domain to the N-terminal amino acid of the trimerization domain, optionally through a peptide linker as defined herein.
- the costimulatory TNF receptor family member is selected from the group consisting of 4- IBB, OX40 and GITR. More particularly the costimulatory TNF receptor family member is selected from OX40 and 4- IBB.
- the moiety capable of specific binding to a costimulatory TNF receptor family member binds to OX40. In some embodiments, the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:3.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety comprises a VH comprising
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO:
- a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16 and SEQ ID NO: 17,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO:20, and
- a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 and SEQ ID NO:26.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises a VH comprising an amino acid sequence that is at least about 95%, 96%>, 97%, 98%>, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:27, SEQ ID NO: 29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO :37 and SEQ ID NO:39 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99%) or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:28, SEQ ID NO: 30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38 and SEQ ID NO:40.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the mo
- VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:4, CDR-H2 comprising the amino acid sequence of SEQ ID NO:6, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 8 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO : 15 , CDR-L2 comprising the amino acid sequence of SEQ ID NO : 18 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:21,
- VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:4, CDR-H2 comprising the amino acid sequence of SEQ ID NO:6, CDR-H3 comprising the amino acid sequence of SEQ ID NO:9 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO : 15 , CDR-L2 comprising the amino acid sequence of SEQ ID NO : 18 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:22,
- VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:4, CDR-H2 comprising the amino acid sequence of SEQ ID NO:6, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 10 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO: 15, CDR-L2 comprising the amino acid sequence of SEQ ID NO: 18 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:23,
- VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:5, CDR-H2 comprising the amino acid sequence of SEQ ID NO:7, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 13 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO: 16, CDR-L2 comprising the amino acid sequence of SEQ ID NO: 17 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:25, or
- VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:5, CDR-H2 comprising the amino acid sequence of SEQ ID NO:7, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 14 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO: 17, CDR-L2 comprising the amino acid sequence of SEQ ID NO: 18 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:26.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises
- VH comprising the amino acid sequence of SEQ ID NO:37 and a VL comprising the amino acid sequence of SEQ ID NO:38, or
- the moiety capable of specific binding to a costimulatory TNF receptor family member binds to 4- IBB. In some embodiments, the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:41. In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4- IBB, wherein the moiety comprises a VH comprising
- a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:44 and SEQ ID NO:45, and
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50, and a VL comprising
- a CDR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NO:51 and SEQ ID NO:52,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:53 and SEQ ID NO:54, and
- a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58 and SEQ ID NO:59.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises a VH comprising an amino acid sequence that is at least about 95%, 96%>, 97%, 98%, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66 and SEQ ID NO:68 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:61 , SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67 and SEQ ID NO:69.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises
- VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:42, CDR-H2 comprising the amino acid sequence of SEQ ID NO:44, CDR-H3 comprising the amino acid sequence of SEQ ID NO:46 and a VL comprising CDR-Ll comprising the amino acid sequence of SEQ ID NO: 51, CDR-L2 comprising the amino acid sequence of SEQ ID NO:53 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:55,
- VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:42, CDR-H2 comprising the amino acid sequence of SEQ ID NO:44, CDR-H3 comprising the amino acid sequence of SEQ ID NO:49 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO: 51, CDR-L2 comprising the amino acid sequence of SEQ ID NO:53 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:58, or
- VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:42, CDR-H2 comprising the amino acid sequence of SEQ ID NO:44, CDR-H3 comprising the amino acid sequence of SEQ ID NO:50 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO:51, CDR-L2 comprising the amino acid sequence of SEQ ID NO:53 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:59.
- the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises (i) a VH comprising the amino acid sequence of SEQ ID NO: 60 and a VL comprising the amino acid sequence of SEQ ID NO:61,
- VH comprising the amino acid sequence of SEQ ID NO: 66 and a VL comprising the amino acid sequence of SEQ ID NO:67, or
- a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein the moiety capable of specific binding to a
- costimulatory TNF receptor family member is fused at the C-terminal amino acid to the N- terminal amino acid of the trimerization domain, optionally through a peptide linker.
- the fusion can be a direct bond between the moiety capable of specific binding to a costimulatory TNF receptor family member and the trimerization domain, or the moiety capable of specific binding to a costimulatory TNF receptor family member and the trimerization domain may be connected through a peptide linker.
- the moiety capable of specific binding to a costimulatory TNF receptor family member and the trimerization domain are connected through a peptide linker.
- the peptide linker is a peptide comprising 2 to 20 amino acids.
- the peptide linker is a peptide selected from the group consisting of GGGGS (SEQ ID NO: 109), GGGGSGGGGS (SEQ ID NO: 110), SGGGGSGGGG (SEQ ID NO: 111), (G 4 S) 3 or
- GGGGSGGGGSGGGGS SEQ ID NO: l 12
- GGGGSGGGGSGGGG or G4(SG4) 2 SEQ ID NO: 113
- (G 4 S) 4 or GGGGSGGGGSGGGGSGGGGS SEQ ID NO: 114
- the sequences GSPGSSSSGS SEQ ID NO: 115
- GSGSGSGS SEQ ID NO: 116
- GSGSGNGS SEQ ID NO: 117
- GGSGSGSG SEQ ID NO: 118
- GGSGSG SEQ ID NO: 119
- GGSG SEQ ID NO: 120
- GGSGNGSG SEQ ID NO: 121
- GGNGSGSGSG SEQ ID NO: 122
- GGNGSG SEQ ID NO: 123
- the peptide linker is selected from (G4S)i or GGGGS (SEQ ID NO : 109), (G 4 S) 2 or GGGGSGGGGS (SEQ ID NO : 110), (G 4
- GGGGSGGGGSGGGGS SEQ ID NO: 112
- G 4 S 4 or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: l 14).
- the moiety capable of specific binding to a costimulatory TNF receptor family member and the huCMP trimerization domain are connected by a peptide linker of SEQ ID NO: 114.
- a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein the moiety capable of specific binding to a target cell antigen is fused at the N-terminal amino acid to the C-terminal amino acid of the trimerization domain, optionally through a peptide linker.
- the trimerization domain and the moiety capable of specific binding to a target cell antigen are connected through a peptide linker.
- the peptide linker is a peptide selected from the group consisting of GGGGS (SEQ ID NO: 109), GGGGSGGGGS (SEQ ID NO: 110), SGGGGSGGGG (SEQ ID NO: 111), (G 4 S) 3 or GGGGSGGGGSGGGGS (SEQ ID NO : 112), GGGGSGGGGSGGGG or G4(SG4) 2 (SEQ ID NO: l 13), and (G 4 S) 4 or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: l 14), but also include the sequences GSPGSSSSGS (SEQ ID NO: l 15), GSGSGS (SEQ ID NO: l 16), GSGSGNGS (SEQ ID NO: 117), GGSGSGSG (SEQ ID NO: 118), GGSGSG (SEQ ID NO: 119), GGSG (SEQ ID NO: 120), GGSGNGSG (SEQ ID NO: 121), GGNGSGSG (SEQ ID NO: 111
- the peptide linker is selected from (G4S)i or GGGGS (SEQ ID NO: 109), (G 4 S) 2 or GGGGSGGGGS (SEQ ID NO: l 10), (G 4 S) 3 or GGGGSGGGGSGGGGS (SEQ ID NO: 112) and (G 4 S) 4 or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: l 14).
- the huCMP trimerization domain and the moiety capable of specific binding to a target cell antigen are connected by a peptide linker of SEQ ID NO: 110.
- the invention provides a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein the moiety capable of specific binding to a target cell antigen is selected from the group consisting of is selected from the group consisting of an antibody, an antibody fragment and a scaffold antigen binding protein.
- the moiety capable of specific binding to a target cell antigen is selected from the group consisting of an antibody fragment, a Fab molecule, a crossover Fab molecule, a single chain Fab molecule, a Fv molecule, a scFv molecule, a single domain antibody, an aVH and a scaffold antigen binding protein.
- the invention provides a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a target cell antigen is an antibody fragment.
- the antibody fragment is selected from the group consisting of a Fab molecule, a crossover Fab molecule, a single chain Fab molecule, a Fv molecule, a scFv molecule, a single domain antibody, and aVH.
- the moiety capable of specific binding to a target cell antigen is a single chain Fab molecule.
- the moiety capable of specific binding to a target cell antigen is a single domain antibody or an aVH.
- the invention provides a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a target cell antigen is a scaffold antigen binding protein.
- the moiety capable of specific binding to a target cell antigen can be a specifically designed ankyrin repeat protein.
- the invention is concerned with a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a target cell antigen is a Fab molecule capable of specific binding to a target cell antigen.
- the invention provides an antigen binding molecule comprising (a) a moiety capable of specific binding to a
- TNF receptor family member (b) a trimerization domain derived from human cartilage matrix protein (huCMP) of amino acid sequence of SEQ ID NO: 1 , and (c) a Fab molecule capable of specific binding to a target cell antigen.
- huCMP human cartilage matrix protein
- said Fab molecule is fused at the C-terminal amino acid of the CHI domain to the N-terminal amino acid of the trimerization domain, optionally through a peptide linker as defined above.
- a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein the target cell antigen is selected from the group consisting of Fibroblast Activation Protein (FAP), Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), Carcinoembryonic Antigen (CEA), CD 19, CD20 and CD33.
- FAP Fibroblast Activation Protein
- MCSP Melanoma-associated Chondroitin Sulfate Proteoglycan
- EGFR Epidermal Growth Factor Receptor
- CEA Carcinoembryonic Antigen
- the target cell antigen is Fibroblast Activation Protein (FAP).
- FAP Fibroblast Activation Protein
- the moiety capable of specific binding to a target cell antigen binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:86.
- a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein the moiety capable of specific binding to FAP comprises
- VH comprising (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:70, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:71 and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 72, and a VL comprising (iv) CDR-L1 comprising the amino acid sequence of SEQ ID NO:73, (v) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 74 and (vi) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 75 or
- VH comprising (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:76, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 77 and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:78, and a VL comprising (iv) CDR-L1 comprising the amino acid sequence of SEQ ID NO:79, (v) CDR-L2 comprising the amino acid sequence of SEQ ID NO : 80 and (vi) CDR-L3 comprising the amino acid sequence of SEQ ID NO : 81.
- the moiety capable of specific binding to FAP comprises a VH comprising an amino acid sequence that is at least about 95%, 96%>, 97%, 98%>, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 82 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 83.
- the moiety capable of specific binding to FAP comprises a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 84 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 85.
- the moiety capable of specific binding to FAP comprises
- a VH comprising the amino acid sequence of SEQ ID NO: 82 and a VL comprising the amino acid sequence of SEQ ID NO:83
- a VH comprising the amino acid sequence of SEQ ID NO: 84 and a VL comprising the amino acid sequence of SEQ ID NO: 85.
- a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein said three fusion polypeptides are identical.
- the trimeric antigen binding molecules of the present invention are characterized by agonistic binding to a costimulatory TNF receptor family member.
- the costimulatory TNF receptor family member is selected from the group consisting of OX40 and 4- IBB.
- the invention provides a fusion polypeptide comprising (a) a VH and/or VL of a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) comprising the amino acid sequence of SEQ ID NO:2, wherein the trimerization domain is capable of mediating stable association of the fusion polypeptide with two further such fusion polypeptides and (c) a VH and/or VL of a moiety capable of specific binding to a target cell antigen.
- a fusion polypeptide comprising (a) a VH and/or VL of a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) comprising the amino acid sequence of SEQ ID NO:2, wherein the trimerization domain is capable of mediating stable association of the fusion polypeptide with two further such fusion polypeptide
- the fusion polypeptide comprises a VH of a moiety capable of specific binding to FAP, wherein the VH comprises
- a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:70 and SEQ ID NO:76,
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:71 and SEQ ID NO:77, and
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:72 and SEQ ID NO:78.
- the fusion polypeptide comprises a VH of a moiety capable of specific binding to FAP, wherein the VH comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:82 and SEQ ID NO:84.
- the fusion polypeptide comprises a VL of a moiety capable of specific binding to FAP, wherein the VL comprises
- a CDR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NO:73 and SEQ ID NO:79,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:74 and SEQ ID NO:80, and
- a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:75 and SEQ ID NO:81.
- the fusion polypeptide comprises a VL of a moiety capable of specific binding to FAP, wherein the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:83 and SEQ ID NO:85.
- the fusion polypeptide comprises a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises (i) a VH comprising the amino acid sequence of SEQ ID NO: 82 and a VL comprising the amino acid sequence of SEQ ID NO:83, or
- the fusion polypeptide comprises a VH of a moiety capable of specific binding to OX40, wherein the moiety comprises a VH comprising
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14.
- the fusion polypeptide comprises a VH of a moiety capable of specific binding to OX40, wherein the VH comprises an amino acid sequence that is at least about 95%, 96%), 97%, 98%>, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:27, SEQ ID NO: 29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37 and SEQ ID NO:39.
- the fusion polypeptide comprises a VL of a moiety capable of specific binding to OX40, wherein the moiety comprises a VL comprising
- a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16 and SEQ ID NO: 17,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO:20, and
- SEQ ID NO:21 SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 and SEQ ID NO:26.
- the fusion polypeptide comprises a VL of a moiety capable of specific binding to OX40, wherein the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:28, SEQ ID NO: 30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38 and SEQ ID NO:40.
- the fusion polypeptide comprises comprises a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises (i) a VH comprising the amino acid sequence of SEQ ID NO:27 and a VL comprising the amino acid sequence of SEQ ID NO:28,
- VH comprising the amino acid sequence of SEQ ID NO:37 and a VL comprising the amino acid sequence of SEQ ID NO:38, or
- the present invention provides a fusion polypeptide comprising, or consisting of, the amino acid selected from the group consisting of SEQ ID NO:227, 229, 231, 233, 235 and 237.
- the fusion polypeptide comprises a VH of a moiety capable of specific binding to 4-1BB, wherein the moiety comprises a VH comprising
- a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:44 and SEQ ID NO:45, and
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50.
- the fusion polypeptide comprises a VH of a moiety capable of specific binding to 4-1BB, wherein the VH comprises an amino acid sequence that is at least about 95%, 96%o, 97%, 98%>, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66 and SEQ ID NO:68.
- the fusion polypeptide comprises a VL of a moiety capable of specific binding to 4-1BB, wherein the moiety comprises a VL comprising
- a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:51 and SEQ ID NO:52
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:53 and SEQ ID NO:54
- the fusion polypeptide comprises a VL of a moiety capable of specific binding to 4-1BB, wherein the VL comprises an amino acid sequence that is at least about 95%, 96%o, 97%, 98%>, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67 and SEQ ID NO:69.
- the fusion polypeptide comprises comprises a moiety capable of specific binding to 4- IBB, wherein the moiety capable of specific binding to 4- IBB comprises
- VH comprising the amino acid sequence of SEQ ID NO: 66 and a VL comprising the amino acid sequence of SEQ ID NO:67, or
- the present invention provides a fusion polypeptide comprising, or consisting of, the amino acid selected from the group consisting of SEQ ID NO:246, 248, 250 and 252.
- the invention further provides isolated polynucleotides encoding a trimeric antigen binding molecule of the invention as described herein, or a fragment thereof.
- the isolated polynucleotides encoding trimeric antigen binding molecules of the invention may be expressed as a single polynucleotide that encodes the entire antigen binding molecule or as multiple (e.g., two or more) polynucleotides that are co-expressed.
- Polypeptides encoded by polynucleotides that are co-expressed may associate through, e.g., disulfide bonds or other means to form a functional trimeric antigen binding molecule.
- the light chain portion of a moiety capable of specific binding to a target cell antigen may be encoded by a separate polynucleotide from the heavy chain portion of the capable of specific binding to a target cell antigen. When co-expressed, the heavy chain polypeptides will associate with the light chain polypeptides to form the moiety capable of specific binding to a target cell antigen.
- the light chain portion of a moiety capable of specific binding to a costimulatory TNF receptor family member may be encoded by a separate polynucleotide from the heavy chain portion of the capable of specific binding to a costimulatory TNF receptor family member.
- the heavy chain polypeptides When co-expressed, the heavy chain polypeptides will associate with the light chain polypeptides to form the moiety capable of specific binding to a costimulatory TNF receptor family member.
- the invention relates to an isolated polynucleotide encoding a fusion polypeptide of the present invention as described herein.
- the present invention provides a polynucleotide encoding a fusion polypeptide comprising, or consisting of, the amino acid selected from the group consisting of SEQ ID NO:227, 229, 231, 233, 235 and 237. More particularly, provided is a polynucleotide comprising, or consisting of, the sequence selected from the group consisting of SEQ ID NO:215, 217, 219, 221 , 223 and 225.
- the present invention provides a polynucleotide encoding a fusion polypeptide comprising, or consisting of, the amino acid selected from the group consisting of SEQ ID NO: 246, 248, 250 and 252. More particularly, provided is a
- RNA for example, in the form of messenger R A (mR A).
- RNA of the present invention may be single stranded or double stranded.
- an isolated polynucleotide encoding a trimeric antigen binding molecule as defined herein before or a fusion polypeptide as described herein before.
- the invention further provides a vector, particularly an expression vector, comprising the isolated polynucleotide of the invention and a host cell comprising the isolated polynucleotide or the vector of the invention.
- the host cell is a eukaryotic cell, particularly a mammalian cell.
- a method for producing the trimeric antigen binding molecule of the invention comprising the steps of (i) culturing the host cell of the invention under conditions suitable for expression of said antigen binding molecule, and (ii) isolating said trimeric antigen binding molecule.
- the invention also encompasses a trimeric antigen binding molecule produced by the method of the invention.
- Trimeric antigen binding molecules of the invention may be obtained, for example, by solid-state peptide synthesis (e.g. Merrifield solid phase synthesis) or recombinant production.
- solid-state peptide synthesis e.g. Merrifield solid phase synthesis
- polynucleotide encoding the antigen binding molecule or polypeptide fragments thereof, e.g., as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
- Such polynucleotide may be readily isolated and sequenced using conventional procedures.
- a vector, preferably an expression vector, comprising one or more of the polynucleotides of the invention is provided.
- the expression vector can be part of a plasmid, virus, or may be a nucleic acid fragment.
- the expression vector includes an expression cassette into which the polynucleotide encoding the trimeric antigen binding molecule or polypeptide fragments thereof (i.e. the coding region) is cloned in operable association with a promoter and/or other transcription or translation control elements.
- a "coding region" is a portion of nucleic acid which consists of codons translated into amino acids.
- a "stop codon" (TAG, TGA, or TAA) is not translated into an amino acid, it may be considered to be part of a coding region, if present, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, 5' and 3' untranslated regions, and the like, are not part of a coding region.
- Two or more coding regions can be present in a single polynucleotide construct, e.g. on a single vector, or in separate polynucleotide constructs, e.g. on separate (different) vectors.
- any vector may contain a single coding region, or may comprise two or more coding regions, e.g.
- a vector of the present invention may encode one or more polypeptides, which are post- or co-translationally separated into the final proteins via proteolytic cleavage.
- a vector, polynucleotide, or nucleic acid of the invention may encode heterologous coding regions, either fused or unfused to a polynucleotide encoding the trimeric antigen binding molecule of the invention or polypeptide fragments thereof, or variants or derivatives thereof.
- Heterologous coding regions include without limitation specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain. An operable association is when a coding region for a gene product, e.g.
- a polypeptide is associated with one or more regulatory sequences in such a way as to place expression of the gene product under the influence or control of the regulatory sequence(s).
- Two DNA fragments (such as a polypeptide coding region and a promoter associated therewith) are "operably associated” if induction of promoter function results in the transcription of mRNA encoding the desired gene product and if the nature of the linkage between the two DNA fragments does not interfere with the ability of the expression regulatory sequences to direct the expression of the gene product or interfere with the ability of the DNA template to be transcribed.
- a promoter region would be operably associated with a nucleic acid encoding a polypeptide if the promoter was capable of effecting transcription of that nucleic acid.
- the promoter may be a cell-specific promoter that directs substantial transcription of the DNA only in predetermined cells.
- Other transcription control elements besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can be operably associated with the polynucleotide to direct cell-specific transcription.
- transcription control regions which function in vertebrate cells, such as, but not limited to, promoter and enhancer segments from cytomegaloviruses (e.g. the immediate early promoter, in conjunction with intron-A), simian virus 40 (e.g. the early promoter), and retroviruses (such as, e.g. Rous sarcoma virus).
- transcription control regions include those derived from vertebrate genes such as actin, heat shock protein, bovine growth hormone and rabbit a-globin, as well as other sequences capable of controlling gene expression in eukaryotic cells.
- tissue-specific promoters and enhancers as well as inducible promoters (e.g. promoters inducible tetracyclins).
- inducible promoters e.g. promoters inducible tetracyclins
- translation control elements include, but are not limited to ribosome binding sites, translation initiation and termination codons, and elements derived from viral systems (particularly an internal ribosome entry site, or IRES, also referred to as a CITE sequence).
- the expression cassette may also include other features such as an origin of replication, and/or chromosome integration elements such as retroviral long terminal repeats (LTRs), or adeno-associated viral (AAV) inverted terminal repeats (ITRs).
- LTRs retroviral long terminal repeats
- AAV adeno-associated viral inverted terminal repeats
- Polynucleotide and nucleic acid coding regions of the present invention may be associated with additional coding regions which encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide of the present invention.
- additional coding regions which encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide of the present invention.
- DNA encoding a signal sequence may be placed upstream of the nucleic acid encoding a trimeric antigen binding molecule of the invention or polypeptide fragments thereof.
- proteins secreted by mammalian cells have a signal peptide or secretory leader sequence which is cleaved from the mature protein once export of the growing protein chain across the rough endoplasmic reticulum has been initiated.
- polypeptides secreted by vertebrate cells generally have a signal peptide fused to the N-terminus of the polypeptide, which is cleaved from the translated polypeptide to produce a secreted or "mature" form of the polypeptide.
- the native signal peptide e.g.
- an immunoglobulin heavy chain or light chain signal peptide is used, or a functional derivative of that sequence that retains the ability to direct the secretion of the polypeptide that is operably associated with it.
- a heterologous mammalian signal peptide, or a functional derivative thereof may be used.
- the wild-type leader sequence may be substituted with the leader sequence of human tissue plasminogen activator (TP A) or mouse ⁇ - glucuronidase.
- TP A tissue plasminogen activator
- fusion protein e.g. a histidine tag
- assist in labeling the fusion protein may be included within or at the ends of the polynucleotide encoding a trimeric antigen binding molecule of the invention or polypeptide fragments thereof.
- a host cell comprising one or more polynucleotides of the invention.
- a host cell comprising one or more vectors of the invention.
- the polynucleotides and vectors may incorporate any of the features, singly or in combination, described herein in relation to polynucleotides and vectors, respectively.
- a host cell comprises (e.g. has been transformed or transfected with) a vector comprising a polynucleotide that encodes (part of) a trimeric antigen binding molecule of the invention.
- the term "host cell" refers to any kind of cellular system which can be engineered to generate the fusion proteins of the invention or fragments thereof.
- Host cells suitable for replicating and for supporting expression of antigen binding molecules are well known in the art. Such cells may be transfected or transduced as appropriate with the particular expression vector and large quantities of vector containing cells can be grown for seeding large scale fermenters to obtain sufficient quantities of the antigen binding molecule for clinical applications.
- Suitable host cells include prokaryotic microorganisms, such as E. coli, or various eukaryotic cells, such as Chinese hamster ovary cells (CHO), human embryonic kidney (HEK) cells, insect cells, or the like.
- prokaryotic microorganisms such as E. coli
- various eukaryotic cells such as Chinese hamster ovary cells (CHO), human embryonic kidney (HEK) cells, insect cells, or the like.
- polypeptides may be produced in bacteria in particular when glycosylation is not needed. After expression, the polypeptide may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for polypeptide-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been "humanized", resulting in the production of a polypeptide with a partially or fully human glycosylation pattern.
- fungi and yeast strains whose glycosylation pathways have been "humanized", resulting in the production of a polypeptide with a partially or fully human glycosylation pattern.
- Suitable host cells for the expression of (glycosylated) polypeptides are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells.
- baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells. Plant cell cultures can also be utilized as hosts. See e.g. US Patent Nos. 5,959,177, 6,040,498,
- Vertebrate cells may also be used as hosts.
- Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- TM4 cells as described, e.g., in Mather, Biol Reprod 23, 243-251 (1980)
- monkey kidney cells CV1
- African green monkey kidney cells VERO-76
- human cervical carcinoma cells HELA
- canine kidney cells MDCK
- buffalo rat liver cells BBL 3A
- human lung cells W138
- human liver cells Hep G2
- mouse mammary tumor cells MMT 060562
- TRI cells as described, e.g., in Mather et al, Annals N.Y.
- MRC 5 cells MRC 5 cells
- FS4 cells Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including dhfr- CHO cells (Urlaub et al, Proc Natl Acad Sci USA 77, 4216 (1980)); and myeloma cell lines such as YO, NS0, P3X63 and Sp2/0.
- CHO Chinese hamster ovary
- dhfr- CHO cells Urlaub et al, Proc Natl Acad Sci USA 77, 4216 (1980)
- myeloma cell lines such as YO, NS0, P3X63 and Sp2/0.
- Host cells include cultured cells, e.g., mammalian cultured cells, yeast cells, insect cells, bacterial cells and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.
- the host cell is a eukaryotic cell, preferably a mammalian cell, such as a Chinese Hamster Ovary (CHO) cell, a human embryonic kidney (HEK) cell or a lymphoid cell (e.g., Y0, NS0, Sp20 cell). Standard technologies are known in the art to express foreign genes in these systems.
- Cells expressing a polypeptide comprising either the heavy or the light chain of an antigen binding domain may be engineered so as to also express the other of the
- immunoglobulin chains such that the expressed product is an antigen binding domain that has both a heavy and a light chain.
- a method for producing the trimeric antigen binding molecule of the invention comprising the steps of (i) culturing the host cell of the invention under conditions suitable for expression of said antigen binding molecule, and (ii) isolating said trimeric antigen binding molecule form the host cell or host cell culture medium.
- the components of the trimeric antigen binding molecule are genetically fused to each other.
- Trimeric antigen binding molecules can be designed such that its components are fused directly to each other or indirectly through a linker sequence.
- the composition and length of the linker may be determined in accordance with methods well known in the art and may be tested for efficacy. Examples of linker sequences between different components of trimeric antigen binding molecules are found in the sequences provided herein. Additional sequences may also be included to incorporate a cleavage site to separate the individual components of the fusion if desired, for example an endopeptidase recognition sequence.
- the moieties capable of specific binding to a target cell antigen (e.g. Fab fragments or scFv) forming part of the antigen binding molecule comprise at least an immunoglobulin variable region capable of binding to a target cell antigen.
- the moieties capable of specific binding to a costimulatory TNF receptor family member (e.g. Fab fragments or scFv) forming part of the antigen binding molecule comprise at least an immunoglobulin variable region capable of binding to a costimulatory TNF receptor family member.
- Variable regions can form part of and be derived from naturally or non-naturally occurring antibodies and fragments thereof.
- Non-naturally occurring antibodies can be constructed using solid phase-peptide synthesis, can be produced recombinantly (e.g. as described in U.S. patent No. 4,186,567) or can be obtained, for example, by screening
- any animal species of immunoglobulin can be used in the invention.
- Non-limiting immunoglobulins useful in the present invention can be of murine, primate, or human origin. If the fusion protein is intended for human use, a chimeric form of immunoglobulin may be used wherein the constant regions of the immunoglobulin are from a human.
- a humanized or fully human form of the immunoglobulin can also be prepared in accordance with methods well known in the art (see e. g. U.S. Patent No. 5,565,332 to Winter).
- Humanization may be achieved by various methods including, but not limited to (a) grafting the non-human (e.g., donor antibody) CDRs onto human (e.g. recipient antibody) framework and constant regions with or without retention of critical framework residues (e.g. those that are important for retaining good antigen binding affinity or antibody functions), (b) grafting only the non-human specificity-determining regions (SDRs or a-CDRs; the residues critical for the antibody-antigen interaction) onto human framework and constant regions, or (c) transplanting the entire non-human variable domains, but "cloaking" them with a human-like section by replacement of surface residues.
- a grafting the non-human (e.g., donor antibody) CDRs onto human (e.g. recipient antibody) framework and constant regions with or without retention of critical framework residues (e.g. those that are important for retaining good antigen binding affinity or antibody functions)
- SDRs or a-CDRs the residues critical for the antibody-antigen interaction
- Particular immunoglobulins according to the invention are human immunoglobulins.
- Human antibodies and human variable regions can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr Opin Pharmacol 5, 368-74 (2001) and Lonberg, Curr Opin Immunol 20, 450-459 (2008). Human variable regions can form part of and be derived from human monoclonal antibodies made by the hybridoma method (see e.g. Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)).
- Human antibodies and human variable regions may also be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge (see e.g. Lonberg, Nat Biotech 23, 1117-1125 (2005). Human antibodies and human variable regions may also be generated by isolating Fv clone variable region sequences selected from human-derived phage display libraries (see e.g., Hoogenboom et al.
- Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
- the moieties capable of specific binding to the relevant target e.g. Fab fragments or scFv
- the moieties capable of specific binding to the relevant target are engineered to have enhanced binding affinity according to, for example, the methods disclosed in PCT publication WO 2012/020006 (see Examples relating to affinity maturation) or U.S. Pat. Appl. Publ. No. 2004/0132066.
- the ability of the antigen binding molecules of the invention to bind to a specific antigenic determinant can be measured either through an enzyme-linked immunosorbent assay (ELISA) or other techniques familiar to one of skill in the art, e.g.
- ELISA enzyme-linked immunosorbent assay
- Competition assays may be used to identify an antigen binding molecule that competes with a reference antibody for binding to a particular antigen.
- a competing antigen binding molecule binds to the same epitope (e.g. a linear or a conformational epitope) that is bound by the reference antigen binding molecule.
- epitope e.g. a linear or a conformational epitope
- immobilized antigen is incubated in a solution comprising a first labeled antigen binding molecule that binds to the antigen and a second unlabeled antigen binding molecule that is being tested for its ability to compete with the first antigen binding molecule for binding to the antigen.
- the second antigen binding molecule may be present in a hybridoma supernatant.
- immobilized antigen is incubated in a solution comprising the first labeled antigen binding molecule but not the second unlabeled antigen binding molecule.
- Trimeric antigen binding molecules of the invention prepared as described herein may be purified by art-known techniques such as high performance liquid chromatography, ion exchange chromatography, gel electrophoresis, affinity chromatography, size exclusion chromatography, and the like.
- the actual conditions used to purify a particular protein will depend, in part, on factors such as net charge, hydrophobicity, hydrophilicity etc., and will be apparent to those having skill in the art.
- affinity chromatography purification an antibody, ligand, receptor or antigen can be used to which the trimeric antigen binding molecule binds.
- a matrix with protein A or protein G may be used.
- Sequential Protein A or G affinity chromatography and size exclusion chromatography can be used to isolate an antigen binding molecule essentially as described in the Examples.
- the purity of the trimeric antigen binding molecule or fragments thereof can be determined by any of a variety of well-known analytical methods including gel electrophoresis, high pressure liquid chromatography, and the like.
- the trimeric antigen binding molecule expressed as described in the Examples were shown to be intact and properly assembled as demonstrated by reducing and non-reducing SDS-PAGE.
- the invention also encompasses a trimeric antigen binding molecule produced by the methods of the invention.
- the trimeric antigen binding molecules provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art. 1. Affinity assays
- the affinity of the trimeric antigen binding molecule provided herein for the corresponding TNF receptor can be determined in accordance with the methods set forth in the Examples by surface plasmon resonance (SPR), using standard instrumentation such as a BIAcore instrument (GE Healthcare), and receptors or target proteins such as may be obtained by recombinant expression.
- the affinity of the trimeric antigen binding molecule for the target cell antigen can also be determined by surface plasmon resonance (SPR), using standard instrumentation such as a BIAcore instrument (GE Healthcare), and receptors or target proteins such as may be obtained by recombinant expression.
- SPR surface plasmon resonance
- a specific illustrative and exemplary embodiment for measuring binding affinity is described in Example 4.1.
- K D is measured by surface plasmon resonance using a BIACORE® T200 machine (GE Healthcare) at 25 °C.
- Binding of the trimeric antigen binding molecule provided herein to the corresponding receptor expressing cells may be evaluated using cell lines expressing the particular receptor or target antigen, for example by flow cytometry (FACS).
- FACS flow cytometry
- PBMCs peripheral blood mononuclear cells
- activated mouse splenocytes expressing the TNF receptor molecule
- cancer cell lines expressing the target cell antigen were used to demonstrate the binding of the antigen binding molecules to the target cell antigen.
- competition assays may be used to identify an antigen binding molecule that competes with a specific antibody or antigen binding molecule for binding to the target or TNF receptor, respectively.
- a competing antigen binding molecule binds to the same epitope (e.g., a linear or a conformational epitope) that is bound by a specific anti-target antibody or a specific anti-TNF receptor antibody.
- epitope e.g., a linear or a conformational epitope
- Detailed exemplary methods for mapping an epitope to which an antibody binds are provided in Morris (1996) "Epitope Mapping Protocols," in Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ).
- assays are provided for identifying trimeric antigen binding molecules that bind to a specific target cell antigen and to a specific TNF receptor having biological activity.
- Biological activity may include, e.g., agonistic signalling through the TNF receptor on cells expressing the TNF receptor.
- Trimeric antigen binding molecules identified by the assays as having such biological activity in vitro are also provided.
- a reporter cell assay detecting NF- ⁇ activation in Hela cells expressing human 4- IBB or human OX40 and co- cultured with FAP-expressing tumor cells is provided (see e.g. Example 5.1).
- trimeric antigen binding molecules of the invention are tested for such biological activity.
- Assays for detecting the biological activity of the molecules of the invention are those described in Example 5 or Example 8.
- the biological activity of such complexes can be assessed by evaluating their effects on survival, proliferation and lymphokine secretion of various lymphocyte subsets such as NK cells, NKT-cells or ⁇ T-cells or assessing their capacity to modulate phenotype and function of antigen presenting cells such as dendritic cells, monocytes/macrophages or B-cells.
- the invention provides pharmaceutical compositions comprising any of the trimeric antigen binding molecules provided herein, e.g., for use in any of the below therapeutic methods.
- a pharmaceutical composition comprises a trimeric antigen binding molecule and at least one pharmaceutically acceptable excipient.
- a pharmaceutical composition comprises any of the trimeric antigen binding molecules provided herein and at least one additional therapeutic agent, e.g., as described below.
- pharmaceutically acceptable excipient refers to molecular entities and compositions that are generally non-toxic to recipients at the dosages and concentrations employed, i.e. do not produce an adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate.
- pharmaceutical composition that contains at least one trimeric antigen binding molecule and optionally an additional active ingredient will be known to those of skill in the art in light of the present disclosure, as exemplified by Remington's
- compositions are lyophilized formulations or aqueous solutions.
- pharmaceutically acceptable excipient includes any and all solvents, buffers, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g. antibacterial agents, antifungal agents), isotonic agents, salts, stabilizers and combinations thereof, as would be known to one of ordinary skill in the art.
- Parenteral compositions include those designed for administration by injection, e.g.
- the trimeric antigen binding molecules of the invention may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, Ringer's solution, or physiological saline buffer.
- the solution may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the fusion proteins may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- Sterile injectable solutions are prepared by incorporating the fusion proteins or trimeric antigen binding molecules of the invention in the required amount in the appropriate solvent with various of the other ingredients enumerated below, as required.
- Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and/or the other ingredients.
- the preferred methods of preparation are vacuum-drying or freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile- filtered liquid medium thereof.
- the liquid medium should be suitably buffered if necessary and the liquid diluent first rendered isotonic prior to injection with sufficient saline or glucose.
- composition must be stable under the conditions of manufacture and storage, and preserved against the contaminating action of microorganisms, such as bacteria and fungi. It will be appreciated that endotoxin contamination should be kept minimally at a safe level, for example, less that 0.5 ng/mg protein.
- Suitable pharmaceutically acceptable excipients include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monos
- Aqueous injection suspensions may contain compounds which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, dextran, or the like.
- the suspension may also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
- suspensions of the active compounds may be prepared as appropriate oily injection suspensions.
- Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl cleats or triglycerides, or liposomes.
- Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano- particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences (18th Ed. Mack Printing Company, 1990).
- Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the polypeptide, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
- sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the polypeptide, which matrices are in the form of shaped articles, e.g.
- prolonged absorption of an injectable composition can be brought about by the use in the compositions of agents delaying absorption, such as, for example, aluminum monostearate, gelatin or combinations thereof.
- Exemplary pharmaceutically acceptable excipients herein further include insterstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20 (HYLENEX®, Baxter International, Inc.).
- sHASEGP soluble neutral-active hyaluronidase glycoproteins
- rHuPH20 HYLENEX®, Baxter International, Inc.
- Certain exemplary sHASEGPs and methods of use, including rHuPH20 are described in US Patent Publication Nos. 2005/0260186 and 2006/0104968.
- a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.
- Exemplary lyophilized antibody formulations are described in US Patent No. 6,267,958.
- Aqueous antibody formulations include those described in US Patent No. 6,171,586 and
- the trimeric antigen binding molecules may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by
- the trimeric antigen binding molecules may be formulated with suitable polymeric or hydrophobic materials (for example as emulsion in a pharmaceutically acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
- suitable polymeric or hydrophobic materials for example as emulsion in a pharmaceutically acceptable oil
- ion exchange resins for example, as a sparingly soluble salt.
- Pharmaceutical compositions comprising the trimeric antigen binding molecules of the invention may be manufactured by means of conventional mixing, dissolving, emulsifying, encapsulating, entrapping or lyophilizing processes.
- Pharmaceutical compositions may be formulated in conventional manner using one or more physiologically acceptable carriers, diluents, excipients or auxiliaries which facilitate processing of the proteins into preparations that can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
- the trimeric antigen binding molecules may be formulated into a composition in a free acid or base, neutral or salt form.
- Pharmaceutically acceptable salts are salts that substantially retain the biological activity of the free acid or base. These include the acid addition salts, e.g. those formed with the free amino groups of a proteinaceous composition, or which are formed with inorganic acids such as for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric or mandelic acid. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as for example, sodium, potassium, ammonium, calcium or ferric hydroxides; or such organic bases as isopropylamine, trimethylamine, histidine or procaine. Pharmaceutical salts tend to be more soluble in aqueous and other protic solvents than are the corresponding free base forms.
- the pharmaceutical compositions may also contain more than one active ingredients as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. Such active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
- the pharmaceutical composition comprises a trimeric antigen binding molecule and another active anti-cancer agent.
- the formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
- any of the trimeric antigen binding molecules provided herein may be used in therapeutic methods.
- the antigen binding molecules of the invention can be formulated, dosed, and administered in a fashion consistent with good medical practice.
- Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
- the trimeric antigen binding molecules of the invention are provided for use as a medicament. In further aspects, the trimeric antigen binding molecules of the invention are provided for use in treating a disease, in particular for use in the treatment of cancer. In certain embodiments, the trimeric costimulatory antigen binding molecules of the invention are provided for use in a method of treatment. In one embodiment, the invention provides a trimeric antigen binding molecule as described herein for use in the treatment of a disease in an individual in need thereof. In certain embodiments, the invention provides a trimeric antigen binding molecule for use in a method of treating an individual having a disease comprising administering to the individual a therapeutically effective amount of the trimeric antigen binding molecule. In certain embodiments the disease to be treated is cancer.
- the disease to be treated is a proliferative disorder, particularly cancer.
- cancers include bladder cancer, brain cancer, head and neck cancer, pancreatic cancer, lung cancer, breast cancer, ovarian cancer, uterine cancer, cervical cancer, endometrial cancer, esophageal cancer, colon cancer, colorectal cancer, rectal cancer, gastric cancer, prostate cancer, blood cancer, skin cancer, squamous cell carcinoma, bone cancer, and kidney cancer.
- neoplasms located in the: abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic region, and urogenital system. Also included are pre-cancerous conditions or lesions and cancer metastases.
- the cancer is chosen from the group consisting of renal cell cancer, skin cancer, lung cancer, colorectal cancer, breast cancer, brain cancer, head and neck cancer.
- the subject, patient, or "individual” in need of treatment is typically a mammal, more specifically a human.
- the trimeric antigen binding molecule of the invention or the pharmaceutical composition of the invention, for use in up-regulating or prolonging cytotoxic T cell activity.
- the invention provides for the use of a trimeric antigen binding molecule of the invention in the manufacture or preparation of a medicament for the treatment of a disease in an individual in need thereof.
- the medicament is for use in a method of treating a disease comprising administering to an individual having the disease a therapeutically effective amount of the medicament.
- the disease to be treated is a proliferative disorder, particularly cancer.
- cancers include bladder cancer, brain cancer, head and neck cancer, pancreatic cancer, lung cancer, breast cancer, ovarian cancer, uterine cancer, cervical cancer, endometrial cancer, esophageal cancer, colon cancer, colorectal cancer, rectal cancer, gastric cancer, prostate cancer, blood cancer, skin cancer, squamous cell carcinoma, bone cancer, and kidney cancer.
- neoplasms located in the: abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic region, and urogenital system. Also included are pre-cancerous conditions or lesions and cancer metastases.
- the cancer is chosen from the group consisting of renal cell cancer, skin cancer, lung cancer, colorectal cancer, breast cancer, brain cancer, head and neck cancer.
- the trimeric antigen binding molecule may not provide a cure but may only provide partial benefit.
- a physiological change having some benefit is also considered therapeutically beneficial.
- an amount of trimeric antigen binding molecule that provides a physiological change is considered an "effective amount" or a "therapeutically effective amount”.
- the individual is preferably a mammal, particularly a human.
- the invention provides a method for treating a disease in an individual, comprising administering to said individual a therapeutically effective amount of a trimeric antigen binding molecule of the invention.
- a composition is administered to said individual, comprising a fusion protein of the invention in a pharmaceutically acceptable form.
- the disease to be treated is a proliferative disorder.
- the disease is cancer.
- the method further comprises administering to the individual a therapeutically effective amount of at least one additional therapeutic agent, e.g. an anti-cancer agent if the disease to be treated is cancer.
- An "individual" according to any of the above embodiments may be a mammal, preferably a human.
- the appropriate dosage of a trimeric antigen binding molecule of the invention (when used alone or in combination with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the route of administration, the body weight of the patient, the type of fusion protein, the severity and course of the disease, whether the fusion protein is administered for preventive or therapeutic purposes, previous or concurrent therapeutic interventions, the patient's clinical history and response to the fusion protein, and the discretion of the attending physician.
- the practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject.
- Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
- the trimeric antigen binding molecule is suitably administered to the patient at one time or over a series of treatments.
- about 1 ⁇ g/kg to 15 mg/kg (e.g. 0.1 mg/kg - 10 mg/kg) of the antigen binding molecule can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
- One typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above.
- the treatment would generally be sustained until a desired suppression of disease symptoms occurs.
- One exemplary dosage of the fusion protein would be in the range from about 0.005 mg/kg to about 10 mg/kg.
- a dose may also comprise from about 1 ⁇ g/kg body weight, about 5 ⁇ g/kg body weight, about 10 ⁇ g/kg body weight, about 50 ⁇ g/kg body weight, about 100 ⁇ g/kg body weight, about 200 ⁇ g/kg body weight, about 350 ⁇ g/kg body weight, about 500 ⁇ g/kg body weight, about 1 mg/kg body weight, about 5 mg/kg body weight, about 10 mg/kg body weight, about 50 mg/kg body weight, about 100 mg/kg body weight, about 200 mg/kg body weight, about 350 mg/kg body weight, about 500 mg/kg body weight, to about 1000 mg/kg body weight or more per administration, and any range derivable therein.
- a range of about 5 mg/kg body weight to about 100 mg/kg body weight, about 5 ⁇ g/kg body weight to about 500 mg/kg body weight etc. can be administered, based on the numbers described above.
- one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 5.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the patient.
- Such doses may be administered intermittently, e.g. every week or every three weeks (e.g. such that the patient receives from about two to about twenty, or e.g. about six doses of the trimeric antigen binding molecule).
- An initial higher loading dose, followed by one or more lower doses may be administered.
- other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
- the trimeric antigen binding molecule of the invention will generally be used in an amount effective to achieve the intended purpose.
- the trimeric antigen binding molecules of the invention, or pharmaceutical compositions thereof are administered or applied in a therapeutically effective amount. Determination of a therapeutically effective amount is well within the capabilities of those skilled in the art, especially in light of the detailed disclosure provided herein.
- a therapeutically effective dose can be estimated initially from in vitro assays, such as cell culture assays.
- a dose can then be formulated in animal models to achieve a circulating concentration range that includes the IC 50 as determined in cell culture. Such information can be used to more accurately determine useful doses in humans.
- Initial dosages can also be estimated from in vivo data, e.g., animal models, using techniques that are well known in the art. One having ordinary skill in the art could readily optimize administration to humans based on animal data.
- Dosage amount and interval may be adjusted individually to provide plasma levels of the trimeric antigen binding molecules which are sufficient to maintain therapeutic effect.
- Usual patient dosages for administration by injection range from about 0.1 to 50 mg/kg/day, typically from about 0.5 to 1 mg/kg/day.
- Therapeutically effective plasma levels may be achieved by administering multiple doses each day. Levels in plasma may be measured, for example, by HPLC.
- the effective local concentration of the trimeric antigen binding molecules may not be related to plasma concentration.
- One skilled in the art will be able to optimize therapeutically effective local dosages without undue
- a therapeutically effective dose of the trimeric antigen binding molecules described herein will generally provide therapeutic benefit without causing substantial toxicity.
- Toxicity and therapeutic efficacy of a fusion protein can be determined by standard pharmaceutical
- Cell culture assays and animal studies can be used to determine the LD 50 (the dose lethal to 50% of a population) and the ED 50 (the dose therapeutically effective in 50% of a population).
- the dose ratio between toxic and therapeutic effects is the therapeutic index, which can be expressed as the ratio LD 50 /ED 50 .
- Trimeric antigen binding molecules that exhibit large therapeutic indices are preferred.
- the trimeric antigen binding molecule according to the present invention exhibits a high therapeutic index.
- the data obtained from cell culture assays and animal studies can be used in formulating a range of dosages suitable for use in humans. The dosage lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
- the dosage may vary within this range depending upon a variety of factors, e.g., the dosage form employed, the route of administration utilized, the condition of the subject, and the like.
- the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition (see, e.g., Fingl et al, 1975, in: The Pharmacological Basis of Therapeutics, Ch. 1, p. 1, incorporated herein by reference in its entirety).
- the attending physician for patients treated with the trimeric antigen binding molecules of the invention will know how and when to terminate, interrupt, or adjust administration due to toxicity, organ dysfunction, and the like. Conversely, the attending physician would also know to adjust treatment to higher levels if the clinical response were not adequate (precluding toxicity).
- the magnitude of an administered dose in the management of the disorder of interest will vary with the severity of the condition to be treated, with the route of administration, and the like. The severity of the condition may, for example, be evaluated, in part, by standard prognostic evaluation methods. Further, the dose and perhaps dose frequency will also vary according to the age, body weight, and response of the individual patient.
- the trimeric antigen binding molecules of the invention may be administered in any order.
- a fusion protein of the invention may be co-administered with at least one additional therapeutic agent.
- therapeutic agent encompasses any agent that can be administered for treating a symptom or disease in an individual in need of such treatment.
- additional therapeutic agent may comprise any active ingredients suitable for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- an additional therapeutic agent is another anti-cancer agent.
- Such other agents are suitably present in combination in amounts that are effective for the purpose intended.
- the effective amount of such other agents depends on the amount of fusion protein used, the type of disorder or treatment, and other factors discussed above.
- the trimeric antigen binding molecules are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
- combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate compositions), and separate administration, in which case, administration of the trimeric antigen binding molecule of the invention can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant.
- an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above comprises a container and a label or package insert on or associated with the container.
- Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc.
- the containers may be formed from a variety of materials such as glass or plastic.
- the container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper that is pierceable by a hypodermic injection needle).
- At least one active agent in the composition is a trimeric antigen binding molecule of the invention.
- the label or package insert indicates that the composition is used for treating the condition of choice.
- the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises a trimeric antigen binding molecule of the invention; and (b) a second container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent.
- the article of manufacture in this embodiment of the invention may further comprise a package insert indicating that the compositions can be used to treat a particular condition.
- the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
- BWFI bacteriostatic water for injection
- phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
- BWFI bacteriostatic water for injection
- phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
- BWFI bacteriostatic water for injection
- Ringer's solution such as phosphate
- a trimeric antigen binding molecule comprising three fusion polypeptides, each of the three fusion polypeptides comprising (a) a moiety capable of specific binding to a costimulatory TNF receptor family member,
- trimerization domain comprises an amino acid sequence having at least 95% identity to SEQ ID NO:2.
- trimerization domain comprises the amino acid sequence of SEQ ID NO:2.
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14, and a VL comprising
- a CDR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16 and SEQ ID NO: 17,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO:20, and
- a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 and SEQ ID NO:26.
- the trimeric antigen binding molecule as defined in any one of the preceding points comprising a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:27, SEQ ID NO: 29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37 and SEQ ID NO:39 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:28, SEQ ID NO: 30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38 and SEQ ID NO:40.
- VH comprising the amino acid sequence of SEQ ID NO:37 and a VL comprising the amino acid sequence of SEQ ID NO:38, or
- a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:44 and SEQ ID NO:45, and
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50, and a VL comprising
- a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:51 and SEQ ID NO:52,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:53 and SEQ ID NO:54, and
- SEQ ID NO:55 SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58 and SEQ ID NO:59.
- the trimeric antigen binding molecule as defined in any one of points (1) to (6), or points (11) to (13) above, comprising a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises
- VH comprising the amino acid sequence of SEQ ID NO: 60 and a VL comprising the amino acid sequence of SEQ ID NO:61
- VH comprising the amino acid sequence of SEQ ID NO: 62 and a VL comprising the amino acid sequence of SEQ ID NO: 63
- VH comprising the amino acid sequence of SEQ ID NO: 66 and a VL comprising the amino acid sequence of SEQ ID NO: 67, or
- the moiety capable of specific binding to a costimulatory TNF receptor family member is a Fab fragment or a scFv.
- FAP Melanoma-associated Chondroitin Sulfate Proteoglycan
- MCSP Melanoma-associated Chondroitin Sulfate Proteoglycan
- EGFR Epidermal Growth Factor Receptor
- CEA Carcinoembryonic Antigen
- CD19 CD20 and CD33.
- a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:70 and SEQ ID NO:76,
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:72 and SEQ ID NO:78,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:74 and SEQ ID NO:80
- a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:75 and SEQ ID NO:81.
- the trimeric antigen binding molecule as defined in any one of the preceding points comprising a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 82 and SEQ ID NO: 84, and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 82 and SEQ ID NO: 84, and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ
- VH comprising the amino acid sequence of SEQ ID NO: 82 and a VL comprising the amino acid sequence of SEQ ID NO:83, or
- a fusion polypeptide comprising (a) a VH and/or VL of a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) comprising the amino acid sequence of SEQ ID NO:2, wherein the trimerization domain is capable of mediating stable association of the fusion polypeptide with two further such fusion polypeptides and
- the moiety capable of specific binding to FAP comprises a VH comprising
- a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:70 and SEQ ID NO:76
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:71 and SEQ ID NO:77
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:72 and SEQ ID NO:78,
- a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:73 and SEQ ID NO:79,
- a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:74 and SEQ ID NO:80, and
- polypeptide comprises a VH of a moiety capable of specific binding to OX40, wherein the VH comprises
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
- SEQ ID NO:8 SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14.
- polypeptide comprises a VH of a moiety capable of specific binding to 4- IBB, wherein the VH comprises
- a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
- a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:44 and SEQ ID NO:45, and
- a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50.
- An expression vector comprising the polynucleotide of point (26) above.
- a host cell comprising the polynucleotide point (26) above or the expression vector of point (27) above.
- a method of producing a trimeric antigen binding molecule comprising culturing the host cell of point (28) above under conditions suitable for the expression of the trimeric antigen binding molecule, and isolating the trimeric antigen binding molecule.
- a pharmaceutical composition comprising the trimeric antigen binding molecule of any one of points (1) to (21) above and at least one pharmaceutically acceptable excipient.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Plant Pathology (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention relates to novel trimeric antigen binding molecules comprising three fusion polypeptides, each of the three fusion polypeptides comprising (a) a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) of amino acid sequence of SEQ ID NO: l, and (c) a moiety capable of specific binding to a target cell antigen, and to methods of producing these molecules and to methods of using the same.
Description
Trimeric antigen binding molecules specific for a costimulatory TNF receptor
FIELD OF THE INVENTION
The invention relates to novel trimeric antigen binding molecules comprising three fusion polypeptides, each of the three fusion polypeptides comprising (a) a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain, in particular a trimerization domain derived from human cartilage matrix protein (hCMP, SEQ ID NO: 1), and (c) a moiety capable of specific binding to a target cell antigen, and to methods of producing these molecules and to methods of using the same. The invention further relates to methods of producing these molecules and to methods of using the same.
BACKGROUND Several members of the tumor necrosis factor receptor (TNFR) family function after initial
T cell activation to sustain T cell responses and thus have pivotal roles in the organization and function of the immune system. CD27, 4-1BB (CD137), OX40 (CD134), HVEM, CD30, and GITR can have costimulatory effects on T cells, meaning that they sustain T-cell responses after initial T cell activation (Watts T.H. (2005) Annu. Rev. Immunol. 23, 23-68). The effects of these costimulatory TNFR family members can often be functionally, temporally, or spatially segregated from those of CD28 and from each other. The sequential and transient regulation of T cell activation/survival signals by different costimulators may function to allow longevity of the response while maintaining tight control of T cell survival. Depending on the disease condition, stimulation via costimulatory TNF family members can exacerbate or ameliorate disease.
Despite these complexities, stimulation or blockade of TNFR family costimulators shows promise for several therapeutic applications, including cancer, infectious disease, transplantation, and autoimmunity.
Among several costimulatory molecules, the tumor necrosis factor (TNF) receptor family member OX40 (CD 134) plays a key role in the survival and homeostasis of effector and memory T cells (Croft M. et al. (2009), Immunological Reviews 229, 173-191). OX40 (CD134) is expressed in several types of cells and regulates immune responses against infections, tumors and self-antigens and its expression has been demonstrated on the surface of T-cells, NKT-cells and NK-cells as well as neutrophils (Baumann R. et al. (2004), Eur. J. Immunol. 34, 2268-2275) and shown to be strictly inducible or strongly upregulated in response to various stimulatory signals. Functional activity of the molecule has been demonstrated in every OX40-expressing cell type suggesting complex regulation of OX40-mediated activity in vivo. Combined with T-
cell receptor triggering, OX40 engagement on T-cells by its natural ligand or agonistic antibodies leads to synergistic activation of the PI3K and NFKB signalling pathways (Song J. et al. (2008) J. Immunology 180(11), 7240-7248). In turn, this results in enhanced proliferation, increased cytokine receptor and cytokine production and better survival of activated T-cells. In addition to its co-stimulatory activity in effector CD4+ or CD8+ T-cells, OX40 triggering has been recently shown to inhibit the development and immunosuppressive function of T regulatory cells. This effect is likely to be responsible, at least in part, for the enhancing activity of OX40 on anti-tumor or anti-microbial immune responses. Given that OX40 engagement can expand T- cell populations, promote cytokine secretion, and support T-cell memory, agonists including antibodies and soluble forms of the ligand OX40L have been used successfully in a variety of preclinical tumor models (Weinberg et al. (2000), J. Immunol. 164, 2160-2169).
4-1BB (CD137), a member of the TNF receptor superfamily, has been first identified as a molecule whose expression is induced by T-cell activation (Kwon Y.H. and Weissman S.M. (1989), Proc. Natl. Acad. Sci. USA 86, 1963-1967). Subsequent studies demonstrated expression of 4-1BB in T- and B-lymphocytes (Snell L.M. et al. (2011) Immunol. Rev. 244, 197-217 or Zhang X.et al. (2010), J. Immunol. 184, 787-795), NK-cells (Lin W. et al. (2008), Blood 112, 699-707, NKT-cells (Kim D.H. et al. (2008), J. Immunol. 180, 2062-2068), monocytes (Kienzle G. and von Kempis J. (2000), Int. Immunol. 12, 73-82, or Schwarz H. et al. (1995), Blood 85, 1043-1052), neutrophils (Heinisch I.V. et al. (2000), Eur. J. Immunol. 30, 3441-3446), mast (Nishimoto H. et al. (2005), Blood 106, 4241-4248), and dendritic cells as well as cells of non- hematopoietic origin such as endothelial and smooth muscle cells (Broil K. et al. (2001), Am. J. Clin. Pathol. 115, 543-549 or Olofsson P.S. et al. (2008), Circulation 117, 1292-1301).
Expression of 4- IBB in different cell types is mostly inducible and driven by various stimulatory signals, such as T-cell receptor (TCR) or B-cell receptor triggering, as well as signaling induced through co-stimulatory molecules or receptors of pro-inflammatory cytokines (Diehl L. et al.
(2002), J. Immunol. 168, 3755-3762; von Kempis J. et al. (1997), Osteoarthritis Cartilage 5, 394- 406; Zhang X.et al. (2010), J. Immunol. 184, 787-795).
CD 137 signaling is known to stimulate IFNy secretion and proliferation of NK cells (Buechele C. et al. (2012), Eur. J. Immunol. 42, 737-748; Lin W. et al. (2008), Blood 112, 699- 707; Melero I. et al. (1998), Cell Immunol. 190, 167-172) as well as to promote DC activation as indicated by their increased survival and capacity to secret cytokines and upregulate co- stimulatory molecules (Choi B. K. et al. (2009), J. Immunol. 182, 4107-4115; Futagawa T. et al. (2002), Int. Immunol. 14, 275-286; Wilcox R. A. et al. (2002), J. Immunol. 168, 4262-4267). However, CD 137 is best characterized as a co-stimulatory molecule which modulates TCR- induced activation in both the CD4+ and CD8+ subsets of T-cells. In combination with TCR triggering, agonistic 4-lBB-specific antibodies enhance proliferation of T-cells, stimulate lymphokine secretion and decrease sensitivity of T-lymphocytes to activation- induced cells
death (Snell L.M. et al. (2011) Immunol. Rev. 244, 197-217). In line with these co-stimulatory effects of 4- IBB antibodies on T-cells in vitro, their administration to tumor bearing mice leads to potent anti-tumor effects in many experimental tumor models (Melero I. et al. (1997), Nat. Med. 3, 682-685; Narazaki H. et al. (2010), Blood 115, 1941-1948). In vivo depletion
experiments demonstrated that CD8+ T-cells play the most critical role in anti-tumoral effect of 4-lBB-specific antibodies. However, depending on the tumor model or combination therapy, which includes anti-4-lBB, contributions of other types of cells such as DCs, NK-cells or CD4+ T-cells have been reported (Murillo O. et al. (2009), Eur. J. Immunol. 39, 2424-2436; Stagg J. et al. (2011), Proc. Natl. Acad. Sci. USA 108, 7142-7147). In addition to their direct effects on different lymphocyte subsets, 4- IBB agonists can also induce infiltration and retention of activated T-cells in the tumor through 4-lBB-mediated upregulation of intercellular adhesion molecule 1 (ICAM1) and vascular cell adhesion molecule 1 (VCAM1) on tumor vascular endothelium (Palazon A. et al. (2011), Cancer Res. 71, 801-811). 4- IBB triggering may also reverse the state of T-cell anergy induced by exposure to soluble antigen that may contribute to disruption of immunological tolerance in the tumor micro- environment or during chronic infections (Wilcox R.A. et al. (2004), Blood 103, 177-184).
It appears that the immunomodulatory properties of 4- IBB agonistic antibodies in vivo require the presence of the wild type Fc-portion on the antibody molecule thereby implicating Fc-receptor binding as an important event required for the pharmacological activity of such reagents as has been described for agonistic antibodies specific to other apoptosis-inducing or immunomodulatory members of the TNFR-superfamily (Li F. and Ravetch J.V. (2011), Science 333, 1030-1034; Teng M.W. et al. (2009), J. Immunol. 183, 1911-1920). However, systemic administration of 4-lBB-specific agonistic antibodies with the functionally active Fc domain also induces expansion of CD8+ T-cells associated with liver toxicity (Dubrot J. et al. (2010), Cancer Immunol. Immunother. 59, 1223-1233) that is diminished or significantly ameliorated in the absence of functional Fc-receptors in mice. In human clinical trials (ClinicalTrials.gov, NCT00309023), Fc-competent 4-1BB agonistic antibodies (BMS-663513) administered once every three weeks for 12 weeks induced stabilization of the disease in patients with melanoma, ovarian or renal cell carcinoma. However, the same antibody given in another trial
(NCT00612664) caused grade 4 hepatitis leading to termination of the trial (Simeone E. and
Ascierto P.A. (2012), J. Immunotoxicology 9, 241-247). Thus, there is a need for new generation agonists that should not only effectively engage 4- IBB on the surface of hematopoietic and endothelial cells but also be capable of achieving that through mechanisms other than binding to Fc-receptors in order to avoid uncontrollable side effects. Several approaches have been described to generate artificial multimers with defined stoichiometries of recombinant antibodies or other proteins. WO 01/49866 discloses recombinant
fusion proteins comprising a TNF cytokine and a multimerization component, particularly proteins from the Clq protein family such as ACRP30 or a collectin. A disadvantage of these fusion proteins is, however, that the trimerization domain usually has a large molecular weight and/or that the trimerization is rather inefficient. WO 2007/014744, WO 2009/000538 and Wyzgol et al. (2009) disclose fusion proteins comprising a TNF cytokine and a trimerization domain from the chicken protein tenascin. Biological activity could be strongly enhanced.
However, a trimerization domain that is derived from a non-human origin, could have the disadvantage of causing immunogenicity reactions in the human body. Human cartilage matix protein (huCMP) is a major extracellular matrix protein localized specifically in cartilage. Its C- terminal region forms a three-stranded alpha-helical coiled-coil structure (Beck, 1996). WO
2017/025610 and WO 2015/183902 disclose GITR ligands and OX40 ligands, respectively, that are fused to a trimerization domain which is connected to a Fc domain. However, these molecules lack the "tumor-targeting" through a moiety capable of binding to tumor-specific target and thus could lead to unspecific immune reactions. The available pre-clinical and clinical data clearly demonstrate that there is a high clinical need for effective agonists of costimulatory TNFR family members such as OX40 and 4- IBB that are able to induce and enhance effective endogenous immune responses to cancer. However, almost never are the effects limited to a single cell type or acting via a single mechanism and studies designed to elucidate inter- and intracellular signaling mechanisms have revealed increasing levels of complexity. Thus, there is a need of "targeted" agonists that preferably act on a single cell type. The antigen binding molecules of the invention combine a moiety capable of preferred binding to tumor-specific or tumor-associated targets with a moiety capable of agonistic binding to costimulatory TNF receptors. The antigen binding molecules of this invention may be able to trigger TNF receptors not only effectively, but also very selectively at the desired site thereby reducing undesirable side effects.
SUMMARY OF THE INVENTION
The present invention provides a trimeric antigen binding molecule comprising three fusion polypeptides, each of the three fusion polypeptides comprising
(a) a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) of amino acid sequence of SEQ ID NO: l, and
(c) a moiety capable of specific binding to a target cell antigen.
The novel trimeric antigen binding molecules of the present invention are stable, as the fusion polypeptides associate with each other through the huCMP trimerization domain. The stable antigen binding molecule trimers are able to trigger TNF receptors highly effectively due
to their trimeric structure, but also very selectively at the site where the target cell antigen is expressed, due to their binding capability towards a target cell antigen. Side effects may therefore be drastically reduced.
In some embodiments, the trimeric antigen binding molecule comprises three fusion polypeptides, each of the three fusion polypeptides comprising a trimerization domain comprising an amino acid sequence having at least 95% identity to SEQ ID NO:2. More particularly, the trimerization domain comprises the amino acid sequence of SEQ ID NO:2.
In some embodiments, the three fusion polypeptides are linked by disulphide bonds. In some embodiments, the three fusion polypeptides are linked by disulphide bonds formed between the trimerization domains of the fusion polypeptides.
In some embodiments, the costimulatory TNF receptor family member is selected from OX40 and 4-lBB.
In some embodiments, the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:3.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety comprises a heavy chain variable domain (VH) comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:4 and SEQ ID NO:5,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14,
and a light chain variable domain (VL) comprising
(iv) a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16 and SEQ ID NO: 17,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 18, SEQ ID NO:19 and SEQ ID NO:20, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21 , SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 and SEQ ID NO:26.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises a heavy chain variable domain (VH) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:27, SEQ ID NO: 29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37 and SEQ ID NO:39 and a light chain variable domain (VL) comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:28, SEQ ID NO: 30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38 and SEQ ID NO:40. In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises (i) a heavy chain variable domain (VH) comprising the amino acid sequence of SEQ ID NO:27 and light chain variable domain (VL) comprising the amino acid sequence of SEQ ID NO:28,
(ii) a VH comprising the amino acid sequence of SEQ ID NO:29 and a VL comprising the amino acid sequence of SEQ ID NO:30,
(iii) a VH comprising the amino acid sequence of SEQ ID NO: 31 and a VL comprising the amino acid sequence of SEQ ID NO:32,
(iv) a VH comprising the amino acid sequence of SEQ ID NO:33 and a VL comprising the amino acid sequence of SEQ ID NO:34,
(v) a VH comprising the amino acid sequence of SEQ ID NO:35 and a VL comprising the amino acid sequence of SEQ ID NO:36,
(vi) a VH comprising the amino acid sequence of SEQ ID NO:37 and a VL comprising the amino acid sequence of SEQ ID NO:38, or
(vii) a VH comprising the amino acid sequence of SEQ ID NO:39 and a VL comprising the amino acid sequence of SEQ ID NO:40.
In some embodiments, the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:41. In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4- IBB, wherein the moiety comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:44 and SEQ ID NO:45, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50, and a VL comprising
(iv) a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:51 and SEQ ID NO:52,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:53 and SEQ ID NO:54, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58 and SEQ ID NO:59. In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises a VH comprising an amino acid sequence that is at least about 95%, 96%>, 97%, 98%, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66 and SEQ ID NO:68 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67 and SEQ ID NO:69.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises (i) a VH comprising the amino acid sequence of SEQ ID NO: 60 and a VL comprising the amino acid sequence of SEQ ID NO:61,
(ii) a VH comprising the amino acid sequence of SEQ ID NO: 62 and a VL comprising the amino acid sequence of SEQ ID NO:63,
(iii) a VH comprising the amino acid sequence of SEQ ID NO: 64 and a VL comprising the amino acid sequence of SEQ ID NO: 65,
(iv) a VH comprising the amino acid sequence of SEQ ID NO: 66 and a VL comprising the amino acid sequence of SEQ ID NO:67, or
(v) a VH comprising the amino acid sequence of SEQ ID NO:68 and a VL comprising the amino acid sequence of SEQ ID NO:69. In some embodiments, the moiety capable of specific binding to a costimulatory TNF receptor family member is fused at the C-terminal amino acid to the N-terminal amino acid of the trimerization domain, optionally through a peptide linker.
In some embodiments, the moiety capable of specific binding to a costimulatory TNF receptor family member is a Fab fragment or a scFv.
In some embodiments, the target cell antigen is selected from the group consisting of Fibroblast Activation Protein (FAP), Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), Carcinoembryonic Antigen (CEA), CD 19, CD20 and CD33. In some embodiments, the target cell antigen is FAP or CEA. In particular, the target cell antigen is FAP.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:70 and SEQ ID NO:76,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:71 and SEQ ID NO:77, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:72 and SEQ ID NO:78,
and a VL comprising
(iv) a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:73 and SEQ ID NO:79,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:74 and SEQ ID NO:80, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:75 and SEQ ID NO:81.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises a heavy chain variable domain (VH) comprising an amino acid sequence that is at least about 95%, 96%o, 97%), 98%o, 99%> or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 82 and SEQ ID NO: 84 and a light chain variable domain (VL) comprising an amino acid sequence that is at least about 95%>, 96%>, 97%>, 98%>, 99%. or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 83 and SEQ ID NO:85. In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises
(i) a VH comprising the amino acid sequence of SEQ ID NO: 82 and a VL comprising the amino acid sequence of SEQ ID NO:83, or
(ii) a VH comprising the amino acid sequence of SEQ ID NO: 84 and a VL comprising the amino acid sequence of SEQ ID NO:85.
In some embodiments, the moiety capable of specific binding to a target cell antigen is fused at the N-terminal amino acid to the C-terminal amino acid of the trimerization domain, optionally through a peptide linker.
In some embodiments, three fusion polypeptides are identical. The present invention also provides a fusion polypeptide comprising (a) a VH and/or VL of a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) comprising the amino acid sequence of SEQ ID NO:2, wherein the trimerization domain is capable of mediating stable association of the fusion polypeptide with two further such fusion polypeptides and (c) a VH and/or VL of a moiety capable of specific binding to a target cell antigen.
In some embodiments, the fusion polypeptide comprises a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:70 and SEQ ID NO:76,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:71 and SEQ ID NO:77, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:72 and SEQ ID NO:78,
and a VL comprising
(iv) a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:73 and SEQ ID NO:79,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:74 and SEQ ID NO:80, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:75 and SEQ ID NO:81.
In some embodiments, the fusion polypeptide comprises a VH of a moiety capable of specific binding to OX40, wherein the VH comprises
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:4 and SEQ ID NO:5,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14.
In some embodiments, the fusion polypeptide comprises a VH of a moiety capable of specific binding to 4- IBB, wherein the VH comprises
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of
SEQ ID NO:44 and SEQ ID NO:45, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50.
The present invention also provides a polynucleotide encoding the trimeric antigen binding molecule of the invention, or the fusion polypeptide of the invention.
The present invention also provides a vector, e.g. an expression vector, comprising the polynucleotide of the invention.
The present invention also provides a host cell comprising the polynucleotide of the invention or the expression vector of the invention. In some embodiments the host cell is a eukaryotic cell, particularly a mammalian cell.
The present invention also provides a method of producing a trimeric antigen binding molecule, comprising culturing the host cell of the invention under conditions suitable for the expression of the trimeric antigen binding molecule, and isolating the trimeric antigen binding molecule. The invention also encompasses a trimeric antigen binding molecule produced by the method of the invention.
The present invention also provides a pharmaceutical composition comprising the trimeric antigen binding molecule of the invention and at least one pharmaceutically acceptable excipient.
The present invention also provides the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, for use as a medicament. The present invention also provides the trimeric antigen binding molecule as described herein before, or the pharmaceutical composition of the invention, for use
(i) in stimulating T cell response,
(ii) in supporting survival of activated T cells,
(iii) in the treatment of infections,
(iv) in the treatment of cancer,
(v) in delaying progression of cancer, or
(vi) in prolonging the survival of a patient suffering from cancer.
The present invention also provides the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, for use in the treatment of a disease in an individual in need thereof. Also provided is the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, for use in the treatment of cancer.
The present invention also provides the use of the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, in the manufacture of a disease in an individual in need thereof, in particular for the manufacture of a medicament for the treatment of cancer.
The present invention also provides a method of treating a disease in an individual, comprising administering to the individual a therapeutically effective amount of a composition comprising the trimeric antigen binding molecule of the invention in a pharmaceutically acceptable form. Also provided is a method of treating an individual having cancer, said method comprising administering to the individual an effective amount of the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention. The present invention also provides the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, for use in up-regulating or prolonging cytotoxic T cell activity. Also provided is the use of the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, in the manufacture of a medicament for up-regulating or prolonging cytotoxic T cell activity. Also provided is a method of up-regulating or prolonging cytotoxic T cell activity in an individual having cancer, comprising administering to the individual an effective amount of the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention.
In some embodiments in accordance with various aspects of the present invention the individual is a mammal, particularly a human.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 shows the monomeric form of Fc-linked TNF receptor antigen that was used for the preparation of TNF receptor antibodies.
Figure 2A shows a schematic representation of the trimeric, bispecific, antigen binding molecules comprising three anti-OX40 Fab, and three scFv capable of specific binding to FAP. Figure 2B shows the trimeric, bispecific antigen binding molecules comprising three anti-4-lBB Fab, and three scFv capable of specific binding to FAP.
Figure 3A shows a schematic representation of the set up of the surface plasmon resonance assays for simultaneous binding of human OX40 and human FAP by the trimeric,
bispecific anti-OX40, anti-FAP antigen binding molecules. Figure 3B shows a schematic representation of the set up of the surface plasmon resonance assays for simultaneous binding of human 4- IBB and human FAP by the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules. Figures 4A to 4E show the binding of the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules to recombinant OX40 Fc (kih) receptor and human FAP protein, as assessed by surface plasmon resonance. Figure 4A shows binding of molecules comprising anti-OX40 clone 8H9, Figure 4B shows binding of molecules comprising anti-OX40 clone 1G4, Figure 4C shows binding of molecules comprising anti-OX40 clone 49B4, Figure 4D shows binding of molecules comprising anti-OX40 clone 21H4, and Figure 4E shows binding of molecules comprising anti-OX40 clone CLC-563.
Figures 5A to 5C show the binding of the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules to resting and activated human CD4+ and CD 8+ T cells. Figure 5 A shows binding to resting CD4+ T cells, Figure 5B shows binding to activated CD4+ T cells, Figure 5C shows binding to resting CD8+ T cells, and Figure 5D shows binding to activated CD8+ T cells. Binding is shown as the median of fluorescence intensity (MFI) of FITC conjugated anti- human IgG F(ab')2-fragment-specific goat IgG F(ab")2 fragment, which is used as secondary detection antibody. MFI was measured by flow cytometry and baseline corrected by subtracting the MFI of the blank control. The x-axis shows the concentration of the antigen binding molecules. All OX40 clones bind to activated, OX40 expressing human CD4+ T cells, and to a lower extent to activated human CD8+ T cells. OX40 is not expressed on resting human PBMCs (Figure 5A and 5C). After activation, OX40 is up-regulated on CD4+ and CD8+ T cells (Figure 5B and 5D). OX40 expression on human CD8+ T cells is lower than on CD4+ T cells. The clones vary in the strength of binding (EC50 values as well as signal strength) to OX40 positive cells. Figures 6A and 6B show the binding of the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules to tumor cells which do not express FAP (FAP-), or which express FAP (FAP+). Figure 6 A shows binding to CHO cells, which are negative for FAP. Figure 6B shows binding to WM266-4 cells, which express high levels of human fibroblast activation protein (huFAP). Binding is shown as the median of fluorescence intensity (MFI) of FITC conjugated anti-human IgG F(ab')2-fragment-specific goat IgG F(ab")2 fragment, which is used as secondary detection antibody. MFI was measured by flow cytometry. The x-axis shows the concentration of antibody constructs. The molecules are shown to bind to FAP-expressing WM266-4 cells (Figure 6B), but not to FAP-negative CHO cells (Figure 6A).
Figures 7A to 7E show activation of NFKB by the trimeric, bispecific anti-OX40, anti- FAP antigen binding molecules, in the presence or absence of crosslinking by FAP -positive cells.
Figure 7 A shows NFKB activation by molecules comprising anti-OX40 clone 49B4, Figure 7B shows NFKB activation by molecules comprising anti-OX40 clone 1G4, Figure 7C shows NFKB activation by molecules comprising anti-OX40 clone CLC-563, Figure 7D shows NFKB activation by molecules comprising anti-OX40 clone 8H9, and Figure 7E shows NFKB activation by molecules comprising anti-OX40 clone 21H4. Open triangles show activation of NFKB in the absence of hyper-crosslinking, and filled circles show activation of NFKB following hyper-crosslinking by culture in the presence of FAP-expressing NIH/3T3-huFAP clone 39 cells (2: 1 ratio of FAP+ tumor cells to reporter cells). NF-KB-mediated luciferase activity was characterized by plotting the units of released light (URL), measured during 0.5 s, versus the concentration of the antigen binding molecule (in nM). URLs are emitted due to luciferase- mediated oxidation of luciferin to oxyluciferin. The values were baseline-corrected by
subtracting the URLs for a 'blank control' condition. All of the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules induced NFkB activation in OX40+ HeLa reporter cells in the absence of FAP -positive cells, and addition of FAP -positive cells resulted in a strong increase in NFkB activation.
Figures 8A to 8D show activation of NFKB by the trimeric, bispecific anti-OX40, anti- FAP antigen binding molecules, in the presence or absence of crosslinking by FAP -positive cells. Figure 8A shows activation of NFKB by molecules comprising anti-OX40 clones 49B4, 1G4, CLC-356, 21H4 and 8H9, or DP47 hulgGI P329GLALA (isotype control), following hyper- crosslinking by culture in the presence of FAP-expressing NIH/3T3-huFAP clone 39 cells (2: 1 ratio of FAP+ tumor cells to reporter cells), Figure 8B shows activation of NFKB by molecules comprising anti-OX40 clones 49B4, 1G4, CLC-356, 21H4 and 8H9 in the absence of hyper- crosslinking. NF-KB-mediated luciferase activity was characterized by plotting the units of released light (URL), measured during 0.5 s, versus the concentration of the antigen binding molecule (in nM). URLs are emitted due to luciferase-mediated oxidation of luciferin to oxyluciferin. The values are baseline-corrected by subtracting the URLs for a 'blank control' condition. Limited, dose-dependent NFkB activation observed in the absence of FAP+ cells, in line with the observation that the trimeric OX40L naturally engages three OX40 receptors on the cell surface to form the basic signaling unit. Hyper- crosslinking of anti-OX40 antibodies by FAP expressing NIH/3T3huFAP cells strongly increased the induction of NFKB-mediated luciferase-activation, in a concentration-dependent manner. Full agonism of the OX40 axis may only be achieved when at least a hexameric OX40 signaling unit is assembled, which could be facilitated by FAP mediated immobilization of the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules. However, with increasing concentration a drop in bioactivity was observed after an initial increase; it may be that at high concentration, efficient hyper- crosslinking is limited by insufficient FAP molecules at the cell surface, or by steric hindrance. NFkB activation then drops back to the levels observed in the absence of hyper-crosslinking.
Figure 8C shows NFKB activation in the presence of hyper-crosslinking (Figure 8A) minus NFKB activation in the absence of hyper-crosslinking (Figure 8B). Figure 8D shows the data of Figure 8C represented as area under the curve (AUC).
Figures 9A to 9D show rescue of suboptimal TCR restimulation of preactivated CD4 T cells with plate-immobilized trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules. Suboptimally PHA-L pre-activated CFSE-labeled human CD4 T cells were cultured for four days on plates pre-coated with mouse IgG Fey-specific antibodies (2 ug/mL), human IgG Fab specific antibodies (2 ug/mL), mouse anti- human CD3 antibodies (clone OKT3, [3 ng/mL]) and titrated trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules, or DP47 hulgGI P329GLALA (isotype control). Cells were stained with a combination of fluorochrome-labeled mouse anti-human TIM-3 (clone F38-2E2, Biolegend, Ca.No.345008) and anti-CD 127 (clone A019D5, Biolegend, Ca.No.351234), and analysed by flow cytometry. Values were baseline- corrected to values for samples containing only the plate-immobilized anti- human CD3. Figure 9A shows the number of events, Figure 9B shows the percentage of proliferating (i.e. CFSElow) cells, Figure 9C shows the percentage of effector T cells (i.e. CD1271ow) and Figure 9D shows the percentage of cells with an activated phenotype (Tim-3 positive cells). All of the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules were able to rescue suboptimal TCR stimulation of preactivated, OX40+ CD4 T cells when coated to plate.
Figure 10 shows the EC50 values of the plate-immobilized trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules for rescuing suboptimal TCR stimulation, as calculated from the data of Figure 9A to 9D. Event count, the percentage of proliferating (CFSElow) cells, the percentage of CD1271ow and Tim-3 positive cells at day 4 were plotted against the antigen binding molecule concentration concentration, and EC50 values as measure for agonistic strength were calculated using the inbuilt sigmoidal dose response quotation in Prism4
(GraphPad Software, USA). All of the trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules were able to rescue suboptimal TCR stimulation of preactivated, OX40+ CD4 T cells when plate-immobilised, and potency was clone dependent.
Figures 11A to 11D show rescue of suboptimal TCR restimulation of preactivated CD4 T cells with plate-immobilized trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules, in the presence or absence of crosslinking by FAP-positive cells. CFSE-labeled human PBMCs were activated with anti- human CD3 antibodies (clone V9, human IgGl; 2 nM) and trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules or non-targeted trivalent OX40 antigen binding molecules, at the indicated concentrations, for four days. Cells were
subsequently surface-stained with fluorescent dye-conjugated anti-human CD4 (clone RPA-T4, BioLegend, Cat.-No. 300532), anti-CD8 (clone RPa-T8, BioLegend, Cat.-No. 3010441) and anti-CD25 (clone M-A251, BioLegend, Cat.-No. 356112), and analysed by flow cytometry.
Values were baseline-corrected to values for samples containing containing only the anti-human CD3 (clone V9, hulgGI), resting human PBMC and NIH/3T3-huFAP clone 39. Figures 11A and llC show the MFI of CD25 (as a marker of activation) on vital CD4+ T cells. Figures 11B and 11D show the percentage of CD4+ T cells which were CD4+ CD25+ T cells. Only constructs containing FAP binding moiety were able to rescue suboptimal TCR stimulation of preactivated, OX40+ CD4 T cells when crosslinking was provided by FAP positive cells. The high affinity clone 8H9 (Figures 11A and 11B), showed peak activity at concentration of -0.1-1 nM, and a reduced activity at higher concentration.
Figures 12A and 12B show the correlation between the strength of binding to cells, and the strength of NFKB activation (as determined as AUC for NFKB activation; Figure 12A) and the strength of T cell activation (Figure 12B) shown for trimeric, bispecific anti-OX40, anti-FAP antigen binding molecules. The binding strength is the MFI of at the highest concentration (see Figure 5) for each clone. The AUC of bioactivity is the AUC calculated for NFkB activation as in Figure 8D. The AUC of T cell bioactivity was calculated from dose response curves shown in Figure 11. A negative correlation between binding strength to OX40 and agonism of bioactivity was observed. This may be explained by improved ability of molecules binding to OX40 with a low affinity (and high avidity) to dynamically recruit signaling OX40 receptor units. Low affinity binding may provide for a higher turn-over of receptor units by quick catch and release, whereas the high avidity still guarantees a clustering of several OX40 molecules at once and hyper-crosslinking by FAP, for optimal receptor signaling.
Figures 13 A to 13C show the binding of the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules to recombinant 4- IBB Fc (kih) receptor and human FAP protein, as assessed by surface plasmon resonance. Figure 13A shows binding of molecules comprising anti-4-lBB clone 25G7, Figure 13B shows binding of molecules comprising anti-4-lBB clone 12B3, and Figure 13C shows binding of molecules comprising anti-4-lBB clone 9B11.
Figures 14A to 14D show the binding of the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules; trimeric, bispecific isotype control DP47, anti-FAP antigen binding molecules; trimeric, monospecific anti-4-lBB antigen binding molecules; and isotype control DP47 hulgG P329G LALA molecules, to resting (naive) and activated human CD4+ and CD8+ T cells. Figure 14A shows binding to naive CD8+ T cells, Figure 14B shows binding to naive CD4+ T cells, Figure 14C shows binding to activated CD8+ T cells, and Figure 14D shows binding to activated CD4+ T cells. Binding is shown as the median of fluorescence intensity (MFI) of PE conjugated anti- human IgG F(ab')2-fragment-specific goat IgG F(ab")2 fragment, which is used as secondary detection antibody. MFI was measured by flow cytometry and baseline corrected by subtracting the MFI of the blank control. The x-axis shows the
concentration of antigen binding molecules. All anti-4-lBB antigen binding molecules were
shown to bind to activated, 4- IBB expressing human CD4+ T cells and CD8+ T cells (Figure 14C and 14D), but did not display binding to na'ive CD4+ and CD8+ T cells (Figure 14A and 14B).
Figure 15 shows the binding of the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules; trimeric, bispecific anti-4-lBB, isotype control DP47 antigen binding molecules; and monospecific, anti-4-lBB hulgGI P329G LALA antigen binding molecules to FAP-expressing NIH/3T3-huFAP clone 39 cells. The trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules are efficiently targeted to FAP, whereas the molecules lacking anti- FAP scFv did not bind to FAP-expressing NHI/3T3-huFAP clone 39 cells. Figures 16A and 16B show activation of NFKB by the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules, in the presence of crosslinking by FAP -positive cells. NF- κΒ-mediated luciferase activity was characterized by plotting the units of released light (URL), measured during 0.5 s, versus the concentration of the antigen binding molecule (in nM). URLs are emitted due to luciferase-mediated oxidation of luciferin to oxyluciferin (Figure 16A). The values were baseline-corrected by subtracting the URLs for a 'blank control' condition. Figure 16B shows that the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules (clone 25G7, filled diamonds and clone 12B3, filled squares) induced NFkB activation in human 4- lBB-positive HeLa reporter cells, but the control monospecific anti-4-lBB hulgGI P329G LALA and trimeric monospecific anti-4-lBB antigen binding molecules lacking anti-FAP scFv did not trigger activation of NFKB.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
Unless defined otherwise, technical and scientific terms used herein have the same meaning as generally used in the art to which this invention belongs. For purposes of interpreting this specification, the following definitions will apply and whenever appropriate, terms used in the singular will also include the plural and vice versa.
As used herein, the term "antigen binding molecule" refers in its broadest sense to a molecule that specifically binds an antigenic determinant. Examples of antigen binding molecules are antibodies, antibody fragments and scaffold antigen binding proteins. As used herein, the term "moiety capable of specific binding to a target cell antigen" or
"antigen binding domain capable of specific binding" refers to a polypeptide molecule that specifically binds to an antigenic determinant. In one aspect, the antigen binding moiety is able to activate signaling through its target cell antigen. In a particular aspect, the antigen binding
moiety is able to direct the entity to which it is attached to a target site, for example to a specific type of tumor cell or tumor stroma bearing the antigenic determinant. Moieties capable of specific binding to a target cell antigen include antibodies and fragments thereof as further defined herein. In one aspect, a "moiety capable of specific binding to a target cell antigen" is an antigen binding domain comprising an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH) capable of specific binding to a target cell antigen. In a particular aspect, the "moiety capable of specific binding to a costimulatory TNF receptor family member" may be a Fab fragment, a cross-Fab fragment or a scFv. In addition, moieties capable of specific binding to a target cell antigen include scaffold antigen binding proteins as further defined herein, e.g. binding domains which are based on designed repeat proteins or designed repeat domains (see e.g. WO 2002/020565).
In relation to an antibody or fragment thereof, the term "moiety capable of specific binding to a target cell antigen" refers to the part of the molecule that comprises the area which specifically binds to and is complementary to part or all of an antigen. A moiety capable of specific antigen binding may be provided, for example, by one or more antibody variable domains (also called antibody variable regions). Particularly, a moiety capable of specific antigen binding comprises an antibody light chain variable domain (VL) and an antibody heavy chain variable domain (VH). In some embodiments, the "moiety capable of specific binding to a target cell antigen" may be a scFv, a Fab fragment or a cross-Fab fragment. The term "moiety capable of specific binding to a costimulatory TNF receptor family member" or "antigen binding domain capable of specific binding to a costimulatory TNF receptor family member " refers to a polypeptide molecule that specifically binds to a costimulatory TNF receptor family member. In one aspect, the antigen binding moiety is able to activate signaling through a costimulatory TNF receptor family member. Moieties capable of specific binding to a target cell antigen include antibodies and fragments thereof as further defined herein. In addition, moieties capable of specific binding to a costimulatory TNF receptor family member include scaffold antigen binding proteins as further defined herein, e.g. binding domains which are based on designed repeat proteins or designed repeat domains (see e.g. WO 2002/020565). Particularly, a moiety capable of specific binding to a costimulatory TNF receptor family member comprises an antibody light chain variable domain (VL) and an antibody heavy chain variable domain (VH). In a particular aspect, the "moiety capable of specific binding to a costimulatory TNF receptor family member" may be a Fab fragment, a cross-Fab fragment or a scFv.
The term "antibody" herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies,
monospecific and multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g. containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
The term "monospecific" antibody as used herein denotes an antibody that has one or more binding sites each of which bind to the same epitope of the same antigen. The term
"bispecific" means that the antigen binding molecule is able to specifically bind to at least two distinct antigenic determinants. A bispecific antigen binding molecule comprises at least two antigen binding sites, each of which is specific for a different antigenic determinant. In certain embodiments the bispecific antigen binding molecule is capable of simultaneously binding two antigenic determinants, particularly two antigenic determinants expressed on two distinct cells. For example, the trimeric antigen binding molecules of the present invention are bispecific, comprising a moiety capable of specific binding to a costimulatory TNF receptor family member and a moiety capable of specific binding to a target cell antigen.
The term "valent" as used within the current application denotes the presence of a specified number of binding sites in an antigen binding molecule. As such, the terms "bivalent", "tetravalent", and "hexavalent" denote the presence of two binding sites, four binding sites, and six binding sites, respectively, in an antigen binding molecule. Valency of an antigen binding molecule may also be expressed in relation to the number of binding sites for a given antigenic determinant. For example, the trimeric antigen binding molecules of the present invention are trivalent with respect to the target target cell antigen, and trivalent with respect to the
costimulatory TNF receptor family member. Overall, the trimeric antigen binding molecules comprise six binding sites (3+3). The terms "full length antibody", "intact antibody", and "whole antibody" are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure. "Native antibodies" refer to naturally occurring immunoglobulin molecules with varying structures. For example, native IgG-class antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two light chains and two heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also
called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI, CH2, and CH3), also called a heavy chain constant region. Similarly, from N- to C-terminus, each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a light chain constant domain (CL), also called a light chain constant region. The heavy chain of an antibody may be assigned to one of five types, called a (IgA), δ (IgD), ε (IgE), γ (IgG), or μ (IgM), some of which may be further divided into subtypes, e.g. γΐ (IgGl), γ2 (IgG2), γ3 (IgG3), γ4 (IgG4), al (IgAl) and a2 (IgA2). The light chain of an antibody may be assigned to one of two types, called kappa (κ) and lambda (λ), based on the amino acid sequence of its constant domain. An "antibody fragment" refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
Examples of antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab')2; diabodies, triabodies, tetrabodies, cross-Fab fragments; linear antibodies; single-chain antibody molecules (e.g. scFv); and single domain antibodies. For a review of certain antibody fragments, see Hudson et al, Nat Med 9, 129-134 (2003). For a review of scFv fragments, see e.g.
Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer- Verlag, New York, pp. 269-315 (1994); see also WO 93/16185; and U.S. Patent Nos. 5,571,894 and 5,587,458. For discussion of Fab and F(ab')2 fragments comprising salvage receptor binding epitope residues and having increased in vivo half-life, see U.S. Patent No. 5,869,046. Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific, see, for example, EP 404,097; WO 1993/01161; Hudson et al, Nat Med 9, 129-134 (2003); and Hollinger et al, Proc Natl Acad Sci USA 90, 6444-6448 (1993). Triabodies and tetrabodies are also described in Hudson et al, Nat Med 9, 129-134 (2003). Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody. In certain embodiments, a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, MA; see e.g. U.S. Patent No. 6,248,516 Bl). Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g. E. coli or phage), as described herein. Papain digestion of intact antibodies produces two identical antigen-binding fragments, called "Fab" fragments containing each the heavy- and light-chain variable domains and also the constant domain of the light chain and the first constant domain (CHI) of the heavy chain. As used herein, Thus, the term "Fab fragment" refers to an antibody fragment comprising a light chain fragment comprising a light chain variable domain (VL) and a constant domain of a light chain (CL), and a heavy chain variable domain (VH) and a first constant domain (CHI) of a heavy chain. Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHI domain including one or more cysteins from the
antibody hinge region. Fab'-SH are Fab' fragments in which the cysteine residue(s) of the constant domains bear a free thiol group. Pepsin treatment yields an F(ab')2 fragment that has two antigen-combining sites (two Fab fragments) and a part of the Fc region.
The term "cross-Fab fragment" or "xFab fragment" or "crossover Fab fragment" refers to a Fab fragment, wherein either the variable regions or the constant regions of the heavy and light chain are exchanged. Two different chain compositions of a crossover Fab molecule are possible and comprised in the bispecific antibodies of the invention: On the one hand, the variable regions of the Fab heavy and light chain are exchanged, i.e. the crossover Fab molecule comprises a peptide chain composed of the light chain variable region (VL) and the heavy chain constant region (CHI), and a peptide chain composed of the heavy chain variable region (VH) and the light chain constant region (CL). This crossover Fab molecule is also referred to as CrossFab (VLVH). On the other hand, when the constant regions of the Fab heavy and light chain are exchanged, the crossover Fab molecule comprises a peptide chain composed of the heavy chain variable region (VH) and the light chain constant region (CL), and a peptide chain composed of the light chain variable region (VL) and the heavy chain constant region (CHI). This crossover Fab molecule is also referred to as CrossFab (CLCHI).
A "single chain Fab fragment" or "scFab" is a polypeptide consisting of an antibody heavy chain variable domain (VH), an antibody constant domain 1 (CHI), an antibody light chain variable domain (VL), an antibody light chain constant domain (CL) and a linker, wherein said antibody domains and said linker have one of the following orders in N-terminal to C-terminal direction: a) VH-CH1 -linker- VL-CL, b) VL-CL-linker-VH-CHl, c) VH-CL-linker-VL-CHl or d) VL-CH1 -linker- VH-CL; and wherein said linker is a polypeptide of at least 30 amino acids, preferably between 32 and 50 amino acids. Said single chain Fab fragments are stabilized via the natural disulfide bond between the CL domain and the CHI domain. In addition, these single chain Fab molecules might be further stabilized by generation of interchain disulfide bonds via insertion of cysteine residues (e.g. position 44 in the variable heavy chain and position 100 in the variable light chain according to Kabat numbering).
A "crossover single chain Fab fragment" or "x-scFab" is a is a polypeptide consisting of an antibody heavy chain variable domain (VH), an antibody constant domain 1 (CHI), an antibody light chain variable domain (VL), an antibody light chain constant domain (CL) and a linker, wherein said antibody domains and said linker have one of the following orders in N- terminal to C-terminal direction: a) VH-CL-linker-VL-CHl and b) VL-CH1 -linker- VH-CL; wherein VH and VL form together an antigen-binding site which binds specifically to an antigen and wherein said linker is a polypeptide of at least 30 amino acids. In addition, these x-scFab molecules might be further stabilized by generation of interchain disulfide bonds via insertion of
cysteine residues (e.g. position 44 in the variable heavy chain and position 100 in the variable light chain according to Kabat numbering).
A "single-chain variable fragment (scFv)" is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of an antibody, connected with a short linker peptide of ten to about 25 amino acids. The linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity of the original antibody, despite removal of the constant regions and the introduction of the linker. scFv antibodies are, e.g. described in Houston, J.S., Methods in Enzymol. 203 (1991) 46-96). In addition, antibody fragments comprise single chain polypeptides having the characteristics of a VH domain, namely being able to assemble together with a VL domain, or of a VL domain, namely being able to assemble together with a VH domain to a functional antigen binding site and thereby providing the antigen binding property of full length antibodies.
"Scaffold antigen binding proteins" are known in the art, for example, fibronectin and designed ankyrin repeat proteins (DARPins) have been used as alternative scaffolds for antigen- binding domains, see, e.g., Gebauer and Skerra, Engineered protein scaffolds as next-generation antibody therapeutics. Curr Opin Chem Biol 13:245-255 (2009) and Stumpp et al., Darpins: A new generation of protein therapeutics. Drug Discovery Today 13: 695-701 (2008). In one aspect of the invention, a scaffold antigen binding protein is selected from the group consisting of CTLA-4 (Evibody), Lipocalins (Anticalin), a Protein A-derived molecule such as Z-domain of Protein A (Affibody), an A-domain (Avimer/Maxibody), a serum transferrin (trans-body); a designed ankyrin repeat protein (DARPin), a variable domain of antibody light chain or heavy chain (single-domain antibody, sdAb), a variable domain of antibody heavy chain (nanobody, aVH), VNAR fragments, a fibronectin (AdNectin), a C-type lectin domain (Tetranectin); a variable domain of a new antigen receptor beta-lactamase (VNAR fragments), a human gamma- crystallin or ubiquitin (Affilin molecules); a kunitz type domain of human protease inhibitors, microbodies such as the proteins from the knottin family, peptide aptamers and fibronectin (adnectin).
CTLA-4 (Cytotoxic T Lymphocyte-associated Antigen 4) is a CD28-family receptor expressed on mainly CD4+ T-cells. Its extracellular domain has a variable domain- like Ig fold. Loops corresponding to CDRs of antibodies can be substituted with heterologous sequence to confer different binding properties. CTLA-4 molecules engineered to have different binding specificities are also known as Evibodies (e.g. US7166697B1). Evibodies are around the same size as the isolated variable region of an antibody (e.g. a domain antibody). For further details see Journal of Immunological Methods 248 (1-2), 31-45 (2001).
Lipocalins are a family of extracellular proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids and lipids. They have a rigid beta-sheet secondary structure with a number of loops at the open end of the conical structure which can be engineered to bind to different target antigens. Anticalins are between 160-180 amino acids in size, and are derived from lipocalins. For further details see Biochim Biophys Acta 1482: 337-350 (2000), US7250297B1 and US20070224633.
An affibody is a scaffold derived from Protein A of Staphylococcus aureus which can be engineered to bind to antigen. The domain consists of a three-helical bundle of approximately 58 amino acids. Libraries have been generated by randomization of surface residues. For further details see Protein Eng. Des. Sel. 17, 455-462 (2004) and EP 1641818A1.
Avimers are multidomain proteins derived from the A-domain scaffold family. The native domains of approximately 35 amino acids adopt a defined disulfide bonded structure. Diversity is generated by shuffling of the natural variation exhibited by the family of A-domains. For further details see Nature Biotechnology 23(12), 1556 - 1561 (2005) and Expert Opinion on Investigational Drugs 16(6), 909-917 (June 2007).
A transferrin is a monomeric serum transport glycoprotein. Transferrins can be engineered to bind different target antigens by insertion of peptide sequences in a permissive surface loop. Examples of engineered transferrin scaffolds include the Trans-body. For further details see J. Biol. Chem 274, 24066-24073 (1999). Designed Ankyrin Repeat Proteins (DARPins) are derived from Ankyrin which is a family of proteins that mediate attachment of integral membrane proteins to the cytoskeleton. A single ankyrin repeat is a 33 residue motif consisting of two alpha- helices and a beta-turn. They can be engineered to bind different target antigens by randomizing residues in the first alpha-helix and a beta-turn of each repeat. Their binding interface can be increased by increasing the number of modules (a method of affinity maturation). For further details see J. Mol. Biol. 332, 489-503 (2003), PNAS 100(4), 1700-1705 (2003) and J. Mol. Biol. 369, 1015-1028 (2007) and
US20040132028A1.
A single-domain antibody is an antibody fragment consisting of a single monomeric variable antibody domain. The first single domains were derived from the variable domain of the antibody heavy chain from came lids (nanobodies or VHH fragments). Furthermore, the term single-domain antibody includes an autonomous human heavy chain variable domain (aVH) or VNAR fragments derived from sharks.
Fibronectin is a scaffold which can be engineered to bind to antigen. Adnectins consists of a backbone of the natural amino acid sequence of the 10th domain of the 15 repeating units of
human fibronectin type III (FN3). Three loops at one end of the .beta. -sandwich can be engineered to enable an Adnectin to specifically recognize a therapeutic target of interest. For further details see Protein Eng. Des. Sel. 18, 435- 444 (2005), US20080139791, WO2005056764 and US6818418B1. Peptide aptamers are combinatorial recognition molecules that consist of a constant scaffold protein, typically thioredoxin (TrxA) which contains a constrained variable peptide loop inserted at the active site. For further details see Expert Opin. Biol. Ther. 5, 783-797 (2005).
Microbodies are derived from naturally occurring microproteins of 25-50 amino acids in length which contain 3-4 cysteine bridges - examples of microproteins include KalataBI and conotoxin and knottins. The microproteins have a loop which can beengineered to include upto 25 amino acids without affecting the overall fold of the microprotein. For further details of engineered knottin domains, see WO2008098796.
An "antigen binding molecule that binds to the same epitope" as a reference molecule refers to an antigen binding molecule that blocks binding of the reference molecule to its antigen in a competition assay by 50% or more, and conversely, the reference molecule blocks binding of the antigen binding molecule to its antigen in a competition assay by 50% or more.
The term "antigen binding domain" refers to the part of an antigen binding molecule that comprises the area which specifically binds to and is complementary to part or all of an antigen. Where an antigen is large, an antigen binding molecule may only bind to a particular part of the antigen, which part is termed an epitope. An antigen binding domain may be provided by, for example, one or more variable domains (also called variable regions). Preferably, an antigen binding domain comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH).
As used herein, the term "antigenic determinant" is synonymous with "antigen" and "epitope," and refers to a site (e.g. a contiguous stretch of amino acids or a conformational configuration made up of different regions of non-contiguous amino acids) on a polypeptide macromolecule to which an antigen binding moiety binds, forming an antigen binding moiety- antigen complex. Useful antigenic determinants can be found, for example, on the surfaces of tumor cells, on the surfaces of virus-infected cells, on the surfaces of other diseased cells, on the surface of immune cells, free in blood serum, and/or in the extracellular matrix (ECM). The proteins useful as antigens herein can be any native form the proteins from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g. mice and rats), unless otherwise indicated. In a particular embodiment the antigen is a human protein. Where reference is made to a specific protein herein, the term encompasses the "full-length", unprocessed protein
as well as any form of the protein that results from processing in the cell. The term also encompasses naturally occurring variants of the protein, e.g. splice variants or allelic variants.
By "specific binding" is meant that the binding is selective for the antigen and can be discriminated from unwanted or non-specific interactions. The ability of an antigen binding molecule to bind to a specific antigen can be measured either through an enzyme-linked immunosorbent assay (ELISA) or other techniques familiar to one of skill in the art, e.g. Surface Plasmon Resonance (SPR) technique (analyzed on a BIAcore instrument) (Liljeblad et al., Glyco J 17, 323-329 (2000)), and traditional binding assays (Heeley, Endocr Res 28, 217-229 (2002)). In one embodiment, the extent of binding of an antigen binding molecule to an unrelated protein is less than about 10% of the binding of the antigen binding molecule to the antigen as measured, e.g. by SPR. In certain embodiments, an molecule that binds to the antigen has a dissociation constant (Kd) of < 1 μΜ, < 100 nM, < 10 nM, < 1 nM, < 0.1 nM, < 0.01 nM, or < 0.001 nM (e.g. 10~8 M or less, e.g. from 10~8 M to 10"13 M, e.g. from 10"9 M to 10"13 M).
"Affinity" or "binding affinity" refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g. an antibody) and its binding partner (e.g. an antigen). Unless indicated otherwise, as used herein, "binding affinity" refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g.
antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd), which is the ratio of dissociation and association rate constants (koff and kon, respectively). Thus, equivalent affinities may comprise different rate constants, as long as the ratio of the rate constants remains the same. Affinity can be measured by common methods known in the art, including those described herein. A particular method for measuring affinity is Surface Plasmon Resonance (SPR).
A "target cell antigen" as used herein refers to an antigenic determinant presented on the surface of a target cell, for example a cell in a tumor such as a cancer cell or a cell of the tumor stroma. In certain embodiments, the target cell antigen is an antigen on the surface of a tumor cell. In one embodiment, target cell antigen is selected from the group consisting of Fibroblast Activation Protein (FAP), Carcinoembryonic Antigen (CEA), Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), CD 19, CD20 and CD33. In particular, the target cell antigen is Fibroblast Activation Protein (FAP).
The term "Fibroblast activation protein (FAP)", also known as Prolyl endopeptidase FAP or Seprase (EC 3.4.21), refers to any native FAP from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated. The term encompasses "full-length," unprocessed FAP as well as any form of FAP that results from processing in the cell. The term
also encompasses naturally occurring variants of FAP, e.g., splice variants or allelic variants. In one embodiment, the antigen binding molecule of the invention is capable of specific binding to human, mouse and/or cynomolgus FAP. The amino acid sequence of human FAP is shown in UniProt (www.uniprot.org) accession no. Q12884 (version 149, SEQ ID NO:86), or NCBI (www.ncbi.nlm.nih.gov/) RefSeq NP 004451.2. The extracellular domain (ECD) of human FAP extends from amino acid position 26 to 760. The amino acid and nucleotide sequences of a His- tagged human FAP ECD is shown in SEQ ID NOs 87 and 88, respectively. The amino acid sequence of mouse FAP is shown in UniProt accession no. P97321 (version 126, SEQ ID NO:89), or NCBI RefSeq NP 032012.1. The extracellular domain (ECD) of mouse FAP extends from amino acid position 26 to 761. SEQ ID NOs 90 and 91 show the amino acid and nucleotide sequences, respectively, of a His-tagged mouse FAP ECD. SEQ ID NOs 92 and 93 show the amino acid and nucleotide sequences, respectively, of a His-tagged cynomolgus FAP ECD. Preferably, an anti-FAP binding molecule of the invention binds to the extracellular domain of FAP. Exemplary anti-FAP binding molecules are described in International Patent Application No. WO 2012/020006 A2.
The term "Carcinoembroynic antigen (CEA)", also known as Carcinoembryonic antigen- related cell adhesion molecule 5 (CEACAM5), refers to any native CEA from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g.
cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated. The amino acid sequence of human CEA is shown in UniProt accession no. P06731 (version 151, SEQ ID NO: 94). CEA has long been identified as a tumor-associated antigen (Gold and Freedman, J Exp Med., 121 :439-462, 1965; Berinstein N. L., J Clin Oncol, 20:2197-2207, 2002). Originally classified as a protein expressed only in fetal tissue, CEA has now been identified in several normal adult tissues. These tissues are primarily epithelial in origin, including cells of the gastrointestinal, respiratory, and urogential tracts, and cells of colon, cervix, sweat glands, and prostate (Nap et al, Tumour Biol, 9(2-3): 145-53, 1988; Nap et al, Cancer Res., 52(8):2329- 23339, 1992). Tumors of epithelial origin, as well as their metastases, contain CEA as a tumor associated antigen. While the presence of CEA itself does not indicate transformation to a cancerous cell, the distribution of CEA is indicative. In normal tissue, CEA is generally expressed on the apical surface of the cell (Hammarstrom S., Semin Cancer Biol. 9(2):67-81 (1999)), making it inaccessible to antibody in the blood stream. In contrast to normal tissue, CEA tends to be expressed over the entire surface of cancerous cells (Hammarstrom S., Semin Cancer Biol. 9(2):67-81 (1999)). This change of expression pattern makes CEA accessible to antibody binding in cancerous cells. In addition, CEA expression increases in cancerous cells. Furthermore, increased CEA expression promotes increased intercellular adhesions, which may lead to metastasis (Marshall J., Semin Oncol, 30(a Suppl. 8):30-6, 2003). The prevalence of CEA expression in various tumor entities is generally very high. In concordance with published
data, own analyses performed in tissue samples confirmed its high prevalence, with approximately 95% in colorectal carcinoma (CRC), 90% in pancreatic cancer, 80% in gastric cancer, 60%> in non-small cell lung cancer (NSCLC, where it is co-expressed with HER3), and 40% in breast cancer; low expression was found in small cell lung cancer and glioblastoma. CEA is readily cleaved from the cell surface and shed into the blood stream from tumors, either directly or via the lymphatics. Because of this property, the level of serum CEA has been used as a clinical marker for diagnosis of cancers and screening for recurrence of cancers, particularly colorectal cancer (Goldenberg D M., The International Journal of Biological
Markers, 7: 183-188, 1992; Chau I., et al, J Clin Oncol, 22: 1420-1429, 2004; Flamini et al, Clin Cancer Res; 12(23):6985-6988, 2006).
The term "Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP)", also known as Chondroitin Sulfate Proteoglycan 4 (CSPG4) refers to any native MCSP from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated. The amino acid sequence of human MCSP is shown in UniProt accession no. Q6UVK1 (version 103, SEQ ID NO:95). The term "Epidermal Growth Factor Receptor (EGFR)", also named Proto- oncogene c-ErbB-1 or Receptor tyro sine-protein kinase erbB-1, refers to any native EGFR from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated. The amino acid sequence of human EGFR is shown in UniProt accession no. P00533 (version 211, SEQ ID NO:96).
The term "CD19" refers to B-lymphocyte antigen CD19, also known as B-lymphocyte surface antigen B4 or T-cell surface antigen Leu- 12 and includes any native CD 19 from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated. The amino acid sequence of human CD19 is shown in Uniprot accession no. P15391 (version 160, SEQ ID NO:97). The term encompasses "full-length" unprocessed human CD19 as well as any form of human CD 19 that results from processing in the cell as long as the antibody as reported herein binds thereto. CD 19 is a structurally distinct cell surface receptor expressed on the surface of human B cells, including, but not limited to, pre-B cells, B cells in early development {i.e., immature B cells), mature B cells through terminal differentiation into plasma cells, and malignant B cells. CD 19 is expressed by most pre-B acute lymphoblastic leukemias (ALL), non- Hodgkin's lymphomas, B cell chronic lymphocytic leukemias (CLL), pro-lymphocytic leukemias, hairy cell leukemias, common acute lymphocytic leukemias, and some Null-acute lymphoblastic leukemias. The expression of CD 19 on plasma cells further suggests it may be expressed on differentiated B cell tumors such as multiple myeloma. Therefore, the CD 19 antigen is a target
for immunotherapy in the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
"CD20" refers to B-lymphocyte antigen CD20, also known as membrane-spanning 4- domains subfamily A member 1 (MS4A1), B-lymphocyte surface antigen Bl or Leukocyte surface antigen Leu- 16, and includes any native CD20 from any vertebrate source, including mammals such as primates (e.g. humans) non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated. The amino acid sequence of human CD20 is shown in Uniprot accession no. PI 1836 (version 149, SEQ ID NO:98). "CD33" refers to Myeloid cell surface antigen CD33, also known as SIGLEC3 or gp67, and includes any native CD33 from any vertebrate source, including mammals such as primates (e.g. humans) non- human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated. The amino acid sequence of human CD33 is shown in Uniprot accession no. P20138 (version 157, SEQ ID NO:99).
The term "variable region" or "variable domain" refers to the domain of an antibody heavy or light chain that is involved in binding the antigen binding molecule to antigen. The variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs). See, e.g., Kindt et al, Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007). A single VH or VL may be sufficient to confer antigen-binding specificity.
The term "hypervariable region" or "HVR," as used herein refers to each of the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops ("hypervariable loops"). Generally, native four-chain antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3). HVRs generally comprise amino acid residues from the hypervariable loops and/or from the "complementarity determining regions" (CDRs), the latter being of highest sequence variability and/or involved in antigen recognition. Exemplary hypervariable loops occur at amino acid residues 26-32 (LI), 50- 52 (L2), 91-96 (L3), 26-32 (HI), 53-55 (H2), and 96-101 (H3). (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987).) Exemplary CDRs (CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3) occur at amino acid residues 24-34 of LI, 50-56 of L2, 89-97 of L3, 31-35B of HI, 50-65 of H2, and 95-102 of H3. (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991).)
Hypervariable regions (HVRs) are also referred to as complementarity determining regions (CDRs), and these terms are used herein interchangeably in reference to portions of the variable region that form the antigen binding regions. This particular region has been described by Kabat et al, U.S. Dept. of Health and Human Services, "Sequences of Proteins of Immunological
Interest" (1983) and by Chothia et al, J. Mol. Biol. 196:901-917 (1987), where the definitions include overlapping or subsets of amino acid residues when compared against each other.
Nevertheless, application of either definition to refer to a CDR of an antibody or variants thereof is intended to be within the scope of the term as defined and used herein. The appropriate amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth below in Table A as a comparison. The exact residue numbers which encompass a particular CDR will vary depending on the sequence and size of the CDR. Those skilled in the art can routinely determine which residues comprise a particular CDR given the variable region amino acid sequence of the antibody
Table A. CDR Definitions1
1 Numbering of all CDR definitions in Table A is according to the numbering conventions set forth by Kabat et al. (see below).
2 "AbM" with a lowercase "b" as used in Table A refers to the CDRs as
defined by Oxford Molecular's "AbM" antibody modeling software. Kabat et al. also defined a numbering system for variable region sequences that is applicable to any antibody. One of ordinary skill in the art can unambiguously assign this system of "Kabat numbering" to any variable region sequence, without reliance on any experimental data beyond the sequence itself. As used herein, "Kabat numbering" refers to the numbering system set forth by Kabat et al, U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest" (1983). Unless otherwise specified, references to the numbering of specific amino acid residue positions in an antibody variable region are according to the Kabat numbering system.
With the exception of CDRl in VH, CDRs generally comprise the amino acid residues that form the hypervariable loops. CDRs also comprise "specificity determining residues," or "SDRs," which are residues that contact antigen. SDRs are contained within regions of the CDRs called abbreviated-CDRs, or a-CDRs. Exemplary a-CDRs (a-CDR-Ll, a-CDR-L2, a-CDR-L3, a- CDR-H1 , a-CDR-H2, and a-CDR-H3) occur at amino acid residues 31-34 of LI , 50-55 of L2, 89-96 of L3, 31-35B of HI, 50-58 of H2, and 95-102 of H3. (See Almagro and Fransson, Front.
Biosci. 13: 1619-1633 (2008).) Unless otherwise indicated, HVR residues and other residues in the variable domain (e.g., FR residues) are numbered herein according to Kabat et al., supra.
As used herein, the term "affinity matured" in the context of antigen binding molecules (e.g., antibodies) refers to an antigen binding molecule that is derived from a reference antigen binding molecule, e.g., by mutation, binds to the same antigen, preferably binds to the same epitope, as the reference antibody; and has a higher affinity for the antigen than that of the reference antigen binding molecule. Affinity maturation generally involves modification of one or more amino acid residues in one or more CDRs of the antigen binding molecule. Typically, the affinity matured antigen binding molecule binds to the same epitope as the initial reference antigen binding mo lecule .
"Framework" or "FR" refers to variable domain residues other than hypervariable region (HVR) residues. The FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4. An "acceptor human framework" for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below. An acceptor human framework "derived from" a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less. In some embodiments, the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence. The term "chimeric" antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
The "class" of an antibody refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgGi, IgG2, IgG3, IgG4, IgAi, and IgA2. The heavy chain constant domains that correspond to the different classes of immunoglobulins are called α, δ, ε, γ, and μ respectively.
A "humanized" antibody refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs. In certain embodiments, a
humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non- human antibody, and all or substantially all of the FRs correspond to those of a human antibody. A humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody. A "humanized form" of an antibody, e.g., a non-human antibody, refers to an antibody that has undergone humanization. Other forms of "humanized antibodies" encompassed by the present invention are those in which the constant region has been additionally modified or changed from that of the original antibody to generate the properties according to the invention, especially in regard to Clq binding and/or Fc receptor (FcR) binding.
A "human" antibody is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non- human antigen-binding residues.
The term "Fc domain" or "Fc region" herein is used to define a C-terminal region of an antibody heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. An IgG Fc region comprises an IgG CH2 and an IgG CH3 domain. The "CH2 domain" of a human IgG Fc region usually extends from an amino acid residue at about position 231 to an amino acid residue at about position 340. In one embodiment, a carbohydrate chain is attached to the CH2 domain. The CH2 domain herein may be a native sequence CH2 domain or variant CH2 domain. The "CH3 domain" comprises the stretch of residues C-terminal to a CH2 domain in an Fc region (i.e. from an amino acid residue at about position 341 to an amino acid residue at about position 447 of an IgG). The CH3 region herein may be a native sequence CH3 domain or a variant CH3 domain (e.g. a CH3 domain with an introduced "protuberance" ("knob") in one chain thereof and a corresponding introduced "cavity" ("hole") in the other chain thereof; see US Patent No. 5,821,333, expressly incorporated herein by reference). Such variant CH3 domains may be used to promote heterodimerization of two non- identical antibody heavy chains as herein described. In one embodiment, a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
The "knob-into-hole" technology is described e.g. in US 5,731,168; US 7,695,936;
Ridgway et al, Prot Eng 9, 617-621 (1996) and Carter, J Immunol Meth 248, 7-15 (2001).
Generally, the method involves introducing a protuberance ("knob") at the interface of a first polypeptide and a corresponding cavity ("hole") in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation. Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g. tyrosine or tryptophan). Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). The protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g. by site-specific mutagenesis, or by peptide synthesis. In a specific embodiment a knob modification comprises the amino acid substitution T366W in one of the two subunits of the Fc domain, and the hole modification comprises the amino acid substitutions T366S, L368A and Y407V in the other one of the two subunits of the Fc domain. In a further specific embodiment, the subunit of the Fc domain comprising the knob modification additionally comprises the amino acid substitution S354C, and the subunit of the Fc domain comprising the hole modification additionally comprises the amino acid substitution Y349C. Introduction of these two cysteine residues results in the formation of a disulfide bridge between the two subunits of the Fc region, thus further stabilizing the dimer (Carter, J Immunol Methods 248, 7-15 (2001)).
A "region equivalent to the Fc region of an immunoglobulin" is intended to include naturally occurring allelic variants of the Fc region of an immunoglobulin as well as variants having alterations which produce substitutions, additions, or deletions but which do not decrease substantially the ability of the immunoglobulin to mediate effector functions (such as antibody- dependent cellular cytotoxicity). For example, one or more amino acids can be deleted from the N-terminus or C-terminus of the Fc region of an immunoglobulin without substantial loss of biological function. Such variants can be selected according to general rules known in the art so as to have minimal effect on activity (see, e.g., Bowie, J. U. et al, Science 247: 1306-10 (1990)).
The term "effector functions" refers to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: Clq binding and complement dependent cytotoxicity (CDC), Fc receptor binding, antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune complex-mediated antigen uptake by antigen presenting cells, down regulation of cell surface receptors (e.g. B cell receptor), and B cell activation.
Fc receptor binding dependent effector functions can be mediated by the interaction of the Fc-region of an antibody with Fc receptors (FcRs), which are specialized cell surface receptors on hematopoietic cells. Fc receptors belong to the immunoglobulin superfamily, and have been shown to mediate both the removal of antibody-coated pathogens by phagocytosis of immune complexes, and the lysis of erythrocytes and various other cellular targets (e.g. tumor cells) coated with the corresponding antibody, via antibody dependent cell mediated cytotoxicity (ADCC) (see e.g. Van de Winkel, J.G. anderson, C.L., J. Leukoc. Biol. 49 (1991) 511-524). FcRs are defined by their specificity for immunoglobulin isotypes: Fc receptors for IgG antibodies are referred to as FcyR. Fc receptor binding is described e.g. in Ravetch, J.V. and Kinet, J.P., Annu. Rev. Immunol. 9 (1991) 457-492; Capel, P.J., et al, Immunomethods 4 (1994) 25-34; de Haas, M., et al, J. Lab. Clin. Med. 126 (1995) 330-341; and Gessner, J.E., et al, Ann. Hematol. 76 (1998) 231-248.
Cross-linking of receptors for the Fc-region of IgG antibodies (FcyR) triggers a wide variety of effector functions including phagocytosis, antibody-dependent cellular cytotoxicity, and release of inflammatory mediators, as well as immune complex clearance and regulation of antibody production. In humans, three classes of FcyR have been characterized, which are:
- FcyRI (CD64) binds monomeric IgG with high affinity and is expressed on macrophages, monocytes, neutrophils and eosinophils. Modification in the Fc-region IgG at least at one of the amino acid residues E233-G236, P238, D265, N297, A327 and P329 (numbering according to EU index of Kabat) reduce binding to FcyRI. IgG2 residues at positions 233-236, substituted into IgGl and IgG4, reduced binding to FcyRI by 103-fold and eliminated the human monocyte response to antibody-sensitized red blood cells (Armour, K.L., et al, Eur. J. Immunol. 29 (1999) 2613-2624).
-FcyRII (CD32) binds complexed IgG with medium to low affinity and is widely expressed. This receptor can be divided into two sub-types, FcyRII A and FcyRIIB. FcyRII A is found on many cells involved in killing (e.g. macrophages, monocytes, neutrophils) and seems able to activate the killing process. FcyRIIB seems to play a role in inhibitory processes and is found on B cells, macrophages and on mast cells and eosinophils. On B-cells it seems to function to suppress further immunoglobulin production and isotype switching to, for example, the IgE class. On macrophages, FcyRIIB acts to inhibit phagocytosis as mediated through FcyRIIA. On eosinophils and mast cells the B-form may help to suppress activation of these cells through IgE binding to its separate receptor. Reduced binding for FcyRIIA is found e.g. for antibodies comprising an IgG Fc-region with mutations at least at one of the amino acid residues E233- G236, P238, D265, N297, A327, P329, D270, Q295, A327, R292, and K414 (numbering according to EU index of Kabat).
- FcyRIII (CD 16) binds IgG with medium to low affinity and exists as two types. FcyRIIIA is found on NK cells, macrophages, eosinophils and some monocytes and T cells and mediates
ADCC. Fc γ RIIIB is highly expressed on neutrophils. Reduced binding to FcyRIIIA is found e.g. for antibodies comprising an IgG Fc-region with mutation at least at one of the amino acid residues E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, S239, E269, E293, Y296, V303, A327, K338 and D376 (numbering according to EU index of Kabat).
Mapping of the binding sites on human IgGl for Fc receptors, the above mentioned mutation sites and methods for measuring binding to FcyRI and FcyRIIA are described in Shields, R.L., et al. J. Biol. Chem. 276 (2001) 6591-6604.
The term "ADCC" or "antibody-dependent cellular cytotoxicity" is a function mediated by Fc receptor binding and refers to lysis of target cells by an antibody as reported herein in the presence of effector cells. The capacity of the antibody to induce the initial steps mediating
ADCC is investigated by measuring their binding to Fey receptors expressing cells, such as cells, recombinantly expressing FcyRI and/or FcyRIIA or NK cells (expressing essentially FcyRIIIA). In particular, binding to FcyR on NK cells is measured.
An "activating Fc receptor" is an Fc receptor that following engagement by an Fc region of an antibody elicits signaling events that stimulate the receptor-bearing cell to perform effector functions. Activating Fc receptors include FcyRIIIa (CD 16a), FcyRI (CD64), FcyRIIa (CD32), and FcaRI (CD89). A particular activating Fc receptor is human FcyRIIIa (see UniProt accession no. P08637, version 141).
The "Tumor Necrosis factor receptor superfamily" or "TNF receptor superfamily" currently consists of 27 receptors. It is a group of cytokine receptors characterized by the ability to bind tumor necrosis factors (TNFs) via an extracellular cysteine-rich domain (CRD). These pseudorepeats are defined by intrachain disulphides generated by highly conserved cysteine residues within the receptor chains. With the exception of nerve growth factor (NGF), all TNFs are homologous to the archetypal TNF-alpha. In their active form, the majority of TNF receptors form trimeric complexes in the plasma membrame. Accordingly, most TNF receptors contain transmembrane domains (TMDs). Several of these receptors also contain intracellular death domains (DDs) that recruit caspase-interacting proteins following ligand binding to initiate the extrinsic pathway of caspase activation. Other TNF superfamily receptors that lack death domains bind TNF receptor-associated factors and activate intracellular signaling pathways that can lead to proliferation or differentiation. These receptors can also initiate apoptosis, but they do so via indirect mechanisms. In addition to regulating apoptosis, several TNF superfamily receptors are involved in regulating immune cell functions such as B cell homeostasis and activation, natural killer cell activation, and T cell co-stimulation. Several others regulate cell type-specific responses such as hair follicle development and osteoclast development. Members of the TNF receptor superfamily include the following: Tumor necrosis factor receptor 1 (1 A) (TNFRSF1A, CD120a), Tumor necrosis factor receptor 2 (IB) (TNFRSF1B, CD120b),
Lymphotoxin beta receptor (LTBR, CD 18), OX40 (TNFRSF4, CD 134), CD40 (Bp50), Fas receptor (Apo-1, CD95, FAS), Decoy receptor 3 (TR6, M68, TNFRSF6B), CD27 (S152, Tp55), CD30 (Ki-1, TNFRSF8), 4- IBB (CD137, TNFRSF9), DR4 (TRAILR1, Apo-2, CD261, TNFRSF10A), DR5 (TRAILR2, CD262, TNFRSF10B), Decoy Receptor 1 (TRAILR3, CD263, TNFRSF10C), Decoy Receptor 2 (TRAILR4, CD264, TNFRSF10D), RANK (CD265,
TNFRSF11A), Osteoprotegerin (OCIF, TR1, TNFRSF1 IB), TWEAK receptor (Fnl4, CD266, TNFRSF12A), TACI (CD267, TNFRSF13B), BAFF receptor (CD268, TNFRSF13C),
Herpesvirus entry mediator (HVEM, TR2, CD270, TNFRSF14), Nerve growth factor receptor (p75NTR, CD271 , NGFR), B-cell maturation antigen (CD269, TNFRSF17), Glucocorticoid- induced TNFR-related (GITR, AITR, CD357, TNFRSF18), TROY (TNFRSF19), DR6 (CD358, TNFRSF21), DR3 (Apo-3, TRAMP, WS-1, TNFRSF25) and Ectodysplasin A2 receptor (XEDAR, EDA2R).
Several members of the tumor necrosis factor receptor (TNFR) family function after initial T cell activation to sustain T cell responses. The term "costimulatory TNF receptor family member" or "costimulatory TNF family receptor" refers to a subgroup of TNF receptor family members, which are able to costimulate proliferation and cytokine production of T-cells. The term refers to any native TNF family receptor from any vertebrate source, including mammals such as primates (e.g. humans), non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated. In specific embodiments of the invention, costimulatory TNF receptor family members are selected from the group consisting of OX40 (CD134), 4-1BB (CD137), CD27, HVEM (CD270), CD30, and GITR, all of which can have costimulatory effects on T cells. More particularly, the costimulatory TNF receptor family member is selected from the group consisting of OX40 and 4- IBB.
Further information, in particular sequences, of the TNF receptor family members may be obtained from publically accessible databases such as Uniprot (www.uniprot.org). For instance, the human costimulatory TNF receptors have the following amino acid sequences: human OX40 (UniProt accession no. P43489, SEQ ID NO: 100), human 4-1BB (UniProt accession no.
Q07011, SEQ ID NO: 101), human CD27 (UniProt accession no. P26842, SEQ ID NO: 102), human HVEM (UniProt accession no. Q92956, SEQ ID NO: 103), human CD30 (UniProt accession no. P28908, SEQ ID NO: 104), and human GITR (UniProt accession no. Q9Y5U5, SEQ ID NO: 105).
The term "OX40", as used herein, refers to any native OX40 from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated. The term encompasses "full-length," unprocessed OX40 as well as any form of OX40 that results from processing in the cell. The term also encompasses naturally occurring variants of OX40, e.g., splice variants or allelic variants. The amino acid sequence of an
exemplary human OX40 is shown in SEQ ID NO: 100 (Uniprot P43489, version 112) and the amino acid sequence of an exemplary murine OX40 is shown in SEQ ID NO: 106 (Uniprot P47741, version 101).
The terms "anti-OX40 antibody", "anti-OX40", "OX40 antibody and "an antibody that specifically binds to OX40" refer to an antibody that is capable of binding OX40 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting OX40. In one embodiment, the extent of binding of an anti-OX40 antibody to an unrelated, non- OX40 protein is less than about 10% of the binding of the antibody to OX40 as measured, e.g., by a radioimmunoassay (RIA) or flow cytometry (FACS). In certain embodiments, an antibody that binds to OX40 has a dissociation constant ( KD) of < ΙμΜ, < 100 nM, < 10 nM, < 1 nM,
< 0.1 nM, < 0.01 nM, or < 0.001 nM (e.g. 10"6 M or less, e.g. from 10~68 M to 10"13 M, e.g., from 10~8 M to 10"10 M).
The term "4-lBB", as used herein, refers to any native 4-lBB from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated. The term encompasses "full-length," unprocessed 4- IBB as well as any form of 4- IBB that results from processing in the cell. The term also encompasses naturally occurring variants of 4-lBB, e.g., splice variants or allelic variants. The amino acid sequence of an exemplary human 4- IBB is shown in SEQ ID NO: 101 (Uniprot accession no. Q07011), the amino acid sequence of an exemplary murine 4- IBB is shown in SEQ ID NO: 107 (Uniprot accession no. P20334) and the amino acid sequence of an exemplary cynomolgous 4-lBB (from Macaca mulatta) is shown in SEQ ID NO: 108 (Uniprot accession no. F6W5G6).
The terms "anti-4-lBB antibody", "anti-4-lBB", "4-lBB antibody and "an antibody that specifically binds to 4- IBB" refer to an antibody that is capable of binding 4- IBB with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting 4- IBB. In one embodiment, the extent of binding of an anti-4-lBB antibody to an unrelated, non- 4-1BB protein is less than about 10% of the binding of the antibody to 4-lBB as measured, e.g., by a radioimmunoassay (RIA) or flow cytometry (FACS). In certain embodiments, an antibody that binds to 4- IBB has a dissociation constant ( KD) of < ΙμΜ, < 100 nM, < 10 nM, < 1 nM,
< 0.1 nM, < 0.01 nM, or < 0.001 nM (e.g. 10"6 M or less, e.g. from 10~68 M to 10"13 M, e.g., from 10~8 M to 10~10 M).
The term "peptide linker" refers to a peptide comprising one or more amino acids, typically about 2 to 20 amino acids. Peptide linkers are known in the art or are described herein. Suitable, non-immunogenic linker peptides are, for example, (G4S)n, (SG4)n or G4(SG4)n peptide linkers, wherein "n" is generally a number between 1 and 10, typically between 1 and 4, in particular 2, i.e. the peptides selected from the group consisting of GGGGS (SEQ ID NO: 109),
GGGGSGGGGS (SEQ ID NO: 110), SGGGGSGGGG (SEQ ID NO: 111), (G4S)3 or GGGGSGGGGSGGGGS (SEQ ID NO: l 12), GGGGSGGGGSGGGG or G4(SG4)2 (SEQ ID NO: 113), and (G4S)4 or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 114), but also include the sequences GSPGSSSSGS (SEQ ID NO: 115), GSGSGSGS (SEQ ID NO: 116), GSGSGNGS (SEQ ID NO: 117), GGSGSGSG (SEQ ID NO: 118), GGSGSG (SEQ ID NO: 119), GGSG (SEQ ID NO: 120), GGSGNGSG (SEQ ID NO: 121), GGNGSGSG (SEQ ID NO:122) and GGNGSG (SEQ ID NO: 123). Peptide linkers of particular interest are (G4S)i or GGGGS (SEQ ID
NO: 109), (G4S)2 or GGGGSGGGGS (SEQ ID NO: l 10), (G4S)3 or GGGGSGGGGSGGGGS (SEQ ID NO: l 12) and (G4S)4 or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: l 14). The term "amino acid" as used within this application denotes the group of naturally occurring carboxy a-amino acids comprising alanine (three letter code: ala, one letter code: A), arginine (arg, R), asparagine (asn, N), aspartic acid (asp, D), cysteine (cys, C), glutamine (gin, Q), glutamic acid (glu, E), glycine (gly, G), histidine (his, H), isoleucine (ile, I), leucine (leu, L), lysine (lys, K), methionine (met, M), phenylalanine (phe, F), proline (pro, P), serine (ser, S), threonine (thr, T), tryptophan (trp, W), tyrosine (tyr, Y), and valine (val, V).
A "fusion polypeptide" as used herein refers to a single chain polypeptide comprising a heavy chain variable domain (VH) and/or light chain variable domain (VL) of a moiety capable of specific binding to a costimulatory TNF receptor family member, fused to a trimerization domain. In some embodiments, the fusion polypeptide further comprises a VH and/or VL of a moiety capable of specific binding to a target cell antigen. The fusion may occur by direc linking of the N- or C-terminal amino acids of the respective domains via a peptide linker. By "fused" or "connected" it is meant that the components are linked by peptide bonds, either directly or via one or more peptide linkers.
In some embodiments, the fusion polypeptide comprises a scFv fragment capable of specific binding to a costimulatory TNF receptor family member (i.e. the VH and VL domains of a scFv fragment). In some embodiments, the fusion polypeptide comprises the VH and CHI domains of a Fab fragment capable of binding to a costimulatory TNF receptor family member. In some embodiments, the fusion polypeptide comprises the VL and CL domains of a Fab fragment capable of binding to a costimulatory TNF receptor family member. In some embodiments, the fusion polypeptide comprises a scFv fragment capable of specific binding to a target cell antigen (i.e. the VH and VL domains of a scFv fragment). In some embodiments, the fusion polypeptide comprises the VH and CHI domains of a Fab fragment capable of binding to a target cell antigen. In some embodiments, the fusion
polypeptide comprises the VL and CL domains of a Fab fragment capable of binding to a target cell antigen.
The term "trimerization domain" refers to an amino acid sequence within a polypeptide that promotes self-assembly by associating with two other trimerization domains to form a trimer. The term is also use to refer to the polynucleotide encoding said amino acid sequence. Typically, the trimerization domain comprises an amino acid sequence able to form an alpha-helicial coiled-coil domain or an isoleucine zipper domain. Suitable trimerization domains include
TRAF2 (UniProt accession no. Q12933, SEQ ID NO: 124), in particular amino acids 299 to 348 or amino acids 310 to 349), Thrombospondin 1 (UniProt accession no. P07996, SEQ ID
NO: 125), in particular amino acids 291 to 314), Matrilin-4 (UniProt accession no. 095460, SEQ ID NO: 126), in particular amino acids 594 to 618; CMP (matrilin-1) (Uniprot accession No. P21941, SEQ ID NO: l), in particular amino acids 454 to 496, and Cubilin (UniProt accession no. 060494, SEQ ID NO: 127), in particular amino acids 104 to 138. An exemplary isoleucine zipper domain is the engineered yeast GCN4 isoleucine variant described by Harbury et al. (1993) Science 262, 1401- 1407 comprising the amino acid sequence of SEQ ID NO: 128.
A particular trimerization domain is "huCMP" or "CMP" or "human cartilage matrix protein", a protein that is also known as matrilin-1 or MATN1 or CRTM (UniProt accession no. P21941, SEQ ID NO: l). The term "huCMP trimerization domain" or "trimerization domain derived from human cartilage matrix protein (CMP)" refers to a polypeptide structure capable of associating with two similar or identical polypeptides to form a stable trimer.The trimerisation is mediated through ionic bonds and other non-covalent bonds formed between adjacent charged amino acids of the polypeptide chains. The huCMP trimerization domain has been been described e.g. in Beck et al (1996), J. Mol. Biol. 256, 909-923. A huCMP trimerization domain of particular interes comprises a sequence having at least 95% identity and most preferably at least 98% identity to SEQ ID NO 2. In one embodiment said trimerization domain comprises the sequence of SEQ ID NO. 2. "Percent (%) amino acid sequence identity" with respect to a reference polypeptide
(protein) sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN. SAWI or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN- 2 sequence comparison computer program was authored by Genentech, Inc., and the source code
has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary. In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows:
100 times the fraction X/Y where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program.
In certain embodiments, amino acid sequence variants of the trimeric antigen binding molecules provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the trimeric antigen binding molecules. Amino acid sequence variants of the trimeric antigen binding molecules may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the molecules, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen-binding. Sites of interest for substitutional mutagenesis include the HVRs and Framework (FRs). Conservative substitutions are provided in Table B under the heading "Preferred Substitutions" and further described below in reference to amino acid side chain classes (1) to (6). Amino acid substitutions may be introduced into the molecule of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
Table B.
Amino acids may be grouped according to common side-chain properties:
(1) hydrophobic: Norleucine, Met, Ala, Val, Leu, He;
(2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin;
(3) acidic: Asp, Glu;
(4) basic: His, Lys, Arg;
(5) residues that influence chain orientation: Gly, Pro;
(6) aromatic: Trp, Tyr, Phe.
Non-conservative substitutions will entail exchanging a member of one of these classesother class.
The term "amino acid sequence variants" includes substantial variants wherein there are amino acid substitutions in one or more hypervariable region residues of a parent antigen binding molecule (e.g. a humanized or human antibody). Generally, the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antigen binding molecule and/or will have substantially retained certain biological properties of the parent antigen binding molecule. An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antigen binding molecules displayed on phage and screened for a particular biological activity (e.g. binding affinity). In certain embodiments, substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antigen binding molecule to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs. A useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells (1989) Science, 244: 1081-1085. In this method, a residue or group of target residues (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to determine whether the interaction of the antibody with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antigen binding molecule complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include the fusion to the N- or C-terminus to a polypeptide which increases the serum half-life of the trimeric antigen binding molecules.
In certain aspects, the trimeric antigen binding molecules provided herein are altered to increase or decrease the extent to which the antibody is glycosylated. Glycosylation variants of the molecules may be conveniently obtained by altering the amino acid sequence such that one or more glycosylation sites is created or removed. In certain aspects, the trimeric antigen binding molecules provided herein may be further modified to contain additional non-proteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization
of the antigen binding molecule include but are not limited to water soluble polymers. Non- limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-l,3,6-trioxane,
ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer is attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antigen binding molecule to be improved. The term "polynucleotide" refers to an isolated nucleic acid molecule or construct, e.g. messenger RNA (mRNA), virally-derived RNA, or plasmid DNA (pDNA). A polynucleotide may comprise a conventional phosphodiester bond or a non-conventional bond (e.g. an amide bond, such as found in peptide nucleic acids (PNA). The term "nucleic acid molecule" refers to any one or more nucleic acid segments, e.g. DNA or RNA fragments, present in a polynucleotide. By "isolated" nucleic acid molecule or polynucleotide is intended a nucleic acid molecule,
DNA or RNA, which has been removed from its native environment. For example, a
recombinant polynucleotide encoding a polypeptide contained in a vector is considered isolated for the purposes of the present invention. Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in solution. An isolated polynucleotide includes a polynucleotide molecule contained in cells that ordinarily contain the polynucleotide molecule, but the polynucleotide molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location. Isolated RNA molecules include in vivo or in vitro RNA transcripts of the present invention, as well as positive and negative strand forms, and double-stranded forms. Isolated polynucleotides or nucleic acids according to the present invention further include such molecules produced synthetically. In addition, a polynucleotide or a nucleic acid may be or may include a regulatory element such as a promoter, ribosome binding site, or a transcription terminator.
By a nucleic acid or polynucleotide having a nucleotide sequence at least, for example, 95% "identical" to a reference nucleotide sequence of the present invention, it is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the
polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence. In other words, to obtain a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence. These alterations of the reference sequence may occur at the 5' or 3' terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence. As a practical matter, whether any particular polynucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence of the present invention can be determined conventionally using known computer programs, such as the ones discussed above for polypeptides (e.g.
ALIGN-2).
The term "expression cassette" refers to a polynucleotide generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell. The recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment. Typically, the recombinant expression cassette portion of an expression vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter. In certain
embodiments, the expression cassette of the invention comprises polynucleotide sequences that encode bispecific antigen binding molecules of the invention or fragments thereof.
The term "vector" or "expression vector" is synonymous with "expression construct" and refers to a DNA molecule that is used to introduce and direct the expression of a specific gene to which it is operably associated in a target cell. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. The expression vector of the present invention comprises an expression cassette. Expression vectors allow transcription of large amounts of stable mRNA. Once the expression vector is inside the target cell, the ribonucleic acid molecule or protein that is encoded by the gene is produced by the cellular transcription and/or translation machinery. In one embodiment, the expression vector of the invention comprises an expression cassette that comprises polynucleotide sequences that encode bispecific antigen binding molecules of the invention or fragments thereof.
The terms "host cell", "host cell line," and "host cell culture" are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include "transformants" and "transformed cells," which include the primary transformed cell and progeny derived therefrom without regard to the number of passages.
Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein. A host cell is any type of cellular system that can be used to generate the bispecific antigen binding molecules of the present invention. Host cells include cultured cells, e.g. mammalian cultured cells, such as CHO cells, HEK cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, yeast cells, insect cells, and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue. An "effective amount" of an agent refers to the amount that is necessary to result in a physiological change in the cell or tissue to which it is administered.
A "therapeutically effective amount" of an agent, e.g. a pharmaceutical composition, refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result. A therapeutically effective amount of an agent for example eliminates, decreases, delays, minimizes or prevents adverse effects of a disease.
An "individual" or "subject" is a mammal. Mammals include, but are not limited to, domesticated animals (e.g. cows, sheep, cats, dogs, and horses), primates (e.g. humans and non- human primates such as monkeys), rabbits, and rodents (e.g. mice and rats). Particularly, the individual or subject is a human. In some embodiments, an individual or subject may be a patient. The term "pharmaceutical composition" refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
A "pharmaceutically acceptable excipient" refers to an ingredient in a pharmaceutical composition, other than an active ingredient, which is nontoxic to a subject. A pharmaceutically acceptable excipient includes, but is not limited to, a buffer, a stabilizer, or a preservative.
As used herein, "treatment" (and grammatical variations thereof such as "treat" or
"treating") refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect
pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
In some embodiments, the molecules of the invention are used to delay development of a disease or to slow the progression of a disease.
The term "cancer" as used herein refers to proliferative diseases, such as lymphomas, lymphocytic leukemias, lung cancer, non-small cell lung (NSCL) cancer, bronchioloalviolar cell lung cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, gastric cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis, mesothelioma, hepatocellular cancer, biliary cancer, neoplasms of the central nervous system (CNS), spinal axis tumors, brain stem glioma, glioblastoma
multiforme, astrocytomas, schwanomas, ependymonas, medulloblastomas, meningiomas, squamous cell carcinomas, pituitary adenoma and Ewings sarcoma, including refractory versions of any of the above cancers, or a combination of one or more of the above cancers.
Trimeric antigen binding molecules of the invention
The invention provides novel trimeric antigen binding molecules with particularly advantageous properties such as producibility, stability, binding affinity, biological activity, targeting efficiency and reduced toxicity.
The present invention provides a trimeric antigen binding molecule comprising three fusion polypeptides, each of the three fusion polypeptides comprising
(a) a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) of amino acid sequence of SEQ ID NO: l, and
(c) a moiety capable of specific binding to a target cell antigen.
Thus, disclosed herein is a trimeric antigen binding molecule comprising three fusion polypeptides, each of the three fusion polypeptides comprising
(a) a moiety capable of specific binding to a costimulatory TNF receptor family member,
(b) a trimerization domain, and
(c) a moiety capable of specific binding to a target cell antigen.
A trimerization domain can be derived from a polypeptide derived from a protein selected from the group consisting of human TRAF2, human thrombospondin 1, human matrilin-4,
human cartilage matrix protein (huCMP) and human cubilin. It can also be an isoleucine zipper domain, for example the peptide with the amino acid sequence of SEQ ID NO: 128. A trimeric antigen binding molecule of the invention comprises a trimerization domain derived from human cartilage matrix protein (huCMP) of amino acid sequence of SEQ ID NO: 1. The trimerization domain derived from human cartilage matrix protein (huCMP) comprises at least a part of SEQ ID NO.: 1. In one aspect, the trimerization domain comprises an amino acid sequence having at least 95% identity and most preferably at least 98% identity to SEQ ID NO:2. More particularly, the trimerization domain comprises the amino acid sequence of SEQ ID NO:2. The trimerization domain derived from human cartilage matrix protein (CMP) is herein further referred to as "huCMP trimerization domain".
The trimeric antigen binding molecule according to the present invention may associate to form trimers through disulphide bonds formed between the trimerisation domains of the fusion polypeptides.
In a particular aspect, the trimeric antigen binding molecule comprises three fusion polypeptides, each of the three fusion polypeptides comprising a trimerization domain comprising an amino acid sequence having at least 95% identity and in particular at least 98% identity to SEQ ID NO:2. More particularly, each of the three fusion polypeptides comprises one trimerization domain comprising the amino acid sequence of SEQ ID NO:2.
In some embodiments, the moiety capable of specific binding to a costimulatory TNF receptor family member is selected from the group consisting of is selected from the group consisting of an antibody, an antibody fragment and a scaffold antigen binding protein. In one aspect, the moiety capable of specific binding to a costimulatory TNF receptor family member is selected from the group consisting of an antibody fragment, a Fab molecule, a crossover Fab molecule, a single chain Fab molecule, a Fv molecule, a scFv molecule, a single domain antibody, an aVH and a scaffold antigen binding protein.
In some embodiments, the invention provides a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member is an antibody fragment. In particular, the antibody fragment is selected from the group consisting of a Fab molecule, a crossover Fab molecule, a single chain Fab molecule, a Fv molecule, a scFv molecule, a single domain antibody, and aVH. In one aspect, the moiety capable of specific binding to a target cell antigen is a single chain Fab molecule. In one aspect, the moiety capable of specific binding to a target cell antigen is a single domain antibody or an aVH.
In a further aspect, the invention provides a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member is a scaffold antigen binding protein. In particular, the moiety capable of specific binding to a costimulatory TNF receptor family member can be a specifically designed ankyrin repeat protein.
In a particular aspect, the invention is concerned with a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member is a Fab molecule capable of specific binding to a costimulatory TNF receptor family member. Thus, the invention provides an antigen binding molecule comprising (a) a Fab molecule capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) of amino acid sequence of SEQ ID NO: 1 , and (c) a moiety capable of specific binding to a target cell antigen.
In a further aspect, said Fab molecule is fused at the C-terminal amino acid of the CHI domain to the N-terminal amino acid of the trimerization domain, optionally through a peptide linker as defined herein.
In some embodiments, the costimulatory TNF receptor family member is selected from the group consisting of 4- IBB, OX40 and GITR. More particularly the costimulatory TNF receptor family member is selected from OX40 and 4- IBB.
In some embodiments, the moiety capable of specific binding to a costimulatory TNF receptor family member binds to OX40. In some embodiments, the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:3.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of
SEQ ID NO:4 and SEQ ID NO:5,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID
NO: 13 and SEQ ID NO: 14,
and a VL comprising
(iv) a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16 and SEQ ID NO: 17,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO:20, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 and SEQ ID NO:26.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises a VH comprising an amino acid sequence that is at least about 95%, 96%>, 97%, 98%>, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:27, SEQ ID NO: 29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO :37 and SEQ ID NO:39 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99%) or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:28, SEQ ID NO: 30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38 and SEQ ID NO:40. In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises
(a) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:4, CDR-H2 comprising the amino acid sequence of SEQ ID NO:6, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 8 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO : 15 , CDR-L2 comprising the amino acid sequence of SEQ ID NO : 18 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:21,
(b) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:4, CDR-H2 comprising the amino acid sequence of SEQ ID NO:6, CDR-H3 comprising the amino acid sequence of SEQ ID NO:9 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO : 15 , CDR-L2 comprising the amino acid sequence of SEQ ID NO : 18 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:22,
(c) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:4, CDR-H2 comprising the amino acid sequence of SEQ ID NO:6, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 10 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO: 15, CDR-L2 comprising the amino acid sequence of SEQ ID NO: 18 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:23,
(d) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:4, CDR-H2 comprising the amino acid sequence of SEQ ID NO:6, CDR-H3 comprising the amino acid sequence of SEQ ID NO: l 1 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO: 18, CDR-L2 comprising the amino acid sequence of SEQ ID NO: 16 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:24,
(e) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:5, CDR-H2 comprising the amino acid sequence of SEQ ID NO:7, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 12 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO: 16, CDR-L2 comprising the amino acid sequence of SEQ ID NO: 17 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:25,
(f) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:5, CDR-H2 comprising the amino acid sequence of SEQ ID NO:7, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 13 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO: 16, CDR-L2 comprising the amino acid sequence of SEQ ID NO: 17 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:25, or
(g) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:5, CDR-H2 comprising the amino acid sequence of SEQ ID NO:7, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 14 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO: 17, CDR-L2 comprising the amino acid sequence of SEQ ID NO: 18 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:26.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises
(i) a VH comprising the amino acid sequence of SEQ ID NO:27 and a VL comprising the amino acid sequence of SEQ ID NO:28,
(ii) a VH comprising the amino acid sequence of SEQ ID NO:29 and a VL comprising the amino acid sequence of SEQ ID NO:30,
(iii) a VH comprising the amino acid sequence of SEQ ID NO: 31 and a VL comprising the amino acid sequence of SEQ ID NO:32,
(iv) a VH comprising the amino acid sequence of SEQ ID NO:33 and a VL comprising the amino acid sequence of SEQ ID NO:34,
(v) a VH comprising the amino acid sequence of SEQ ID NO:35 and a VL comprising the amino acid sequence of SEQ ID NO:36,
(vi) a VH comprising the amino acid sequence of SEQ ID NO:37 and a VL comprising the amino acid sequence of SEQ ID NO:38, or
(vii) a VH comprising the amino acid sequence of SEQ ID NO:39 and a VL comprising the amino acid sequence of SEQ ID NO:40.
In some embodiments, the moiety capable of specific binding to a costimulatory TNF receptor family member binds to 4- IBB. In some embodiments, the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:41.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4- IBB, wherein the moiety comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:44 and SEQ ID NO:45, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50, and a VL comprising
(iv) a CDR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NO:51 and SEQ ID NO:52,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:53 and SEQ ID NO:54, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58 and SEQ ID NO:59.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises a VH comprising an amino acid sequence that is at least about 95%, 96%>, 97%, 98%, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66 and SEQ ID NO:68 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:61 , SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67 and SEQ ID NO:69.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises
(a) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:42, CDR-H2 comprising the amino acid sequence of SEQ ID NO:44, CDR-H3 comprising the amino acid sequence of SEQ ID NO:46 and a VL comprising CDR-Ll comprising the amino acid sequence of SEQ ID NO: 51, CDR-L2 comprising the amino acid sequence of SEQ ID NO:53 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:55,
(b) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:43, CDR-H2 comprising the amino acid sequence of SEQ ID NO:45, CDR-H3 comprising the amino acid sequence of SEQ ID NO:47 and a VL comprising CDR-Ll comprising the amino acid sequence of SEQ ID NO:52, CDR-L2 comprising the amino acid sequence of SEQ ID NO:54 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:56,
(c) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:42, CDR-H2 comprising the amino acid sequence of SEQ ID NO:44, CDR-H3 comprising the amino acid sequence of SEQ ID NO:48 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO: 51, CDR-L2 comprising the amino acid sequence of SEQ ID NO:53 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:57,
(d) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:42, CDR-H2 comprising the amino acid sequence of SEQ ID NO:44, CDR-H3 comprising the amino acid sequence of SEQ ID NO:49 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO: 51, CDR-L2 comprising the amino acid sequence of SEQ ID NO:53 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:58, or
(e) a VH comprising CDR-H1 comprising the amino acid sequence of SEQ ID NO:42, CDR-H2 comprising the amino acid sequence of SEQ ID NO:44, CDR-H3 comprising the amino acid sequence of SEQ ID NO:50 and a VL comprising CDR-L1 comprising the amino acid sequence of SEQ ID NO:51, CDR-L2 comprising the amino acid sequence of SEQ ID NO:53 and CDR-L3 comprising the amino acid sequence of SEQ ID NO:59.
In some embodiments, the trimeric antigen binding molecule comprises a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises (i) a VH comprising the amino acid sequence of SEQ ID NO: 60 and a VL comprising the amino acid sequence of SEQ ID NO:61,
(ii) a VH comprising the amino acid sequence of SEQ ID NO: 62 and a VL comprising the amino acid sequence of SEQ ID NO:63,
(iii) a VH comprising the amino acid sequence of SEQ ID NO: 64 and a VL comprising the amino acid sequence of SEQ ID NO:65,
(iv) a VH comprising the amino acid sequence of SEQ ID NO: 66 and a VL comprising the amino acid sequence of SEQ ID NO:67, or
(v) a VH comprising the amino acid sequence of SEQ ID NO:68 and a VL comprising the amino acid sequence of SEQ ID NO:69.
In another aspect, provided is a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein the moiety capable of specific binding to a
costimulatory TNF receptor family member is fused at the C-terminal amino acid to the N- terminal amino acid of the trimerization domain, optionally through a peptide linker. The fusion can be a direct bond between the moiety capable of specific binding to a costimulatory TNF receptor family member and the trimerization domain, or the moiety capable of specific binding to a costimulatory TNF receptor family member and the trimerization domain may be connected through a peptide linker. In a particular aspect, the moiety capable of specific binding to a
costimulatory TNF receptor family member and the trimerization domain are connected through a peptide linker.
Typically, the peptide linker is a peptide comprising 2 to 20 amino acids. In particular, the peptide linker is a peptide selected from the group consisting of GGGGS (SEQ ID NO: 109), GGGGSGGGGS (SEQ ID NO: 110), SGGGGSGGGG (SEQ ID NO: 111), (G4S)3 or
GGGGSGGGGSGGGGS (SEQ ID NO: l 12), GGGGSGGGGSGGGG or G4(SG4)2 (SEQ ID NO: 113), and (G4S)4 or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 114), but also include the sequences GSPGSSSSGS (SEQ ID NO: 115), GSGSGSGS (SEQ ID NO: 116), GSGSGNGS (SEQ ID NO: 117), GGSGSGSG (SEQ ID NO: 118), GGSGSG (SEQ ID NO: 119), GGSG (SEQ ID NO: 120), GGSGNGSG (SEQ ID NO: 121), GGNGSGSG (SEQ ID NO: 122) and GGNGSG (SEQ ID NO: 123). More particularly, the peptide linker is selected from (G4S)i or GGGGS (SEQ ID NO : 109), (G4S)2 or GGGGSGGGGS (SEQ ID NO : 110), (G4S)3 or
GGGGSGGGGSGGGGS (SEQ ID NO: 112) and (G4S)4 or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: l 14). Most particularly, the moiety capable of specific binding to a costimulatory TNF receptor family member and the huCMP trimerization domain are connected by a peptide linker of SEQ ID NO: 114.
In a further aspect, provided is a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein the moiety capable of specific binding to a target cell antigen is fused at the N-terminal amino acid to the C-terminal amino acid of the trimerization domain, optionally through a peptide linker. In a particular aspect, the trimerization domain and the moiety capable of specific binding to a target cell antigen are connected through a peptide linker.
In particular, the peptide linker is a peptide selected from the group consisting of GGGGS (SEQ ID NO: 109), GGGGSGGGGS (SEQ ID NO: 110), SGGGGSGGGG (SEQ ID NO: 111), (G4S)3 or GGGGSGGGGSGGGGS (SEQ ID NO : 112), GGGGSGGGGSGGGG or G4(SG4)2 (SEQ ID NO: l 13), and (G4S)4 or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: l 14), but also include the sequences GSPGSSSSGS (SEQ ID NO: l 15), GSGSGSGS (SEQ ID NO: l 16), GSGSGNGS (SEQ ID NO: 117), GGSGSGSG (SEQ ID NO: 118), GGSGSG (SEQ ID NO: 119), GGSG (SEQ ID NO: 120), GGSGNGSG (SEQ ID NO: 121), GGNGSGSG (SEQ ID NO: 122) and GGNGSG (SEQ ID NO: 123). More particularly, the peptide linker is selected from (G4S)i or GGGGS (SEQ ID NO: 109), (G4S)2 or GGGGSGGGGS (SEQ ID NO: l 10), (G4S)3 or GGGGSGGGGSGGGGS (SEQ ID NO: 112) and (G4S)4 or GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: l 14). Most particularly, the huCMP trimerization domain and the moiety capable of specific binding to a target cell antigen are connected by a peptide linker of SEQ ID NO: 110.
In another aspect, the invention provides a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein the moiety capable of specific binding to a target cell antigen is selected from the group consisting of is selected from the group consisting of an antibody, an antibody fragment and a scaffold antigen binding protein. In one aspect, the moiety capable of specific binding to a target cell antigen is selected from the group consisting of an antibody fragment, a Fab molecule, a crossover Fab molecule, a single chain Fab molecule, a Fv molecule, a scFv molecule, a single domain antibody, an aVH and a scaffold antigen binding protein.
In one aspect, the invention provides a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a target cell antigen is an antibody fragment. In particular, the antibody fragment is selected from the group consisting of a Fab molecule, a crossover Fab molecule, a single chain Fab molecule, a Fv molecule, a scFv molecule, a single domain antibody, and aVH. In one aspect, the moiety capable of specific binding to a target cell antigen is a single chain Fab molecule. In one aspect, the moiety capable of specific binding to a target cell antigen is a single domain antibody or an aVH.
In a further aspect, the invention provides a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a target cell antigen is a scaffold antigen binding protein. In particular, the moiety capable of specific binding to a target cell antigen can be a specifically designed ankyrin repeat protein. In a particular aspect, the invention is concerned with a trimeric antigen binding molecule as defined herein before, wherein the moiety capable of specific binding to a target cell antigen is a Fab molecule capable of specific binding to a target cell antigen. Thus, the invention provides an antigen binding molecule comprising (a) a moiety capable of specific binding to a
costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) of amino acid sequence of SEQ ID NO: 1 , and (c) a Fab molecule capable of specific binding to a target cell antigen.
In a further aspect, said Fab molecule is fused at the C-terminal amino acid of the CHI domain to the N-terminal amino acid of the trimerization domain, optionally through a peptide linker as defined above. In a further aspect, provided is a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein the target cell antigen is selected from the group consisting of Fibroblast Activation Protein (FAP), Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), Carcinoembryonic Antigen (CEA), CD 19, CD20 and CD33. In a particular aspect, the target cell antigen is Fibroblast
Activation Protein (FAP). In some embodiments, the moiety capable of specific binding to a target cell antigen binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:86.
In a further aspect, provided is a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein the moiety capable of specific binding to FAP comprises
(a) a VH comprising (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:70, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO:71 and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO: 72, and a VL comprising (iv) CDR-L1 comprising the amino acid sequence of SEQ ID NO:73, (v) CDR-L2 comprising the amino acid sequence of SEQ ID NO: 74 and (vi) CDR-L3 comprising the amino acid sequence of SEQ ID NO: 75 or
(b) a VH comprising (i) CDR-H1 comprising the amino acid sequence of SEQ ID NO:76, (ii) CDR-H2 comprising the amino acid sequence of SEQ ID NO: 77 and (iii) CDR-H3 comprising the amino acid sequence of SEQ ID NO:78, and a VL comprising (iv) CDR-L1 comprising the amino acid sequence of SEQ ID NO:79, (v) CDR-L2 comprising the amino acid sequence of SEQ ID NO : 80 and (vi) CDR-L3 comprising the amino acid sequence of SEQ ID NO : 81.
In a further aspect, the moiety capable of specific binding to FAP comprises a VH comprising an amino acid sequence that is at least about 95%, 96%>, 97%, 98%>, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 82 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 83.
In another aspect, the moiety capable of specific binding to FAP comprises a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 84 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 85.
In a further aspect, the moiety capable of specific binding to FAP comprises
(a) a VH comprising the amino acid sequence of SEQ ID NO: 82 and a VL comprising the amino acid sequence of SEQ ID NO:83, or (b) a VH comprising the amino acid sequence of SEQ ID NO: 84 and a VL comprising the amino acid sequence of SEQ ID NO: 85. In a further aspect, provided is a trimeric antigen binding molecule comprising three fusion polypeptides as described before, wherein said three fusion polypeptides are identical.
In some embodiments, the trimeric antigen binding molecules of the present invention are characterized by agonistic binding to a costimulatory TNF receptor family member. Particularly,
the costimulatory TNF receptor family member is selected from the group consisting of OX40 and 4- IBB.
In another aspect, the invention provides a fusion polypeptide comprising (a) a VH and/or VL of a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) comprising the amino acid sequence of SEQ ID NO:2, wherein the trimerization domain is capable of mediating stable association of the fusion polypeptide with two further such fusion polypeptides and (c) a VH and/or VL of a moiety capable of specific binding to a target cell antigen.
In some embodiments the fusion polypeptide comprises a VH of a moiety capable of specific binding to FAP, wherein the VH comprises
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:70 and SEQ ID NO:76,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:71 and SEQ ID NO:77, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:72 and SEQ ID NO:78.
In some embodiments the fusion polypeptide comprises a VH of a moiety capable of specific binding to FAP, wherein the VH comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:82 and SEQ ID NO:84.
In some embodiments the fusion polypeptide comprises a VL of a moiety capable of specific binding to FAP, wherein the VL comprises
(iv) a CDR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NO:73 and SEQ ID NO:79,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:74 and SEQ ID NO:80, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:75 and SEQ ID NO:81.
In some embodiments, the fusion polypeptide comprises a VL of a moiety capable of specific binding to FAP, wherein the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:83 and SEQ ID NO:85.
In some embodiments, the fusion polypeptide comprises a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises
(i) a VH comprising the amino acid sequence of SEQ ID NO: 82 and a VL comprising the amino acid sequence of SEQ ID NO:83, or
(ii) a VH comprising the amino acid sequence of SEQ ID NO: 84 and a VL comprising the amino acid sequence of SEQ ID NO:85. In some embodiments the fusion polypeptide comprises a VH of a moiety capable of specific binding to OX40, wherein the moiety comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:4 and SEQ ID NO:5,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14.
In some embodiments the fusion polypeptide comprises a VH of a moiety capable of specific binding to OX40, wherein the VH comprises an amino acid sequence that is at least about 95%, 96%), 97%, 98%>, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:27, SEQ ID NO: 29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37 and SEQ ID NO:39.
In some embodiments the fusion polypeptide comprises a VL of a moiety capable of specific binding to OX40, wherein the moiety comprises a VL comprising
(iv) a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16 and SEQ ID NO: 17,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO:20, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of
SEQ ID NO:21 , SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 and SEQ ID NO:26.
In some embodiments, the fusion polypeptide comprises a VL of a moiety capable of specific binding to OX40, wherein the VL comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:28, SEQ ID NO: 30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38 and SEQ ID NO:40.
In some embodiments, the fusion polypeptide comprises comprises a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises
(i) a VH comprising the amino acid sequence of SEQ ID NO:27 and a VL comprising the amino acid sequence of SEQ ID NO:28,
(ii) a VH comprising the amino acid sequence of SEQ ID NO:29 and a VL comprising the amino acid sequence of SEQ ID NO:30,
(iii) a VH comprising the amino acid sequence of SEQ ID NO: 31 and a VL comprising the amino acid sequence of SEQ ID NO:32,
(iv) a VH comprising the amino acid sequence of SEQ ID NO:33 and a VL comprising the amino acid sequence of SEQ ID NO:34,
(v) a VH comprising the amino acid sequence of SEQ ID NO:35 and a VL comprising the amino acid sequence of SEQ ID NO:36,
(vi) a VH comprising the amino acid sequence of SEQ ID NO:37 and a VL comprising the amino acid sequence of SEQ ID NO:38, or
(vii) a VH comprising the amino acid sequence of SEQ ID NO:39 and a VL comprising the amino acid sequence of SEQ ID NO:40.
In particular embodiments, the present invention provides a fusion polypeptide comprising, or consisting of, the amino acid selected from the group consisting of SEQ ID NO:227, 229, 231, 233, 235 and 237.
In some embodiments the fusion polypeptide comprises a VH of a moiety capable of specific binding to 4-1BB, wherein the moiety comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:44 and SEQ ID NO:45, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50.
In some embodiments the fusion polypeptide comprises a VH of a moiety capable of specific binding to 4-1BB, wherein the VH comprises an amino acid sequence that is at least about 95%, 96%o, 97%, 98%>, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66 and SEQ ID NO:68.
In some embodiments the fusion polypeptide comprises a VL of a moiety capable of specific binding to 4-1BB, wherein the moiety comprises a VL comprising
(iv) a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:51 and SEQ ID NO:52,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:53 and SEQ ID NO:54, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58 and SEQ ID NO:59. In some embodiments, the fusion polypeptide comprises a VL of a moiety capable of specific binding to 4-1BB, wherein the VL comprises an amino acid sequence that is at least about 95%, 96%o, 97%, 98%>, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67 and SEQ ID NO:69. In some embodiments, the fusion polypeptide comprises comprises a moiety capable of specific binding to 4- IBB, wherein the moiety capable of specific binding to 4- IBB comprises
(i) a VH comprising the amino acid sequence of SEQ ID NO: 60 and a VL comprising the amino acid sequence of SEQ ID NO:61,
(ii) a VH comprising the amino acid sequence of SEQ ID NO: 62 and a VL comprising the amino acid sequence of SEQ ID NO: 63,
(iii) a VH comprising the amino acid sequence of SEQ ID NO: 64 and a VL comprising the amino acid sequence of SEQ ID NO:65,
(iv) a VH comprising the amino acid sequence of SEQ ID NO: 66 and a VL comprising the amino acid sequence of SEQ ID NO:67, or
(v) a VH comprising the amino acid sequence of SEQ ID NO:68 and a VL comprising the amino acid sequence of SEQ ID NO:69.
In particular embodiments, the present invention provides a fusion polypeptide comprising, or consisting of, the amino acid selected from the group consisting of SEQ ID NO:246, 248, 250 and 252. Polynucleotides
The invention further provides isolated polynucleotides encoding a trimeric antigen binding molecule of the invention as described herein, or a fragment thereof.
The isolated polynucleotides encoding trimeric antigen binding molecules of the invention may be expressed as a single polynucleotide that encodes the entire antigen binding molecule or as multiple (e.g., two or more) polynucleotides that are co-expressed. Polypeptides encoded by polynucleotides that are co-expressed may associate through, e.g., disulfide bonds or other means to form a functional trimeric antigen binding molecule. For example, the light chain portion of a moiety capable of specific binding to a target cell antigen may be encoded by a separate polynucleotide from the heavy chain portion of the capable of specific binding to a
target cell antigen. When co-expressed, the heavy chain polypeptides will associate with the light chain polypeptides to form the moiety capable of specific binding to a target cell antigen.
Similarly, the light chain portion of a moiety capable of specific binding to a costimulatory TNF receptor family member may be encoded by a separate polynucleotide from the heavy chain portion of the capable of specific binding to a costimulatory TNF receptor family member. When co-expressed, the heavy chain polypeptides will associate with the light chain polypeptides to form the moiety capable of specific binding to a costimulatory TNF receptor family member.
In a particular aspect, the invention relates to an isolated polynucleotide encoding a fusion polypeptide of the present invention as described herein. In particular embodiments, the present invention provides a polynucleotide encoding a fusion polypeptide comprising, or consisting of, the amino acid selected from the group consisting of SEQ ID NO:227, 229, 231, 233, 235 and 237. More particularly, provided is a polynucleotide comprising, or consisting of, the sequence selected from the group consisting of SEQ ID NO:215, 217, 219, 221 , 223 and 225. In particular embodiments, the present invention provides a polynucleotide encoding a fusion polypeptide comprising, or consisting of, the amino acid selected from the group consisting of SEQ ID NO: 246, 248, 250 and 252. More particularly, provided is a
polynucleotide comprising, or consisting of, the sequence selected from the group consisting of SEQ ID NO:238, 240, 242 and 244. In certain embodiments the polynucleotide or nucleic acid is DNA. In other embodiments, a polynucleotide of the present invention is RNA, for example, in the form of messenger R A (mR A). RNA of the present invention may be single stranded or double stranded.
According to another aspect of the invention, there is provided an isolated polynucleotide encoding a trimeric antigen binding molecule as defined herein before or a fusion polypeptide as described herein before. The invention further provides a vector, particularly an expression vector, comprising the isolated polynucleotide of the invention and a host cell comprising the isolated polynucleotide or the vector of the invention. In some embodiments the host cell is a eukaryotic cell, particularly a mammalian cell.
In another aspect, provided is a method for producing the trimeric antigen binding molecule of the invention, comprising the steps of (i) culturing the host cell of the invention under conditions suitable for expression of said antigen binding molecule, and (ii) isolating said trimeric antigen binding molecule. The invention also encompasses a trimeric antigen binding molecule produced by the method of the invention.
Recombinant Methods
Trimeric antigen binding molecules of the invention may be obtained, for example, by solid-state peptide synthesis (e.g. Merrifield solid phase synthesis) or recombinant production. For recombinant production one or more polynucleotide encoding the antigen binding molecule or polypeptide fragments thereof, e.g., as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell. Such polynucleotide may be readily isolated and sequenced using conventional procedures. In one aspect of the invention, a vector, preferably an expression vector, comprising one or more of the polynucleotides of the invention is provided. Methods which are well known to those skilled in the art can be used to construct expression vectors containing the coding sequence of the trimeric antigen binding molecule (fragment) along with appropriate transcriptional/translational control signals. These methods include in vitro recombinant DNA techniques, synthetic techniques and in vivo recombination/genetic recombination. See, for example, the techniques described in Maniatis et al, MOLECULAR CLONING: A LABORATORY MANUAL, Cold Spring Harbor Laboratory, N.Y. (1989); and Ausubel et al, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY,
Greene Publishing Associates and Wiley Interscience, N.Y. (1989). The expression vector can be part of a plasmid, virus, or may be a nucleic acid fragment. The expression vector includes an expression cassette into which the polynucleotide encoding the trimeric antigen binding molecule or polypeptide fragments thereof (i.e. the coding region) is cloned in operable association with a promoter and/or other transcription or translation control elements. As used herein, a "coding region" is a portion of nucleic acid which consists of codons translated into amino acids. Although a "stop codon" (TAG, TGA, or TAA) is not translated into an amino acid, it may be considered to be part of a coding region, if present, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, 5' and 3' untranslated regions, and the like, are not part of a coding region. Two or more coding regions can be present in a single polynucleotide construct, e.g. on a single vector, or in separate polynucleotide constructs, e.g. on separate (different) vectors. Furthermore, any vector may contain a single coding region, or may comprise two or more coding regions, e.g. a vector of the present invention may encode one or more polypeptides, which are post- or co-translationally separated into the final proteins via proteolytic cleavage. In addition, a vector, polynucleotide, or nucleic acid of the invention may encode heterologous coding regions, either fused or unfused to a polynucleotide encoding the trimeric antigen binding molecule of the invention or polypeptide fragments thereof, or variants or derivatives thereof. Heterologous coding regions include without limitation specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain. An operable association is when a coding region for a gene product, e.g. a polypeptide, is associated with one or more regulatory sequences in such a way as to place expression of the gene product under the influence or control of the regulatory
sequence(s). Two DNA fragments (such as a polypeptide coding region and a promoter associated therewith) are "operably associated" if induction of promoter function results in the transcription of mRNA encoding the desired gene product and if the nature of the linkage between the two DNA fragments does not interfere with the ability of the expression regulatory sequences to direct the expression of the gene product or interfere with the ability of the DNA template to be transcribed. Thus, a promoter region would be operably associated with a nucleic acid encoding a polypeptide if the promoter was capable of effecting transcription of that nucleic acid. The promoter may be a cell- specific promoter that directs substantial transcription of the DNA only in predetermined cells. Other transcription control elements, besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can be operably associated with the polynucleotide to direct cell-specific transcription.
Suitable promoters and other transcription control regions are disclosed herein. A variety of transcription control regions are known to those skilled in the art. These include, without limitation, transcription control regions, which function in vertebrate cells, such as, but not limited to, promoter and enhancer segments from cytomegaloviruses (e.g. the immediate early promoter, in conjunction with intron-A), simian virus 40 (e.g. the early promoter), and retroviruses (such as, e.g. Rous sarcoma virus). Other transcription control regions include those derived from vertebrate genes such as actin, heat shock protein, bovine growth hormone and rabbit a-globin, as well as other sequences capable of controlling gene expression in eukaryotic cells. Additional suitable transcription control regions include tissue-specific promoters and enhancers as well as inducible promoters (e.g. promoters inducible tetracyclins). Similarly, a variety of translation control elements are known to those of ordinary skill in the art. These include, but are not limited to ribosome binding sites, translation initiation and termination codons, and elements derived from viral systems (particularly an internal ribosome entry site, or IRES, also referred to as a CITE sequence). The expression cassette may also include other features such as an origin of replication, and/or chromosome integration elements such as retroviral long terminal repeats (LTRs), or adeno-associated viral (AAV) inverted terminal repeats (ITRs).
Polynucleotide and nucleic acid coding regions of the present invention may be associated with additional coding regions which encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide of the present invention. For example, if secretion of the trimeric antigen binding molecule or polypeptide fragments thereof is desired, DNA encoding a signal sequence may be placed upstream of the nucleic acid encoding a trimeric antigen binding molecule of the invention or polypeptide fragments thereof. According to the signal hypothesis, proteins secreted by mammalian cells have a signal peptide or secretory leader sequence which is cleaved from the mature protein once export of the growing protein chain across the rough endoplasmic reticulum has been initiated. Those of ordinary skill in the art are
aware that polypeptides secreted by vertebrate cells generally have a signal peptide fused to the N-terminus of the polypeptide, which is cleaved from the translated polypeptide to produce a secreted or "mature" form of the polypeptide. In certain embodiments, the native signal peptide, e.g. an immunoglobulin heavy chain or light chain signal peptide is used, or a functional derivative of that sequence that retains the ability to direct the secretion of the polypeptide that is operably associated with it. Alternatively, a heterologous mammalian signal peptide, or a functional derivative thereof, may be used. For example, the wild-type leader sequence may be substituted with the leader sequence of human tissue plasminogen activator (TP A) or mouse β- glucuronidase. DNA encoding a short protein sequence that could be used to facilitate later purification
(e.g. a histidine tag) or assist in labeling the fusion protein may be included within or at the ends of the polynucleotide encoding a trimeric antigen binding molecule of the invention or polypeptide fragments thereof.
In a further aspect of the invention, a host cell comprising one or more polynucleotides of the invention is provided. In certain embodiments a host cell comprising one or more vectors of the invention is provided. The polynucleotides and vectors may incorporate any of the features, singly or in combination, described herein in relation to polynucleotides and vectors, respectively. In one aspect, a host cell comprises (e.g. has been transformed or transfected with) a vector comprising a polynucleotide that encodes (part of) a trimeric antigen binding molecule of the invention. As used herein, the term "host cell" refers to any kind of cellular system which can be engineered to generate the fusion proteins of the invention or fragments thereof. Host cells suitable for replicating and for supporting expression of antigen binding molecules are well known in the art. Such cells may be transfected or transduced as appropriate with the particular expression vector and large quantities of vector containing cells can be grown for seeding large scale fermenters to obtain sufficient quantities of the antigen binding molecule for clinical applications. Suitable host cells include prokaryotic microorganisms, such as E. coli, or various eukaryotic cells, such as Chinese hamster ovary cells (CHO), human embryonic kidney (HEK) cells, insect cells, or the like. For example, polypeptides may be produced in bacteria in particular when glycosylation is not needed. After expression, the polypeptide may be isolated from the bacterial cell paste in a soluble fraction and can be further purified. In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for polypeptide-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been "humanized", resulting in the production of a polypeptide with a partially or fully human glycosylation pattern. See Gerngross, Nat Biotech 22, 1409-1414 (2004), and Li et al, Nat Biotech 24, 210-215 (2006).
Suitable host cells for the expression of (glycosylated) polypeptides are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells. Plant cell cultures can also be utilized as hosts. See e.g. US Patent Nos. 5,959,177, 6,040,498,
6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIES™ technology for producing antibodies in transgenic plants). Vertebrate cells may also be used as hosts. For example, mammalian cell lines that are adapted to grow in suspension may be useful. Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293T cells as described, e.g., in Graham et al., J Gen Virol 36, 59 (1977)), baby hamster kidney cells (BHK), mouse Sertoli cells (TM4 cells as described, e.g., in Mather, Biol Reprod 23, 243-251 (1980)), monkey kidney cells (CV1), African green monkey kidney cells (VERO-76), human cervical carcinoma cells (HELA), canine kidney cells (MDCK), buffalo rat liver cells (BRL 3A), human lung cells (W138), human liver cells (Hep G2), mouse mammary tumor cells (MMT 060562), TRI cells (as described, e.g., in Mather et al, Annals N.Y. Acad Sci 383, 44-68 (1982)), MRC 5 cells, and FS4 cells. Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including dhfr- CHO cells (Urlaub et al, Proc Natl Acad Sci USA 77, 4216 (1980)); and myeloma cell lines such as YO, NS0, P3X63 and Sp2/0. For a review of certain mammalian host cell lines suitable for protein production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ), pp. 255-268 (2003). Host cells include cultured cells, e.g., mammalian cultured cells, yeast cells, insect cells, bacterial cells and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue. In one embodiment, the host cell is a eukaryotic cell, preferably a mammalian cell, such as a Chinese Hamster Ovary (CHO) cell, a human embryonic kidney (HEK) cell or a lymphoid cell (e.g., Y0, NS0, Sp20 cell). Standard technologies are known in the art to express foreign genes in these systems. Cells expressing a polypeptide comprising either the heavy or the light chain of an antigen binding domain, may be engineered so as to also express the other of the
immunoglobulin chains such that the expressed product is an antigen binding domain that has both a heavy and a light chain.
In another aspect, provided is a method for producing the trimeric antigen binding molecule of the invention, comprising the steps of (i) culturing the host cell of the invention under conditions suitable for expression of said antigen binding molecule, and (ii) isolating said trimeric antigen binding molecule form the host cell or host cell culture medium. The components of the trimeric antigen binding molecule are genetically fused to each other. Trimeric antigen binding molecules can be designed such that its components are fused directly to each other or indirectly through a linker sequence. The composition and length of the
linker may be determined in accordance with methods well known in the art and may be tested for efficacy. Examples of linker sequences between different components of trimeric antigen binding molecules are found in the sequences provided herein. Additional sequences may also be included to incorporate a cleavage site to separate the individual components of the fusion if desired, for example an endopeptidase recognition sequence.
In certain embodiments the moieties capable of specific binding to a target cell antigen (e.g. Fab fragments or scFv) forming part of the antigen binding molecule comprise at least an immunoglobulin variable region capable of binding to a target cell antigen. Simialrly, in certain embodiments, the moieties capable of specific binding to a costimulatory TNF receptor family member (e.g. Fab fragments or scFv) forming part of the antigen binding molecule comprise at least an immunoglobulin variable region capable of binding to a costimulatory TNF receptor family member. Variable regions can form part of and be derived from naturally or non-naturally occurring antibodies and fragments thereof. Methods to produce polyclonal antibodies and monoclonal antibodies are well known in the art (see e.g. Harlow and Lane, "Antibodies, a laboratory manual", Cold Spring Harbor Laboratory, 1988). Non-naturally occurring antibodies can be constructed using solid phase-peptide synthesis, can be produced recombinantly (e.g. as described in U.S. patent No. 4,186,567) or can be obtained, for example, by screening
combinatorial libraries comprising variable heavy chains and variable light chains (see e.g. U.S. Patent. No. 5,969,108 to McCafferty). Any animal species of immunoglobulin can be used in the invention. Non-limiting immunoglobulins useful in the present invention can be of murine, primate, or human origin. If the fusion protein is intended for human use, a chimeric form of immunoglobulin may be used wherein the constant regions of the immunoglobulin are from a human. A humanized or fully human form of the immunoglobulin can also be prepared in accordance with methods well known in the art (see e. g. U.S. Patent No. 5,565,332 to Winter). Humanization may be achieved by various methods including, but not limited to (a) grafting the non-human (e.g., donor antibody) CDRs onto human (e.g. recipient antibody) framework and constant regions with or without retention of critical framework residues (e.g. those that are important for retaining good antigen binding affinity or antibody functions), (b) grafting only the non-human specificity-determining regions (SDRs or a-CDRs; the residues critical for the antibody-antigen interaction) onto human framework and constant regions, or (c) transplanting the entire non-human variable domains, but "cloaking" them with a human-like section by replacement of surface residues. Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front Biosci 13, 1619-1633 (2008), and are further described, e.g., in Riechmann et al, Nature 332, 323-329 (1988); Queen et al, Proc Natl Acad Sci USA 86, 10029-10033 (1989); US Patent Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Jones et al, Nature 321, 522-525 (1986);
Morrison et al, Proc Natl Acad Sci 81, 6851-6855 (1984); Morrison and Oi, Adv Immunol 44,
65-92 (1988); Verhoeyen et al, Science 239, 1534-1536 (1988); Padlan, Molec Immun 31(3), 169-217 (1994); Kashmiri et al, Methods 36, 25-34 (2005) (describing SDR (a-CDR) grafting); Padlan, Mol Immunol 28, 489-498 (1991) (describing "resurfacing"); DaU'Acqua et al, Methods 36, 43-60 (2005) (describing "FR shuffling"); and Osbourn et al, Methods 36, 61-68 (2005) and Klimka et al, Br J Cancer 83, 252-260 (2000) (describing the "guided selection" approach to FR shuffling). Particular immunoglobulins according to the invention are human immunoglobulins. Human antibodies and human variable regions can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr Opin Pharmacol 5, 368-74 (2001) and Lonberg, Curr Opin Immunol 20, 450-459 (2008). Human variable regions can form part of and be derived from human monoclonal antibodies made by the hybridoma method (see e.g. Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)). Human antibodies and human variable regions may also be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge (see e.g. Lonberg, Nat Biotech 23, 1117-1125 (2005). Human antibodies and human variable regions may also be generated by isolating Fv clone variable region sequences selected from human-derived phage display libraries (see e.g., Hoogenboom et al. in Methods in Molecular Biology 178, 1-37 (O'Brien et al, ed., Human Press, Totowa, NJ, 2001); and McCafferty et al, Nature 348, 552-554; Clackson et al, Nature 352, 624-628 (1991)). Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
In certain aspects, the moieties capable of specific binding to the relevant target (e.g. Fab fragments or scFv) comprised in the antigen binding molecules of the present invention are engineered to have enhanced binding affinity according to, for example, the methods disclosed in PCT publication WO 2012/020006 (see Examples relating to affinity maturation) or U.S. Pat. Appl. Publ. No. 2004/0132066. The ability of the antigen binding molecules of the invention to bind to a specific antigenic determinant can be measured either through an enzyme-linked immunosorbent assay (ELISA) or other techniques familiar to one of skill in the art, e.g. surface plasmon resonance technique (Liljeblad, et al, Glyco J 17, 323-329 (2000)), and traditional binding assays (Heeley, Endocr Res 28, 217-229 (2002)). Competition assays may be used to identify an antigen binding molecule that competes with a reference antibody for binding to a particular antigen. In certain embodiments, such a competing antigen binding molecule binds to the same epitope (e.g. a linear or a conformational epitope) that is bound by the reference antigen binding molecule. Detailed exemplary methods for mapping an epitope to which an antigen binding molecule binds are provided in Morris (1996) "Epitope Mapping Protocols", in Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ). In an exemplary competition assay, immobilized antigen is incubated in a solution comprising a first labeled antigen binding
molecule that binds to the antigen and a second unlabeled antigen binding molecule that is being tested for its ability to compete with the first antigen binding molecule for binding to the antigen. The second antigen binding molecule may be present in a hybridoma supernatant. As a control, immobilized antigen is incubated in a solution comprising the first labeled antigen binding molecule but not the second unlabeled antigen binding molecule. After incubation under conditions permissive for binding of the first antibody to the antigen, excess unbound antibody is removed, and the amount of label associated with immobilized antigen is measured. If the amount of label associated with immobilized antigen is substantially reduced in the test sample relative to the control sample, then that indicates that the second antigen binding molecule is competing with the first antigen binding molecule for binding to the antigen. See Harlow and Lane (1988) Antibodies: A Laboratory Manual ch.14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY).
Trimeric antigen binding molecules of the invention prepared as described herein may be purified by art-known techniques such as high performance liquid chromatography, ion exchange chromatography, gel electrophoresis, affinity chromatography, size exclusion chromatography, and the like. The actual conditions used to purify a particular protein will depend, in part, on factors such as net charge, hydrophobicity, hydrophilicity etc., and will be apparent to those having skill in the art. For affinity chromatography purification an antibody, ligand, receptor or antigen can be used to which the trimeric antigen binding molecule binds. For example, for affinity chromatography purification of fusion proteins of the invention, a matrix with protein A or protein G may be used. Sequential Protein A or G affinity chromatography and size exclusion chromatography can be used to isolate an antigen binding molecule essentially as described in the Examples. The purity of the trimeric antigen binding molecule or fragments thereof can be determined by any of a variety of well-known analytical methods including gel electrophoresis, high pressure liquid chromatography, and the like. For example, the trimeric antigen binding molecule expressed as described in the Examples were shown to be intact and properly assembled as demonstrated by reducing and non-reducing SDS-PAGE.
The invention also encompasses a trimeric antigen binding molecule produced by the methods of the invention.
Assays
The trimeric antigen binding molecules provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
1. Affinity assays
The affinity of the trimeric antigen binding molecule provided herein for the corresponding TNF receptor can be determined in accordance with the methods set forth in the Examples by surface plasmon resonance (SPR), using standard instrumentation such as a BIAcore instrument (GE Healthcare), and receptors or target proteins such as may be obtained by recombinant expression. The affinity of the trimeric antigen binding molecule for the target cell antigen can also be determined by surface plasmon resonance (SPR), using standard instrumentation such as a BIAcore instrument (GE Healthcare), and receptors or target proteins such as may be obtained by recombinant expression. A specific illustrative and exemplary embodiment for measuring binding affinity is described in Example 4.1. According to one aspect, KD is measured by surface plasmon resonance using a BIACORE® T200 machine (GE Healthcare) at 25 °C.
2. Binding assays and other assays
Binding of the trimeric antigen binding molecule provided herein to the corresponding receptor expressing cells may be evaluated using cell lines expressing the particular receptor or target antigen, for example by flow cytometry (FACS). In one aspect, fresh peripheral blood mononuclear cells (PBMCs) expressing the TNF receptor are used in the binding assay. These cells are used directly after isolation (naive PMBCs) or after stimulation (activated PMBCs). In another aspect, activated mouse splenocytes (expressing the TNF receptor molecule) can be used to demonstrate binding of trimeric antigen binding molecule of the invention to the
corresponding TNF receptor expressing cells.
In a further aspect, cancer cell lines expressing the target cell antigen, for example FAP, were used to demonstrate the binding of the antigen binding molecules to the target cell antigen.
In another aspect, competition assays may be used to identify an antigen binding molecule that competes with a specific antibody or antigen binding molecule for binding to the target or TNF receptor, respectively. In certain embodiments, such a competing antigen binding molecule binds to the same epitope (e.g., a linear or a conformational epitope) that is bound by a specific anti-target antibody or a specific anti-TNF receptor antibody. Detailed exemplary methods for mapping an epitope to which an antibody binds are provided in Morris (1996) "Epitope Mapping Protocols," in Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ).
3. Activity assays
In one aspect, assays are provided for identifying trimeric antigen binding molecules that bind to a specific target cell antigen and to a specific TNF receptor having biological activity. Biological activity may include, e.g., agonistic signalling through the TNF receptor on cells
expressing the TNF receptor. Trimeric antigen binding molecules identified by the assays as having such biological activity in vitro are also provided. In particular, a reporter cell assay detecting NF-κΒ activation in Hela cells expressing human 4- IBB or human OX40 and co- cultured with FAP-expressing tumor cells is provided (see e.g. Example 5.1). In certain aspects, trimeric antigen binding molecules of the invention are tested for such biological activity. Assays for detecting the biological activity of the molecules of the invention are those described in Example 5 or Example 8. In addition the biological activity of such complexes can be assessed by evaluating their effects on survival, proliferation and lymphokine secretion of various lymphocyte subsets such as NK cells, NKT-cells or γδ T-cells or assessing their capacity to modulate phenotype and function of antigen presenting cells such as dendritic cells, monocytes/macrophages or B-cells.
Pharmaceutical Compositions, Formulations and Routes of Administation
In a further aspect, the invention provides pharmaceutical compositions comprising any of the trimeric antigen binding molecules provided herein, e.g., for use in any of the below therapeutic methods. In one embodiment, a pharmaceutical composition comprises a trimeric antigen binding molecule and at least one pharmaceutically acceptable excipient. In another embodiment, a pharmaceutical composition comprises any of the trimeric antigen binding molecules provided herein and at least one additional therapeutic agent, e.g., as described below.
Pharmaceutical compositions of the present invention comprise a therapeutically effective amount of one or more trimeric antigen binding molecule dissolved or dispersed in a
pharmaceutically acceptable excipient. The phrases "pharmaceutical or pharmacologically acceptable" refers to molecular entities and compositions that are generally non-toxic to recipients at the dosages and concentrations employed, i.e. do not produce an adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate. The preparation of a pharmaceutical composition that contains at least one trimeric antigen binding molecule and optionally an additional active ingredient will be known to those of skill in the art in light of the present disclosure, as exemplified by Remington's
Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, incorporated herein by reference. In particular, the compositions are lyophilized formulations or aqueous solutions. As used herein, "pharmaceutically acceptable excipient" includes any and all solvents, buffers, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g. antibacterial agents, antifungal agents), isotonic agents, salts, stabilizers and combinations thereof, as would be known to one of ordinary skill in the art.
Parenteral compositions include those designed for administration by injection, e.g.
subcutaneous, intradermal, intralesional, intravenous, intraarterial intramuscular, intrathecal or
intraperitoneal injection. For injection, the trimeric antigen binding molecules of the invention may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, Ringer's solution, or physiological saline buffer. The solution may contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Alternatively, the fusion proteins may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use. Sterile injectable solutions are prepared by incorporating the fusion proteins or trimeric antigen binding molecules of the invention in the required amount in the appropriate solvent with various of the other ingredients enumerated below, as required.
Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and/or the other ingredients. In the case of sterile powders for the preparation of sterile injectable solutions, suspensions or emulsion, the preferred methods of preparation are vacuum-drying or freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile- filtered liquid medium thereof. The liquid medium should be suitably buffered if necessary and the liquid diluent first rendered isotonic prior to injection with sufficient saline or glucose. The composition must be stable under the conditions of manufacture and storage, and preserved against the contaminating action of microorganisms, such as bacteria and fungi. It will be appreciated that endotoxin contamination should be kept minimally at a safe level, for example, less that 0.5 ng/mg protein. Suitable pharmaceutically acceptable excipients include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG). Aqueous injection suspensions may contain compounds which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, dextran, or the like. Optionally, the suspension may also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions. Additionally, suspensions of the active compounds may be prepared as appropriate oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl cleats or triglycerides, or liposomes.
Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano- particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences (18th Ed. Mack Printing Company, 1990). Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the polypeptide, which matrices are in the form of shaped articles, e.g. films, or microcapsules. In particular
embodiments, prolonged absorption of an injectable composition can be brought about by the use in the compositions of agents delaying absorption, such as, for example, aluminum monostearate, gelatin or combinations thereof.
Exemplary pharmaceutically acceptable excipients herein further include insterstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20 (HYLENEX®, Baxter International, Inc.). Certain exemplary sHASEGPs and methods of use, including rHuPH20, are described in US Patent Publication Nos. 2005/0260186 and 2006/0104968. In one aspect, a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases. Exemplary lyophilized antibody formulations are described in US Patent No. 6,267,958.
Aqueous antibody formulations include those described in US Patent No. 6,171,586 and
WO2006/044908, the latter formulations including a histidine-acetate buffer.
In addition to the compositions described previously, the trimeric antigen binding molecules may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by
intramuscular injection. Thus, for example, the trimeric antigen binding molecules may be formulated with suitable polymeric or hydrophobic materials (for example as emulsion in a pharmaceutically acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt. Pharmaceutical compositions comprising the trimeric antigen binding molecules of the invention may be manufactured by means of conventional mixing, dissolving, emulsifying, encapsulating, entrapping or lyophilizing processes. Pharmaceutical compositions may be formulated in conventional manner using one or more physiologically acceptable carriers, diluents, excipients or auxiliaries which facilitate processing of the proteins into preparations that
can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
The trimeric antigen binding molecules may be formulated into a composition in a free acid or base, neutral or salt form. Pharmaceutically acceptable salts are salts that substantially retain the biological activity of the free acid or base. These include the acid addition salts, e.g. those formed with the free amino groups of a proteinaceous composition, or which are formed with inorganic acids such as for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric or mandelic acid. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as for example, sodium, potassium, ammonium, calcium or ferric hydroxides; or such organic bases as isopropylamine, trimethylamine, histidine or procaine. Pharmaceutical salts tend to be more soluble in aqueous and other protic solvents than are the corresponding free base forms.
The pharmaceutical compositions may also contain more than one active ingredients as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. Such active ingredients are suitably present in combination in amounts that are effective for the purpose intended. In one aspect, the pharmaceutical composition comprises a trimeric antigen binding molecule and another active anti-cancer agent.
The formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
Therapeutic methods and compositions
Any of the trimeric antigen binding molecules provided herein may be used in therapeutic methods. For use in therapeutic methods, the antigen binding molecules of the invention can be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
In one aspect, the trimeric antigen binding molecules of the invention are provided for use as a medicament. In further aspects, the trimeric antigen binding molecules of the invention are provided for use in treating a disease, in particular for use in the treatment of cancer. In certain embodiments, the trimeric costimulatory antigen binding molecules of the invention are provided for use in a method of treatment. In one embodiment, the invention provides a trimeric antigen binding molecule as described herein for use in the treatment of a disease in an individual in
need thereof. In certain embodiments, the invention provides a trimeric antigen binding molecule for use in a method of treating an individual having a disease comprising administering to the individual a therapeutically effective amount of the trimeric antigen binding molecule. In certain embodiments the disease to be treated is cancer. In certain embodiments the disease to be treated is a proliferative disorder, particularly cancer. Examples of cancers include bladder cancer, brain cancer, head and neck cancer, pancreatic cancer, lung cancer, breast cancer, ovarian cancer, uterine cancer, cervical cancer, endometrial cancer, esophageal cancer, colon cancer, colorectal cancer, rectal cancer, gastric cancer, prostate cancer, blood cancer, skin cancer, squamous cell carcinoma, bone cancer, and kidney cancer. Other cell proliferation disorders that can be treated using a trimeric antigen binding molecule of the present invention include, but are not limited to neoplasms located in the: abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic region, and urogenital system. Also included are pre-cancerous conditions or lesions and cancer metastases. In certain embodiments the cancer is chosen from the group consisting of renal cell cancer, skin cancer, lung cancer, colorectal cancer, breast cancer, brain cancer, head and neck cancer. The subject, patient, or "individual" in need of treatment is typically a mammal, more specifically a human.
Also encompassed by the invention is the trimeric antigen binding molecule of the invention, or the pharmaceutical composition of the invention, for use in up-regulating or prolonging cytotoxic T cell activity.
In a further aspect, the invention provides for the use of a trimeric antigen binding molecule of the invention in the manufacture or preparation of a medicament for the treatment of a disease in an individual in need thereof. In one aspect, the medicament is for use in a method of treating a disease comprising administering to an individual having the disease a therapeutically effective amount of the medicament. In certain embodiments the disease to be treated is a proliferative disorder, particularly cancer. Examples of cancers include bladder cancer, brain cancer, head and neck cancer, pancreatic cancer, lung cancer, breast cancer, ovarian cancer, uterine cancer, cervical cancer, endometrial cancer, esophageal cancer, colon cancer, colorectal cancer, rectal cancer, gastric cancer, prostate cancer, blood cancer, skin cancer, squamous cell carcinoma, bone cancer, and kidney cancer. Other cell proliferation disorders that can be treated using a trimeric antigen binding molecule of the present invention include, but are not limited to neoplasms located in the: abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic region, and urogenital system. Also included are pre-cancerous conditions or lesions and cancer metastases. In certain embodiments the cancer is chosen from the group consisting of
renal cell cancer, skin cancer, lung cancer, colorectal cancer, breast cancer, brain cancer, head and neck cancer. A skilled artisan readily recognizes that in many cases the trimeric antigen binding molecule may not provide a cure but may only provide partial benefit. In some embodiments, a physiological change having some benefit is also considered therapeutically beneficial. Thus, in some embodiments, an amount of trimeric antigen binding molecule that provides a physiological change is considered an "effective amount" or a "therapeutically effective amount". In any of the above embodiments the individual is preferably a mammal, particularly a human.
In a further aspect, the invention provides a method for treating a disease in an individual, comprising administering to said individual a therapeutically effective amount of a trimeric antigen binding molecule of the invention. In one embodiment a composition is administered to said individual, comprising a fusion protein of the invention in a pharmaceutically acceptable form. In certain embodiments the disease to be treated is a proliferative disorder. In a particular embodiment the disease is cancer. In certain embodiments the method further comprises administering to the individual a therapeutically effective amount of at least one additional therapeutic agent, e.g. an anti-cancer agent if the disease to be treated is cancer. An "individual" according to any of the above embodiments may be a mammal, preferably a human.
For the prevention or treatment of disease, the appropriate dosage of a trimeric antigen binding molecule of the invention (when used alone or in combination with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the route of administration, the body weight of the patient, the type of fusion protein, the severity and course of the disease, whether the fusion protein is administered for preventive or therapeutic purposes, previous or concurrent therapeutic interventions, the patient's clinical history and response to the fusion protein, and the discretion of the attending physician. The practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject. Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
The trimeric antigen binding molecule is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, about 1 μg/kg to 15 mg/kg (e.g. 0.1 mg/kg - 10 mg/kg) of the antigen binding molecule can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. One typical daily dosage might range from about 1 μg/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment would generally be sustained until a desired suppression of disease symptoms occurs. One exemplary
dosage of the fusion protein would be in the range from about 0.005 mg/kg to about 10 mg/kg. In other examples, a dose may also comprise from about 1 μg/kg body weight, about 5 μg/kg body weight, about 10 μg/kg body weight, about 50 μg/kg body weight, about 100 μg/kg body weight, about 200 μg/kg body weight, about 350 μg/kg body weight, about 500 μg/kg body weight, about 1 mg/kg body weight, about 5 mg/kg body weight, about 10 mg/kg body weight, about 50 mg/kg body weight, about 100 mg/kg body weight, about 200 mg/kg body weight, about 350 mg/kg body weight, about 500 mg/kg body weight, to about 1000 mg/kg body weight or more per administration, and any range derivable therein. In examples of a derivable range from the numbers listed herein, a range of about 5 mg/kg body weight to about 100 mg/kg body weight, about 5 μg/kg body weight to about 500 mg/kg body weight etc., can be administered, based on the numbers described above. Thus, one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 5.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the patient. Such doses may be administered intermittently, e.g. every week or every three weeks (e.g. such that the patient receives from about two to about twenty, or e.g. about six doses of the trimeric antigen binding molecule). An initial higher loading dose, followed by one or more lower doses may be administered. However, other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
The trimeric antigen binding molecule of the invention will generally be used in an amount effective to achieve the intended purpose. For use to treat or prevent a disease condition, the trimeric antigen binding molecules of the invention, or pharmaceutical compositions thereof, are administered or applied in a therapeutically effective amount. Determination of a therapeutically effective amount is well within the capabilities of those skilled in the art, especially in light of the detailed disclosure provided herein.
For systemic administration, a therapeutically effective dose can be estimated initially from in vitro assays, such as cell culture assays. A dose can then be formulated in animal models to achieve a circulating concentration range that includes the IC50 as determined in cell culture. Such information can be used to more accurately determine useful doses in humans.
Initial dosages can also be estimated from in vivo data, e.g., animal models, using techniques that are well known in the art. One having ordinary skill in the art could readily optimize administration to humans based on animal data.
Dosage amount and interval may be adjusted individually to provide plasma levels of the trimeric antigen binding molecules which are sufficient to maintain therapeutic effect. Usual patient dosages for administration by injection range from about 0.1 to 50 mg/kg/day, typically from about 0.5 to 1 mg/kg/day. Therapeutically effective plasma levels may be achieved by
administering multiple doses each day. Levels in plasma may be measured, for example, by HPLC.
In cases of local administration or selective uptake, the effective local concentration of the trimeric antigen binding molecules may not be related to plasma concentration. One skilled in the art will be able to optimize therapeutically effective local dosages without undue
experimentation.
A therapeutically effective dose of the trimeric antigen binding molecules described herein will generally provide therapeutic benefit without causing substantial toxicity. Toxicity and therapeutic efficacy of a fusion protein can be determined by standard pharmaceutical
procedures in cell culture or experimental animals. Cell culture assays and animal studies can be used to determine the LD50 (the dose lethal to 50% of a population) and the ED50 (the dose therapeutically effective in 50% of a population). The dose ratio between toxic and therapeutic effects is the therapeutic index, which can be expressed as the ratio LD50/ED50. Trimeric antigen binding molecules that exhibit large therapeutic indices are preferred. In one embodiment, the trimeric antigen binding molecule according to the present invention exhibits a high therapeutic index. The data obtained from cell culture assays and animal studies can be used in formulating a range of dosages suitable for use in humans. The dosage lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon a variety of factors, e.g., the dosage form employed, the route of administration utilized, the condition of the subject, and the like. The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition (see, e.g., Fingl et al, 1975, in: The Pharmacological Basis of Therapeutics, Ch. 1, p. 1, incorporated herein by reference in its entirety).
The attending physician for patients treated with the trimeric antigen binding molecules of the invention will know how and when to terminate, interrupt, or adjust administration due to toxicity, organ dysfunction, and the like. Conversely, the attending physician would also know to adjust treatment to higher levels if the clinical response were not adequate (precluding toxicity). The magnitude of an administered dose in the management of the disorder of interest will vary with the severity of the condition to be treated, with the route of administration, and the like. The severity of the condition may, for example, be evaluated, in part, by standard prognostic evaluation methods. Further, the dose and perhaps dose frequency will also vary according to the age, body weight, and response of the individual patient.
Other agents and treatments
The trimeric antigen binding molecules of the invention may be administered in
combination with one or more other agents in therapy. For instance, a fusion protein of the
invention may be co-administered with at least one additional therapeutic agent. The term "therapeutic agent" encompasses any agent that can be administered for treating a symptom or disease in an individual in need of such treatment. Such additional therapeutic agent may comprise any active ingredients suitable for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. In certain embodiments, an additional therapeutic agent is another anti-cancer agent.
Such other agents are suitably present in combination in amounts that are effective for the purpose intended. The effective amount of such other agents depends on the amount of fusion protein used, the type of disorder or treatment, and other factors discussed above. The trimeric antigen binding molecules are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
Such combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate compositions), and separate administration, in which case, administration of the trimeric antigen binding molecule of the invention can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant.
Articles of Manufacture
In another aspect of the invention, an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above is provided. The article of manufacture comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper that is pierceable by a hypodermic injection needle). At least one active agent in the composition is a trimeric antigen binding molecule of the invention.
The label or package insert indicates that the composition is used for treating the condition of choice. Moreover, the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises a trimeric antigen binding molecule of the invention; and (b) a second container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent. The article of manufacture in this embodiment of the invention may further comprise a package insert indicating that the compositions can be used to treat a particular condition.
Alternatively, or additionally, the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
Table C. Sequences
NO:
19 OX40(CLC-563, CLC564) GASSRAT
CDR-L2
20 0X40(17 A9) CDR-L2 GK RPS
21 OX40(8H9) CDR-L3 QQYLTYSRFT
22 OX40(49B4) CDR-L3 QQYSSQPYT
23 0X40(1 G4) CDR-L3 QQYISYSMLT
24 OX40(20B7) CDR-L3 QQYQAFSLT
25 OX40(CLC-563, CLC-164) QQYGSSPLT
CDR-L3
26 0X40(17 A9) CDR-L3 NSRVMPHNRV
27 OX40(8H9) VH OVOLVOSGAEVKKPGSSVKVSCKASGGTFSSYAIS
WVROAPGOGLEWMGGIIPIFGTANYAOKFOGRVTI TADKSTSTAYMELSSLRSEDTAVYYCAREYGWMD YWGQGTTVTVSS
28 OX40(8H9) VL DIOMTO SPSTLS ASVGDRVTITCRASO SIS S WLAWY
OOKPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTL
TISSLOPDDFATYYCOOYLTYSRFTFGOGTKVEIK
29 OX40(49B4) VH OVOLVOSGAEVKKPGSSVKVSCKASGGTFSSYAIS
WVROAPGOGLEWMGGIIPIFGTANYAOKFOGRVTI TADKSTSTAYMELSSLRSEDTAVYYCAREYYRGPY DYWGQGTTVTVSS
30 OX40(49B4) VL DIOMTO SPSTLS ASVGDRVTITCRASO SIS S WLAWY
OOKPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTL TIS SLOPDDFATYYCOOYS SOPYTFGOGTKVEIK
31 0X40(1 G4) VH OVOLVOSGAEVKKPGSSVKVSCKASGGTFSSYAIS
WVROAPGOGLEWMGGIIPIFGTANYAOKFOGRVTI TADKSTSTAYMELSSLRSEDTAVYYCAREYGSMDY WGQGTTVTVSS
32 0X40(1 G4) VL DIOMTO SPSTLS ASVGDRVTITCRASO SIS S WLAWY
OOKPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTL
TISSLOPDDFATYYCOOYISYSMLTFGOGTKVEIK
33 OX40(20B7) VH OVOLVO SGAEVKKPGS SVKVSCKASGGTFS SYAIS
WVROAPGOGLEWMGGIIPIFGTANYAOKFOGRVTI TADKSTSTAYMELSSLRSEDTAVYYCARVNYPYSY WGDFDYWGOGTTVTVS S
34 OX40(20B7) VL DIOMTO SPSTLS ASVGDRVTITCRASO SIS S WLAWY
OOKPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTL
TISSLOPDDFATYYCOOYOAFSLTFGOGTKVEIK
35 OX40(CLC-563) VH EVOLLESGGGLVOPGGSLRLSCAASGFTFSSYAMS
WVROAPGKGLEWVSAISGSGGSTYYADSVKGRFTI SRDNSKNTLYLOMNSLRAEDTAVYYCALDVGAFD YWGQGALVTVSS
36 OX40(CLC-563) VL EIVLTOSPGTLSLSPGERATLSCRASOSVSSSYLAWY
OOKPGOAPRLLIYGASSRATGIPDRFSGSGSGTDFTL TISRLEPEDFAVYYCOOYGSSPLTFGOGTKVEIK
37 OX40(CLC-564) VH EVOLLESGGGLVOPGGSLRLSCAASGFTFSSYAMS
WVROAPGKGLEWVSAISGSGGSTYYADSVKGRFTI SRDNSKNTLYLOMNSLRAEDTAVYYCAFDVGPFD YWGQGTLVTVSS
NO:
TADKSTSTAYMELSSLRSEDTAVYYCARSTLIYGYF
DYWGQGTTVTVSS
65 4-lBB(l lD5) VL DIOMTO SPSTLS ASVGDRVTITCRASO SIS S WLAWY
OOKPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTL
TISSLOPDDFATYYCOOLNSYPOTFGOGTKVEIK
66 4-lBB(9Bl l) VH OVOLVO SGAEVKKPGS SVKVSCKASGGTFS SYAIS
WVROAPGOGLEWMGGIIPIFGTANYAOKFOGRVTI TADKSTSTAYMELSSLRSEDTAVYYCARSSGAYPG YFD YWGOGTTVTVS S
67 4-lBB(9Bl l) VL DIOMTO SPSTLS ASVGDRVTITCRASO SIS S WLAWY
OOKPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTL
TISSLOPDDFATYYCOOVNSYPOTFGOGTKVEIK
68 4-lBB(20G2) VH OVOLVO SGAEVKKPGS SVKVSCKASGGTFS SYAIS
WVROAPGOGLEWMGGIIPIFGTANYAOKFOGRVTI TADKSTSTAYMELSSLRSEDTAVYYCARSYYWESY PFDYWGOGTTVTVS S
69 4-lBB(20G2) VL DIOMTO SPSTLS ASVGDRVTITCRASO SIS S WLAWY
OOKPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTL
TISSLOPDDFATYYCOOOHSYYTFGOGTKVEIK
70 FAP(28H1) CDR-H1 SHAMS
71 FAP(28H1) CDR-H2 AIWASGEQYYADSVKG
72 FAP(28H1) CDR-H3 GWLGNFDY
73 FAP(28H1) CDR-L1 RASQSVSRSYLA
74 FAP(28H1) CDR-L2 GASTRAT
75 FAP(28H1) CDR-L3 QQGQVIPPT
76 FAP(4B9) CDR-H1 SYAMS
77 FAP(4B9) CDR-H2 AIIGSGASTYYADSVKG
78 FAP(4B9) CDR-H3 GWFGGFNY
79 FAP(4B9) CDR-L1 RASQSVTSSYLA
80 FAP(4B9) CDR-L2 VGSRRAT
81 FAP(4B9) CDR-L3 QQGIMLPPT
82 FAP(28H1) VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSHAMS
WVRQAPGKGLEWVSAIWASGEQYYADSVKGRFTI SRDNSKNTLYLQMNSLRAEDTAVYYCAKGWLGNF D YWGQ GTLVTVS S
83 FAP(28H1) VL EIVLTQSPGTLSLSPGERATLSCRASQSVSRSYLAW
YQQKPGQAPRLLIIGASTRATGIPDRFSGSGSGTDFT
LTISRLEPEDFAVYYCQQGQVIPPTFGQGTKVEIK
84 FAP(4B9) VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMS
WVRQ APGKGLE WVS AIIGS GASTYYAD S VKGRFTI SRDNSKNTLYLQMNSLRAEDTAVYYCAKGWFGGF NYWGQ GTLVTVS S
85 FAP(4B9) VL EIVLTQSPGTLSLSPGERATLSCRASQSVTSSYLAWY
QQKPGQAPRLLINVGSRRATGIPDRFSGSGSGTDFT
LTISRLEPEDFAVYYCQQGIMLPPTFGQGTKVEIK
86 Human (hu) FAP UniProt no. Q12884
87 hu FAP ectodomain+poly-lys- RPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWI tag+his6-tag SGQEYLHQSADN IVLYNIETGQSYTILSNRTMKSV
NASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIY DLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQN
SEQ Name Sequence
NO:
NIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEE
MLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYY
GDEQYPRTINIPYPKAGAK PVVRIFIIDTTYPAYVG
PQEVPVPAMIASSDYYFSWLTWVTDERVCLQWLK
RVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTG
WAGGFFVSTPVFSYDAISYYKIFSDKDGYKHIHYIK
DTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEY
PGRRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASF
SDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEENK
ELENALK IQLPKEEIKKLEVDEITLWYKMILPPQFD
RSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKE
GMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVED
QITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALA
SGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTK
DDNLEHYK STVMARAEYFRNVDYLLIHGTADDN
VHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSG
LSTNHLYTHMTHFLKQCFSLSDGKKKKKKGHHHH
HH
88 nucleotide sequence hu FAP CGCCCTTCAAGAGTTCATAACTCTGAAGAAAATA ectodomain+poly-lys- CAATGAGAGCACTCACACTGAAGGATATTTTAAA tag+his6-tag TGGAACATTTTCTTATAAAACATTTTTTCCAAACT
GGATTTCAGGACAAGAATATCTTCATCAATCTGC
AGATAACAATATAGTACTTTATAATATTGAAACA
GGACAATCATATACCATTTTGAGTAATAGAACCA
TGAAAAGTGTGAATGCTTCAAATTACGGCTTATC
ACCTGATCGGCAATTTGTATATCTAGAAAGTGAT
TATTCAAAGCTTTGGAGATACTCTTACACAGCAA
CATATTACATCTATGACCTTAGCAATGGAGAATT
TGTAAGAGGAAATGAGCTTCCTCGTCCAATTCAG
TATTTATGCTGGTCGCCTGTTGGGAGTAAATTAG
CATATGTCTATCAAAACAATATCTATTTGAAACA
AAGACCAGGAGATCCACCTTTTCAAATAACATTT
AATGGAAGAGAAAATAAAATATTTAATGGAATC
CCAGACTGGGTTTATGAAGAGGAAATGCTTGCTA
CAAAATATGCTCTCTGGTGGTCTCCTAATGGAAA
ATTTTTGGCATATGCGGAATTTAATGATACGGAT
ATACCAGTTATTGCCTATTCCTATTATGGCGATGA
ACAATATCCTAGAACAATAAATATTCCATACCCA
AAGGCTGGAGCTAAGAATCCCGTTGTTCGGATAT
TTATTATCGATACCACTTACCCTGCGTATGTAGGT
CCCCAGGAAGTGCCTGTTCCAGCAATGATAGCCT
CAAGTGATTATTATTTCAGTTGGCTCACGTGGGTT
ACTGATGAACGAGTATGTTTGCAGTGGCTAAAAA
GAGTCCAGAATGTTTCGGTCCTGTCTATATGTGA
CTTCAGGGAAGACTGGCAGACATGGGATTGTCCA
AAGACCCAGGAGCATATAGAAGAAAGCAGAACT
GGATGGGCTGGTGGATTCTTTGTTTCAACACCAG
TTTTCAGCTATGATGCCATTTCGTACTACAAAATA
TTTAGTGACAAGGATGGCTACAAACATATTCACT
ATATCAAAGACACTGTGGAAAATGCTATTCAAAT
TACAAGTGGCAAGTGGGAGGCCATAAATATATTC
AGAGTAACACAGGATTCACTGTTTTATTCTAGCA
SEQ Name Sequence
NO:
ATGAATTTGAAGAATACCCTGGAAGAAGAAACA
TCTACAGAATTAGCATTGGAAGCTATCCTCCAAG
CAAGAAGTGTGTTACTTGCCATCTAAGGAAAGAA
AGGTGCCAATATTACACAGCAAGTTTCAGCGACT
ACGCCAAGTACTATGCACTTGTCTGCTACGGCCC
AGGCATCCCCATTTCCACCCTTCATGATGGACGC
ACTGATCAAGAAATTAAAATCCTGGAAGAAAAC
AAGGAATTGGAAAATGCTTTGAAAAATATCCAGC
TGCCTAAAGAGGAAATTAAGAAACTTGAAGTAG
ATGAAATTACTTTATGGTACAAGATGATTCTTCCT
CCTCAATTTGACAGATCAAAGAAGTATCCCTTGC
TAATTCAAGTGTATGGTGGTCCCTGCAGTCAGAG
TGTAAGGTCTGTATTTGCTGTTAATTGGATATCTT
ATCTTGCAAGTAAGGAAGGGATGGTCATTGCCTT
GGTGGATGGTCGAGGAACAGCTTTCCAAGGTGAC
AAACTCCTCTATGCAGTGTATCGAAAGCTGGGTG
TTTATGAAGTTGAAGACCAGATTACAGCTGTCAG
AAAATTCATAGAAATGGGTTTCATTGATGAAAAA
AGAATAGCCATATGGGGCTGGTCCTATGGAGGAT
ACGTTTCATCACTGGCCCTTGCATCTGGAACTGGT
CTTTTCAAATGTGGTATAGCAGTGGCTCCAGTCTC
CAGCTGGGAATATTACGCGTCTGTCTACACAGAG
AGATTCATGGGTCTCCCAACAAAGGATGATAATC
TTGAGCACTATAAGAATTCAACTGTGATGGCAAG
AGCAGAATATTTCAGAAATGTAGACTATCTTCTC
ATCCACGGAACAGCAGATGATAATGTGCACTTTC
AAAACTCAGCACAGATTGCTAAAGCTCTGGTTAA
TGCACAAGTGGATTTCCAGGCAATGTGGTACTCT
GACCAGAACCACGGCTTATCCGGCCTGTCCACGA
ACCACTTATACACCCACATGACCCACTTCCTAAA
GCAGTGTTTCTCTTTGTCAGACGGCAAAAAGAAA
AAGAAAAAGGGCCACCACCATCACCATCAC
89 mouse FAP UniProt no. P97321
90 Murine FAP RPSRVYKPEGNTKPvALTLKDILNGTFSYKTYFPNWI ectodomain+poly-lys- SEQEYLHQSEDDNIVFYNIETRESYIILSNSTMKSVN tag+his6-tag ATDYGLSPDRQFVYLESDYSKLWRYSYTATYYIYD
LQNGEFVRGYELPRPIQYLCWSPVGSKLAYVYQN
IYLKQRPGDPPFQITYTGRENRIFNGIPDWVYEEEML
ATKYALWWSPDGKFLAYVEFNDSDIPIIAYSYYGD
GQYPRTINIPYPKAGAKNPWRVFIVDTTYPHHVGP
MEVPVPEMIASSDYYFSWLTWVSSERVCLQWLKR
VQNVSVLSICDFREDWHAWECPKNQEHVEESRTG
WAGGFFVSTPAFSQDATSYYKIFSDKDGYKHIHYIK
DTVENAIQITSGKWEAIYIFRVTQDSLFYSSNEFEGY
PGRRNIYRISIGNSPPSKKCVTCHLRKERCQYYTASF
SYKAKYYALVCYGPGLPISTLHDGRTDQEIQVLEEN
KELENSLRNIQLPKVEIKKLKDGGLTFWYKMILPPQ
FDRSKKYPLLIQVYGGPCSQSVKSVFAVNWITYLAS
KEGIVIALVDGRGTAFQGDKFLHAVYRKLGVYEVE
DQLTAVRKFIEMGFIDEERIAIWGWSYGGYVSSLAL
ASGTGLFKCGIAVAPVSSWEYYASIYSERFMGLPTK
DDNLEHYK STVMARAEYFRNVDYLLIHGTADDN
SEQ Name Sequence
NO:
VHFQNSAQIAKALVNAQVDFQAMWYSDQNHGILS GRSQNHLYTHMTHFLKQCFSLSDGKKKKKKGHHH HHH
91 nucleotide sequence of CGTCCCTCAAGAGTTTACAAACCTGAAGGAAACA murine FAP CAAAGAGAGCTCTTACCTTGAAGGATATTTTAAA ectodomain+poly-lys- TGGAACATTCTCATATAAAACATATTTTCCCAACT tag+his6-tag GGATTTCAGAACAAGAATATCTTCATCAATCTGA
GGATGATAACATAGTATTTTATAATATTGAAACA
AGAGAATCATATATCATTTTGAGTAATAGCACCA
TGAAAAGTGTGAATGCTACAGATTATGGTTTGTC
ACCTGATCGGCAATTTGTGTATCTAGAAAGTGAT
TATTCAAAGCTCTGGCGATATTCATACACAGCGA
CATACTACATCTACGACCTTCAGAATGGGGAATT
TGTAAGAGGATACGAGCTCCCTCGTCCAATTCAG
TATCTATGCTGGTCGCCTGTTGGGAGTAAATTAG
CATATGTATATCAAAACAATATTTATTTGAAACA
AAGACCAGGAGATCCACCTTTTCAAATAACTTAT
ACTGGAAGAGAAAATAGAATATTTAATGGAATA
CCAGACTGGGTTTATGAAGAGGAAATGCTTGCCA
CAAAATATGCTCTTTGGTGGTCTCCAGATGGAAA
ATTTTTGGCATATGTAGAATTTAATGATTCAGATA
TACCAATTATTGCCTATTCTTATTATGGTGATGGA
CAGTATCCTAGAACTATAAATATTCCATATCCAA
AGGCTGGGGCTAAGAATCCGGTTGTTCGTGTTTT
TATTGTTGACACCACCTACCCTCACCACGTGGGC
CCAATGGAAGTGCCAGTTCCAGAAATGATAGCCT
CAAGTGACTATTATTTCAGCTGGCTCACATGGGT
GTCCAGTGAACGAGTATGCTTGCAGTGGCTAAAA
AGAGTGCAGAATGTCTCAGTCCTGTCTATATGTG
ATTTCAGGGAAGACTGGCATGCATGGGAATGTCC
AAAGAACCAGGAGCATGTAGAAGAAAGCAGAAC
AGGATGGGCTGGTGGATTCTTTGTTTCGACACCA
GCTTTTAGCCAGGATGCCACTTCTTACTACAAAA
TATTTAGCGACAAGGATGGTTACAAACATATTCA
CTACATCAAAGACACTGTGGAAAATGCTATTCAA
ATTACAAGTGGCAAGTGGGAGGCCATATATATAT
TCCGCGTAACACAGGATTCACTGTTTTATTCTAGC
AATGAATTTGAAGGTTACCCTGGAAGAAGAAAC
ATCTACAGAATTAGCATTGGAAACTCTCCTCCGA
GCAAGAAGTGTGTTACTTGCCATCTAAGGAAAGA
AAGGTGCCAATATTACACAGCAAGTTTCAGCTAC
AAAGCCAAGTACTATGCACTCGTCTGCTATGGCC
CTGGCCTCCCCATTTCCACCCTCCATGATGGCCGC
ACAGACCAAGAAATACAAGTATTAGAAGAAAAC
AAAGAACTGGAAAATTCTCTGAGAAATATCCAGC
TGCCTAAAGTGGAGATTAAGAAGCTCAAAGACG
GGGGACTGACTTTCTGGTACAAGATGATTCTGCC
TCCTCAGTTTGACAGATCAAAGAAGTACCCTTTG
CTAATTCAAGTGTATGGTGGTCCTTGTAGCCAGA
GTGTTAAGTCTGTGTTTGCTGTTAATTGGATAACT
TATCTCGCAAGTAAGGAGGGGATAGTCATTGCCC
TGGTAGATGGTCGGGGCACTGCTTTCCAAGGTGA
SEQ Name Sequence
NO:
CAAATTCCTGCATGCCGTGTATCGAAAACTGGGT
GTATATGAAGTTGAGGACCAGCTCACAGCTGTCA
GAAAATTCATAGAAATGGGTTTCATTGATGAAGA
AAGAATAGCCATATGGGGCTGGTCCTACGGAGGT
TATGTTTCATCCCTGGCCCTTGCATCTGGAACTGG
TCTTTTCAAATGTGGCATAGCAGTGGCTCCAGTCT
CCAGCTGGGAATATTACGCATCTATCTACTCAGA
GAGATTCATGGGCCTCCCAACAAAGGACGACAAT
CTCGAACACTATAAAAATTCAACTGTGATGGCAA
GAGCAGAATATTTCAGAAATGTAGACTATCTTCT
CATCCACGGAACAGCAGATGATAATGTGCACTTT
CAGAACTCAGCACAGATTGCTAAAGCTTTGGTTA
ATGCACAAGTGGATTTCCAGGCGATGTGGTACTC
TGACCAGAACCATGGTATATTATCTGGGCGCTCC
CAGAATCATTTATATACCCACATGACGCACTTCC
TCAAGCAATGCTTTTCTTTATCAGACGGCAAAAA
GAAAAAGAAAAAGGGCCACCACCATCACCATCA
C
92 Cynomolgus FAP RPPRVHNSEENTMRALTLKDILNGTFSYKTFFPNWI ectodomain+poly-lys- SGQEYLHQSADN IVLYNIETGQSYTILSNRTMKSV tag+his6-tag NASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIY
DLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQN
NIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEE
MLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYY
GDEQYPRTINIPYPKAGAK PFVRIFIIDTTYPAYVG
PQEVPVPAMIASSDYYFSWLTWVTDERVCLQWLK
RVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTG
WAGGFFVSTPVFSYDAISYYKIFSDKDGYKHIHYIK
DTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEDY
PGRRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASF
SDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEENK
ELENALK IQLPKEEIKKLEVDEITLWYKMILPPQFD
RSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKE
GMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVED
QITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALA
SGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTK
DDNLEHYK STVMARAEYFRNVDYLLIHGTADDN
VHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSG
LSTNHLYTHMTHFLKQCFSLSDGKKKKKKGHHHH
HH
93 nucleotide sequence of CGCCCTCCAAGAGTTCATAACTCTGAAGAAAATA cynomolgus FAP CAATGAGAGCACTCACACTGAAGGATATTTTAAA ectodomain+poly-lys- TGGGACATTTTCTTATAAAACATTTTTTCCAAACT tag+his6-tag GGATTTCAGGACAAGAATATCTTCATCAATCTGC
AGATAACAATATAGTACTTTATAATATTGAAACA
GGACAATCATATACCATTTTGAGTAACAGAACCA
TGAAAAGTGTGAATGCTTCAAATTATGGCTTATC
ACCTGATCGGCAATTTGTATATCTAGAAAGTGAT
TATTCAAAGCTTTGGAGATACTCTTACACAGCAA
CATATTACATCTATGACCTTAGCAATGGAGAATT
TGTAAGAGGAAATGAGCTTCCTCGTCCAATTCAG
TATTTATGCTGGTCGCCTGTTGGGAGTAAATTAG
SEQ Name Sequence
NO:
CATATGTCTATCAAAACAATATCTATTTGAAACA
AAGACCAGGAGATCCACCTTTTCAAATAACATTT
AATGGAAGAGAAAATAAAATATTTAATGGAATC
CCAGACTGGGTTTATGAAGAGGAAATGCTTGCTA
CAAAATATGCTCTCTGGTGGTCTCCTAATGGAAA
ATTTTTGGCATATGCGGAATTTAATGATACAGAT
ATACCAGTTATTGCCTATTCCTATTATGGCGATGA
ACAATATCCCAGAACAATAAATATTCCATACCCA
AAGGCCGGAGCTAAGAATCCTTTTGTTCGGATAT
TTATTATCGATACCACTTACCCTGCGTATGTAGGT
CCCCAGGAAGTGCCTGTTCCAGCAATGATAGCCT
CAAGTGATTATTATTTCAGTTGGCTCACGTGGGTT
ACTGATGAACGAGTATGTTTGCAGTGGCTAAAAA
GAGTCCAGAATGTTTCGGTCTTGTCTATATGTGAT
TTCAGGGAAGACTGGCAGACATGGGATTGTCCAA
AGACCCAGGAGCATATAGAAGAAAGCAGAACTG
GATGGGCTGGTGGATTCTTTGTTTCAACACCAGTT
TTCAGCTATGATGCCATTTCATACTACAAAATATT
TAGTGACAAGGATGGCTACAAACATATTCACTAT
ATCAAAGACACTGTGGAAAATGCTATTCAAATTA
CAAGTGGCAAGTGGGAGGCCATAAATATATTCAG
AGTAACACAGGATTCACTGTTTTATTCTAGCAAT
GAATTTGAAGATTACCCTGGAAGAAGAAACATCT
ACAGAATTAGCATTGGAAGCTATCCTCCAAGCAA
GAAGTGTGTTACTTGCCATCTAAGGAAAGAAAGG
TGCCAATATTACACAGCAAGTTTCAGCGACTACG
CCAAGTACTATGCACTTGTCTGCTATGGCCCAGG
CATCCCCATTTCCACCCTTCATGACGGACGCACT
GATCAAGAAATTAAAATCCTGGAAGAAAACAAG
GAATTGGAAAATGCTTTGAAAAATATCCAGCTGC
CTAAAGAGGAAATTAAGAAACTTGAAGTAGATG
AAATTACTTTATGGTACAAGATGATTCTTCCTCCT
CAATTTGACAGATCAAAGAAGTATCCCTTGCTAA
TTCAAGTGTATGGTGGTCCCTGCAGTCAGAGTGT
AAGGTCTGTATTTGCTGTTAATTGGATATCTTATC
TTGCAAGTAAGGAAGGGATGGTCATTGCCTTGGT
GGATGGTCGGGGAACAGCTTTCCAAGGTGACAA
ACTCCTGTATGCAGTGTATCGAAAGCTGGGTGTT
TATGAAGTTGAAGACCAGATTACAGCTGTCAGAA
AATTCATAGAAATGGGTTTCATTGATGAAAAAAG
AATAGCCATATGGGGCTGGTCCTATGGAGGATAT
GTTTCATCACTGGCCCTTGCATCTGGAACTGGTCT
TTTCAAATGTGGGATAGCAGTGGCTCCAGTCTCC
AGCTGGGAATATTACGCGTCTGTCTACACAGAGA
GATTCATGGGTCTCCCAACAAAGGATGATAATCT
TGAGCACTATAAGAATTCAACTGTGATGGCAAGA
GCAGAATATTTCAGAAATGTAGACTATCTTCTCA
TCCACGGAACAGCAGATGATAATGTGCACTTTCA
AAACTCAGCACAGATTGCTAAAGCTCTGGTTAAT
GCACAAGTGGATTTCCAGGCAATGTGGTACTCTG
ACCAGAACCACGGCTTATCCGGCCTGTCCACGAA
CCACTTATACACCCACATGACCCACTTCCTAAAG
SEQ Name Sequence
NO:
CAGTGTTTCTCTTTGTCAGACGGCAAAAAGAAAA AGAAAAAGGGCCACCACCATCACCATCAC
94 human CEA UniProt no. P06731
95 human MCSP UniProt no. Q6UVK1
96 human EGFR UniProt no. P00533
97 human CD 19 UniProt no. P15391
98 human CD20 Uniprot no. PI 1836
99 human CD33 UniProt no. P20138
100 human OX40 UniProt no. P43489
101 human 4- IBB UniProt no. Q07011
102 human CD27 UniProt no. P26842
103 human HVEM UniProt no. Q92956
104 human CD30 UniProt no. P28908
105 human GITR UniProt no. Q9Y5U5
106 murine OX40 UniProt no. P47741
107 murine 4- IBB UniProt no. P20334
108 cynomolgus 4- IBB Uniprot no. F6W5G6
109 Petpide linker G4S GGGGS
110 Peptide linker (G4S)2 GGGGSGGGGS
111 Peptide linker (SG4)2 S GGGGS GGGG
112 Peptide linker (G4S)3 GGGGS GGGGS GGGGS
113 Peptide linker G4(SG4)2 GGGGS GGGGS GGGG
114 Peptide linker (G4S)4 GGGGSGGGGSGGGGSGGGGS
115 Peptide linker GSPGSSSSGS
116 Peptide linker GSGSGSGS
117 Peptide linker GSGSGNGS
118 Peptide linker GGSGSGSG
119 Peptide linker GGSGSG
120 Peptide linker GGSG
121 Peptide linker GGSGNGSG
122 Peptide linker GGNGSGSG
123 Peptide linker GGNGSG
124 human TRAF2 UniProt no. Q12933
125 human Thrombospondin 1 UniProt no. P07996
126 human Matrilin-4 UniProt no. 095460
127 human Cubilin UniProt no. 060494
iso leucine zipper domain IKQIEDKIEE ILSKIYHIEN EIARIKKLIG ER
128
cynomolgus OX40 ECD aa 29-214
129
murine OX40 ECD aa 10-211
130
nucleotide sequence see Table 2
131 Fc hole chain
nucleotide sequence see Table 2
human OX40 antigen Fc knob
132 chain
nucleotide sequence see Table 2
The following points describe aspects of the present invention:
(1) A trimeric antigen binding molecule comprising three fusion polypeptides, each of the three fusion polypeptides comprising
(a) a moiety capable of specific binding to a costimulatory TNF receptor family member,
(b) a trimerization domain, and
(c) a moiety capable of specific binding to a target cell antigen.
(2) The trimeric antigen binding molecule as defined in the point (1) above, comprising three fusion polypeptides, each of the three fusion polypeptides comprising
(a) a moiety capable of specific binding to a costimulatory TNF receptor family member,
(b) a trimerization domain derived from human cartilage matrix protein (huCMP) of amino acid sequence of SEQ ID NO: l, and
(c) a moiety capable of specific binding to a target cell antigen.
(3) The trimeric antigen binding molecule as defined in point (1) or point (2) above, wherein the trimerization domain comprises an amino acid sequence having at least 95% identity to SEQ ID NO:2.
(4) The trimeric antigen binding molecule as defined in any one of the preceding points, wherein the trimerization domain comprises the amino acid sequence of SEQ ID NO:2.
(5) The trimeric antigen binding molecule as defined in any one of the preceding points, wherein the three fusion polypeptides are linked by disulphide bonds.
(6) The trimeric antigen binding molecule as defined in any one of the preceding points, wherein the costimulatory TNF receptor family member is selected from OX40 and 4- 1BB.
(7) The trimeric antigen binding molecule as defined in any one of the preceding points, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:3.
(8) The trimeric antigen binding molecule as defined in any one of the preceding points, comprising a moiety capable of specific binding to OX40, wherein the moiety comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:4 and SEQ ID NO:5,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14,
and a VL comprising
(iv) a CDR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16 and SEQ ID NO: 17,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO:20, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 and SEQ ID NO:26. (9) The trimeric antigen binding molecule as defined in any one of the preceding points, comprising a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:27, SEQ ID NO: 29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37 and SEQ ID NO:39 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:28, SEQ ID NO: 30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38 and SEQ ID NO:40.
(10) The trimeric antigen binding molecule as defined in any one of the preceding points, comprising a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises
(i) a VH comprising the amino acid sequence of SEQ ID NO:27 and a VL comprising the amino acid sequence of SEQ ID NO:28,
(ii) a VH comprising the amino acid sequence of SEQ ID NO:29 and a VL comprising the amino acid sequence of SEQ ID NO:30,
(iii) a VH comprising the amino acid sequence of SEQ ID NO: 31 and a VL comprising the amino acid sequence of SEQ ID NO:32,
(iv) a VH comprising the amino acid sequence of SEQ ID NO:33 and a VL comprising the amino acid sequence of SEQ ID NO:34,
(v) a VH comprising the amino acid sequence of SEQ ID NO:35 and a VL comprising the amino acid sequence of SEQ ID NO:36,
(vi) a VH comprising the amino acid sequence of SEQ ID NO:37 and a VL comprising the amino acid sequence of SEQ ID NO:38, or
(vii) a VH comprising the amino acid sequence of SEQ ID NO:39 and a VL comprising the amino acid sequence of SEQ ID NO:40.
(11) The trimeric antigen binding molecule as defined in any one of the preceding points, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:41.
(12) The trimeric antigen binding molecule as defined in any one of points (1) to (6), or point (11) above, comprising a moiety capable of specific binding to 4- IBB, wherein the moiety comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:44 and SEQ ID NO:45, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50, and a VL comprising
(iv) a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:51 and SEQ ID NO:52,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:53 and SEQ ID NO:54, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of
SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58 and SEQ ID NO:59.
(13) The trimeric antigen binding molecule as defined in any one of points (1) to (6), point (11) or point (12) above, comprising a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4- IBB comprises a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66 and SEQ ID NO:68 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:61, SEQ ID
NO:63, SEQ ID NO:65, SEQ ID NO:67 and SEQ ID NO:69.
(14) The trimeric antigen binding molecule as defined in any one of points (1) to (6), or points (11) to (13) above, comprising a moiety capable of specific binding to 4-1BB, wherein the moiety capable of specific binding to 4-1BB comprises
(i) a VH comprising the amino acid sequence of SEQ ID NO: 60 and a VL comprising the amino acid sequence of SEQ ID NO:61,
(ii) a VH comprising the amino acid sequence of SEQ ID NO: 62 and a VL comprising the amino acid sequence of SEQ ID NO: 63,
(iii) a VH comprising the amino acid sequence of SEQ ID NO: 64 and a VL comprising the amino acid sequence of SEQ ID NO: 65,
(iv) a VH comprising the amino acid sequence of SEQ ID NO: 66 and a VL comprising the amino acid sequence of SEQ ID NO: 67, or
(v) a VH comprising the amino acid sequence of SEQ ID NO:68 and a VL comprising the amino acid sequence of SEQ ID NO: 69. (15) The trimeric antigen binding molecule as defined in any one of the preceding
points, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member is fused at the C-terminal amino acid to the N-terminal amino acid of the trimerization domain, optionally through a peptide linker. (16) The trimeric antigen binding molecule as defined in any one of the preceding
points, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member is a Fab fragment or a scFv.
(17) The trimeric antigen binding molecule as defined in any one of the preceding points, wherein the target cell antigen is selected from the group consisting of Fibroblast
Activation Protein (FAP), Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), Carcinoembryonic Antigen (CEA), CD 19, CD20 and CD33. (18) The trimeric antigen binding molecule as defined in any one of the preceding
points, comprising a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:70 and SEQ ID NO:76,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of
SEQ ID NO:71 and SEQ ID NO:77, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:72 and SEQ ID NO:78,
and a VL comprising
(iv) a CDR-Ll comprising an amino acid sequence selected from the group consisting of
SEQ ID NO:73 and SEQ ID NO:79,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:74 and SEQ ID NO:80, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:75 and SEQ ID NO:81.
(19) The trimeric antigen binding molecule as defined in any one of the preceding points, comprising a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises a VH comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 82 and SEQ ID NO: 84, and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ
ID NO: 83 and SEQ ID NO: 85.
(20) The trimeric antigen binding molecule as defined in any one of the preceding points, comprising a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises
(i) a VH comprising the amino acid sequence of SEQ ID NO: 82 and a VL comprising the amino acid sequence of SEQ ID NO:83, or
(ii) a VH comprising the amino acid sequence of SEQ ID NO: 84 and a VL comprising the amino acid sequence of SEQ ID NO: 85.
(21) The trimeric antigen binding molecule as defined in any one of the preceding points, wherein the moiety capable of specific binding to a target cell antigen is fused at the N-terminal amino acid to the C-terminal amino acid of the trimerization domain, optionally through a peptide linker.
(22) A fusion polypeptide comprising (a) a VH and/or VL of a moiety capable of specific binding to a costimulatory TNF receptor family member, (b) a trimerization domain derived from human cartilage matrix protein (huCMP) comprising the amino acid sequence of SEQ ID NO:2, wherein the trimerization domain is capable of mediating stable association of the fusion polypeptide with two further such fusion polypeptides and
(c) a VH and/or VL of a moiety capable of specific binding to a target cell antigen.
(23) The fusion polypeptide of point (22) above, wherein the fusion polypeptide
comprises a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:70 and SEQ ID NO:76,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:71 and SEQ ID NO:77, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:72 and SEQ ID NO:78,
and a VL comprising
(iv) a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:73 and SEQ ID NO:79,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:74 and SEQ ID NO:80, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of
SEQ ID NO:75 and SEQ ID NO:81.
(24) The fusion polypeptide of point (22) or point (23) above, wherein the fusion
polypeptide comprises a VH of a moiety capable of specific binding to OX40, wherein the VH comprises
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:4 and SEQ ID NO:5,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of
SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14.
(25) The fusion polypeptide of point (22) or point (23) above, wherein the fusion
polypeptide comprises a VH of a moiety capable of specific binding to 4- IBB, wherein the VH comprises
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:44 and SEQ ID NO:45, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50.
(26) A polynucleotide encoding the trimeric antigen binding molecule of any one of points (1) to (21) above, or the fusion polypeptide of any one of points (22) to (25) above.
(27) An expression vector comprising the polynucleotide of point (26) above.
(28) A host cell comprising the polynucleotide point (26) above or the expression vector of point (27) above.
(29) A method of producing a trimeric antigen binding molecule, comprising culturing the host cell of point (28) above under conditions suitable for the expression of the trimeric antigen binding molecule, and isolating the trimeric antigen binding molecule.
(30) A pharmaceutical composition comprising the trimeric antigen binding molecule of any one of points (1) to (21) above and at least one pharmaceutically acceptable excipient.
(31) The trimeric antigen binding molecule of any one of points (1) to (21) above, or the pharmaceutical composition of point (30) above, for use as a medicament. (32) The trimeric antigen binding molecule of any one of points (1) to (21) above, or the pharmaceutical composition of point (30) above, for use
(i) in stimulating T cell response,
(ii) in supporting survival of activated T cells,
(iii) in the treatment of infections,
(iv) in the treatment of cancer,
(v) in delaying progression of cancer, or
(vi) in prolonging the survival of a patient suffering from cancer.
(33) The trimeric antigen binding molecule of any one of points (1) to (21) above, or the pharmaceutical composition of point (30) above, for use in the treatment of cancer.
(34) Use of the trimeric antigen binding molecule of any one of points (1) to (21) above, or the pharmaceutical composition of point (30) above, in the manufacture of a medicament for the treatment of cancer.
(35) A method of treating an individual having cancer comprising administering to the individual an effective amount of the trimeric antigen binding molecule of any one of points (1) to (21) above, or the pharmaceutical composition of point (30) above. (36) The trimeric antigen binding molecule of any one of points (1) to (21) above, or the pharmaceutical composition of point (30) above, for use in up-regulating or prolonging cytotoxic T cell activity.
(37) ) Use of the trimeric antigen binding molecule of any one of points (1) to (21) above, or the pharmaceutical composition of point (30) above, in the manufacture of a medicament for up-regulating or prolonging cytotoxic T cell activity.
(38) ) A method of up-regulating or prolonging cytotoxic T cell activity in an individual having cancer, comprising administering to the individual an effective amount of the trimeric antigen binding molecule of any one of points (1) to (21) above, or the pharmaceutical composition of point (30) above.
EXAMPLES
The following are examples of methods and compositions of the invention. It is understood that various other embodiments may be practiced, given the general description provided above.
Recombinant DNA techniques
Standard methods were used to manipulate DNA as described in Sambrook et al,
Molecular cloning: A laboratory manual; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989. The molecular biological reagents were used according to the manufacturer's instructions. General information regarding the nucleotide sequences of human immunoglobulin light and heavy chains is given in: Kabat, E.A. et al., (1991) Sequences of Proteins of Immunological Interest, Fifth Ed., NIH Publication No 91-3242. DNA sequencing
DNA sequences were determined by double strand sequencing. Gene synthesis
Desired gene segments were either generated by PCR using appropriate templates or were synthesized by Geneart AG (Regensburg, Germany) from synthetic oligonucleotides and PCR products by automated gene synthesis. In cases where no exact gene sequence was available, oligonucleotide primers were designed based on sequences from closest homologues and the genes were isolated by RT-PCR from RNA originating from the appropriate tissue. The gene segments flanked by singular restriction endonuclease cleavage sites were cloned into standard cloning / sequencing vectors. The plasmid DNA was purified from transformed bacteria and concentration determined by UV spectroscopy. The DNA sequence of the subcloned gene fragments was confirmed by DNA sequencing. Gene segments were designed with suitable restriction sites to allow sub-cloning into the respective expression vectors. All constructs were designed with a 5 '-end DNA sequence coding for a leader peptide which targets proteins for secretion in eukaryotic cells.
Protein purification
Proteins were purified from filtered cell culture supernatants referring to standard protocols. In brief, antibodies were applied to a Protein A Sepharose column (GE healthcare) and washed with PBS. Elution of antibodies was achieved at pH 2.8 followed by immediate neutralization of the sample. Aggregated protein was separated from monomeric antibodies by size exclusion chromatography (Superdex 200, GE Healthcare) in PBS or in 20 mM Histidine, 150 mM NaCl pH 6.0. Monomeric antibody fractions were pooled, concentrated (if required) using e.g., a MILLIPORE Amicon Ultra (30 MWCO) centrifugal concentrator, frozen and stored at -20°C or -80°C. Part of the samples were provided for subsequent protein analytics and analytical characterization e.g. by SDS-PAGE, size exclusion chromatography (SEC) or mass spectrometry.
SDS-PAGE
The NuPAGE® Pre-Cast gel system (Invitrogen) was used according to the manufacturer's instruction. In particular, 10% or 4-12% NuPAGE® Novex® Bis-TRIS Pre-Cast gels (pH 6.4) and a NuPAGE® MES (reduced gels, with NuPAGE® Antioxidant running buffer additive) or MOPS (non-reduced gels) running buffer was used.
Analytical size exclusion chromatography
Size exclusion chromatography (SEC) for the determination of the aggregation and oligomeric state of antibodies was performed by HPLC chromatography. Briefly, Protein A purified antibodies were applied to a Tosoh TSKgel G3000SW column in 300 mM NaCl, 50 mM KH2PO4/K2HPO4, pH 7.5 on an Agilent HPLC 1100 system or to a Superdex 200 column (GE Healthcare) in 2 x PBS on a Dionex HPLC-System. The eluted protein was quantified by UV absorbance and integration of peak areas. BioRad Gel Filtration Standard 151-1901 served as a standard.
Example 1 Generation of OX40 antibodies
1.1 Preparation, purification and characterization of antigens and screening tools for the generation of novel OX40 binders by Phage Display
DNA sequences encoding the ectodomains of human, mouse or cynomolgus OX40
(Table 1) were subcloned in frame with the human IgGl heavy chain CH2 and CH3 domains on the knob (Merchant et al., 1998). An AcTEV protease cleavage site was introduced between an antigen ectodomain and the Fc of human IgGl . An Avi tag for directed biotinylation was introduced at the C-terminus of the antigen-Fc knob. Combination of the antigen-Fc knob chain
containing the S354C/T366W mutations, with a Fc hole chain containing the
Y349C/T366S/L368A/Y407V mutations allows generation of a heterodimer which includes a single copy of the OX40 ectodomain containing chain, thus creating a monomeric form of Fc- linked antigen (Figure 1). Table 1 shows the amino acid sequences of the various OX40 ectodomains. Table 2 the cDNA and amino acid sequences of monomeric antigen Fc(kih) fusion molecules as depicted in Figure 1.
Table 1. Amino acid numbering of antigen ectodomains (ECD) and their
Table 2. cDNA and amino acid sequences of monomeric antigen Fc(kih) fusion molecules (produced by combination of one Fc hole chain with one antigen Fc knob chain)
SEQ ID NO: Antigen Sequence
131 Nucleotide GACAAAACTCACACATGCCCACCGTGCCCAGCACCT
GAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCC
sequence CAAAACCCAAGGACACCCTCATGATCTCCCGGACCC Fc hole chain CTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACG
AAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACG
GCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGG
GAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGC
GTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGC
AAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTC
CCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAA
GGGCAGCCCCGAGAACCACAGGTGTGCACCCTGCCC
CCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGC
CTCTCGTGCGCAGTCAAAGGCTTCTATCCCAGCGAC
ATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGA
GAACAACTACAAGACCACGCCTCCCGTGCTGGACTC
CGACGGCTCCTTCTTCCTCGTGAGCAAGCTCACCGTG
GACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCA
TGCTCCGTGATGCATGAGGCTCTGCACAACCACTAC
ACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA
Nucleotide CTGCACTGCGTGGGCGACACCTACCCCAGCAACGAC
CGGTGCTGCCACGAGTGCAGACCCGGCAACGGCATG
sequence GTGTCCCGGTGCAGCCGGTCCCAGAACACCGTGTGC human OX40 AGACCTTGCGGCCCTGGCTTCTACAACGACGTGGTG antigen Fc TCCAGCAAGCCCTGCAAGCCTTGTACCTGGTGCAAC
CTGCGGAGCGGCAGCGAGCGGAAGCAGCTGTGTACC
knob chain
GCCACCCAGGATACCGTGTGCCGGTGTAGAGCCGGC
ACCCAGCCCCTGGACAGCTACAAACCCGGCGTGGAC
TGCGCCCCTTGCCCTCCTGGCCACTTCAGCCCTGGCG
ACAACCAGGCCTGCAAGCCTTGGACCAACTGCACCC
TGGCCGGCAAGCACACCCTGCAGCCCGCCAGCAATA
GCAGCGACGCCATCTGCGAGGACCGGGATCCTCCTG
CCACCCAGCCTCAGGAAACCCAGGGCCCTCCCGCCA
GACCCATCACCGTGCAGCCTACAGAGGCCTGGCCCA
GAACCAGCCAGGGGCCTAGCACCAGACCCGTGGAA
GTGCCTGGCGGCAGAGCCGTCGACGAACAGTTATAT
TTTCAGGGCGGCTCACCCAAATCTGCAGACAAAACT
CACACATGCCCACCGTGCCCAGCACCTGAACTCCTG
GGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCA
AGGACACCCTCATGATCTCCCGGACCCCTGAGGTCA
CATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTG
AGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGG
TGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAG
TACAACAGCACGTACCGTGTGGTCAGCGTCCTCACC
GTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTAC
AAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCC
ATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCC
CGAGAACCACAGGTGTACACCCTGCCCCCATGCCGG
GATGAGCTGACCAAGAACCAGGTCAGCCTGTGGTGC
CTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTG
GAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTA
CAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTC
CTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAG
CAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGT
GATGCATGAGGCTCTGCACAACCACTACACGCAGAA
GAGCCTCTCCCTGTCTCCGGGTAAATCCGGAGGCCT
GAACGACATCTTCGAGGCCCAGAAGATTGAATGGCA
CGAG
Nucleotide CTCCACTGTGTCGGGGACACCTACCCCAGCAACGAC
CGGTGCTGTCAGGAGTGCAGGCCAGGCAACGGGATG
sequence GTGAGCCGCTGCAACCGCTCCCAGAACACGGTGTGC cynomolgus CGTCCGTGCGGGCCCGGCTTCTACAACGACGTGGTC OX40 antigen AGCGCCAAGCCCTGCAAGGCCTGCACATGGTGCAAC
CTCAGAAGTGGGAGTGAGCGGAAACAGCCGTGCAC
Fc knob chain
GGCCACACAGGACACAGTCTGCCGCTGCCGGGCGGG
CACCCAGCCCCTGGACAGCTACAAGCCTGGAGTTGA
CTGTGCCCCCTGCCCTCCAGGGCACTTCTCCCCGGGC
GACAACCAGGCCTGCAAGCCCTGGACCAACTGCACC
TTGGCCGGGAAGCACACCCTGCAGCCAGCCAGCAAT
AGCTCGGACGCCATCTGTGAGGACAGGGACCCCCCA
CCCACACAGCCCCAGGAGACCCAGGGCCCCCCGGCC
AGGCCCACCACTGTCCAGCCCACTGAAGCCTGGCCC
AGAACCTCACAGAGACCCTCCACCCGGCCCGTGGAG
GTCCCCAGGGGCCCTGCGGTCGACGAACAGTTATAT
TTTCAGGGCGGCTCACCCAAATCTGCAGACAAAACT
CACACATGCCCACCGTGCCCAGCACCTGAACTCCTG
GGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCA
AGGACACCCTCATGATCTCCCGGACCCCTGAGGTCA
CATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTG
AGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGG
TGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAG
TACAACAGCACGTACCGTGTGGTCAGCGTCCTCACC
GTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTAC
AAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCC
ATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCC
CGAGAACCACAGGTGTACACCCTGCCCCCATGCCGG
GATGAGCTGACCAAGAACCAGGTCAGCCTGTGGTGC
CTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTG
GAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTA
CAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTC
CTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAG
CAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGT
GATGCATGAGGCTCTGCACAACCACTACACGCAGAA
GAGCCTCTCCCTGTCTCCGGGTAAATCCGGAGGCCT
GAACGACATCTTCGAGGCCCAGAAGATTGAATGGCA
CGAG
134 Nucleotide GTGACCGCCAGACGGCTGAACTGCGTGAAGCACACC
TACCCCAGCGGCCACAAGTGCTGCAGAGAGTGCCAG
sequence CCCGGCCACGGCATGGTGTCCAGATGCGACCACACA murine OX40 CGGGACACCCTGTGCCACCCTTGCGAGACAGGCTTC antigen Fc TACAACGAGGCCGTGAACTACGATACCTGCAAGCAG
TGCACCCAGTGCAACCACAGAAGCGGCAGCGAGCTG
knob chain
AAGCAGAACTGCACCCCCACCCAGGATACCGTGTGC
AGATGCAGACCCGGCACCCAGCCCAGACAGGACAG
CGGCTACAAGCTGGGCGTGGACTGCGTGCCCTGCCC
TCCTGGCCACTTCAGCCCCGGCAACAACCAGGCCTG
CAAGCCCTGGACCAACTGCACCCTGAGCGGCAAGCA
GACCAGACACCCCGCCAGCGACAGCCTGGATGCCGT
GTGCGAGGACAGAAGCCTGCTGGCCACCCTGCTGTG
GGAGACACAGCGGCCCACCTTCAGACCCACCACCGT
GCAGAGCACCACCGTGTGGCCCAGAACCAGCGAGCT
GCCCAGTCCTCCTACCCTCGTGACACCTGAGGGCCCC
GTCGACGAACAGTTATATTTTCAGGGCGGCTCACCC
AAATCTGCAGACAAAACTCACACATGCCCACCGTGC
CCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTC
CTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCT
CCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACG
TGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGT
ACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAA
AGCCGCGGGAGGAGCAGTACAACAGCACGTACCGT
GTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGG
CTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAAC
AAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCC
AAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTA
CACCCTGCCCCCATGCCGGGATGAGCTGACCAAGAA
CCAGGTCAGCCTGTGGTGCCTGGTCAAAGGCTTCTAT
CCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGG
CAGCCGGAGAACAACTACAAGACCACGCCTCCCGTG
CTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGC
TCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAAC
GTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACA
ACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGG
GTAAATCCGGAGGCCTGAACGACATCTTCGAGGCCC
AGAAGATTGAATGGCACGAG
135 Fc hole chain DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ
YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI
EKTISKAKGQPREPQVCTLPPSRDELTKNQVSLSCAVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVS
KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP
GK
136 human OX40 LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCR
PCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTAT
antigen Fc QDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQ knob chain ACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQ
ETQGPP ARPIT VQPTE A WPRT S QGP STRP VE VPGGRAV
DEQLYFQGGSPKSADKTHTCPPCPAPELLGGPSVFLFPP
KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE
YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDE
LTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA
LHNHYTQKSLSLSPGKSGGLNDIFEAQKIEWHE
137 cynomolgus LHCVGDTYPSNDRCCQECRPGNGMVSRCNRSQNTVCR
PCGPGFYNDVVSAKPCKACTWCNLRSGSERKQPCTAT OX40 antigen QDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQ Fc knob chain ACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPPTQPQ
ETQGPP ARPTTVQPTEAWPRTSQRPSTRPVEVPRGPAV
DEQLYFQGGSPKSADKTHTCPPCPAPELLGGPSVFLFPP
KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE
YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDE
LTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA
LHNHYTQKSLSLSPGKSGGLNDIFEAQKIEWHE
138 murine OX40 VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHT
RDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELK
antigen Fc QNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPG knob chain HF SPGNNQ ACKP WTNCTL S GKQTRHP ASD SLD AVCED
RSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTL
VTPEGPVDEQLYFQGGSPKSADKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN
WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD
WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT
LPPCRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPE
NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGKSGGLNDIFEAQKIEWHE
All OX40-Fc-fusion encoding sequences were cloned into a plasmid vector driving expression of the insert from an MPSV promoter and containing a synthetic polyA signal sequence located at the 3' end of the CDS. In addition, the vector contained an EBV OriP sequence for episomal maintenance of the plasmid.
For preparation of the biotinylated monomeric antigen/Fc fusion molecules, exponentially growing suspension HEK293 EBNA cells were co-transfected with three vectors encoding the
two components of fusion protein (knob and hole chains) as well as BirA, an enzyme necessary for the biotinylation reaction. The corresponding vectors were used at a 2 : 1 : 0.05 ratio
("antigen ECD-AcTEV- Fc knob" : "Fc hole" : "BirA").
For protein production in 500 ml shake flasks, 400 million HEK293 EBNA cells were seeded 24 hours before transfection. For transfection, cells were centrifuged for 5 minutes at 210 g, and supernatant was replaced by pre-warmed CD CHO medium. Expression vectors were resuspended in 20 mL of CD CHO medium containing 200 μg of vector DNA. After addition of 540 of polyethylenimine (PEI), the solution was vortexed for 15 seconds and incubated for 10 minutes at room temperature. Afterwards, cells were mixed with the DNA/PEI solution, transferred to a 500 mL shake flask and incubated for 3 hours at 37 °C in an incubator with a 5% C02 atmosphere. After the incubation, 160 mL of F17 medium was added and cells were cultured for 24 hours. One day after transfection, 1 mM valproic acid and 7% Feed were added to the culture. After 7 days of culturing, the cell supernatant was collected by spinning down cells for 15 min at 210 g. The solution was sterile filtered (0.22 μιη filter), supplemented with sodium azide to a final concentration of 0.01 % (w/v), and kept at 4 °C.
Secreted proteins were purified from cell culture supernatants by affinity chromatography using Protein A, followed by size exclusion chromatography. For affinity chromatography, the supernatant was loaded on a HiTrap ProteinA HP column (CV = 5 mL, GE Healthcare) equilibrated with 40 mL 20 mM sodium phosphate, 20 mM sodium citrate pH 7.5. Unbound protein was removed by washing with at least 10 column volumes of a buffer containing 20 mM sodium phosphate, 20 mM sodium citrate and 0.5 M sodium chloride (pH 7.5). The bound protein was eluted using a linear pH-gradient of sodium chloride (from 0 to 500 mM) created over 20 column volumes of 20 mM sodium citrate, 0.01% (v/v) Tween-20, pH 3.0 . The column was then washed with 10 column volumes of a solution containing 20 mM sodium citrate, 500 mM sodium chloride and 0.01% (v/v) Tween-20, pH 3.0.
The pH of the collected fractions was adjusted by adding 1/40 (v/v) of 2M Tris, pH8.0. The protein was concentrated and filtered prior to loading on a HiLoad Superdex 200 column (GE Healthcare) equilibrated with 2 mM MOPS, 150 mM sodium chloride, 0.02% (w/v) sodium azide solution of pH 7.4.
1.2 Selection of OX40-specific 8H9, 20B7, 49B4, 1G4, CLC-563, CLC-564 and 17A9 antibodies from generic Fab and common light chain libraries
Anti-OX40 antibodies were selected from three different generic phage display libraries: DP88-4 (clones 20B7, 8H9 1G4 and 49B4), the common light chain library Vk3_20/VH3_23 (clones CLC-563 and CLC-564) and lambda-DP47 (clone 17A9).
The DP88-4 library was constructed on the basis of human germline genes using the V- domain pairing Vkl_5 (kappa light chain) and VH1 69 (heavy chain) comprising randomized sequence space in CDR3 of the light chain (L3, 3 different lengths) and CDR3 of the heavy chain (H3, 3 different lengths). Library generation was performed by assembly of 3 PCR- amplified fragments applying splicing by overlapping extension (SOE) PCR. Fragment 1 comprises the 5' end of the antibody gene including randomized L3, fragment 2 is a central constant fragment spanning from L3 to H3 whereas fragment 3 comprises randomized H3 and the 3' portion of the antibody gene. The following primer combinations were used to generate these library fragments for DP88-4 library: fragment 1 (forward primer LMB3 combined with reverse primers Vkl_5_L3r_S or Vkl_5_L3r_SY or Vkl_5_L3r_SPY), fragment 2 (forward primer RJH31 combined with reverse primer RJH32) and fragment 3 (forward primers DP88-v4- 4 or DP88-v4-6 or DP88-v4-8 combined with reverse primer fdseqlong), respectively. PCR parameters for production of library fragments were 5 min initial denaturation at 94 °C, 25 cycles of 1 min 94 °C, 1 min 58 °C, 1 min 72 °C and terminal elongation for 10 min at 72 °C. For assembly PCR, using equimolar ratios of the gel-purified single fragments as template, parameters were 3 min initial denaturation at 94 °C and 5 cycles of 30 s 94 °C, 1 min 58 °C, 2 min 72 °C. At this stage, outer primers (LMB3 and fdseqlong) were added and additional 20 cycles were performed prior to a terminal elongation for 10 min at 72 °C. After assembly of sufficient amounts of full length randomized Fab constructs, they were digested Ncol / Nhel and ligated into similarly treated acceptor phagemid vector. Purified ligations were used for ~60 transformations into electrocompetent E. coli TGI . Phagemid particles displaying the Fab library were rescued and purified by PEG/NaCl purification to be used for selections. These library construction steps were repeated three times to obtain a final library size of 4.4 x 109.
Percentages of functional clones, as determined by C-terminal tag detection in dot blot, were 92.6% for the light chain and 93.7% for the heavy chain, respectively.
The common light chain library Vk3_20/VH3_23 was constructed on the basis of human germline genes using the V-domain pairing Vk3_20 (kappa light chain) and VH3 23 (heavy chain) comprising a constant non-randomized common light chain Vk3_20 and randomized sequence space in CDR3 of the heavy chain (H3, 3 different lengths). Library generation was performed by assembly of 2 PCR-amp lifted fragments applying splicing by overlapping extension (SOE) PCR. Fragment 1 is a constant fragment spanning from L3 to H3 whereas fragment 2 comprises randomized H3 and the 3' portion of the antibody gene. The following primer combinations were used to generate these library fragments for the Vk3_20/VH3_23 common light chain library: fragment 1 (forward primer MS64 combined with reverse primer DP47CDR3_ba (mod.)) and fragment 2 (forward primers DP47-v4-4, DP47-v4-6, DP47-v4-8 combined with reverse primer fdseqlong), respectively. PCR parameters for production of library fragments were 5 min initial denaturation at 94 °C, 25 cycles of 1 min 94 °C, 1 min 58 °C, 1 min
72 °C and terminal elongation for 10 min at 72 °C. For assembly PCR, using equimolar ratios of the gel-purified single fragments as template, parameters were 3 min initial denaturation at 94 °C and 5 cycles of 30 s 94 °C, 1 min 58 °C, 2 min 72 °C. At this stage, outer primers (MS64 and fdseqlong) were added and additional 18 cycles were performed prior to a terminal elongation for 10 min at 72 °C. After assembly of sufficient amounts of full length randomized VH constructs, they were digested Muni / Notl and ligated into similarly treated acceptor phagemid vector. Purified ligations were used for ~60 transformations into electrocompetent E. coli TGI . Phagemid particles displaying the Fab library were rescued and purified by PEG/NaCl purification to be used for selections. A final library size of 3.75 x 109 was obtained.
Percentages of functional clones, as determined by C-terminal tag detection in dot blot, were 98.9% for the light chain and 89.5% for the heavy chain, respectively.
The lambda-DP47 library was constructed on the basis of human germline genes using the following V-domain pairings: V13 19 lambda light chain with VH3 23 heavy chain. The library was randomized in CDR3 of the light chain (L3) and CDR3 of the heavy chain (H3) and was assembled from 3 fragments by "splicing by overlapping extension" (SOE) PCR. Fragment 1 comprises the 5' end of the antibody gene including randomized L3, fragment 2 is a central constant fragment spanning from the end of L3 to the beginning of H3 whereas fragment 3 comprises randomized H3 and the 3 ' portion of the Fab fragment. The following primer combinations were used to generate library fragments for library: fragment 1 (LMB3 - V1 3 19_L3r_V / V1 3 19_L3r_HV / V1 3 19_L3r_HLV), fragment 2 (RJH80 -
DP47CDR3_ba (mod)) and fragment 3 (DP47-v4-4 / DP47-v4-6 / DP47-v4-8 - fdseqlong). PCR parameters for production of library fragments were 5 min initial denaturation at 94 °C, 25 cycles of 60 sec at 94 °C, 60 sec at 55 °C, 60 sec at 72 °C and terminal elongation for 10 min at 72 °C. For assembly PCR, using equimolar ratios of the 3 fragments as template, parameters were 3 min initial denaturation at 94 °C and 5 cycles of 60 sec at 94 °C, 60 sec at 55°C, 120 sec at 72 °C. At this stage, outer primers were added and additional 20 cycles were performed prior to a terminal elongation for 10 min at 72 °C. After assembly of sufficient amounts of full length randomized Fab fragments, they were digested with Ncol / Nhel alongside with similarly treated acceptor phagemid vector. 15ug of Fab library insert were ligated with 13.3ug of phagemid vector. Purified ligations were used for 60 transformations resulting in 1.5 x 109 transformants. Phagemid particles displaying the Fab library were rescued and purified by PEG/NaCl purification to be used for selections.
Human OX40 (CD 134) as antigen for the phage display selections was transiently expressed as N-terminal monomeric Fc-fusion in HEK EBNA cells and in vivo site-specifically biotinylated via co-expression of BirA biotin ligase at the avi-tag recognition sequence located a the C-terminus of the Fc portion carrying the receptor chain (Fc knob chain).
Selection rounds (biopanning) were performed in solution according to the following pattern:
1. Pre-clearing of - 1012 phagemid particles on maxisorp plates coated with 10 μg/ml of an unrelated human IgG to deplete the libraries of antibodies recognizing the Fc-portion of the antigen,
2. incubation of the non-binding phagemid particles with 100 nM biotinylated human OX40 for 0.5 h in the presence of 100 nM unrelated non-biotinylated Fc knob-into-hole construct for further depletion of Fc-binders in a total volume of 1 ml,
3. capture of biotinylated hu OX40 and attached specifically binding phage by transfer to 4 wells of a neutravidin pre-coated microtiter plate for 10 min (in rounds 1 & 3),
4. washing of respective wells using 5x PBS/Tween20 and 5x PBS,
5. elution of phage particles by addition of 250ul 100 mM TEA (triethylamine) per well for 10 min and neutralization by addition of 500 μΐ 1M Tris/HCl pH 7.4 to the pooled eluates from 4 wells,
6. post-clearing of neutralized eluates by incubation on neutravidin pre-coated microtiter plate with 100 nM biotin-captured Fc knob-into-hole construct for final removal of Fc-binders, 7. re-infection of log-phase E. coli TGI cells with the supernatant of eluted phage particles, infection with helperphage VCSM13, incubation on a shaker at 30°C over night and subsequent PEG/NaCl precipitation of phagemid particles to be used in the next selection round. Selections were carried out over 3 or 4 rounds using constant antigen concentrations of 100 nM. In order to increase the likelihood for binders that are cross-reactive not only to cynomolgus OX40 but also murine OX40, in some selection rounds the murine target was used instead of the human OX40. In rounds 2 and 4, in order to avoid enrichment of binders to neutravidin, capture of antigen : phage complexes was performed by addition of 5.4 x 107 streptavidin-coated magnetic beads. Specific binders were identified by ELISA as follows: lOOul of 25 nM biotinylated human OX40 and 10 μg/ml of human IgG were coated on neutravidin plates and maxisorp plates, respectively. Fab-containing bacterial supernatants were added and binding Fabs were detected via their Flag-tags using an anti-Flag/HRP secondary antibody. Clones exhibiting signals on human OX40 and being negative on human IgG were short-listed for further analyses and were also tested in a similar fashion against cynomolgus and murine OX40. They were bacterially expressed in a 0.5 liter culture volume, affinity purified and further characterized by SPR-analysis using BioRad's ProteOn XPR36 biosensor.
Table 3 shows the sequence of generic phage-displayed antibody library (DP88-4), Table 4 provides cDNA and amino acid sequences of library DP88-4 germline template and Table 5 shows the Primer sequences used for generation of DP88-4 germline template.
Table 3. Sequence of generic phage-displayed antibody library (DP88-4)
SEQ ID Description Sequence
NO:
TGAAATACCTATTGCCTACGGCAGCCGCTGGATTGTTATTA
CTCGCGGCCCAGCCGGCCATGGCCGACATCCAGATGACCC
AGTCTCCTTCCACCCTGTCTGCATCTGTAGGAGACCGTGTC
ACCATCACTTGCCGTGCCAGTCAGAGTATTAGTAGCTGGTT
nucleotide GGCCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGCTC sequence CTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATC of ACGTTTCAGCGGCAGTGGATCCGGGACAGAATTCACTCTC
ACCATCAGCAGCTTGCAGCCTGATGATTTTGCAACTTATTA
CTGCCAACAGTATAATAGTTATTCTACGTTTGGCCAGGGCA
pRJH33 CCAAAGTCGAGATCAAGCGTACGGTGGCTGCACCATCTGT library CTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAA template CTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGA
DP88-4 GAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAAT library; CGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCA complete AGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAG
Fab coding CAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAA region GTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCT comprising TCAACAGGGGAGAGTGTGGAGCCGCAGAACAAAAACTCA
PelB leader TCTCAGAAGAGGATCTGAATGGAGCCGCAGACTACAAGGA sequence + CGACGACGACAAGGGTGCCGCATAATAAGGCGCGCCAATT
139 Vkl_5 CTATTTCAAGGAGACAGTCATATGAAATACCTGCTGCCGA kappa V- CCGCTGCTGCTGGTCTGCTGCTCCTCGCTGCCCAGCCGGCG domain + ATGGCCCAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGA
CL AGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGGCCTC
constant CGGAGGCACATTCAGCAGCTACGCTATAAGCTGGGTGCGA domain for CAGGCCCCTGGACAAGGGCTCGAGTGGATGGGAGGGATCA light chain TCCCTATCTTTGGTACAGCAAACTACGCACAGAAGTTCCAG and PelB + GGCAGGGTCACCATTACTGCAGACAAATCCACGAGCACAG VH1 69 CCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACCGC V-domain CGTGTATTACTGTGCGAGACTATCCCCAGGCGGTTACTATG + CH1 TTATGGATGCCTGGGGCCAAGGGACCACCGTGACCGTCTC constant CTCAGCTAGCACCAAAGGCCCATCGGTCTTCCCCCTGGCAC domain for CCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGG heavy CTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTG chain TCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCT including TCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGC tags AGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGA
CCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAA
AGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACGCGGCC
GCAAGCACTAGTGCCCATCACCATCACCATCACGCCGCGG
CA
Table 4. cDNA and amino acid sequences of library DP88-4 germline template
SEQ ID
Description Sequence
NO:
GACATCCAGATGACCCAGTCTCCTTCCACCCTGTC
TGCATCTGTAGGAGACCGTGTCACCATCACTTGCC
GTGCCAGTCAGAGTATTAGTAGCTGGTTGGCCTGG
TATCAGCAGAAACCAGGGAAAGCCCCTAAGCTCC
TGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTC
CCATCACGTTTCAGCGGCAGTGGATCCGGGACAG
AATTCACTCTCACCATCAGCAGCTTGCAGCCTGAT
GATTTTGCAACTTATTACTGCCAACAGTATAATAG
nucleotide TTATTCTACGTTTGGCCAGGGCACCAAAGTCGAGA
TCAAGCGTACGGTGGCTGCACCATCTGTCTTCATC
sequence of
140 TTCCCGCCATCTGATGAGCAGTTGAAATCTGGAAC
Fab light chain TGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCC Vkl_5 CAGAGAGGCCAAAGTACAGTGGAAGGTGGATAAC
GCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCA
CAGAGCAGGACAGCAAGGACAGCACCTACAGCCT
CAGCAGCACCCTGACGCTGAGCAAAGCAGACTAC
GAGAAACACAAAGTCTACGCCTGCGAAGTCACCC
ATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTT
CAACAGGGGAGAGTGTGGAGCCGCAGAACAAAA
ACTCATCTCAGAAGAGGATCTGAATGGAGCCGCA
GACTACAAGGACGACGACGACAAGGGTGCCGCA
DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQ
QKPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTLTI
SSLQPDDFATYYCQQYNSYSTFGQGTKVEIKRTVAA
Fab light chain
141 PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW
Vkl_5 KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKA
DYEKHKVYACEVTHQGLSSPVTKSFNRGECGAAEQ
KLISEEDLNGAADYKDDDDKGAA
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGA
AGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGCAA
GGCCTCCGGAGGCACATTCAGCAGCTACGCTATA
AGCTGGGTGCGACAGGCCCCTGGACAAGGGCTCG
AGTGGATGGGAGGGATCATCCCTATCTTTGGTACA
GCAAACTACGCACAGAAGTTCCAGGGCAGGGTCA
CCATTACTGCAGACAAATCCACGAGCACAGCCTA
CATGGAGCTGAGCAGCCTGAGATCTGAGGACACC
nucleotide GCCGTGTATTACTGTGCGAGACTATCCCCAGGCGG
TTACTATGTTATGGATGCCTGGGGCCAAGGGACCA
sequence of
142 CCGTGACCGTCTCCTCAGCTAGCACCAAAGGCCCA
Fab heavy chain TCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCAC VH1 69 CTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTC
AAGGACTACTTCCCCGAACCGGTGACGGTGTCGT
GGAACTCAGGCGCCCTGACCAGCGGCGTGCACAC
CTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACT
CCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGC
TTGGGCACCCAGACCTACATCTGCAACGTGAATCA
CAAGCCCAGCAACACCAAAGTGGACAAGAAAGTT
GAGCCCAAATCTTGTGACGCGGCCGCAAGCACTA
GTGCCCATCACCATCACCATCACGCCGCGGCA
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISW
VRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITA
DKSTSTAYMELSSLPvSEDTAVYYCARLSPGGYYVM
Fab heavy chain
143 DAWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTA
VH1 69 ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
S GL Y SL S SWT VP S S SLGTQT YICN VNHKP SNTKVDK
KVEPKSCDAAASTSAHHHHHHAAA
Table 5. Primer sequences used for generation of DP88-4 library
SEQ
Primer name Primer sequence 5' - 3'
ID NO:
144 LMB3 CAGGAAACAGCTATGACCATGATTAC
CTCGACTTTGGTGCCCTGGCCAAACGTS2L4A7
CG^ArrAT CTGTTGGCAGTAATAAGTTGCAAAATC
AT
145 Vkl_5_L3r_S
underlined: 60% original base and 40% randomization as M. bolded and italic: 60% original base and 40% randomization as N
SEQ
Primer name Primer sequence 5' - 3'
ID NO:
CTCGACTTTGGTGCCCTGGCCAAACGTMHRSGRAT CG^ArJAT CTGTTGGCAGTAATAAGTTGCAAAATC AT
146 Vkl_5_L3r_SY
underlined: 60% original base and 40% randomization as M. bolded and italic: 60% original base and 40% randomization as N
CTCGACTTTGGTGCCCTGGCCAAACGTMHHMSSSGR
Ar^CG^ArrAJ^CTGTTGGCAGTAATAAGTTGCAAA ATCAT
147 Vkl_5_L3r_SPY
underlined: 60% original base and 40% randomization as M. bolded and italic: 60% original base and 40% randomization as N
148 RJH31 ACGTTTGGCCAGGGCACCAAAGTCGAG
149 RJH32 TCTCGCACAGTAATACACGGCGGTGTCC
GGACACCGCCGTGTATTACTGTGCGAGA- 1-2-2-3-4- GAC-TAC-
TGGGGCCAAGGGACCACCGTGACCGTCTCC
150 DP88-v4-4
1 : G/D = 20%, E/V/S = 10%, A/P/R/L/T/Y=5%; 2: G/Y/S=15%, A/D/T/R/P/L/V/N/W/F/I/E = 4,6%; 3: G/A/Y = 20%, P/W/S/D/T = 8%; 4: F = 46%, L/M = 15%, G/I/Y = 8%.
GGACACCGCCGTGTATTACTGTGCGAGA- 1 -2-2-2-2-3- 4-GAC-TAC-
TGGGGCCAAGGGACCACCGTGACCGTCTCC
151 DP88-v4-6
1 : G/D = 20%, E/V/S = 10%, A/P/R/L/T/Y=5%; 2: G/Y/S=15%, A/D/T/R/P/L/V/N/W/F/I/E = 4,6%; 3: G/A/Y = 20%, P/W/S/D/T = 8%; 4: F = 46%, L/M = 15%, G/I/Y = 8%.
GGACACCGCCGTGTATTACTGTGCGAGA- 1 -2-2-2-2-2- 2-3-4-GAC-TAC-
152 DP88-v4-8 TGGGGCCAAGGGACCACCGTGACCGTCTCC
1 : G/D = 20%, E/V/S = 10%, A/P/R L/T/Y=5%; 2: G/Y/S=15%, A/D/T/R P/L/V/N/W/F/I/E = 4,6%; 3: G/A/Y =
SEQ
Primer name Primer sequence 5' - 3'
ID NO:
20%, P/W/S/D/T = 8%; 4: F = 46%, L/M = 15%, G/I/Y = 8%.
153 fdseqlong GACGTTAGTAAATGAATTTTCTGTATGAGG
Table 6 shows the sequence of generic phage-displayed antibody common light chain library (Vk3_20/VH3_23). Table 7 provides cDNA and amino acid sequences of common light chain library (Vk3_20/VH3_23) germline template and Table 8 shows the Primer sequences used for generation of common light chain library (Vk3_20/VH3_23).
Table 6. Sequence of generic phage- displayed antibody common light chain library (Vk3_20/VH3_23) template used for PCR
SEQ ID Description Sequence
NO:
ATGAAATACCTATTGCCTACGGCAGCCGCTGGATTGTTATT
ACTCGCGGCCCAGCCGGCCATGGCCGAAATCGTGTTAACG
CAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAG
CCACCCTCTCTTGCAGGGCCAGTCAGAGTGTTAGCAGCAG
CTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCC
pRJHl lO
AGGCTCCTCATCTATGGAGCATCCAGCAGGGCCACTGGCA
library
TCCCAGACAGGTTCAGTGGCAGTGGATCCGGGACAGACTT
template of
CACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCA
common
GTGTATTACTGTCAGCAGTATGGTAGCTCACCGCTGACGTT
light chain
CGGCCAGGGGACCAAAGTGGAAATCAAACGTACGGTGGCT
library
GCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTT
Vk3_20/V
GAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACT
H3 23;
TCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAA
complete
CGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAG
Fab coding
CAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCC
region
TGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTA
comprising
CGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTC
PelB leader
ACAAAGAGCTTCAACAGGGGAGAGTGTGGAGCCGCACATC
sequence +
ACCATCACCATCACGGAGCCGCAGACTACAAGGACGACGA
Vk3_20
CGACAAGGGTGCCGCATAATAAGGCGCGCCAATTCTATTT
154 kappa V-
CAAGGAGACAGTCATATGAAATACCTGCTGCCGACCGCTG
domain +
CTGCTGGTCTGCTGCTCCTCGCTGCCCAGCCGGCGATGGCC CL
GAGGTGCAATTGCTGGAGTCTGGGGGAGGCTTGGTACAGC
constant
CTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTC
domain for
ACCTTTAGCAGTTATGCCATGAGCTGGGTCCGCCAGGCTCC
light chain
AGGGAAGGGGCTGGAGTGGGTCTCAGCTATTAGTGGTAGT
and PelB +
GGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGGT VH3 23
TCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCT
V-domain
GCAGATGAACAGCCTGAGAGCCGAGGACACGGCCGTATAT
+ CH1
TACTGTGCGAAACCGTTTCCGTATTTTGACTACTGGGGCCA
constant
AGGAACCCTGGTCACCGTCTCGAGTGCTAGCACCAAAGGC
domain for
CCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTC
heavy
TGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTAC
chain
TTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCC
including
TGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCC
tags
TCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTC
CAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAAT
CACAAGCCCAGCAACACCAAAGTGGACAAGAAAGTTGAG
CCCAAATCTTGTGACGCGGCCGCAGAACAAAAACTCATCT
CAGAAGAGGATCTGAATGCCGCGGCA
Table 7. cDNA and amino acid sequences of common light chain library (Vk3_20/VH3_23) germline template
SEQ ID
Description Sequence
NO:
GAAATCGTGTTAACGCAGTCTCCAGGCACCCTGTCTT
TGTCTCCAGGGGAAAGAGCCACCCTCTCTTGCAGGG
CCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGGT
ACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCA
TCTATGGAGCATCCAGCAGGGCCACTGGCATCCCAG
ACAGGTTCAGTGGCAGTGGATCCGGGACAGACTTCA
CTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTG
CAGTGTATTACTGTCAGCAGTATGGTAGCTCACCGCT
nucleotide G AC GTTCGGC C AGGGG AC C AAAGTGG AAATC A AAC sequence of GTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCC
155
Fab light chain ATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTT
GTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCC
Vk3_20 AAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCG
GGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGC
AAGGACAGCACCTACAGCCTCAGCAGCACCCTGACG
CTGAGCAAAGCAGACTACGAGAAACACAAAGTCTAC
GCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCC
GTCACAAAGAGCTTCAACAGGGGAGAGTGTGGAGCC
GCACATCACCATCACCATCACGGAGCCGCAGACTAC
AAGGACGACGACGACAAGGGTGCCGCA
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ
KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRL
EPEDFAVYYCQQYGSSPLTFGQGTKVEIKRTVAAPSVFI
Fab light chain
156 FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
Vk3_20
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVY
ACEVTHQGLSSPVTKSFNRGECGAAHHHHHHGAADY
KDDDDKGAA
GAGGTGCAATTGCTGGAGTCTGGGGGAGGCTTGGTA
CAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCC
TCCGGATTCACCTTTAGCAGTTATGCCATGAGCTGGG
TCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCT
CAGCTATTAGTGGTAGTGGTGGTAGCACATACTACG
CAGACTCCGTGAAGGGCCGGTTCACCATCTCCAGAG
ACAATTCCAAGAACACGCTGTATCTGCAGATGAACA
GCCTGAGAGCCGAGGACACGGCCGTATATTACTGTG
nucleotide CGAAACCGTTTCCGTATTTTGACTACTGGGGCCAAG sequence of GAACCCTGGTCACCGTCTCGAGTGCTAGCACCAAAG
157
Fab heavy chain GCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAG
CACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGT VH3 23 CAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTG
GAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTT
CCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTC
AGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGC
ACCCAGACCTACATCTGCAACGTGAATCACAAGCCC
AGCAACACCAAAGTGGACAAGAAAGTTGAGCCCAA
ATCTTGTGACGCGGCCGCAGAACAAAAACTCATCTC
AGAAGAGGATCTGAATGCCGCGGCA
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWV
RQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNS
K TLYLQMNSLRAEDTAVYYCAKPFPYFDYWGQGTL
Fab heavy chain
158 VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP
VH3 23 (DP47)
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP
SSSLGTQTYICNVNHKPSNTKVDK VEPKSCDAAAEQ
KLISEEDLNAAA
Table 8. Primer sequences used for generation of common light chain library (Vk3_20/VH3_23)
SEQ
Primer name Primer sequence 5' - 3'
ID NO:
159 MS64 ACGTTCGGCCAGGGGACCAAAGTGG
160 DP47CDR3_ba
CGCACAGTAATATACGGCCGTGTCC
(mod.)
161 CGAGGACACGGCCGTATATTACTGTGCG-5-1-2-2-3-4-
DP47-v4-4
GAC-TAC-TGGGGCCAAGGAACCCTGGTCACCGTCTCG
CGAGGACACGGCCGTATATTACTGTGCG-5-1-2-2-2-2-3-
162 DP47-v4-6 4-GAC-TAC-
TGGGGCCAAGGAACCCTGGTCACCGTCTCG
SEQ
Primer name Primer sequence 5' - 3'
ID NO:
CGAGGACACGGCCGTATATTACTGTGCG-5-1-2-2-2-2-2-
163 DP47-v4-8 2-3-4-GAC-TAC-
TGGGGCCAAGGAACCCTGGTCACCGTCTCG
164 fdseqlong GACGTTAGTAAATGAATTTTCTGTATGAGG
1 : G/D = 20%, E/V/S = 10%, A/P/R/L/T/Y=5%; 2: G/Y/S=15%, A/D/T/R/P/L/V/N/W/F/I/E = 4,6%; 3: G/A/Y = 20%, P/W/S/D/T = 8%; 4: F = 46%, L/M = 15%, G/I/Y = 8%; 5: K=70%, R =30%.
Table 9 shows the sequence of generic phage-displayed lambda-DP47 library
(V13_19/VH3_23) template used for PCRs. Table 10 provides cDNA and amino acid sequences of lambda-DP47 library (V13_19/VH3_23) germline template and Table 11 shows the Primer sequences used for generation of lambda-DP47 library (V13_19/VH3_23).
Table 9: Sequence of generic phage- displayed lambda-DP47 library (V13_19/VH3_23) template used for PCRs
SEQ ID Description Sequence
NO:
ATGAAATACCTATTGCCTACGGCAGCCGCTGGATTGTTATT
ACTCGCGGCCCAGCCGGCCATGGCCTCGTCTGAGCTGACT
CAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCA
GGATCACATGCCAAGGAGACAGCCTCAGAAGTTATTATGC
AAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTT
pRJH53
GTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAG
library
ACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTG
template of
ACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATT
lambda-
ACTGTAACTCCCGTGATAGTAGCGGTAATCATGTGGTATTC
DP47
GGCGGAGGGACCAAGCTGACCGTCCTAGGACAACCCAAG
library
GCTGCCCCCAGCGTGACCCTGTTCCCCCCCAGCAGCGAGG
V13_19/V
AATTGCAGGCCAACAAGGCCACCCTGGTCTGCCTGATCAG
H3 23;
CGACTTCTACCCAGGCGCCGTGACCGTGGCCTGGAAGGCC
complete
GACAGCAGCCCCGTGAAGGCCGGCGTGGAGACCACCACCC
Fab coding
CCAGCAAGCAGAGCAACAACAAGTACGCCGCCAGCAGCT
region
ACCTGAGCCTGACCCCCGAGCAGTGGAAGAGCCACAGGTC
comprising
CTACAGCTGCCAGGTGACCCACGAGGGCAGCACCGTGGAG
PelB leader
AAAACCGTGGCCCCCACCGAGTGCAGCGGAGCCGCAGAAC
sequence +
AAAAACTCATCTCAGAAGAGGATCTGAATGGAGCCGCAGA
V13 19
CTACAAGGACGACGACGACAAGGGTGCCGCATAATAAGG
165 lambda V-
CGCGCCAATTCTATTTCAAGGAGACAGTCATATGAAATAC
domain +
CTGCTGCCGACCGCTGCTGCTGGTCTGCTGCTCCTCGCTGC
CL
CCAGCCGGCGATGGCCGAGGTGCAATTGCTGGAGTCTGGG
constant
GGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCT
domain for
GTGCAGCCTCCGGATTCACCTTTAGCAGTTATGCCATGAGC
light chain
TGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCT
and PelB +
CAGCTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGA VH3 23
CTCCGTGAAGGGCCGGTTCACCATCTCCAGAGACAATTCC
V-domain
AAGAACACGCTGTATCTGCAGATGAACAGCCTGAGAGCCG
+ CHI
AGGACACGGCCGTATATTACTGTGCGAAACCGTTTCCGTAT
constant
TTTGACTACTGGGGCCAAGGAACCCTGGTCACCGTCTCGA
domain for
GTGCTAGCACCAAAGGCCCATCGGTCTTCCCCCTGGCACCC
heavy
TCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCT
chain
GCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTC
including
GTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTC
tags
CCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAG
CGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACC
TACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAAG
TGGACAAGAAAGTTGAGCCCAAATCTTGTGACGCGGCCGC
AAGCACTAGTGCCCATCACCATCACCATCACGCCGCGGCA
Table 10. cDNA and amino acid sequences of lambda-DP47 library (V13_19/VH3_23) germline template
SEQ ID Description Sequence
NO: nucleotide TCGTCTGAGCTGACTCAGGACCCTGCTGTGTCTGTGG
CCTTGGGACAGACAGTCAGGATCACATGCCAAGGAG
sequence of ACAGCCTCAGAAGTTATTATGCAAGCTGGTACCAGC Fab light chain AGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATG V13 19 GTAAAAACAACCGGCCCTCAGGGATCCCAGACCGAT
TCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTGAC
CATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTA
TTACTGTAACTCCCGTGATAGTAGCGGTAATCATGTG
GTATTCGGCGGAGGGACCAAGCTGACCGTCCTAGGA
CAACCCAAGGCTGCCCCCAGCGTGACCCTGTTCCCC
166 CCCAGCAGCGAGGAATTGCAGGCCAACAAGGCCACC
CTGGTCTGCCTGATCAGCGACTTCTACCCAGGCGCCG
TGACCGTGGCCTGGAAGGCCGACAGCAGCCCCGTGA
AGGCCGGCGTGGAGACCACCACCCCCAGCAAGCAG
AGCAACAACAAGTACGCCGCCAGCAGCTACCTGAGC
CTGACCCCCGAGCAGTGGAAGAGCCACAGGTCCTAC
AGCTGCCAGGTGACCCACGAGGGCAGCACCGTGGAG
AAAACCGTGGCCCCCACCGAGTGCAGCGGAGCCGCA
GAACAAAAACTCATCTCAGAAGAGGATCTGAATGGA
GCCGCAGACTACAAGGACGACGACGACAAGGGTGC
CGCA
Fab light chain SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQ V13 19 KPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITG
AQAEDEADYYCNSRDSSGNHVVFGGGTKLTVLGQPK
167 AAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW
KADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQW KSHRSYSCQVTHEGSTVEKTVAPTECSGAAEQKLISEE DLNGAADYKDDDDKGAA nucleotide see Table 7
sequence of
150
Fab heavy chain
VH3 23
Fab heavy chain see Table 7
151
VH3 23 (DP47)
Table 11. Primer sequences used for generation of lambda-DP47 library (V13_19/VH3_23)
Additional primers used for construction of the lambda-DP47 library, i.e. DP47CDR3_ba (mod.), DP47-v4-4, DP47-v4-6, DP47-v4-8 and fdseqlong, are identical to the primers used for the construction of the common light chain library (Vk3_20/VH3_23) and have already been listed in Table 8.
Clones 8H9, 20B7, 49B4, 1G4, CLC-563, CLC-564 and 17A9 were identified as human OX40-specific binders through the procedure described above. The cDNA sequences of their variable regions are shown in Table 12 below, the corresponding amino acid sequences can be found in Table C.
Table 12. Variable region base pair sequences for phage-derived anti-OX40 antibodies. Underlined are the complementarity determining regions (CDRs).
SEQ ID
Clone Sequence
NO:
TCGTCTGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGG
GACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGA
AGTT ATT ATGC AAGCTGGT AC C AGC AG AAGC C AGG AC AGGC C
CCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGG
173 (VL)
ATCCCAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCT
TCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGAC
TATTACTGTAACTCCCGTGTTATGCCTCATAATCGCGTATTCG
GCGGAGGGACCAAGCTGACCGTC
8H9
GAGGTGCAATTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCT
GGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCT
TTAGCAGTTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGA
AGGGGCTGGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTA
174 (VH) GCACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCT
CCAGAGACAATTCCAAGAACACGCTGTATCTGCAGATGAACA
GCCTGAGAGCCGAGGACACGGCCGTATATTACTGTGCGCGTG
TTTTCTACCGTGGTGGTGTTTCTATGGACTACTGGGGCCAAGG
AACCCTGGTCACCGTCTCGAGT
GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTG
TAGGAGACCGTGTCACCATCACTTGCCGTGCCAGTCAGAGTA
TTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAG
CCCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGG
175 (VL)
GGTCCCATCACGTTTCAGCGGCAGTGGATCCGGGACAGAATT
CACTCTCACCATCAGCAGCTTGCAGCCTGATGATTTTGCAACT
TATTACTGCCAACAGTATAGTTCGCAGCCGTATACGTTTGGCC
AGGGCACCAAAGTCGAGATCAAG
49B4
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCT
GGGTCCTCGGTGAAGGTCTCCTGCAAGGCCTCCGGAGGCACA
TTCAGCAGCTACGCTATAAGCTGGGTGCGACAGGCCCCTGGA
CAAGGGCTCGAGTGGATGGGAGGGATCATCCCTATCTTTGGT
176 (VH) ACAGCAAACTACGCACAGAAGTTCCAGGGCAGGGTCACCATT
ACTGCAGACAAATCCACGAGCACAGCCTACATGGAGCTGAGC
AGCCTGAGATCTGAGGACACCGCCGTGTATTACTGTGCGAGA
GAATACTACCGTGGTCCGTACGACTACTGGGGCCAAGGGACC
ACCGTGACCGTCTCCTCA
GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTG
TAGGAGACCGTGTCACCATCACTTGCCGTGCCAGTCAGAGTA
TTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAG
CCCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGG
177 (VL)
GGTCCCATCACGTTTCAGCGGCAGTGGATCCGGGACAGAATT
CACTCTCACCATCAGCAGCTTGCAGCCTGATGATTTTGCAACT
TATTACTGCCAACAGTATATTTCGTATTCCATGTTGACGTTTG
GCCAGGGCACCAAAGTCGAGATCAAG
1G4
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCT
GGGTCCTCGGTGAAGGTCTCCTGCAAGGCCTCCGGAGGCACA
TTCAGCAGCTACGCTATAAGCTGGGTGCGACAGGCCCCTGGA
CAAGGGCTCGAGTGGATGGGAGGGATCATCCCTATCTTTGGT
178 (VH) ACAGCAAACTACGCACAGAAGTTCCAGGGCAGGGTCACCATT
ACTGCAGACAAATCCACGAGCACAGCCTACATGGAGCTGAGC
AGCCTGAGATCTGAGGACACCGCCGTGTATTACTGTGCGAGA
GAATACGGTTCTATGGACTACTGGGGCCAAGGGACCACCGTG
ACCGTCTCCTCA
GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTG
TAGGAGACCGTGTCACCATCACTTGCCGTGCCAGTCAGAGTA
TTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAG
CCCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGG
179 (VL)
GGTCCCATCACGTTTCAGCGGCAGTGGATCCGGGACAGAATT
CACTCTCACCATCAGCAGCTTGCAGCCTGATGATTTTGCAACT
TATTACTGCCAACAGTATCAGGCTTTTTCGCTTACGTTTGGCC
AGGGCACCAAAGTCGAGATCAAG
20B7
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCT
GGGTCCTCGGTGAAGGTCTCCTGCAAGGCCTCCGGAGGCACA
TTCAGCAGCTACGCTATAAGCTGGGTGCGACAGGCCCCTGGA
CAAGGGCTCGAGTGGATGGGAGGGATCATCCCTATCTTTGGT
180 (VH) ACAGCAAACTACGCACAGAAGTTCCAGGGCAGGGTCACCATT
ACTGCAGACAAATCCACGAGCACAGCCTACATGGAGCTGAGC
AGCCTGAGATCTGAGGACACCGCCGTGTATTACTGTGCGAGA
GTTAACTACCCGTACTCTTACTGGGGTGACTTCGACTACTGGG
GCCAAGGGACCACCGTGACCGTCTCCTCA
GAGATCGTGCTGACCCAGAGCCCCGGCACACTCTCCCTGTCTC
CTGGGGAAAGGGCCACCCTTTCATGCAGAGCCAGCCAGTCCG
TCTCTAGTAGCTACCTGGCATGGTATCAGCAGAAGCCAGGAC
CLC- AAGCCCCCCGCCTCCTGATTTACGGCGCTTCCTCTCGGGCAAC
181 (VL)
563 TGGTATCCCTGACAGGTTCTCAGGGAGCGGAAGCGGAACAGA
TTTTACCTTGACTATTTCTAGACTGGAGCCAGAGGACTTCGCC GTGTATTACTGTCAGCAGTACGGTAGTAGCCCCCTCACCTTTG GCCAGGGGACAAAAGTCGAAATCAAG
GAGGTGCAATTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCT
GGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCT
TTAGCAGTTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGA
AGGGGCTGGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTA
182 (VH) GCACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCT
CCAGAGACAATTCCAAGAACACGCTGTATCTGCAGATGAACA
GCCTGAGAGCCGAGGACACGGCCGTATATTACTGTGCGCTTG
ACGTTGGTGCTTTCGACTACTGGGGCCAAGGAGCCCTGGTCA
CCGTCTCGAGT
GAGATCGTGCTGACCCAGAGCCCCGGCACACTCTCCCTGTCTC
CTGGGGAAAGGGCCACCCTTTCATGCAGAGCCAGCCAGTCCG
TCTCTAGTAGCTACCTGGCATGGTATCAGCAGAAGCCAGGAC
AAGCCCCCCGCCTCCTGATTTACGGCGCTTCCTCTCGGGCAAC
183 (VL)
TGGTATCCCTGACAGGTTCTCAGGGAGCGGAAGCGGAACAGA
TTTTACCTTGACTATTTCTAGACTGGAGCCAGAGGACTTCGCC
GTGTATTACTGTCAGCAGTACGGTAGTAGCCCCCTCACCTTTG
GCCAGGGGACAAAAGTCGAAATCAAG
CLC-
564 GAGGTGCAATTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCT
GGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCT
TTAGCAGTTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGA
AGGGGCTGGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTA
184 (VH) GCACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCT
CCAGAGACAATTCCAAGAACACGCTGTATCTGCAGATGAACA
GCCTGAGAGCCGAGGACACGGCCGTATATTACTGTGCGTTCG
ACGTTGGTCCGTTCGACTACTGGGGCCAAGGAACCCTGGTCA
CCGTCTCGAGT
TCGTCTGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGG
GACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGA
AGTT ATT ATGC AAGCTGGT AC C AGC AG AAGC C AGG AC AGGC C
CCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGG
185 (VL)
ATCCCAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCT
TCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGAC
TATTACTGTAACTCCCGTGTTATGCCTCATAATCGCGTATTCG
GCGGAGGGACCAAGCTGACCGTC
17A9
GAGGTGCAATTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCT
GGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCT
TTAGCAGTTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGA
AGGGGCTGGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTA
186 (VH) GCACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCT
CCAGAGACAATTCCAAGAACACGCTGTATCTGCAGATGAACA
GCCTGAGAGCCGAGGACACGGCCGTATATTACTGTGCGCGTG
TTTTCTACCGTGGTGGTGTTTCTATGGACTACTGGGGCCAAGG
AACCCTGGTCACCGTCTCGAGT
Example 2
Generation of 4-1BB antibodies
2.1 Preparation, purification and characterization of antigens and screening tools for the generation of novel 4-1BB binders by Phage Display
DNA sequences encoding the ectodomains of human, mouse or cynomolgus 4- IBB (Table 13) were subcloned in frame with the human IgGl heavy chain CH2 and CH3 domains on the knob (Merchant et al., 1998). An AcTEV protease cleavage site was introduced between an antigen ectodomain and the Fc of human IgGl . An Avi tag for directed biotinylation was introduced at the C-terminus of the antigen-Fc knob. Combination of the antigen-Fc knob chain containing the S354C/T366W mutations, with a Fc hole chain containing the
Y349C/T366S/L368A/Y407V mutations allows generation of a heterodimer which includes a single copy of 4- IBB ectodomain containing chain, thus creating a monomeric form of Fc-linked antigen (Figure 1). Table 14 shows the cDNA and amino acid sequences of the antigen Fc- fusion constructs .
Table 13. Amino acid numbering of antigen ectodomains (ECD) and their origin
Table 14. cDNA and amino acid sequences of monomeric antigen Fc(kih) fusion molecules (produced by combination of one Fc hole chain with one antigen Fc knob chain)
SEQ ID NO: Antigen Sequence
Nucleotide
131 sequence see Table 2
Fc hole chain
CTGCAGGACCCCTGCAGCAACTGCCCTGCCGGCACC
TTCTGCGACAACAACCGGAACCAGATCTGCAGCCCC
TGCCCCCCCAACAGCTTCAGCTCTGCCGGCGGACAG
CGGACCTGCGACATCTGCAGACAGTGCAAGGGCGTG
TTCAGAACCCGGAAAGAGTGCAGCAGCACCAGCAAC
GCCGAGTGCGACTGCACCCCCGGCTTCCATTGTCTGG
GAGCCGGCTGCAGCATGTGCGAGCAGGACTGCAAGC
AGGGCCAGGAACTGACCAAGAAGGGCTGCAAGGAC
TGCTGCTTCGGCACCTTCAACGACCAGAAGCGGGGC
ATCTGCCGGCCCTGGACCAACTGTAGCCTGGACGGC
AAGAGCGTGCTGGTCAACGGCACCAAAGAACGGGA
CGTCGTGTGCGGCCCCAGCCCTGCTGATCTGTCTCCT
GGGGCCAGCAGCGTGACCCCTCCTGCCCCTGCCAGA
GAGCCTGGCCACTCTCCTCAGGTCGACGAACAGTTA
TATTTTCAGGGCGGCTCACCCAAATCTGCAGACAAA
ACTCACACATGCCCACCGTGCCCAGCACCTGAACTC
Nucleotide
CTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAAC
sequence
CCAAGGACACCCTCATGATCTCCCGGACCCCTGAGG
human 4- IBB
TCACATGCGTGGTGGTGGACGTGAGCCACGAAGACC
antigen Fc
CTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGG
knob chain
AGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAG
CAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTC
ACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAG
TACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCC
CCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAG
CCCCGAGAACCACAGGTGTACACCCTGCCCCCATGC
CGGGATGAGCTGACCAAGAACCAGGTCAGCCTGTGG
TGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCC
GTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAA
CTACAAGACCACGCCTCCCGTGCTGGACTCCGACGG
CTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAG
AGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCC
GTGATGCATGAGGCTCTGCACAACCACTACACGCAG
AAGAGCCTCTCCCTGTCTCCGGGTAAATCCGGAGGC
CTGAACGACATCTTCGAGGCCCAGAAGATTGAATGG
CACGAG
TTGCAGGATCTGTGTAGTAACTGCCCAGCTGGTACAT
TCTGTGATAATAACAGGAGTCAGATTTGCAGTCCCT
GTCCTCCAAATAGTTTCTCCAGCGCAGGTGGACAAA
GGACCTGTGACATATGCAGGCAGTGTAAAGGTGTTT
TCAAGACCAGGAAGGAGTGTTCCTCCACCAGCAATG
CAGAGTGTGACTGCATTTCAGGGTATCACTGCCTGG
GGGCAGAGTGCAGCATGTGTGAACAGGATTGTAAAC
AAGGTCAAGAATTGACAAAAAAAGGTTGTAAAGACT
GTTGCTTTGGGACATTTAATGACCAGAAACGTGGCA
TCTGTCGCCCCTGGACAAACTGTTCTTTGGATGGAAA
GTCTGTGCTTGTGAATGGGACGAAGGAGAGGGACGT
GGTCTGCGGACCATCTCCAGCCGACCTCTCTCCAGG
AGCATCCTCTGCGACCCCGCCTGCCCCTGCGAGAGA
GCCAGGACACTCTCCGCAGGTCGACGAACAGTTATA
TTTTCAGGGCGGCTCACCCAAATCTGCAGACAAAAC
TCACACATGCCCACCGTGCCCAGCACCTGAACTCCT
Nucleotide
GGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCC
sequence
AAGGACACCCTCATGATCTCCCGGACCCCTGAGGTC
cynomolgus 4-
ACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCT
1BB antigen
GAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAG
Fc knob chain
GTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCA
GTACAACAGCACGTACCGTGTGGTCAGCGTCCTCAC
CGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTA
CAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCC
CATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCC
CCGAGAACCACAGGTGTACACCCTGCCCCCATGCCG
GGATGAGCTGACCAAGAACCAGGTCAGCCTGTGGTG
CCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGT
GGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACT
ACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCT
CCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGA
GCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCG
TGATGCATGAGGCTCTGCACAACCACTACACGCAGA
AGAGCCTCTCCCTGTCTCCGGGTAAATCCGGAGGCC
TGAACGACATCTTCGAGGCCCAGAAGATTGAATGGC
ACGAG
GTGCAGAACAGCTGCGACAACTGCCAGCCCGGCACC
TTCTGCCGGAAGTACAACCCCGTGTGCAAGAGCTGC
CCCCCCAGCACCTTCAGCAGCATCGGCGGCCAGCCC
AACTGCAACATCTGCAGAGTGTGCGCCGGCTACTTC
CGGTTCAAGAAGTTCTGCAGCAGCACCCACAACGCC
GAGTGCGAGTGCATCGAGGGCTTCCACTGCCTGGGC
CCCCAGTGCACCAGATGCGAGAAGGACTGCAGACCC
GGCCAGGAACTGACCAAGCAGGGCTGTAAGACCTGC
AGCCTGGGCACCTTCAACGACCAGAACGGGACCGGC
GTGTGCCGGCCTTGGACCAATTGCAGCCTGGACGGG
AGAAGCGTGCTGAAAACCGGCACCACCGAGAAGGA
CGTCGTGTGCGGCCCTCCCGTGGTGTCCTTCAGCCCT
AGCACCACCATCAGCGTGACCCCTGAAGGCGGCCCT
GGCGGACACTCTCTGCAGGTCCTGGTCGACGAACAG
TTATATTTTCAGGGCGGCTCACCCAAATCTGCAGACA
AAACTCACACATGCCCACCGTGCCCAGCACCTGAAC
Nucleotide
TCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAA
sequence
ACCCAAGGACACCCTCATGATCTCCCGGACCCCTGA
191 murine 4- IBB
GGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGA
antigen Fc
CCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGT
knob chain
GGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGG
AGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCC
TCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGG
AGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAG
CCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGC
AGCCCCGAGAACCACAGGTGTACACCCTGCCCCCAT
GCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGT
GGTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCG
CCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAAC
AACTACAAGACCACGCCTCCCGTGCTGGACTCCGAC
GGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACA
AGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCT
CCGTGATGCATGAGGCTCTGCACAACCACTACACGC
AGAAGAGCCTCTCCCTGTCTCCGGGTAAATCCGGAG
GCCTGAACGACATCTTCGAGGCCCAGAAGATTGAAT
GGCACGAG
135 Fc hole chain see Table 2
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTC
DICRQCKGVFPvTRKECSSTSNAECDCTPGFHCLGAGCS
MCEQDCKQGQELTK GCKDCCFGTFNDQKRGICRPW
TNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTP
PAPAREPGHSPQVDEQLYFQGGSPKSADKTHTCPPCPA
human 4- IBB
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED
192 antigen Fc
PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL
knob chain
TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIAVE
WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGKSGGLNDIF
EAQKIEWHE
LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTC
DICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECS
MCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPW
TNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATP
PAPAREPGHSPQVDEQLYFQGGSPKSADKTHTCPPCPA
cynomolgus 4-
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED
193 1BB antigen
PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL
Fc knob chain
TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPCRDELTK QVSLWCLVKGFYPSDIAVE
WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGKSGGLNDIF
EAQKIEWHE
VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNC
NICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTR
CEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWT
NCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPE
GGPGGHSLQVLVDEQLYFQGGSPKSADKTHTCPPCPAP
murine 4- IBB
ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP
914 antigen Fc
EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT
knob chain
VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR
EPQ V YTLPPCRDELTK Q V SL WCL VKGF YP SDI AVE WE
SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGKSGGLNDIFEA
QKIEWHE
All 4-lBB-Fc-fusion molecule encoding sequences were cloned into a plasmid vector, which drives expression of the insert from an MPSV promoter and contains a synthetic polyA signal sequence located at the 3' end of the CDS. In addition, the vector contains an EBV OriP sequence for episomal maintenance of the plasmid.
For preparation of the biotinylated monomeric antigen/Fc fusion molecules, exponentially growing suspension HEK293 EBNA cells were co-transfected with three vectors encoding the two components of fusion protein (knob and hole chains) as well as BirA, an enzyme necessary for the biotinylation reaction. The corresponding vectors were used at a 2 : 1 : 0.05 ratio
("antigen ECD-AcTEV- Fc knob" : "Fc hole" : "BirA").
For protein production in 500 ml shake flasks, 400 million HEK293 EBNA cells were seeded 24 hours before transfection. For transfection cells were centrifuged for 5 minutes at 210 g, and the supernatant was replaced by pre-warmed CD CHO medium. Expression vectors were resuspended in 20 mL of CD CHO medium containing 200 μg of vector DNA. After addition of 540 of polyethylenimine (PEI), the solution was vortexed for 15 seconds and incubated for 10 minutes at room temperature. Afterwards, cells were mixed with the DNA/PEI solution, transferred to a 500 mL shake flask and incubated for 3 hours at 37°C in an incubator with a 5 % C02 atmosphere. After the incubation, 160 mL of F17 medium was added and cells were
cultured for 24 hours. The production medium was supplemented with 5μΜ kifunensine. One day after transfection, 1 mM valproic acid and 7 % Feed were added to the culture. After 7 days of culturing, the cell supernatant was collected by spinning down cells for 15 min at 210 g. The solution was sterile filtered (0.22 μιη filter), supplemented with sodium azide to a final concentration of 0.01 % (w/v), and kept at 4°C.
Secreted proteins were purified from cell culture supernatants by affinity chromatography using Protein A, followed by size exclusion chromatography. For affinity chromatography, the supernatant was loaded on a HiTrap ProteinA HP column (CV = 5 mL, GE Healthcare) equilibrated with 40 mL 20 mM sodium phosphate, 20 mM sodium citrate pH 7.5. Unbound protein was removed by washing with at least 10 column volumes of 20 mM sodium phosphate, 20 mM sodium citrate, 0.5 M sodium chloride containing buffer (pH 7.5). The bound protein was eluted using a linear pH-gradient of sodium chloride (from 0 to 500 mM) created over 20 column volumes of20 mM sodium citrate, 0.01 % (v/v) Tween-20, pH 3.0 . The column was then washed with 10 column volumes of 20 mM sodium citrate, 500 mM sodium chloride, 0.01 % (v/v) Tween-20, pH 3.0. The pH of collected fractions was adjusted by adding 1/40 (v/v) of 2M Tris, pH8.0. The protein was concentrated and filtered prior to loading on a HiLoad Superdex 200 column (GE Healthcare) equilibrated with 2mM MOPS, 150 mM sodium chloride, 0.02 % (w/v) sodium azide solution of pH 7.4.
2.2 Selection of 4-lBB-specific 12B3, 25G7, 11D5, 9B11 and 20G2 antibodies from generic F(ab) libraries
The antibodies 11D5, 9B11, and 12B3 with specificity for human and cynomolgus 4-1BB were selected from a generic phage-displayed antibody library (DP88-4) in the Fab format. From the same library, an additional antibody, clone 20G2, with reactivity to murine 4- IBB was selected as well. This library was constructed on the basis of human germline genes using the V- domain pairing Vkl_5 (kappa light chain) and VH1 69 (heavy chain) comprising randomized sequence space in CDR3 of the light chain (L3, 3 different lengths) and CDR3 of the heavy chain (H3, 3 different lengths). Library generation was performed by assembly of 3 PCR- amplified fragments applying splicing by overlapping extension (SOE) PCR. Fragment 1 comprises the 5' end of the antibody gene including randomized L3, fragment 2 is a central constant fragment spanning from L3 to H3 whereas fragment 3 comprises randomized H3 and the 3' portion of the antibody gene. The following primer combinations were used to generate these library fragments for DP88-4 library: fragment 1 (forward primer LMB3 combined with reverse primers Vkl_5_L3r_S or Vkl_5_L3r_SY or Vkl_5_L3r_SPY), fragment 2 (forward primer RJH31 combined with reverse primer RJH32) and fragment 3 (forward primers DP88-v4- 4 or DP88-v4-6 or DP88-v4-8 combined with reverse primer fdseqlong), respectively. PCR parameters for production of library fragments were 5 min initial denaturation at 94 °C, 25
cycles of 1 min 94 °C, 1 min 58 °C, 1 min 72 °C and terminal elongation for 10 min at 72 °C. For assembly PCR, using equimolar ratios of the gel-purified single fragments as template, parameters were 3 min initial denaturation at 94 °C and 5 cycles of 30 s 94 °C, 1 min 58 °C, 2 min 72 °C. At this stage, outer primers (LMB3 and fdseqlong) were added and additional 20 cycles were performed prior to a terminal elongation for 10 min at 72 °C. After assembly of sufficient amounts of full length randomized Fab constructs, they were digested Ncol I Nhel and ligated into similarly treated acceptor phagemid vector. Purified ligations were used for ~60 transformations into electrocompetent E. coli TGI . Phagemid particles displaying the Fab library were rescued and purified by PEG/NaCl purification to be used for selections. These library construction steps were repeated three times to obtain a final library size of 4.4 x 109.
Percentages of functional clones, as determined by C-terminal tag detection in dot blot, were 92.6% for the light chain and 93.7% for the heavy chain, respectively.
The antibody 25G7 with specificity for human and cynomolgus 4- IBB was selected from a generic phage-displayed antibody library (λ-ϋΡ47) in the Fab format. This library was constructed on the basis of human germline genes using the V-domain pairing V13 19 (lambda light chain) and VH3 23 (heavy chain) comprising randomized sequence space in CDR3 of the light chain (L3, 3 different lengths) and CDR3 of the heavy chain (H3, 3 different lengths). Library generation was performed by assembly of 3 PCR-amplified fragments applying splicing by overlapping extension (SOE) PCR. Fragment 1 comprises the 5' end of the antibody gene including randomized L3, fragment 2 is a central constant fragment spanning from L3 to H3 whereas fragment 3 comprises randomized H3 and the 3' portion of the antibody gene. The following primer combinations were used to generate these library fragments for λ-ϋΡ47 library: fragment 1 (forward primer LMB3 combined with reverse primers Vl_3_19_L3r_V or
Vl_3_19_L3r_HV or Vl_3_19_L3r_HLV), fragment 2 (forward primer RJH80 combined with reverse primer MS63) and fragment 3 (forward primers DP47-v4-4 or DP47-v4-6 or DP47-v4-8 combined with reverse primer fdseqlong), respectively. PCR parameters for production of library fragments were 5 min initial denaturation at 94 °C, 25 cycles of 1 min 94 °C, 1 min 58 °C, 1 min 72 °C and terminal elongation for 10 min at 72 °C. For assembly PCR, using equimolar ratios of the gel-purified single fragments as template, parameters were 3 min initial denaturation at 94 °C and 5 cycles of 30 s 94 °C, 1 min 58 °C, 2 min 72 °C. At this stage, outer primers (LMB3 and fdseqlong) were added and additional 20 cycles were performed prior to a terminal elongation for 10 min at 72 °C. After assembly of sufficient amounts of full length randomized Fab constructs, they were digested Ncol / Nhel and ligated into similarly treated acceptor phagemid vector. Purified ligations were used for ~60 transformations into electrocompetent E. coli TGI . Phagemid particles displaying the Fab library were rescued and purified by PEG/NaCl purification to be used for selections. A final library size of 9.5 x 109 was obtained. Percentages
of functional clones, as determined by C-terminal tag detection in dot blot, were 81.1% for the light chain and 83.2% for the heavy chain, respectively.
Table 3 shows the sequence of generic phage-displayed antibody library (DP88-4), Table 4 provides cDNA and amino acid sequences of library DP88-4 germline template and Table 5 shows the Primer sequences used for generation of DP88-4 germline template.
Table 9 shows the sequence of generic phage-displayed lambda-DP47 library
(V13_19/VH3_23) template used for PCRs. Table 10 provides cDNA and amino acid sequences of lambda-DP47 library (V13_19/VH3_23) germline template and Table 11 shows the Primer sequences used for generation of lambda-DP47 library (V13_19/VH3_23). Human, murine and cynomolgus 4- IBB (CD 137) as antigens for the phage display selections and ELISA- and SPR-based screenings were transiently expressed as N-terminal monomeric Fc-fusion in HEK EBNA cells and in vivo site-specifically biotinylated via co- expression of BirA biotin ligase at the avi-tag recognition sequence located a the C-terminus of the Fc portion carrying the receptor chain (Fc knob chain). Selection rounds (biopanning) were performed in solution according to the following procedure. First step, pre-clearing of ~ 1012 phagemid particles on maxisorp plates coated with 10 μg/ml of an unrelated human IgG to deplete the libraries of antibodies recognizing the Fc- portion of the antigen; second, incubation of the non-binding phagemid particles with 100 nM biotinylated human or murine 4-1BB for 0.5 h in the presence of 100 nM unrelated non- biotinylated Fc knob-into-hole construct for further depletion of Fc-binders in a total volume of lml; third, capture of biotinylated hu 4- IBB and attached specifically binding phage by transfer to 4 wells of a neutravidin pre-coated microtiter plate for 10 min (in rounds 1 & 3); fourth, washing of respective wells using 5x PBS/Tween20 and 5x PBS; fifth, elution of phage particles by addition of 250 μΐ lOOmM TEA (triethylamine) per well for 10 min and neutralization by addition of 500 μΐ 1M Tris/HCl pH 7.4 to the pooled eluates from 4 wells; sixth, post-clearing of neutralized eluates by incubation on neutravidin pre-coated microtiter plate with ΙΟΟηΜ biotin- captured Fc knob-into-hole construct for final removal of Fc-binders; seventh, re-infection of log-phase E. coli TGI cells with the supernatant of eluted phage particles, infection with helperphage VCSM13, incubation on a shaker at 30°C over night and subsequent PEG/NaCl precipitation of phagemid particles to be used in the next selection round. Selections were carried out over 3 or 4 rounds using constant antigen concentrations of 100 nM. In rounds 2 and 4, in order to avoid enrichment of binders to neutravidin, capture of antigen: phage complexes was performed by addition of 5.4 x 107 streptavidin-coated magnetic beads. Specific binders were identified by ELISA as follows: 100 μΐ of 25 nM biotinylated human or murine 4-1BB and lOug/ml of human IgG were coated on neutravidin plates and maxisorp plates, respectively. Fab-
containing bacterial supematants were added and binding Fabs were detected via their Flag-tags using an anti-Flag/HRP secondary antibody. Clones exhibiting signals on human or murine 4- 1BB and being negative on human IgG were short-listed for further analyses and were also tested in a similar fashion against the remaining two species of 4- IBB. They were bacterially expressed in a 0.5 liter culture volume, affinity purified and further characterized by SPR-analysis using BioRad's ProteOn XPR36 biosensor.
Clones 12B3, 25G7, 11D5 and 9B11 were identified as human 4-lBB-specific binder through the procedure described above. Clone 20G2 was identified as murine 4-lBB-specific binder through the procedure described above. The cDNA sequences of their variable regions are shown in Table 15 below, the corresponding amino acid sequences can be found in Table C.
Table 15. Variable region base pair sequences for phage-derived anti-4-lBB antibodies. Underlined are the complementarity determining regions (CDRs).
SEQ ID
Clone Sequence
NO:
GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTG TAGGAGACCGTGTCACCATCACTTGCCGTGCCAGTCAGAGTA TTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAG
CCCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGG
196 (VL)
GGTCCCATCACGTTTCAGCGGCAGTGGATCCGGGACAGAATT
CACTCTCACCATCAGCAGCTTGCAGCCTGATGATTTTGCAACT
TATTACTGCCAACAGTATCATTCGTATCCGCAGACGTTTGGCC
AGGGCACCAAAGTCGAGATCAAG
12B3
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCT
GGGTCCTCGGTGAAGGTCTCCTGCAAGGCCTCCGGAGGCACA
TTCAGCAGCTACGCTATAAGCTGGGTGCGACAGGCCCCTGGA
CAAGGGCTCGAGTGGATGGGAGGGATCATCCCTATCTTTGGT
197 (VH) ACAGCAAACTACGCACAGAAGTTCCAGGGCAGGGTCACCATT
ACTGCAGACAAATCCACGAGCACAGCCTACATGGAGCTGAGC
AGCCTGAGATCTGAGGACACCGCCGTGTATTACTGTGCGAGA
TCTGAATTCCGTTTCTACGCTGACTTCGACTACTGGGGCCAAG
GGACCACCGTGACCGTCTCCTCA
TCGTCTGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGG GACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGA AGTT ATT ATGC AAGCTGGT AC C AGC AG AAGC C AGG AC AGGC C
CCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGG
25G7 198 (VL)
ATCCCAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCT
TCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGAC
TATTACTGTAACTCCCTTGATAGGCGCGGTATGTGGGTATTCG
GCGGAGGGACCAAGCTGACCGTC
GAGGTGCAATTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCT
GGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCT
TTAGCAGTTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGA
AGGGGCTGGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTA
199 (VH) GCACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCT
CCAGAGACAATTCCAAGAACACGCTGTATCTGCAGATGAACA GCCTGAGAGCCGAGGACACGGCCGTATATTACTGTGCGCGTG ACGACCCGTGGCCGCCGTTCGACTACTGGGGCCAAGGAACCC
TGGTCACCGTCTCGAGT
GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTG
TAGGAGACCGTGTCACCATCACTTGCCGTGCCAGTCAGAGTA
TTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAG
CCCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGG
200 (VL)
GGTCCCATCACGTTTCAGCGGCAGTGGATCCGGGACAGAATT
CACTCTCACCATCAGCAGCTTGCAGCCTGATGATTTTGCAACT
TATTACTGCCAACAGCTTAATTCGTATCCTCAGACGTTTGGCC
AGGGCACCAAAGTCGAGATCAAG
1D5 CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCT
GGGTCCTCGGTGAAGGTCTCCTGCAAGGCCTCCGGAGGCACA
TTCAGCAGCTACGCTATAAGCTGGGTGCGACAGGCCCCTGGA
CAAGGGCTCGAGTGGATGGGAGGGATCATCCCTATCTTTGGT
201 (VH) ACAGCAAACTACGCACAGAAGTTCCAGGGCAGGGTCACCATT
ACTGCAGACAAATCCACGAGCACAGCCTACATGGAGCTGAGC AGCCTGAGATCTGAGGACACCGCCGTGTATTACTGTGCGAGA TCTACTCTGATCTACGGTTACTTCGACTACTGGGGCCAAGGGA CCACCGTGACCGTCTCCTCA
GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTG
TAGGAGACCGTGTCACCATCACTTGCCGTGCCAGTCAGAGTA
TTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAG
CCCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGG
202 (VL)
GGTCCCATCACGTTTCAGCGGCAGTGGATCCGGGACAGAATT
CACTCTCACCATCAGCAGCTTGCAGCCTGATGATTTTGCAACT
TATTACTGCCAACAGGTTAATTCTTATCCGCAGACGTTTGGCC
AGGGCACCAAAGTCGAGATCAAG
B11
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCT
GGGTCCTCGGTGAAGGTCTCCTGCAAGGCCTCCGGAGGCACA
TTCAGCAGCTACGCTATAAGCTGGGTGCGACAGGCCCCTGGA
CAAGGGCTCGAGTGGATGGGAGGGATCATCCCTATCTTTGGT
203 (VH) ACAGCAAACTACGCACAGAAGTTCCAGGGCAGGGTCACCATT
ACTGCAGACAAATCCACGAGCACAGCCTACATGGAGCTGAGC
AGCCTGAGATCTGAGGACACCGCCGTGTATTACTGTGCGAGA
TCTTCTGGTGCTTACCCGGGTTACTTCGACTACTGGGGCCAAG
GGACCACCGTGACCGTCTCCTCA
GACATCCAGATGACCCAGTCTCCATCCACCCTGTCTGCATCTG
TAGGAGACCGTGTCACCATCACTTGCCGTGCCAGTCAGAGTA
TTAGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAG
CCCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGG
204 (VL)
GGTCCCATCACGTTTCAGCGGCAGTGGATCCGGGACAGAATT
CACTCTCACCATCAGCAGCTTGCAGCCTGATGATTTTGCAACT
TATTACTGCCAACAGCAGCACTCGTATTATACGTTTGGCCAGG
GCACCAAAGTCGAGATCAAG
20G2
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCT
GGGTCCTCGGTGAAGGTCTCCTGCAAGGCCTCCGGAGGCACA
TTCAGCAGCTACGCTATAAGCTGGGTGCGACAGGCCCCTGGA
CAAGGGCTCGAGTGGATGGGAGGGATCATCCCTATCTTTGGT
205 (VH) ACAGCAAACTACGCACAGAAGTTCCAGGGCAGGGTCACCATT
ACTGCAGACAAATCCACGAGCACAGCCTACATGGAGCTGAGC
AGCCTGAGATCTGAGGACACCGCCGTGTATTACTGTGCGAGA
TCTTACTACTGGGAATCTTACCCGTTCGACTACTGGGGCCAAG
GGACCACCGTGACCGTCTCCAGC
2.3 Preparation, purification and characterization of anti-4-lBB IgGl P329G LALA antibodies
The variable regions of heavy and light chain DNA sequences of selected anti-4-lBB binders were subcloned in frame with either the constant heavy chain or the constant light chain of human IgGl . The Pro329Gly, Leu234Ala and Leu235Ala (i.e. P329G LALA) mutations have been introduced in the constant region of the knob and hole heavy chains to abrogate binding to Fc gamma receptors according to the method described in International Patent Appl. Publ. No. WO 2012/130831 Al . The nucleotide and amino acid sequences of the anti-4-lBB clones are shown in Table 16.
All anti-4-lBB-Fc-fusion encoding sequences were cloned into a plasmid vector, which drives expression of the insert from an MPSV promoter and contains a synthetic polyA signal sequence located at the 3 ' end of the CDS. In addition, the vector contains an EBV OriP sequence for episomal maintenance of the plasmid.
Table 16. Sequences of anti-4-lBB clones in P329GLALA human IgGl format
Clone SEQ ID No. Sequence
GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCTGT
AGGAGACCGTGTCACCATCACTTGCCGTGCCAGTCAGAGTATT
206 AGTAGCTGGTTGGCCTGGTATCAGCAGAAACCAGGGAAAGCC (nucleotide CCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGG
12B3
sequence light TCCCATCACGTTTCAGCGGCAGTGGATCCGGGACAGAATTCAC chain) TCTCACCATCAGCAGCTTGCAGCCTGATGATTTTGCAACTTATT
ACTGCCAACAGTATCATTCGTATCCGCAGACGTTTGGCCAGGG
CACCAAAGTCGAGATCAAGCGTACGGTGGCTGCACCATCTGTC
TTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGC
CTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCA
AAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTC
CCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTA
CAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGA
GAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTG
AGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGT
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTG
GGTCCTCGGTGAAGGTCTCCTGCAAGGCCTCCGGAGGCACATT
CAGCAGCTACGCTATAAGCTGGGTGCGACAGGCCCCTGGACAA
GGGCTCGAGTGGATGGGAGGGATCATCCCTATCTTTGGTACAG
CAAACTACGCACAGAAGTTCCAGGGCAGGGTCACCATTACTGC
AGACAAATCCACGAGCACAGCCTACATGGAGCTGAGCAGCCT
GAGATCTGAGGACACCGCCGTGTATTACTGTGCGAGATCTGAA
TTCCGTTTCTACGCTGACTTCGACTACTGGGGCCAAGGGACCA
CCGTGACCGTCTCCTCAGCTAGCACCAAGGGCCCATCGGTCTT
CCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCG
GCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGA
CGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACAC
CTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCA
GCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTA
207 CATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGA (nucleotide CAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGC sequence heavy CCACCGTGCCCAGCACCTGAAGCTGCAGGGGGACCGTCAGTCT chain) TCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCG
GACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAA
GACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGG
TGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACA
GCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGA
CTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAA
AGCCCTCGGCGCCCCCATCGAGAAAACCATCTCCAAAGCCAAA
GGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCC
GGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGT
CAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGC
AATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTG
CTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGT
GGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCC
GTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCC
TCTCCCTGTCTCCGGGTAAA
DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPG
KAPKLLIYDASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFA
208 TYYCQQYHSYPQTFGQGTKVEIKRTVAAPSVFIFPPSDEQLK (Light chain) SGTASVVCLL NFYPREAKVQWKVDNALQSGNSQESVTEQ
DSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK
SFNPvGEC
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAP
GQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYME
LSSLRSEDTAVYYCARSEFRFYADFDYWGQGTTVTVSSAST
209 KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG (Heavy chain) ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDK VEPKSCDKTHTCPPCPAPEAAGGPSVFLFPP
KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH
NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
NKALGAPIEKTISKAKGQPREPQVYTLPPSRDELTK QVSLT CLVKGFYPSDIAVEWESNGQPE NYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
TCGTCTGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGG
ACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAG
TTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCT
GTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCC
CAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTT
210 GACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTAC
TGTAACTCCCTTGATAGGCGCGGTATGTGGGTATTCGGCGGAG
(nucleotide
GGACCAAGCTGACCGTCCTAGGTCAACCCAAGGCTGCCCCCAG
sequence light CGTGACCCTGTTCCCCCCCAGCAGCGAGGAACTGCAGGCCAAC chain) AAGGCCACCCTGGTCTGCCTGATCAGCGACTTCTACCCAGGCG
CCGTGACCGTGGCCTGGAAGGCCGACAGCAGCCCCGTGAAGG
CCGGCGTGGAGACCACCACCCCCAGCAAGCAGAGCAACAACA
AGTACGCCGCCAGCAGCTACCTGAGCCTGACCCCCGAGCAGTG
GAAGAGCCACAGGTCCTACAGCTGCCAGGTGACCCACGAGGG
CAGCACCGTGGAGAAAACCGTGGCCCCCACCGAGTGCAGC
GAGGTGCAATTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTG
GGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCTTT
AGCAGTTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGAAGG
GGCTGGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTAGCAC
ATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCTCCAGA
GACAATTCCAAGAACACGCTGTATCTGCAGATGAACAGCCTGA
GAGCCGAGGACACGGCCGTATATTACTGTGCGCGTGACGACCC
GTGGCCGCCGTTCGACTACTGGGGCCAAGGAACCCTGGTCACC
GTCTCGAGTGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGG
CACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGG
CTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCG
TGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGG
CTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTG
ACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCA
211 ACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAG (nucleotide TTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTG sequence heavy CCCAGCACCTGAAGCTGCAGGGGGACCGTCAGTCTTCCTCTTC chain) CCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTG
AGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTG
AGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAA
TGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTA
CCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTG
AATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTC
GGCGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAG
CCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATG
AGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGG
CTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGG
CAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACT
CCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAA
GAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATG
CATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCC
TGTCTCCGGGTAAA
SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPV
212 LVIYGKN RPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSL (Light chain) DRRGMWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLV
CLI SDF YPGAVTVAWKAD S SPVKAGVETTTP SKQ SN KYAAS S YL
SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKG
LEWVSAISGSGGSTYYADSVKGRFTISRDNSK TLYLQMNSLRAE
DTAVYYCARDDPWPPFDYWGQGTLVTVSSASTKGPSVFPLAPSS
KSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK
213
THTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSH
(Heavy chain)
EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQ
D WLNGKEYKCKVSNKALGAPIEKTI SKAKGQPREPQ VYTLPP SRD
ELTK QVSLTCLVKGFYPSDIAVEWESNGQPEN YKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP
GK
The antibodies were produced by co-transfecting HEK293-EBNA cells with the
mammalian expression vectors using polyethylenimine. The cells were transfected with the corresponding expression vectors in a 1 : 1 ratio ("vector heavy chain" : "vector light chain" ). For production in 500 mL shake flasks, 400 million HEK293 EBNA cells were seeded 24 hours before transfection. For transfection cells were centrifuged for 5 minutes at 210 x g, and the supernatant was replaced by pre-warmed CD CHO medium. Expression vectors (200 μg of total DNA) were mixed in 20 mL CD CHO medium. After addition of 540 PEI, the solution was vortexed for 15 seconds and incubated for 10 minutes at room temperature. Afterwards, cells were mixed with the DNA/PEI solution, transferred to a 500 mL shake flask and incubated for 3 hours at 37°C in an incubator with a 5% C02 atmosphere. After the incubation, 160 mL of F17 medium was added and cells were cultured for 24 hours. One day after transfection 1 mM valproic acid and 7% Feed with supplements were added. After culturing for 7 days, the supernatant was collected by centrifugation for 15 minutes at 210 x g. The solution was sterile filtered (0.22 μιη filter), supplemented with sodium azide to a final concentration of 0.01 % (w/v), and kept at 4°C.
Purification of antibody molecules from cell culture supernatants was carried out by affinity chromatography using Protein A as described above for purification of antigen Fc fusions. The protein was concentrated and filtered prior to loading on a HiLoad Superdex 200 column (GE Healthcare) equilibrated with 20mM Histidine, 140 mM NaCl solution of pH 6.0.
The protein concentration of purified antibodies was determined by measuring the OD at 280 nm, using the molar extinction coefficient calculated on the basis of the amino acid sequence. Purity and molecular weight of the antibodies were analyzed by CE-SDS in the presence and absence of a reducing agent (Invitrogen, USA) using a LabChipGXII (Caliper). The aggregate content of antibody samples was analyzed using a TSKgel G3000 SW XL analytical size-
exclusion column (Tosoh) equilibrated in a 25 mM K2HP04, 125 mM NaCl, 200mM L-Arginine Monohydrocloride, 0.02 % (w/v) NaN3, pH 6.7 running buffer at 25°C.
Table 17 summarizes the yield and final content of the anti-4-BB P329G LALA IgGl antibodies.
Table 17: Biochemical analysis of anti-4-BB P329G LALA IgGl clones
In addition, an "untargeted" control DP47 hulgGI P329G LALA antibody was prepared, in which the VH and VL of the 4- IBB binder was replaced by a germline control, termed DP47, which does not display binding to 4- IBB. Example 3
Generation of bispecific antibodies targeting OX40 and fibroblast activation protein (FAP)
3.1 Generation of bispecific, trivalent antibodies targeting OX40 and fibroblast activation protein (FAP)
Bispecific agonistic OX40 constructs with trivalent binding for OX40, and trivalent binding for FAP (i.e. '3+3 'constructs) were prepared.
To enhance binding of Fab molecules to OX40, and for enhanced cross-linking of these receptors, trimerized Fab molecules targeting OX40 were generated by the method described in WO 2014/180754 Al .
Fab genes of the OX40 binders (VHCH1) were connected by a (GlySer)2 linker to a short trimerisation domain derived from human cartilage matrix protein (CMP) (Uniprot Accession: P21941; Residues 454 to 496, SEQ ID NO: l) by standard recombinant DNA technologies. The cysteine residues forming interchain disulfide bridges at positions 458 and 460 were used together with the coiled coil domain comprising residues 467 to 495. Downstream of the CMP domain, a (Gly4Ser)4 linker was fused to connect the anti-FAP binding moiety to the
trimerisation domain. The FAP binding moieties were comprised of disulfide stabilized scFv fragments (H44/L100) of the FAP specific binder (28H1).
The CMP chains and anti-OX40 light chains were co-expressed, resulting in the production of bispecific, trimeric molecules as depicted in Figure 2A. The base pair and acid sequences for the constructs are shown in Table 18 and Table 19, respectively.
Table 18. Base pair sequences of mature bispecific anti-OX40, anti-FAP CMP 3+3 format
Clone
(OX40 SEQ ID NO. Base pair sequence
clone/FAP
clone)
CATTCCGACATCCAGATGACCCAGTCTCCTTCC
ACCCTGTCTGCATCTGTAGGAGACCGTGTCACC
ATCACTTGCCGTGCCAGTCAGAGTATTAGTAGC
TGGTTGGCCTGGTATCAGCAGAAACCAGGGAAA
GCCCCTAAGCTCCTGATCTATGATGCCTCCAGTT
TGGAAAGTGGGGTCCCATCACGTTTCAGCGGCA
GTGGATCCGGGACAGAATTCACTCTCACCATCA
GCAGCTTGCAGCCTGATGATTTTGCAACTTATTA
Light chain CTGCCAACAGTATTTGACGTATTCGCGGTTTAC
3+3 (LC) GTTTGGCCAGGGCACCAAAGTCGAGATCAAGCG
214
(8H9/28H1) TACGGTGGCTGCACCATCTGTCTTCATCTTCCCG
CCATCTGATGAGCAGTTGAAATCTGGAACTGCC
(pCON184) TCTGTTGTGTGCCTGCTGAATAACTTCTATCCCA
GAGAGGCCAAAGTACAGTGGAAGGTGGATAAC
GCCCTCCAATCGGGTAACTCCCAGGAGAGTGTC
ACAGAGCAGGACAGCAAGGACAGCACCTACAG
CCTCAGCAGCACCCTGACGCTGAGCAAAGCAGA
CTACGAGAAACACAAAGTCTACGCCTGCGAAGT
CACCCATCAGGGCCTGAGCTCGCCCGTCACAAA
GAGCTTCAACAGGGGAGAGTGT
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTG
AAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGC
AAGGCCTCCGGAGGCACATTCAGCAGCTACGCT
ATAAGCTGGGTGCGACAGGCCCCTGGACAAGG
GCTCGAGTGGATGGGAGGGATCATCCCTATCTT
TGGTACAGCAAACTACGCACAGAAGTTCCAGGG
CAGGGTCACCATTACTGCAGACAAATCCACGAG
CACAGCCTACATGGAGCTGAGCAGCCTGAGATC
TGAGGACACCGCCGTGTATTACTGTGCGAGAGA
ATACGGTTGGATGGACTACTGGGGCCAAGGGAC
CACCGTGACCGTCTCCTCAGCTAGCACAAAGGG
ACCTAGCGTGTTCCCCCTGGCCCCCAGCAGCAA
GTCTACATCTGGCGGAACAGCCGCCCTGGGCTG
CCTCGTGAAGGACTACTTTCCCGAGCCCGTGAC
CGTGTCCTGGAACTCTGGCGCTCTGACAAGCGG
CGTGCACACCTTTCCAGCCGTGCTGCAGAGCAG
CGGCCTGTACTCTCTGAGCAGCGTCGTGACAGT
GCCCAGCAGCTCTCTGGGCACCCAGACCTACAT
CTGCAACGTGAACCACAAGCCCAGCAACACCA
AGGTGGACAAGAAGGTGGAACCCAAGAGCTGC
GACGGCGGAGGGGGATCTGGCGGCGGAGGATC
CGAGGAAGATCCTTGCGCCTGCGAGAGCCTCGT
GAAGTTCCAGGCCAAGGTGGAAGGACTGCTGC
AGGCCCTGACCCGGAAACTGGAAGCCGTGTCCA
CMP chain
AGCGGCTGGCCATCCTGGAAAACACCGTGGTGT
215
CCGGAGGCGGGGGTAGCGGCGGAGGGGGCTCT
pETR12239 GGCGGTGGCGGGTCTGGAGGCGGGGGTTCAGA
AGTGCAGCTGCTGGAATCTGGCGGCGGACTGGT
GCAGCCTGGCGGATCTCTGAGACTGAGCTGTGC
CGCCAGCGGCTTCACCTTTAGCAGCCACGCCAT
GAGCTGGGTGCGCCAGGCCCCTGGAAAGTGCCT
GGAATGGGTGTCCGCCATCTGGGCCAGCGGCGA
GCAGTACTACGCCGATAGCGTGAAGGGCCGGTT
CACCATCAGCCGGGACAACAGCAAGAACACCC
TGTACCTGCAGATGAACAGCCTGCGGGCCGAGG
ACACCGCCGTGTACTATTGTGCCAAGGGCTGGC
TGGGCAACTTCGACTATTGGGGCCAGGGCACCC
TCGTGACCGTGTCTAGCGGAGGGGGCGGAAGTG
GTGGCGGGGGAAGCGGCGGGGGTGGCAGCGGA
GGGGGCGGATCTGAAATTGTGCTGACCCAGAGC
CCTGGCACCCTGAGCCTGTCTCCAGGCGAAAGA
GCCACACTGAGCTGCAGAGCCAGCCAGAGCGT
GTCCAGAAGCTACCTGGCCTGGTATCAGCAGAA
GCCCGGACAGGCCCCCAGACTGCTGATCATCGG
CGCCTCTACAAGAGCCACCGGCATCCCCGATAG
ATTCAGCGGCTCTGGCAGCGGCACCGACTTCAC
CCTGACCATCAGCAGACTGGAACCCGAGGACTT
TGCCGTGTATTACTGCCAGCAGGGCCAAGTGAT
CCCCCCCACCTTTGGCTGTGGCACAAAGGTGGA
AATCAAA
CATTCGGACATCCAGATGACCCAGTCTCCTTCC
ACCCTGTCTGCATCTGTAGGAGACCGTGTCACC
ATCACTTGCCGTGCCAGTCAGAGTATTAGTAGC
TGGTTGGCCTGGTATCAGCAGAAACCAGGGAAA
GCCCCTAAGCTCCTGATCTATGATGCCTCCAGTT
TGGAAAGTGGGGTCCCATCACGTTTCAGCGGCA
GTGGATCCGGGACAGAATTCACTCTCACCATCA
GCAGCTTGCAGCCTGATGATTTTGCAACTTATTA
CTGCCAACAGTATATTTCGTATTCCATGTTGACG
3+3 LC
TTTGGCCAGGGCACCAAAGTCGAGATCAAGCGT
216
ACGGTGGCTGCACCATCTGTCTTCATCTTCCCGC
(1G4/28H1) (pCON251) CATCTGATGAGCAGTTGAAATCTGGAACTGCCT
CTGTTGTGTGCCTGCTGAATAACTTCTATCCCAG
AGAGGCCAAAGTACAGTGGAAGGTGGATAACG
CCCTCCAATCGGGTAACTCCCAGGAGAGTGTCA
CAGAGCAGGACAGCAAGGACAGCACCTACAGC
CTCAGCAGCACCCTGACGCTGAGCAAAGCAGAC
TACGAGAAACACAAAGTCTACGCCTGCGAAGTC
ACCCATCAGGGCCTGAGCTCGCCCGTCACAAAG
AGCTTCAACAGGGGAGAGTGT
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTG
AAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGC
AAGGCCTCCGGAGGCACATTCAGCAGCTACGCT
ATAAGCTGGGTGCGACAGGCCCCTGGACAAGG
GCTCGAGTGGATGGGAGGGATCATCCCTATCTT
TGGTACAGCAAACTACGCACAGAAGTTCCAGGG
CAGGGTCACCATTACTGCAGACAAATCCACGAG
CACAGCCTACATGGAGCTGAGCAGCCTGAGATC
TGAGGACACCGCCGTGTATTACTGTGCGAGAGA
ATACGGTTCTATGGACTACTGGGGCCAAGGGAC
CACCGTGACCGTCTCCTCAGCTAGCACAAAGGG
ACCTAGCGTGTTCCCCCTGGCCCCCAGCAGCAA
GTCTACATCTGGCGGAACAGCCGCCCTGGGCTG
CCTCGTGAAGGACTACTTTCCCGAGCCCGTGAC
CGTGTCCTGGAACTCTGGCGCTCTGACAAGCGG
CGTGCACACCTTTCCAGCCGTGCTGCAGAGCAG
CGGCCTGTACTCTCTGAGCAGCGTCGTGACAGT
GCCCAGCAGCTCTCTGGGCACCCAGACCTACAT
CTGCAACGTGAACCACAAGCCCAGCAACACCA
AGGTGGACAAGAAGGTGGAACCCAAGAGCTGC
GACGGCGGAGGGGGATCTGGCGGCGGAGGATC
CGAGGAAGATCCTTGCGCCTGCGAGAGCCTCGT
GAAGTTCCAGGCCAAGGTGGAAGGACTGCTGC
AGGCCCTGACCCGGAAACTGGAAGCCGTGTCCA
CMP chain
AGCGGCTGGCCATCCTGGAAAACACCGTGGTGT
217
CCGGAGGCGGGGGTAGCGGCGGAGGGGGCTCT
(pETR12640) GGCGGTGGCGGGTCTGGAGGCGGGGGTTCAGA
AGTGCAGCTGCTGGAATCTGGCGGCGGACTGGT
GCAGCCTGGCGGATCTCTGAGACTGAGCTGTGC
CGCCAGCGGCTTCACCTTTAGCAGCCACGCCAT
GAGCTGGGTGCGCCAGGCCCCTGGAAAGTGCCT
GGAATGGGTGTCCGCCATCTGGGCCAGCGGCGA
GCAGTACTACGCCGATAGCGTGAAGGGCCGGTT
CACCATCAGCCGGGACAACAGCAAGAACACCC
TGTACCTGCAGATGAACAGCCTGCGGGCCGAGG
ACACCGCCGTGTACTATTGTGCCAAGGGCTGGC
TGGGCAACTTCGACTATTGGGGCCAGGGCACCC
TCGTGACCGTGTCTAGCGGAGGGGGCGGAAGTG
GTGGCGGGGGAAGCGGCGGGGGTGGCAGCGGA
GGGGGCGGATCTGAAATTGTGCTGACCCAGAGC
CCTGGCACCCTGAGCCTGTCTCCAGGCGAAAGA
GCCACACTGAGCTGCAGAGCCAGCCAGAGCGT
GTCCAGAAGCTACCTGGCCTGGTATCAGCAGAA
GCCCGGACAGGCCCCCAGACTGCTGATCATCGG
CGCCTCTACAAGAGCCACCGGCATCCCCGATAG
ATTCAGCGGCTCTGGCAGCGGCACCGACTTCAC
CCTGACCATCAGCAGACTGGAACCCGAGGACTT
TGCCGTGTATTACTGCCAGCAGGGCCAAGTGAT
CCCCCCCACCTTTGGCTGTGGCACAAAGGTGGA
AATCAAA
GACATCCAGATGACCCAGTCTCCTTCCACCCTG
TCTGCATCTGTAGGAGACCGTGTCACCATCACT
TGCCGTGCCAGTCAGAGTATTAGTAGCTGGTTG
GCCTGGTATCAGCAGAAACCAGGGAAAGCCCCT
AAGCTCCTGATCTATGATGCCTCCAGTTTGGAA
AGTGGGGTCCCATCACGTTTCAGCGGCAGTGGA
TCCGGGACAGAATTCACTCTCACCATCAGCAGC
TTGCAGCCTGATGATTTTGCAACTTATTACTGCC
3+3 AACAGTATAGTTCGCAGCCGTATACGTTTGGCC
LC
AGGGCACCAAAGTCGAGATCAAGCGTACGGTG
218
(49B4/28H1 GCTGCACCATCTGTCTTCATCTTCCCGCCATCTG
(pCON323) ATGAGCAGTTGAAATCTGGAACTGCCTCTGTTG ) TGTGCCTGCTGAATAACTTCTATCCCAGAGAGG
CCAAAGTACAGTGGAAGGTGGATAACGCCCTCC
AATCGGGTAACTCCCAGGAGAGTGTCACAGAGC
AGGACAGCAAGGACAGCACCTACAGCCTCAGC
AGCACCCTGACGCTGAGCAAAGCAGACTACGA
GAAACACAAAGTCTACGCCTGCGAAGTCACCCA
TCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTT
CAACAGGGGAGAGTGT
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTG
AAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGC
AAGGCCTCCGGAGGCACATTCAGCAGCTACGCT
ATAAGCTGGGTGCGACAGGCCCCTGGACAAGG
GCTCGAGTGGATGGGAGGGATCATCCCTATCTT
TGGTACAGCAAACTACGCACAGAAGTTCCAGGG
CAGGGTCACCATTACTGCAGACAAATCCACGAG
CACAGCCTACATGGAGCTGAGCAGCCTGAGATC
TGAGGACACCGCCGTGTATTACTGTGCGAGAGA
ATACTACCGTGGTCCGTACGACTACTGGGGCCA
AGGGACCACCGTGACCGTCTCCTCAGCTAGCAC
AAAGGGACCTAGCGTGTTCCCCCTGGCCCCCAG
CAGCAAGTCTACATCTGGCGGAACAGCCGCCCT
GGGCTGCCTCGTGAAGGACTACTTTCCCGAGCC
CGTGACCGTGTCCTGGAACTCTGGCGCTCTGAC
AAGCGGCGTGCACACCTTTCCAGCCGTGCTGCA
GAGCAGCGGCCTGTACTCTCTGAGCAGCGTCGT
GACAGTGCCCAGCAGCTCTCTGGGCACCCAGAC
CTACATCTGCAACGTGAACCACAAGCCCAGCAA
CACCAAGGTGGACAAGAAGGTGGAACCCAAGA
GCTGCGACGGCGGAGGGGGATCTGGCGGCGGA
GGATCCGAGGAAGATCCTTGCGCCTGCGAGAGC
CTCGTGAAGTTCCAGGCCAAGGTGGAAGGACTG
CTGCAGGCCCTGACCCGGAAACTGGAAGCCGTG
CMP chain
TCCAAGCGGCTGGCCATCCTGGAAAACACCGTG
219
GTGTCCGGAGGCGGGGGTAGCGGCGGAGGGGG
(pETR12899) CTCTGGCGGTGGCGGGTCTGGAGGCGGGGGTTC
AGAAGTGCAGCTGCTGGAATCTGGCGGCGGACT
GGTGCAGCCTGGCGGATCTCTGAGACTGAGCTG
TGCCGCCAGCGGCTTCACCTTTAGCAGCCACGC
CATGAGCTGGGTGCGCCAGGCCCCTGGAAAGTG
CCTGGAATGGGTGTCCGCCATCTGGGCCAGCGG
CGAGCAGTACTACGCCGATAGCGTGAAGGGCC
GGTTCACCATCAGCCGGGACAACAGCAAGAAC
ACCCTGTACCTGCAGATGAACAGCCTGCGGGCC
GAGGACACCGCCGTGTACTATTGTGCCAAGGGC
TGGCTGGGCAACTTCGACTATTGGGGCCAGGGC
ACCCTCGTGACCGTGTCTAGCGGAGGGGGCGGA
AGTGGTGGCGGGGGAAGCGGCGGGGGTGGCAG
CGGAGGGGGCGGATCTGAAATTGTGCTGACCCA
GAGCCCTGGCACCCTGAGCCTGTCTCCAGGCGA
AAGAGCCACACTGAGCTGCAGAGCCAGCCAGA
GCGTGTCCAGAAGCTACCTGGCCTGGTATCAGC
AGAAGCCCGGACAGGCCCCCAGACTGCTGATCA
TCGGCGCCTCTACAAGAGCCACCGGCATCCCCG
ATAGATTCAGCGGCTCTGGCAGCGGCACCGACT
TCACCCTGACCATCAGCAGACTGGAACCCGAGG
ACTTTGCCGTGTATTACTGCCAGCAGGGCCAAG
TGATCCCCCCCACCTTTGGCTGTGGCACAAAGG
TGGAAATCAAA
GACATCCAGATGACCCAGTCTCCTTCCACCCTG
TCTGCATCTGTAGGAGACCGTGTCACCATCACT
TGCCGTGCCAGTCAGAGTATTAGTAGCTGGTTG
GCCTGGTATCAGCAGAAACCAGGGAAAGCCCCT
AAGCTCCTGATCTATGATGCCTCCAGTTTGGAA
AGTGGGGTCCCATCACGTTTCAGCGGCAGTGGA
TCCGGGACAGAATTCACTCTCACCATCAGCAGC
TTGCAGCCTGATGATTTTGCAACTTATTACTGCC
3+3 AACAGTATCAGACGTATCCTGTTACGTTTGGCC
LC
AGGGCACCAAAGTCGAGATCAAGCGTACGGTG
220
(21H4/28H GCTGCACCATCTGTCTTCATCTTCCCGCCATCTG
(pETR12026) ATGAGCAGTTGAAATCTGGAACTGCCTCTGTTG 1) TGTGCCTGCTGAATAACTTCTATCCCAGAGAGG
CCAAAGTACAGTGGAAGGTGGATAACGCCCTCC
AATCGGGTAACTCCCAGGAGAGTGTCACAGAGC
AGGACAGCAAGGACAGCACCTACAGCCTCAGC
AGCACCCTGACGCTGAGCAAAGCAGACTACGA
GAAACACAAAGTCTACGCCTGCGAAGTCACCCA
TCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTT
CAACAGGGGAGAGTGT
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTG
AAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGC
AAGGCCTCCGGAGGCACATTCAGCAGCTACGCT
ATAAGCTGGGTGCGACAGGCCCCTGGACAAGG
GCTCGAGTGGATGGGAGGGATCATCCCTATCTT
TGGTACAGCAAACTACGCACAGAAGTTCCAGGG
CAGGGTCACCATTACTGCAGACAAATCCACGAG
CACAGCCTACATGGAGCTGAGCAGCCTGAGATC
TGAGGACACCGCCGTGTATTACTGTGCGAGAGA
CCCGCGTGGTCCGTACTTCCCGTACTTCGACTAC
TGGGGCCAAGGGACCACCGTGACCGTCTCCTCA
GCTAGCACAAAGGGACCTAGCGTGTTCCCCCTG
GCCCCCAGCAGCAAGTCTACATCTGGCGGAACA
GCCGCCCTGGGCTGCCTCGTGAAGGACTACTTT
CCCGAGCCCGTGACCGTGTCCTGGAACTCTGGC
GCTCTGACAAGCGGCGTGCACACCTTTCCAGCC
GTGCTGCAGAGCAGCGGCCTGTACTCTCTGAGC
AGCGTCGTGACAGTGCCCAGCAGCTCTCTGGGC
ACCCAGACCTACATCTGCAACGTGAACCACAAG
CCCAGCAACACCAAGGTGGACAAGAAGGTGGA
ACCCAAGAGCTGCGACGGCGGAGGGGGATCTG
GCGGCGGAGGATCCGAGGAAGATCCTTGCGCCT
GCGAGAGCCTCGTGAAGTTCCAGGCCAAGGTGG
AAGGACTGCTGCAGGCCCTGACCCGGAAACTGG
CMP chain
AAGCCGTGTCCAAGCGGCTGGCCATCCTGGAAA
221
ACACCGTGGTGTCCGGAGGCGGGGGTAGCGGC
(pETR12810) GGAGGGGGCTCTGGCGGTGGCGGGTCTGGAGG
CGGGGGTTCAGAAGTGCAGCTGCTGGAATCTGG
CGGCGGACTGGTGCAGCCTGGCGGATCTCTGAG
ACTGAGCTGTGCCGCCAGCGGCTTCACCTTTAG
CAGCCACGCCATGAGCTGGGTGCGCCAGGCCCC
TGGAAAGTGCCTGGAATGGGTGTCCGCCATCTG
GGCCAGCGGCGAGCAGTACTACGCCGATAGCGT
GAAGGGCCGGTTCACCATCAGCCGGGACAACA
GCAAGAACACCCTGTACCTGCAGATGAACAGCC
TGCGGGCCGAGGACACCGCCGTGTACTATTGTG
CCAAGGGCTGGCTGGGCAACTTCGACTATTGGG
GCCAGGGCACCCTCGTGACCGTGTCTAGCGGAG
GGGGCGGAAGTGGTGGCGGGGGAAGCGGCGGG
GGTGGCAGCGGAGGGGGCGGATCTGAAATTGT
GCTGACCCAGAGCCCTGGCACCCTGAGCCTGTC
TCCAGGCGAAAGAGCCACACTGAGCTGCAGAG
CCAGCCAGAGCGTGTCCAGAAGCTACCTGGCCT
GGTATCAGCAGAAGCCCGGACAGGCCCCCAGA
CTGCTGATCATCGGCGCCTCTACAAGAGCCACC
GGCATCCCCGATAGATTCAGCGGCTCTGGCAGC
GGCACCGACTTCACCCTGACCATCAGCAGACTG
GAACCCGAGGACTTTGCCGTGTATTACTGCCAG
CAGGGCCAAGTGATCCCCCCCACCTTTGGCTGT
GGCACAAAGGTGGAAATCAAA
GAGATCGTGCTGACCCAGAGCCCCGGCACACTC
TCCCTGTCTCCTGGGGAAAGGGCCACCCTTTCA
TGCAGAGCCAGCCAGTCCGTCTCTAGTAGCTAC
CTGGCATGGTATCAGCAGAAGCCAGGACAAGC
CCCCCGCCTCCTGATTTACGGCGCTTCCTCTCGG
GCAACTGGTATCCCTGACAGGTTCTCAGGGAGC
GGAAGCGGAACAGATTTTACCTTGACTATTTCT
3+3 AGACTGGAGCCAGAGGACTTCGCCGTGTATTAC
TGTCAGCAGTACGGTAGTAGCCCCCTCACCTTT
LC
GGCCAGGGGACAAAAGTCGAAATCAAGCGTAC
(CLC563 222
GGTGGCTGCACCATCTGTCTTCATCTTCCCGCCA
(pCON586) TCTGATGAGCAGTTGAAATCTGGAACTGCCTCT /28H1) GTTGTGTGCCTGCTGAATAACTTCTATCCCAGA
GAGGCCAAAGTACAGTGGAAGGTGGATAACGC
CCTCCAATCGGGTAACTCCCAGGAGAGTGTCAC
AGAGCAGGACAGCAAGGACAGCACCTACAGCC
TCAGCAGCACCCTGACGCTGAGCAAAGCAGACT
ACGAGAAACACAAAGTCTACGCCTGCGAAGTC
ACCCATCAGGGCCTGAGCTCGCCCGTCACAAAG
AGCTTCAACAGGGGAGAGTGT
GAGGTGCAATTGTTGGAGTCTGGGGGAGGCTTG
GTACAGCCTGGGGGGTCCCTGAGACTCTCCTGT
GCAGCCTCCGGATTCACCTTTAGCAGTTATGCC
ATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGG
GCTGGAGTGGGTCTCAGCTATTAGTGGTAGTGG
TGGTAGCACATACTACGCAGACTCCGTGAAGGG
CCGGTTCACCATCTCCAGAGACAATTCCAAGAA
CACGCTGTATCTGCAGATGAACAGCCTGAGAGC
CGAGGACACGGCCGTATATTACTGTGCGCTTGA
CGTTGGTGCTTTCGACTACTGGGGCCAAGGAGC
CCTGGTCACCGTCTCGAGTGCTAGCACAAAGGG
ACCTAGCGTGTTCCCCCTGGCCCCCAGCAGCAA
GTCTACATCTGGCGGAACAGCCGCCCTGGGCTG
CCTCGTGAAGGACTACTTTCCCGAGCCCGTGAC
CGTGTCCTGGAACTCTGGCGCTCTGACAAGCGG
CGTGCACACCTTTCCAGCCGTGCTGCAGAGCAG
CGGCCTGTACTCTCTGAGCAGCGTCGTGACAGT
GCCCAGCAGCTCTCTGGGCACCCAGACCTACAT
CTGCAACGTGAACCACAAGCCCAGCAACACCA
AGGTGGACAAGAAGGTGGAACCCAAGAGCTGC
GACGGCGGAGGGGGATCTGGCGGCGGAGGATC
CGAGGAAGATCCTTGCGCCTGCGAGAGCCTCGT
GAAGTTCCAGGCCAAGGTGGAAGGACTGCTGC
AGGCCCTGACCCGGAAACTGGAAGCCGTGTCCA
CMP chain
AGCGGCTGGCCATCCTGGAAAACACCGTGGTGT
223
CCGGAGGCGGGGGTAGCGGCGGAGGGGGCTCT
(pETR12898) GGCGGTGGCGGGTCTGGAGGCGGGGGTTCAGA
AGTGCAGCTGCTGGAATCTGGCGGCGGACTGGT
GCAGCCTGGCGGATCTCTGAGACTGAGCTGTGC
CGCCAGCGGCTTCACCTTTAGCAGCCACGCCAT
GAGCTGGGTGCGCCAGGCCCCTGGAAAGTGCCT
GGAATGGGTGTCCGCCATCTGGGCCAGCGGCGA
GCAGTACTACGCCGATAGCGTGAAGGGCCGGTT
CACCATCAGCCGGGACAACAGCAAGAACACCC
TGTACCTGCAGATGAACAGCCTGCGGGCCGAGG
ACACCGCCGTGTACTATTGTGCCAAGGGCTGGC
TGGGCAACTTCGACTATTGGGGCCAGGGCACCC
TCGTGACCGTGTCTAGCGGAGGGGGCGGAAGTG
GTGGCGGGGGAAGCGGCGGGGGTGGCAGCGGA
GGGGGCGGATCTGAAATTGTGCTGACCCAGAGC
CCTGGCACCCTGAGCCTGTCTCCAGGCGAAAGA
GCCACACTGAGCTGCAGAGCCAGCCAGAGCGT
GTCCAGAAGCTACCTGGCCTGGTATCAGCAGAA
GCCCGGACAGGCCCCCAGACTGCTGATCATCGG
CGCCTCTACAAGAGCCACCGGCATCCCCGATAG
ATTCAGCGGCTCTGGCAGCGGCACCGACTTCAC
CCTGACCATCAGCAGACTGGAACCCGAGGACTT
TGCCGTGTATTACTGCCAGCAGGGCCAAGTGAT
CCCCCCCACCTTTGGCTGTGGCACAAAGGTGGA
AATCAAA
GACATCCAGATGACCCAGTCTCCTTCCACCCTG
TCTGCATCTGTAGGAGACCGTGTCACCATCACT
TGCCGTGCCAGTCAGAGTATTAGTAGCTGGTTG
GCCTGGTATCAGCAGAAACCAGGGAAAGCCCCT
AAGCTCCTGATCTATGATGCCTCCAGTTTGGAA
AGTGGGGTCCCATCACGTTTCAGCGGCAGTGGA
TCCGGGACAGAATTCACTCTCACCATCAGCAGC
3+3 TTGCAGCCTGATGATTTTGCAACTTATTACTGCC
LC
GGGCACCAAAGTCGAGATCAAGCGTACGGTGG
(20B7 224
CTGCACCATCTGTCTTCATCTTCCCGCCATCTGA
(pCON260) TGAGCAGTTGAAATCTGGAACTGCCTCTGTTGT /28H1) GTGCCTGCTGAATAACTTCTATCCCAGAGAGGC
CAAAGTACAGTGGAAGGTGGATAACGCCCTCCA
ATCGGGTAACTCCCAGGAGAGTGTCACAGAGCA
GGACAGCAAGGACAGCACCTACAGCCTCAGCA
GCACCCTGACGCTGAGCAAAGCAGACTACGAG
AAACACAAAGTCTACGCCTGCGAAGTCACCCAT
CAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTC
AACAGGGGAGAGTGT
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTG
AAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGC
AAGGCCTCCGGAGGCACATTCAGCAGCTACGCT
ATAAGCTGGGTGCGACAGGCCCCTGGACAAGG
GCTCGAGTGGATGGGAGGGATCATCCCTATCTT
TGGTACAGCAAACTACGCACAGAAGTTCCAGGG
CAGGGTCACCATTACTGCAGACAAATCCACGAG
CACAGCCTACATGGAGCTGAGCAGCCTGAGATC
TGAGGACACCGCCGTGTATTACTGTGCGAGAGT
TAACTACCCGTACTCTTACTGGGGTGACTTCGA
CTACTGGGGCCAAGGGACCACCGTGACCGTCTC
CTCAGCTAGCACAAAGGGACCTAGCGTGTTCCC
CCTGGCCCCCAGCAGCAAGTCTACATCTGGCGG
AACAGCCGCCCTGGGCTGCCTCGTGAAGGACTA
CTTTCCCGAGCCCGTGACCGTGTCCTGGAACTCT
GGCGCTCTGACAAGCGGCGTGCACACCTTTCCA
GCCGTGCTGCAGAGCAGCGGCCTGTACTCTCTG
AGCAGCGTCGTGACAGTGCCCAGCAGCTCTCTG
GGCACCCAGACCTACATCTGCAACGTGAACCAC
AAGCCCAGCAACACCAAGGTGGACAAGAAGGT
GGAACCCAAGAGCTGCGACGGCGGAGGGGGAT
CTGGCGGCGGAGGATCCGAGGAAGATCCTTGCG
CCTGCGAGAGCCTCGTGAAGTTCCAGGCCAAGG
TGGAAGGACTGCTGCAGGCCCTGACCCGGAAAC
CMP chain
TGGAAGCCGTGTCCAAGCGGCTGGCCATCCTGG
225
AAAACACCGTGGTGTCCGGAGGCGGGGGTAGC
(pETR12639) GGCGGAGGGGGCTCTGGCGGTGGCGGGTCTGG
AGGCGGGGGTTCAGAAGTGCAGCTGCTGGAATC
TGGCGGCGGACTGGTGCAGCCTGGCGGATCTCT
GAGACTGAGCTGTGCCGCCAGCGGCTTCACCTT
TAGCAGCCACGCCATGAGCTGGGTGCGCCAGGC
CCCTGGAAAGTGCCTGGAATGGGTGTCCGCCAT
CTGGGCCAGCGGCGAGCAGTACTACGCCGATAG
CGTGAAGGGCCGGTTCACCATCAGCCGGGACAA
CAGCAAGAACACCCTGTACCTGCAGATGAACAG
CCTGCGGGCCGAGGACACCGCCGTGTACTATTG
TGCCAAGGGCTGGCTGGGCAACTTCGACTATTG
GGGCCAGGGCACCCTCGTGACCGTGTCTAGCGG
AGGGGGCGGAAGTGGTGGCGGGGGAAGCGGCG
GGGGTGGCAGCGGAGGGGGCGGATCTGAAATT
GTGCTGACCCAGAGCCCTGGCACCCTGAGCCTG
TCTCCAGGCGAAAGAGCCACACTGAGCTGCAGA
GCCAGCCAGAGCGTGTCCAGAAGCTACCTGGCC
TGGTATCAGCAGAAGCCCGGACAGGCCCCCAG
ACTGCTGATCATCGGCGCCTCTACAAGAGCCAC
CGGCATCCCCGATAGATTCAGCGGCTCTGGCAG
CGGCACCGACTTCACCCTGACCATCAGCAGACT
GGAACCCGAGGACTTTGCCGTGTATTACTGCCA
GCAGGGCCAAGTGATCCCCCCCACCTTTGGCTG
TGGCACAAAGGTGGAAATCAAA
Table 19. Amino acid sequence of mature bispecific anti-OX40, anti-FAP CMP 3+3 format
Clone SEQ ID NO. Amino acid sequence
226 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLA
Light chain WYQQKPGKAPKLLIYDASSLESGVPSRFSGSGS
GTEFTLTISSLQPDDFATYYCQQYLTYSRFTFG
(LC) QGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV
VCLLNNFYPREAKVQWKVDNALQSGNSQESV
(pCON184) TEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGEC
227 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSY
AISWVRQAPGQGLEWMGGIIPIFGTANYAQKF
QGRVTITADKSTSTAYMELSSLRSEDTAVYYC
ARE YGWMD YWGQGTT VTVS S ASTKGPS VFPL
3+3
APSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
(8H9/28H1) G ALTS G VHTFP AVLQ S S GL YSL S SWT VP S S SL
GTQTYICNVNHKPSNTKVDKKVEPKSCDGGGG
CMP chain SGGGGSEEDPCACESLVKFQAKVEGLLQALTR
KLEAVSKRLAILENTVVSGGGGSGGGGSGGGG
pETR12239 SGGGGSEVQLLESGGGLVQPGGSLRLSCAASG
FTFSSHAMSWVRQAPGKCLEWVSAIWASGEQ
YYADSVKGRFTISRDNSK TLYLQMNSLRAED
TAVYYCAKGWLGNFDYWGQGTLVTVSSGGG
GSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPG
ERATLSCRASQSVSRSYLAWYQQKPGQAPRLL
IIGASTRATGIPDRFSGSGSGTDFTLTISRLEPED
FAVYYCQQGQVIPPTFGCGTKVEIK
228 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLA
WYQQKPGKAPKLLIYDASSLESGVPSRFSGSGS
3+3 GTEFTLTISSLQPDDFATYYCQQYISYSMLTFG pCON251 QGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV (1G4/28H1) VCLLNNFYPREAKVQWKVDNALQSGNSQESV
TEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGEC
229 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSY
AISWVRQAPGQGLEWMGGIIPIFGTANYAQKF
QGPvVTITADKSTSTAYMELSSLPvSEDTAVYYC
ARE YGSMD YWGQGTT VTVS S ASTKGPS VFPL A
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
CMP chain TQTYICNVNHKPSNTKVDK VEPKSCDGGGGS
GGGGSEEDPCACESLVKFQAKVEGLLQALTRK
LEAVSKRLAILENTVVSGGGGSGGGGSGGGGS
(pETR1264 GGGGSEVQLLESGGGLVQPGGSLRLSCAASGF 0) TFSSHAMSWVRQAPGKCLEWVSAIWASGEQY
YADSVKGRFTISRDNSK TLYLQMNSLRAEDT
AVYYCAKGWLGNFDYWGQGTLVTVSSGGGG
SGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE
RATLSCRASQSVSRSYLAWYQQKPGQAPRLLII
GASTRATGIPDRFSGSGSGTDFTLTISRLEPEDF
AVYYCQQGQVIPPTFGCGTKVEIK
230 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLA
WYQQKPGKAPKLLIYDASSLESGVPSRFSGSGS
LC GTEFTLTIS SLQPDDFAT YYCQQ YS SQP YTFGQ GTKVEIKRT V AAP S VFIFPP SDEQLKS GT AS V VC
(pCON323) LL NFYPREAKVQWKVDNALQSGNSQESVTE
QD SKD ST Y SL S STLTL SKAD YEKHKV Y ACE VT HQGLSSPVTKSFNRGEC
231 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSY
AISWVRQAPGQGLEWMGGIIPIFGTANYAQKF
QGRVTITADKSTSTAYMELSSLRSEDTAVYYC
3+3
AREYYRGPYDYWGQGTTVTVSSASTKGPSVFP
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
(49B4/28H1 SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL ) CMP chain GTQTYICNVNHKPSNTKVDKKVEPKSCDGGGG
SGGGGSEEDPCACESLVKFQAKVEGLLQALTR
KLEAVSKRLAILENTVVSGGGGSGGGGSGGGG
(pETR1289 SGGGGSEVQLLESGGGLVQPGGSLRLSCAASG 9) FTFSSHAMSWVRQAPGKCLEWVSAIWASGEQ
YYADSVKGRFTISRDNSK TLYLQMNSLRAED
TAVYYCAKGWLGNFDYWGQGTLVTVSSGGG
GSGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPG
ERATLSCRASQSVSRSYLAWYQQKPGQAPRLL
IIGASTRATGIPDRFSGSGSGTDFTLTISRLEPED
FAVYYCQQGQVIPPTFGCGTKVEIK
232 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLA
WYQQKPGKAPKLLIYDASSLESGVPSRFSGSGS
LC
GTEFTLTISSLQPDDFATYYCQQYQTYPVTFGQ
GTKVEIKRT V AAP S VFIFPP SDEQLKS GT AS V VC
(pETR1202 LL NFYPREAKVQWKVDNALQSGNSQESVTE 6) QD SKD ST Y SL S STLTL SKAD YEKHKV Y ACE VT
HQGLSSPVTKSFNRGEC
233 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSY
AISWVRQAPGQGLEWMGGIIPIFGTANYAQKF
QGRVTITADKSTSTAYMELSSLRSEDTAVYYC
3+3
ARDPRGPYFPYFDYWGQGTTVTVSSASTKGPS
VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
(21H4/28H WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS 1) SSLGTQTYICNVNHKPSNTKVDK VEPKSCDG
CMP chain
GGGSGGGGSEEDPCACESLVKFQAKVEGLLQA
LTRKLEAVSKRLAILENTVVSGGGGSGGGGSG
(pETR1281 GGGSGGGGSEVQLLESGGGLVQPGGSLRLSCA 0) ASGFTFSSHAMSWVRQAPGKCLEWVSAIWAS
GEQYYADSVKGRFTISRDNSK TLYLQMNSLR
AEDTAVYYCAKGWLGNFDYWGQGTLVTVSS
GGGGSGGGGSGGGGSGGGGSEIVLTQSPGTLS
LSPGERATLSCRASQSVSRSYLAWYQQKPGQA
PRLLIIGASTRATGIPDRFSGSGSGTDFTLTISRL
EPEDFAVYYCQQGQVIPPTFGCGTKVEIK
234 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYL
3+3 AWYQQKPGQAPRLLIYGASSRATGIPDRFSGSG
LC SGTDFTLTISRLEPEDFAVYYCQQYGSSPLTFG
(CLC563 QGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV
(pCON586) VCLLNNFYPREAKVQWKVDNALQSGNSQESV /28H1) TEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGEC
235 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYA
MSWVPvQAPGKGLEWVSAISGSGGSTYYADSV
KGRFTISPvDNSKNTLYLQMNSLRAEDTAVYYC
ALDVGAFDYWGQGALVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
CMP chain TQTYICNVNHKPSNTKVDK VEPKSCDGGGGS
GGGGSEEDPCACESLVKFQAKVEGLLQALTRK
LEAVSKRLAILENTVVSGGGGSGGGGSGGGGS
(pETR1289 GGGGSEVQLLESGGGLVQPGGSLRLSCAASGF 8) TFSSHAMSWVRQAPGKCLEWVSAIWASGEQY
YADSVKGRFTISRDNSK TLYLQMNSLRAEDT
AVYYCAKGWLGNFDYWGQGTLVTVSSGGGG
SGGGGSGGGGSGGGGSEIVLTQSPGTLSLSPGE
RATLSCRASQSVSRSYLAWYQQKPGQAPRLLII
GASTRATGIPDRFSGSGSGTDFTLTISRLEPEDF
AVYYCQQGQVIPPTFGCGTKVEIK
236 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLA
WYQQKPGKAPKLLIYDASSLESGVPSRFSGSGS
LC GTEFTLTISSLQPDDFATYYCQQYQAFSLTFGQ
GTKVEIKRT V AAP S VFIFPP SDEQLKS GT AS V VC
(pCON260) LL NFYPREAKVQWKVDNALQSGNSQESVTE
QD SKD ST Y SL S STLTL SKAD YEKHKV Y ACE VT
HQGLSSPVTKSFNRGEC
237 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSY
AISWVRQAPGQGLEWMGGIIPIFGTANYAQKF
3+3 QGRVTITADKSTSTAYMELSSLRSEDTAVYYC
ARVNYPYSYWGDFDYWGQGTTVTVSSASTKG
(20B7 P S VFPL AP S SKST S GGT AALGCL VKD YFPEP VT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT
/28H1) CMP chain VPSSSLGTQTYICNVNHKPSNTKVDK VEPKSC
DGGGGSGGGGSEEDPCACESLVKFQAKVEGLL
QALTRKLEAVSKRLAILENTVVSGGGGSGGGG
(pETR1263 SGGGGSGGGGSEVQLLESGGGLVQPGGSLRLS 9) CAASGFTFSSHAMSWVRQAPGKCLEWVSAIW
ASGEQYYADSVKGRFTISRDNSK TLYLQMNS
LRAEDTAVYYCAKGWLGNFDYWGQGTLVTV
SSGGGGSGGGGSGGGGSGGGGSEIVLTQSPGT
LSLSPGERATLSCRASQSVSRSYLAWYQQKPG
QAPRLLIIGASTRATGIPDRFSGSGSGTDFTLTIS
RLEPEDFAVYYCQQGQVIPPTFGCGTKVEIK
All genes were transiently expressed under the control of a chimeric MPSV promoter, consisting of the MPSV core promoter combined with the CMV promoter enhancer fragment.
The used expression vectors also contain the oriP region for episomal replication in Epstein Barr Virus Nuclear Antigen (EBNA) containing host cells.
For production of the trimeric, bispecific anti-OX40, anti-FAP molecules constructs were produced by co-transfecting HEK293-EBNA cells with the mammalian expression vectors using polyethylenimine. The cells were transfected with the corresponding expression vectors in a 1 : 1 ratio ("CMP vector" : "LC").
For production in 500 mL shake flasks, 250 million HEK293 EBNA cells were seeded 24 hours before transfection in Excell media with supplements. For transfection, the cells were centrifuged for 5 minutes at 210 x g, and supernatant was replaced by pre-warmed CD-CHO medium. Expression vectors were mixed in 20 mL CD-CHO medium to a final amount of 200 μg DNA. After addition of 540 PEI (1 mg/mL), the solution was vortexed for 15 seconds and incubated for 10 minutes at room temperature. Subsequently, cells were mixed with the
DNA/PEI solution, transferred to a 500 mL shake flask and incubated for 3 hours at 37°C in an incubator with a 5% C02 atmosphere, with shaking at 165 rpm. After the incubation, 160 mL Excell medium with supplements was added and cells were cultured for 24 hours. At this point the valproic acid concentration was 1 mM (the media also contained 5 g/L Pep Soy and 6 mM L- Glutamine). 24h after transfection the cells were supplemented with Feed 7 at 12% final volume (24 mL) and 3 g/L glucose (1.2 mL from 500 g/L stock). After culturing for 7 days, the cell supernatant was collected by centrifugation for 45 minutes at 2000-3000 x g. The solution was sterile filtered (0.22 μιη filter), supplemented with sodium azide to a final concentration of 0.01 % (w/v), and kept at 4°C.
Purification of bispecific constructs from cell culture supernatants was carried out by affinity chromatography using CHI kappa select material (BAC), followed by size exclusion chromatography. The protein was concentrated and filtered prior to loading on the HiLoad Superdex 200 column (GE Healthcare) equilibrated with 20mM Histidine, 140mM NaCl , 0.01% Tween-20 solution of pH 6.0.
For affinity chromatography, the supernatant was loaded on a CHI kappa select column (Life Sciences) (Column Volume = 4.5 mL) equilibrated with 36 mL 50 mM Tris-HCl, 100 mM Glycine, 150 mM sodium chloride, pH 8.0. Unbound protein was removed by washing with 10 column volumes of 50 mM Tris-HCl, 150 mM Glycine, 150 mM sodium chloride, pH 8.0. The bound protein was eluted using a linear pH-gradient of 20 CVs from 0 to 100% of 50 mM Tris-
HC1, 100 mM Glycine, 150 mM sodium chloride, pH 2.0. The column was then washed with 10 column volumes of 50 mM Tris-HCl, 100 mM Glycine, 150 mM sodium chloride, pH 2.0 followed by a re-equilibration step.
The pH of the collected fractions was adjusted by adding 1/10 (v/v) of 2M Tris-HCl, pH 8.0. The protein was concentrated and filtered prior to loading on a HiLoad Superdex 200 column (GE Healthcare) equilibrated with 20 mM Histidine, 140 mM NaCl, pH 6.0, 0.01% Tween20.
The protein concentration of purified bispecific constructs was determined by measuring the OD at 280 nm, using the molar extinction coefficient calculated on the basis of the amino acid sequence. Purity and molecular weight of the bispecific constructs were analyzed by CE- SDS in the presence and absence of a reducing agent (Invitrogen, USA) using a LabChipGXll (Caliper). The aggregate content of bispecific constructs was analyzed using a TSKgel G3000 SW XL analytical size-exclusion column (Tosoh) equilibrated in a 25 mM K2HP04, 125 mM NaCl, 200mM L-Arginine Monohydrocloride, 0.02 % (w/v) NaN3, pH 6.7 running buffer at 25°C (Table 20).
Table 20. Biochemical analysis of bispecific anti-OX40, anti-FAP CMP 3+3 constructs
Yield Monomer CE-SDS CE-SDS
Clone
[mg/1] [%] (non red) (red)
0.94% (179 kDa) 17.84% (28 kDa)
2.14% (204 kDa) 2.06% (29kDa)
OX40 8H9/FAP 28H1
1.2 99.7
2.34% (222 kDa) 1.66% (31 kDa) 3+3 (ID4971)
94.57% (239 78.44% (65 kDa) kDa)
OX40 1G4/FAP 28H1 24.56% (30 kDa)
0.21% (210 kDa)
3+3 (ID5185) 0.72% (32 kDa)
0.36% (227 kDa)
5.5 96.6
2.96% (62 kDa)
99.43% (244
kDa)
71.76% (66 kDa)
OX40 49B4/FAP 28H1 0.31% (32 kDa) 0.2% (26 kDa)
3+3 (ID5350) 0.29% (56 kDa) 25.92% (29 kDa)
0.32% (170 kDa) 0.55% (32 kDa)
6.5 93 0.12% (183 kDa) 0.27% (37 kDa)
0.38% (224 kDa) 0.24% (50 kDa)
98.58% (239 2.05% (60 kDa) kDa)
70.47% (66 kDa)
OX40 21H4/FAP 28H1 0.35% (204 kDa) 25.85% (29 kDa)
3+3 (ID5278) 0.54% (220 kDa) 2.94% (33 kDa)
99.12% (233 6.76% (92 kDa)
11.2 98
kDa)
62.95% (67 kDa)
Some minor peaks < 0.5%
OX40 CLC563/FAP 0.24% (30 kDa) 25.52% (27 kDa)
28H1
0.3% (53 kDa) 0.42% (29 kDa)
3+3 (ID5351)
0.29% (201 kDa) 0.79% (60 kDa)
8.7 98.2
0.5% (219 kDa) 73.27% (64 kDa)
98.66% (235
kDa)
OX40 20B7/FAP 28H1 1.94% (32 kDa) 26.33% (30 kDa)
3+3 (ID5235) 7.2% (57 kDa) 2.08% (32 kDa)
0.27% (177 kDa) 4.18% (62 kDa)
0.17 96.9
19.52% (230 66.82% (66 kDa) kDa)
0.29% (96 kDa)
71.06% (236
kDa) 0.29% (122 kDa)
3.2 Determination of the aggregation temperature of bispecific trivalent 3+3 constructs
For direct comparison of all formats the thermal stability was monitored by Static Light Scattering (SLS) and by measuring the intrinsic protein fluorescence in response to applied temperature stress. 30 mg of filtered protein sample with a protein concentration of 1 mg/ml was applied in duplicate to an Optim 2 instrument (Avacta Analytical Ltd). The temperature was ramped from 25 to 85 °C at 0.1 °C/min, with the radius and total scattering intensity being collected. For determination of intrinsic protein fluorescence the sample was excited at 266 nm and emission was collected between 275 nm and 460 nm.
Table 21. Aggregation temperatures for the bispecific, trivalent anti-OX40, anti-FAP CMP 3+3 constructs
Example 4
Binding of trimeric, bispecific antigen binding molecules targeting OX40 and FAP 4.1 Analysis of simultaneous binding to OX40 and FAP by surface plasmon resonance anaylsis
The ability of the trimeric, bispecific antibodies to bind simultaneously to human OX40 Fc(kih) and human FAP was assessed by surface plasmon resonance (SPR) analysis. All SPR experiments were performed on a Biacore T200 at 25 °C with HBS-EP as running buffer (0.01 M HEPES pH 7.4, 0.15 M NaCl, 3 mM EDTA, 0.005% Surfactant P20, Biacore,
Freiburg/ Germany) .
Biotinylated human OX40 Fc(kih) was directly coupled to the chip surface of a streptavidin (SA) sensor chip. Immobilization levels up to 1000 resonance units (RU) were used.
The bispecific constructs targeting OX40 and FAP were passed over the chip surface at a concentration of 250 nM, and at a flow rate of 30 μΕ/ηώηιίε for 90 seconds, with a dissociation phase set to zero sec. Human FAP was injected as the second analyte, at a concentration of 250
nM, and at a flow rate of 30 μΕ/ηώηιίε for 90 seconds (Figure 3A). Dissociation was monitored for 120 sec. Bulk refractive index differences were corrected for by subtracting the response obtained in a reference flow cell, where no protein was immobilized.
All of the trimeric, bispecific anti-OX40, anti-FAP molecules were found to be able to bind simultaneously to human OX40 and human FAP (Figure 4 A to 4E).
4.2 Binding to human OX40 expressing cells: analysis of binding to naive and activated human peripheral mononuclear blood mononuclear cells (PBMCs)
Human PBMCs were isolated from buffy coat of healthy donors obtained from the blood donation center Zurich (Blutspendezentrum Schlieren, Switzerland) by Ficoll density gradient centrifugation. Buffy coats were diluted with an equal volume of DPBS (Gibco by Life
Technologies, Cat. No. 14190 326). 50 mL polypropylene centrifuge tubes (TPP, Cat.-No. 91050) were supplied with 15 mL Histopaque 1077 (SIGMA Life Science, Cat.-No. 10771, polysucrose and sodium diatrizoate, adjusted to a density of 1.077 g/mL) and the buffy coat solution was layered above the Histopaque 1077. The tubes were centrifuged for 30 min at 400 x g at room temperature, and with low acceleration and no break. Subsequently the PBMCs were collected from the interphase, washed three times with DPBS and resuspended in T cell medium
consisting of RPMI 1640 medium (Gibco by Life Technology, Cat. No. 42401-042)
supplemented with 10 % Fetal Bovine Serum (FBS, Gibco by Life Technology, Cat. No. 16000- 044, Lot 941273, gamma-irradiated, mycoplasma-free and heat inactivated at 56 °C for 35 min), 1 % (v/v) GlutaMAX I (GIBCO by Life Technologies, Cat. No. 35050 038), 1 mM Sodium-
Pyruvat (SIGMA, Cat. No. S8636), 1 % (v/v) MEM non-essential amino acids (SIGMA, Cat.-No. M7145) and 50 μΜ β-Mercaptoethanol (SIGMA, M3148).
PBMCs were used in experiments either directly after isolation (for analysis of binding to resting human PBMCs), or following stimulation to provide for high expression human OX40 on the cell surface of T cells (for analysis of binding to activated human PBMCs). For stimulations, naive PBMCs were cultured for three days in T cell medium supplied with 200 U/mL Proleukin and 2 ug/mL PHA-L, in 6-well tissue culture plates, and subsequently cultured for 1 day on pre- coated 6-well tissue culture plates (pre-coated with 10 μg/mL anti-human CD3 (clone OKT3) and 2 ug/mL anti- human CD28 (clone CD28.2)) in T cell medium supplied with 200 U/mL Proleukin, at 37 °C and 5% C02.
For detection of OX40, naive human PBMCs and activated human PBMCs were mixed. To enable distinction of the naive cells from the activated human PBMCs, resting cells were labeled prior to the binding assay using the eFluor670 cell proliferation dye (eBioscience, Cat.- No.65-0840-85).
For labeling, cells were harvested, washed with pre-warmed (37°C) DPBS and adjusted to a cell density of 1 x 107 cells/mL in DPBS. eFluor670 cell proliferation dye (eBioscience, Cat.- No.65-0840-85 ) was added to the suspension of naive human PBMCs at a final concentration of 2.5 mM, and a final cell density of 0.5 x 107 cells/mL in DPBS. Cells were then incubated for 10 min at room temperature in the dark. To stop the labeling reaction, 2 mL FBS was added and cells were washed three times with T cell medium. A 1 : 1 mixture of 1 x 105 naive, eFluor670- labeled human PBMC and unlabeled, activated human PBMC was then added to wells of round- bottomed suspension cell 96-well plates (Greiner bio-one, Cellstar, Cat. No. 650185).
Plates were centrifuged 4 minutes at 400 x g at 4 °C, and the supernatant was removed. Cells were washed once with 200 L, 4°C FACS buffer (DPBS supplemented with 2 % FBS, 5 mM EDTA pH 8 (Amresco, Cat. No. El 77) and 7.5 mM sodium azide (Sigma- Aldrich S2002)). Cells were resuspended in 50 μΙ,ΛνεΙΙ of 4 °C cold FACS buffer containing titrated bispecific anti-OX40, anti-FAP molecules for 120 minutes at 4 °C. Plates were then washed four times with 200 μΙ,ΛνεΙΙ 4 °C FACS buffer to remove unbound molecules. Cells were subsequently stained for 30 minutes at 4°C in the dark in 25 μΙ,ΛνεΙΙ, 4 °C
FACS buffer containing fluorescently-labeled anti- human CD4 (clone RPA-T4, mouse IgGl k, BioLegend, Cat.-No. 300532), anti-human CD8 (clone RPa-T8, mouse IgGlk, BioLegend, Cat.- No. 3010441), anti-human CD45 (clone HI30, mouse IgGlk, BioLegend, Cat.-No. 304028), and Fluorescein isothiocyanate (FITC)-conjugated AffiniPure anti-human IgG F(ab')2-fragment- specific goat IgG F(ab")2 fragment (Jackson ImmunoResearch, Cat. No. 109-096-097).
Cells were then washed twice with 200 μΕΛνεΙΙ 4 °C FACS buffer, resuspended in 80 μΕ/well FACS-buffer containing 0.2 μg/mL DAPI (Santa Cruz Biotec, Cat. No. Sc-3598) and acquired the same day using 5-laser LSR-Fortessa (BD Bioscience with DIVA software).
As shown in Figures 5A to 5D, none of the trimeric, bispecific anti-OX40, anti-FAP molecules bound to resting human CD4+ T cells or CD8+ T cells, which do not express OX40. By contrast, all of the trimeric, bispecific anti-OX40, anti-FAP molecules displayed binding to activated CD8 or CD4 T cells, which express OX40. Binding to activated CD4 T-cells was much stronger than binding to activated CD8+ T cells. Activated human CD8+ T cells express OX40 at a much lower level than the level of expression by activated CD4+ T cells. Donor- and time-dependent differences in binding were observed.
The molecules were also found to differ in the strength of binding. EC50 values are shown in Table 22. For further evaluation of bivalent and monovalent FAP targeted constructs clones with high (8H9) and low (49B4/1G4) binding capacity were chosen.
Table 22. EC50 values of binding to activated human CD4 T cells
4.3 Binding to human FAP-expressing and FAP-negative tumor cells
Binding of the trimeric, bispecific anti-OX40, anti-FAP molecules to FAP expressed at the cell surface was analysed using the FAP-expressing human melanoma cell line WM266-4 cells (ATCC CRL-1676), and using the FAP-negative ovarian hamster tumor cell ine CHO/dhFr- (ATCC CRL-9096) as a negative control.
In some of the experiments CHO/dhFr- cells were pre-labeled with PKH-26 Red
Fluorescence Cell linker Kit (Sigma, Cat.-No. PKH26GL) to enable separation from unlabeled tumor cells. CHO/dhFr- cells were harvested and washed three times with RPMI 1640 medium. The cells were then stained for 5 minutes at room temperature in the dark at a final cell density of 1 x 107 cells in freshly prepared PKH26-Red-stain solution (at a final concentration of 1 nM, in diluent C (provided with the PKH-26 Red Fluorescence Cell linker Kit)). Excess FBS was added to stop labeling reaction, and cells were then washed four times with RPMI 1640 medium supplemented with 10 % (v/v) FBS, 1 % (v/v) GlutaMAX-I, to remove excess dye.
0.5 x 105 PKH26-labeled CHO/dhFr- and unlabeled WM266-4 cells were then added to wells of round-bottomed suspension cell 96-well plates (Greiner Bio-one, Cellstar, Cat. No. 650185) and the binding assay was performed in a similar manner as described in Example 4.2 hereinabove. Plates were centrifuged 4 minutes at 400 x g at 4 °C, and the supernatant was removed. Cells were washed once with 200 μί, 4°C FACS buffer (DPBS supplemented with 2 % FBS, 5 mM EDTA pH 8 (Amresco, Cat. No. El 77) and 7.5 mM sodium azide (Sigma- Aldrich S2002)). Cells were resuspended in 50 μΕΛνεΙΙ of 4 °C cold FACS buffer containing titrated bispecific anti-OX40, anti-FAP molecules for 120 minutes at 4 °C. Plates were then washed four times with 200 μΕΛνεΙΙ 4 °C FACS buffer to remove unbound molecules. Cells were further stained with 25 μΕΛνεΙΙ of 4 °C secondary antibody solution containing Fluorescein
isothiocyanate (FITC)-conjugated AffmiPure anti-human IgG F(ab')2-fragment-specific goat IgG F(ab")2 fragment (Jackson ImmunoResearch, Cat. No. 109-096-097), and incubated for 30 minutes at 4 °C in the dark. Cells were then resuspended in 80 μΕ/well FACS-buffer containing
0.2 μ§/ητΙ, DAPI (Santa Cruz Biotec, Cat. No. Sc-3598) and acquired the same day using 5-laser LSR-Fortessa (BD Bioscience with DIVA software).
As shown in Figures 6A and 6B, the trimeric, bispecific anti-OX40, anti-FAP molecules bound efficiently to human FAP-expressing WM266-4 cells, but not to FAP -negative
CHO/dhFr- cells. Therefore, bispecific, trimeric anti-FAP and anti-OX40 antigen binding molecules show direct tumor-targeting properties. Differences in the ability of the molecules to bind to cell surface FAP were observed, which might be caused by sterical hindrance with the molecules. EC50 values of binding to FAP positive tumor cells are summarized in Table 23.
Table 23. EC50 values for binding of selected aOX40 binder in a FAP targeted trivalent format to cell surface human FAP
Example 5
Biological Activity of trimeric, bispecific antigen binding molecules targeting OX40 and
FAP 5.1 HeLa cells expressing human OX40 and reporter gene NF- B-luciferase
Agonstic binding of OX40 to its ligand induces downstream signaling via activation of nuclear factor kappa B (NFKB) (A. D. Weinberg et al, J. Leukoc. Biol. 2004, 75(6), 962-972). The recombinant reporter cell line HeLa_hOX40_NFKB_Lucl expressing human OX40 on its surface was generated. This cell line harbors a reporter plasmid containing the luciferase gene under the control of an NFKB-sensitive enhancer segment. Binding and activation of OX40 induces dose-dependent activation of NFKB, which then translocates to the nucleus, where it binds to the NFKB-sensitive enhancer of the reporter plasmid to increase expression of the luciferase protein. Luciferase catalyzes luciferin-oxidation resulting in oxyluciferin, which emits light. This can be detected and quantified using a luminometer. Adherent HeLa_hOX40_NFKB_Lucl cells were harvested using cell dissociation buffer
(Invitrogen, Cat.-No. 13151-014) for 10 minutes at 37 °C. Cells were washed once with DPBS
and were adjusted to a cell density of 2x105 in assay media comprising of MEM (Invitrogen, Cat.-No. 22561-021), 10 % (v/v) heat-inactivated FBS, 1 mM Sodium-Pyruvate and 1% (v/v) non-essential amino acids. Cells were seeded in a density of 0.3 * 105 cells per well in a sterile, white 96-well-flat bottomed tissue culture plate with lid (greiner bio-one, Cat. No. 655083) and incubated overnight at 37 °C in a 5% C02 atmosphere, in an incubator (Hera Cell 150).
The next day, HeLa_hOX40_NFKB_Lucl cells were stimulated for 6 hours by adding assay medium containing various titrated antigen binding molecules targeting OX40 and FAP. To analyse the effect of hyper-crosslinking by cell surface FAP binding, 25 μίΛνεΙΙ of medium containing FAP+ tumor cells (NIH/3T3-huFAP clone 39) were co-cultured with
HeLa_hOX40_NFKB_Lucl cells at a ratio of 2: 1 (i.e. there were twice as many FAP+ tumor cells as reporter cells, per well). NIH/3T3-huFAP clone 39 was generated by the transfection of the mouse embryonic fibroblast NIH/3T3 cell line (ATCC CRL-1658) with the expression vector pETR4921 to express human FAP under a CMV promoter, under puromycin selection
(1.5 μg/mL; InvivoGen, Cat.-No.: ant-pr-5). After incubation, supernatant was aspirated and plates were washed two times with DPBS.
Quantification of light emission was analysed using the luciferase 1000 assay system and the reporter lysis buffer (both Promega, Cat.-No. E4550 and Cat-No: E3971), according to the manufacturer's instructions. Briefly, cells were lysed for 10 minutes at -20 °C by addition of 30 per well lx lysis buffer. Cells were thawed for 20 minutes at 37 °C before 90 μΐ, of luciferase assay reagent was added per well. Light emission was quantified immediately with a SpectraMax M5/M5e microplate reader (Molecular Devices, USA) using 500ms integration time, without any filter to collect all wavelengths. Emitted units of released light (URL) were corrected using readings for basal luminescence of HeLa_hOX40_NFKB_Lucl cells, and were plotted against the logarithmic primary antibody concentration using Prism4 (GraphPad Software, USA). Where possible, trend lines were fitted to the data using the inbuilt sigmoidal dose response.
As shown in Figures 7A to 7E, a limited, dose-dependent activation of NFKB was observed to be induced by addition of the trivalent FAP -targeted, anti-OX40 clones 49B4, 1G4, CLC-563, 21H4 and 8H9 to the HeLa_hOX40_NFKB_Lucl reporter cells (dotted lines, open triangle). This is in line with the observation that the trimeric OX40L naturally engages three OX40 receptors on the cell surface to form the basic signaling unit capable of recruiting TRAFs to the cytosolic part of the OX40 receptor, initiating NFKB activation (Vinay DS et al. 2009. Cell Biol Int. 33(4):453-65). Hyper-crosslinking of the antigen binding molecules bound to the reported cells by FAP-expressing NIH/3T3huFAP strongly increased the induction of NFKB- mediated luciferase-activation, in a concentration-dependent manner (solid lines, filled circle). It has been speculated that full agonism of the OX40 axis can only be achieved when at least a hexameric OX40 signaling unit is assembled (Vinay DS et al. 2009. Cell Biol Int. 33(4):453-65),
which could be facilitated by FAP-mediated immobilization of the FAP targeted trivalent molecules. However, with increasing concentration a drop in bioactivity was observed after an initial increase. It is thought that at high concentrations of the antigen binding molecule, efficient hypercrosslinking is limited by insufficient FAP numbers at the cell surface, or by steric hindrance. NFKB activation drops to the levels observed for addition of trimeric molecules without hypercrosslinking.
The EC50 values of NFKB activation in the absence of hypercrosslinking are summarized in Table 24. The bioactivity in the absence of hypercrosslinking (Figure 8B) was substracted from the bioactivity in the presence of FAP positive cells (Figure 8A) for each evaluated
concentration, and this was then plotted against the concentration of the antigen binding molecule (Figure 8C) to provide an estimate of the increase in bioactivity achieved by targeting the trivalent constructs to FAP. This can be best appreciated when the agonistic capacity of each construct was quantified as the area under the curve (AUC) and plotted against each other
(Figure 8D). Table 24. EC50 values of NFKB activation in the HeLa_hOX40_NFKB_lucl reporter cell line co- incubated with bispecific, trimeric anti-FAP, anti-OX40 antigen binding molecules.
5.2 OX40 mediated costimulation of suboptimally TCR triggered pre-activated human CD4 T cells Ligation of OX40 provides a synergistic co-stimulatory signal promoting division and survival of T-cells following suboptimal T-cell receptor (TCR) stimulation (M. Croft et al., Immunol. Rev. 2009, 229(1), 173-191). Additionally, production of several cytokines and surface expression of T-cell activation markers is increased following ligation of OX40 (I.
Gramaglia et al, J. Immunol. 1998, 161(12), 6510-6517; S. M. Jensen et al., Seminars in Oncology 2010, 37(5), 524-532).
To analyse the agonistic properties of the bispecific, trivalent, anti-FAP and anti-OX40 antigen binding molecules, pre-activated OX40-positive CD4+ T-cells were stimulated for 72
hours with a suboptimal concentration of plate-immobilized anti-CD3 antibodies, in the presence of anti-OX40 antigen binding molecules immobilized on the plate surface. The effects on T-cell survival and proliferation were analyzed by monitoring of total cell counts and CFSE dilution in living cells by flow cytometry. Additionally, cells were co-stained with fluorescently-labeled antibodies against T-cell activation and differentiation markers, e.g. CD127 and TIM-3.
Human PBMCs were isolated via ficoll density centrifugation and were stimulated for three days with PHA-L (2 μg/mL) and Proleukin (200 U/mL) as described in Example 4.2 hereinabove. Cells were then labeled with CFSE at a cell density of lxl 06 cells/ mL with CFDA-SE (Sigma-Aldrich, Cat.-No. 2188), at a final concentration of 50 nM, for 10 minutes at 37 °C. Thereafter, cells were washed twice with excess DPBS containing FBS (10% v/v).
Labeled cells were rested in T-cell media at 37 °C for 30 minutes. Thereafter, non-converted CFDA-SE was removed by two additional washing steps with DPBS. CD4+ T-cell isolation from pre-activated CFSE-labeled human PBMCs was performed using the MACS negative CD4 T- cell isolation kit (Miltenyi Biotec), according to the manufacturer's instructions. Morris et al. previously showed that agonistic co-stimulation with conventional anti-OX40 antibodies relied on surface immobilization (N. P. Morris et al, Mol. Immunol. 2007, 44(12), 3112-3121). Thus, goat anti-mouse Fey-specific antibodies (Jackson ImmunoResearch, Ca.No. 111-500-5008) and goat anti-human Fab-specific antibodies (Sigma, Cat.-No. 15260) were coated to the surface of a 96 well U-bottomed cell culture plates (Greiner Bio One) at a concentration of 2 ug/mL in PBS overnight at 4 °C. Thereafter, the plate surface was blocked with DPBS containing BSA (1 % v/w). All following incubation steps were done at 37 °C for 90 minutes in PBS containing BSA (1 % v/w). Between the incubation steps, plates were washed with DPBS. Mouse anti-human CD3 antibody (clone OKT3, eBioscience, Ca.No. 16-0037-85, fixed concentration of 3 ng/mL) was captured in a subsequent incubation step via the surface coated anti-mouse Fey- specific antibodies. The FAP -targeted trivalent anti-OX40 molecules were then immobilized on plate by an additional incubation step in DPBS, via bindig to the plate-coated goat anti-human Fab-specific antibodies.
CFSE-labeled preactivated CD4+ T cells were added to the pre-coated plates at a cell density of 1 * 105 cells per well in 200 T-cell media, and cultured for 96 hours. Cells were stained with a combination of fluorochrome-labeled mouse anti-human TIM-3 (clone F38-2E2, Biolegend, Ca.No.345008) and anti-CD127 (clone A019D5, Biolegend, Ca.No.351234) for 20 minutes at 4 °C in the dark. Plates where washed twice with 200 μΕΛνεΙΙ 4 °C FACS buffer, were finally resuspended in 80 μΕΛνεΙΙ FACS-buffer containing 0.2 μg/mL DAPI (Santa Cruz Biotec, Cat. No. Sc-3598) and acquired the same day using 5-laser LSR-Fortessa (BD
Bioscience with DIVA software).
Co-stimulation with plate-immobilized trivalent anti-OX40 antigen binding molecules strongly enhanced suboptimal stimulation of pre-activated human CD4 T cells with plate- immobilized anti- human CD3, in a dose dependent manner (Figures 9 A to 9D). T-cells proliferated more strongly, and displayed a more mature phenotype as indicated by a higher percentage of CD 127 low T cells, and a higher percentage of TIM-3 positive activated cells. Half-maximal changes in all analyzed parameters of T-cell activation were achieved at concentrations ranging from 10 to 3000 pM, and are summarized in Figure 10.
5.3 OX40 mediated costimulation of suboptimally TCR triggered resting human PBMC and hypercrosslinking by cell surface FAP It was shown in Example 5.1 that addition of FAP+ tumor cells can strongly increase the
NFKB activity induced by FAP -targeted, trivalent anti-OX40 molecules in a human OX40- positive reporter cell line, by providing strong oligomerization of OX40 receptors. These constructs were therefore evaluated in the presence of NIH/3T3-huFAP clone 39 cells for their ability to rescue suboptimal TCR stimulation of resting human PBMC cells. Human PBMC preparations contain (1) resting OX40-negative CD4+ and CD8+ T cells and
(2) antigen presenting cells with various Fc-γ receptor molecules on their cell surface e.g. B cells and monocytes. Anti- human CD3 antibody of human IgGl isotype can bind with its Fc part to the present Fc-γ receptor molecules and mediate a prolonged TCR activation on resting OX40 negative CD4+ and CD8+ T cells. These cells then start to express OX40 within several hours. Functional agonistic compounds against OX40 can signal via the OX40 receptor present on activated CD8+ and CD4+ T cells and support TCR-mediated stimulation.
Resting CFSE-labeled human PBMCs were stimulated for four days with a suboptimal concentration of anti-CD3 antibody in the presence of irradiated FAP+ NIH/3T3-huFAP clone 39 cells and titrated anti-OX40 constructs. The effects on T-cell survival and proliferation were analyzed through monitoring of total cell counts and CFSE dilution in living cells by flow cytometry. Additionally, cells were co-stained with fluorescently-labeled antibodies against T- cell activation marker CD25.
Mouse embryonic fibroblast NIH/3T3-huFAP clone 39 cells (Example 5.1) were harvested using cell dissociation buffer (Invitrogen, Cat.-No. 13151-014) for 10 minutes at 37 °C. Cells were washed once with DPBS. NIH/3T3-huFAP clone 39 cells were cultured at a density of 0.2* 105 cells per well in T cell media in a sterile 96-well round bottomed adhesion tissue culture plate (TPP, Cat. No. 92097) overnight at 37 °C and 5% C02 in an incubator (Hera Cell 150). The next day they were irradiated in an xRay irradiator using a dose of 45 Gy to prevent later overgrowth of human PBMC by the tumor cell line.
Human PBMCs were isolated by ficoll density centrifugation and were labeled with CFSE as described in Example 4.2. Cells were added to each well at a density of 0.75* 105 cells per well. Anti- human CD3 antibody (clone V9, human IgGl) at a final concentration of 2 nM, and FAP targeted trivalent OX40 antigen binding molecules or non-targeted trivalent OX40 antigen binding molecules were added at the indicated concentrations. Cells were activated for four days at 37 °C and 5% C02 in an incubator (Hera Cell 150). Cells were subsequently surface-stained with fluorescent dye-conjugated antibodies anti-human CD4 (clone RPA-T4, BioLegend, Cat- No. 300532), CD8 (clone RPa-T8, BioLegend, Cat.-No. 3010441) and CD25 (clone M-A251, BioLegend, Cat.-No. 356112) for 20 min at 4 °C. For permeabilizing the cell membrane, cell pellets were washed twice with FACS buffer, then resuspended in 50 μΙ,ΛνεΙΙ freshly prepared FoxP3 Fix/Perm buffer (eBioscience, Cat.-No. 00-5123 and 00-5223) for 45 min at room temperature in the dark. After washing the cells three times with Perm- Wash buffer (eBioscience, Cat.-No. 00-8333-56), cells were stained intracellular with 25 μΙ,ΛνεΙΙ Perm- Wash Buffer containing anti-human Granzyme B antibody (clone GB-11, BD Bioscience, Cat. No. 561142) for 1 h at room temperature in the dark. Cells were then resuspended in 85 μΙ,ΛνεΙΙ FACS buffer, and acquired using a 5 -laser Fortessa flow cyto meter (BD Bioscience with DIVA software).
As shown in Figures 11A to 11D, costimulation with non-targeted trivalent anti-OX40 barely rescued suboptimally TCR-stimulated CD4 T cells (as determined by analysis for CD25 expression). Hyper-crosslinking of the FAP -targeted trivalent anti-OX40 constructs by the NIH/3T3-huFAP clone 39 cells strongly promoted proliferation, survival and induced an enhanced activated phenotype in human CD4 and CD 8 T cells (as indicated by CD25
expression). High affinity clone 8H9 (Figures 11A and 11B), showed again a peak activity at -0.1-1 nM, and a reduced response at higher concentration. Similar to the findings in the NFKB reporter cell line (Figure 7D, as described in Example 5.1) this might be a consequence of competition for target binding between constructs that bind only to FAP or OX40, and those that bind simultaneously to both targets and provide thus the necessary cross-linking function. This effect was not seen when trivalent constructs were coated to plates. The bell shaped effect was less prominent for all other clones in the FAP -targeted, trivalent anti-OX40 format (Figure 11).
5.4 Relationship between binding strength to OX40 and bioactivity of trimeric, bispecific antigen binding molecules targeting OX40 and FAP molecules
Figure 12 shows the correlation between the strength of binding to cells, and the strength of NFKB activation (as determined as AUC for NFKB activation; Figure 12A) and the strength of T cell activation (Figure 12B) shown for each clone in the FAP -targeted trivalent format. Interestingly, a negative correlation was observed between the strength of binding strength to OX40 and agonism of OX40 signalling. The ability to dynamically recruit signaling OX40 receptor units might be stronger in a low affinity format with high avidity. The low affinity
might guarantee turn-over of receptor units by quick catch and release, whereas the avidity still guarantees a clustering of several OX40 molecules at once, and hypercrosslinking by FAP for optimal receptor signaling.
Example 6 Generation of bispecific antibodies targeting 4-lBB and fibroblast activation protein (FAP)
6.1 Generation of bispecific, trivalent antibodies targeting 4-lBB and fibroblast activation protein (FAP)
Bispecific agonistic 4- IBB constructs with trivalent binding for 4- IBB and trivalent binding for FAP were prepared. To enhance binding of Fab molecules to 4-lBB, and for enhanced cross-linking of these receptors, trimerized Fab molecules targeting OX40 were generated by the method described in WO 2014/180754 Al .
Fab genes of the 4- IBB binders (VHCH1) were connected by a (Gly4Ser)2 linker to a short trimerisation domain derived from human cartilage matrix protein (CMP) (Uniprot Accession: P21941 ; Residues 454 to 496, SEQ ID NO : 1 ) by standard recombinant DNA technologies. The cysteine residues forming interchain disulfide bridges at positions 458 and 460 were used together with the coiled coil domain comprising residues 467 to 495. Downstream of the CMP domain, a (Gly4Ser)4 linker was fused to connect the anti-FAP binding moiety to the trimerisation domain. The FAP binding moieties were comprised of disulfide stabilized scFv fragments (H44/L 100) of the FAP specific binder (28H 1 ).
The CMP chain and the anti-4-lBB light chain were co-expressed, resulting in the production of bispecific, trimeric molecules as depicted in Figure 2B. The base pair and amino acid sequences for the constructs are shown in Table 25 and Table 26, respectively.
Table 25. Base pair sequences of mature bispecific trivalent anti-4-lBB, anti-FAP human
Clone
SEQ ID
(4-lBB Base pair sequences
NO.
clone/FA
P clone)
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGAAGA
AGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGGCCTCC
GGAGGCACATTCAGCAGCTACGCTATAAGCTGGGTGC
GACAGGCCCCTGGACAAGGGCTGGAGTGGATGGGAGG
GATCATCCCTATCTTTGGTACAGCAAACTACGCACAGA
AGTTCCAGGGCAGGGTCACCATTACTGCAGACAAATC
CACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGA
TCTGAGGACACCGCCGTGTATTACTGTGCGAGATCTGA
ATTCCGTTTCTACGCTGACTTCGACTACTGGGGCCAAG
GGACCACCGTGACCGTCTCGAGTGCTAGCACAAAGGG
ACCTAGCGTGTTCCCCCTGGCCCCCAGCAGCAAGTCTA
CATCTGGCGGAACAGCCGCCCTGGGCTGCCTCGTGAA
GGACTACTTTCCCGAGCCCGTGACCGTGTCCTGGAACT
CTGGCGCTCTGACAAGCGGCGTGCACACCTTTCCAGCC
GTGCTGCAGAGCAGCGGCCTGTACTCTCTGAGCAGCG
TCGTGACAGTGCCCAGCAGCTCTCTGGGCACCCAGAC
CTACATCTGCAACGTGAACCACAAGCCCAGCAACACC
AAGGTGGACAAGAAGGTGGAACCCAAGAGCTGCGAC
GGCGGAGGGGGATCTGGCGGCGGAGGATCCGAGGAA
3+3 GATCCTTGCGCCTGCGAGAGCCTCGTGAAGTTCCAGGC
VHCH1(
CAAGGTGGAAGGACTGCTGCAGGCCCTGACCCGGAAA
4-1BB)-
CTGGAAGCCGTGTCCAAGCGGCTGGCCATCCTGGAAA CMPtd- 238
ACACCGTGGTGTCCGGAGGCGGGGGTAGCGGCGGAGG
B3/28 scFv
GGGCTCTGGCGGTGGCGGGTCTGGAGGCGGGGGTTCA HI (28H1)
GAAGTGCAGCTGCTGGAATCTGGCGGCGGACTGGTGC
AGCCTGGCGGATCTCTGAGACTGAGCTGTGCCGCCAG
CGGCTTCACCTTTAGCAGCCACGCCATGAGCTGGGTGC
GCCAGGCCCCTGGAAAGTGCCTGGAATGGGTGTCCGC
CATCTGGGCCAGCGGCGAGCAGTACTACGCCGATAGC
GTGAAGGGCCGGTTCACCATCAGCCGGGACAACAGCA
AGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGC
CGAGGACACCGCCGTGTACTATTGTGCCAAGGGCTGG
CTGGGCAACTTCGACTATTGGGGCCAGGGCACCCTCGT
GACCGTGTCTAGCGGAGGGGGCGGAAGTGGTGGCGGG
GGAAGCGGCGGGGGTGGCAGCGGAGGGGGCGGATCT
GAAATTGTGCTGACCCAGAGCCCTGGCACCCTGAGCC
TGTCTCCAGGCGAAAGAGCCACACTGAGCTGCAGAGC
CAGCCAGAGCGTGTCCAGAAGCTACCTGGCCTGGTAT
CAGCAGAAGCCCGGACAGGCCCCCAGACTGCTGATCA
TCGGCGCCTCTACAAGAGCCACCGGCATCCCCGATAG
ATTCAGCGGCTCTGGCAGCGGCACCGACTTCACCCTGA
CCATCAGCAGACTGGAACCCGAGGACTTTGCCGTGTA
TTACTGCCAGCAGGGCCAAGTGATCCCCCCCACCTTTG
GCTGTGGCACAAAGGTGGAAATCAAA
GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGC
ATCTGTAGGAGACCGTGTCACCATCACTTGCCGTGCCA
GTCAGAGTATTAGTAGCTGGTTGGCCTGGTATCAGCAG
AAACCAGGGAAAGCCCCTAAGCTCCTGATCTATGATG
CCTCCAGTTTGGAAAGTGGGGTCCCATCACGTTTCAGC
GGCAGTGGATCCGGGACAGAATTCACTCTCACCATCA
GCAGCTTGCAGCCTGATGATTTTGCAACTTATTACTGC
CAACAGTATCATTCGTATCCGCAGACGTTTGGCCAGGG
CACCAAAGTCGAGATCAAGCGTACGGTGGCTGCACCA
TCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAA
ATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACT
TCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGA
TAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTC
ACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCA
GCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAA
ACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGC
CTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAG
AGTGT
GAGGTGCAATTGTTGGAGTCTGGGGGAGGCTTGGTAC
AGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCC
GGATTCACCTTTAGCAGTTATGCCATGAGCTGGGTCCG
CCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGCT
ATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACT
CCGTGAAGGGCCGGTTCACCATCTCCAGAGACAATTC
CAAGAACACGCTGTATCTGCAGATGAACAGCCTGAGA
GCCGAGGACACGGCCGTATATTACTGTGCGCGTGACG
ACCCGTGGCCGCCGTTCGACTACTGGGGCCAAGGAAC
CCTGGTCACCGTCTCGAGTGCTAGCACAAAGGGACCT
AGCGTGTTCCCCCTGGCCCCCAGCAGCAAGTCTACATC
TGGCGGAACAGCCGCCCTGGGCTGCCTCGTGAAGGAC
TACTTTCCCGAGCCCGTGACCGTGTCCTGGAACTCTGG
CGCTCTGACAAGCGGCGTGCACACCTTTCCAGCCGTGC
TGCAGAGCAGCGGCCTGTACTCTCTGAGCAGCGTCGT
GACAGTGCCCAGCAGCTCTCTGGGCACCCAGACCTAC
ATCTGCAACGTGAACCACAAGCCCAGCAACACCAAGG
TGGACAAGAAGGTGGAACCCAAGAGCTGCGACGGCG
GAGGGGGATCTGGCGGCGGAGGATCCGAGGAAGATCC
TTGCGCCTGCGAGAGCCTCGTGAAGTTCCAGGCCAAG
VHCH1(
3+3 GTGGAAGGACTGCTGCAGGCCCTGACCCGGAAACTGG
4-1BB)-
AAGCCGTGTCCAAGCGGCTGGCCATCCTGGAAAACAC CMPtd- 240
CGTGGTGTCCGGAGGCGGGGGTAGCGGCGGAGGGGGC
scFv
TCTGGCGGTGGCGGGTCTGGAGGCGGGGGTTCAGAAG
G7/28 (28H1)
TGCAGCTGCTGGAATCTGGCGGCGGACTGGTGCAGCC HI TGGCGGATCTCTGAGACTGAGCTGTGCCGCCAGCGGC
TTCACCTTTAGCAGCCACGCCATGAGCTGGGTGCGCCA
GGCCCCTGGAAAGTGCCTGGAATGGGTGTCCGCCATC
TGGGCCAGCGGCGAGCAGTACTACGCCGATAGCGTGA
AGGGCCGGTTCACCATCAGCCGGGACAACAGCAAGAA
CACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAG
GACACCGCCGTGTACTATTGTGCCAAGGGCTGGCTGG
GCAACTTCGACTATTGGGGCCAGGGCACCCTCGTGAC
CGTGTCTAGCGGAGGGGGCGGAAGTGGTGGCGGGGGA
AGCGGCGGGGGTGGCAGCGGAGGGGGCGGATCTGAA
ATTGTGCTGACCCAGAGCCCTGGCACCCTGAGCCTGTC
TCCAGGCGAAAGAGCCACACTGAGCTGCAGAGCCAGC
CAGAGCGTGTCCAGAAGCTACCTGGCCTGGTATCAGC
AGAAGCCCGGACAGGCCCCCAGACTGCTGATCATCGG
CGCCTCTACAAGAGCCACCGGCATCCCCGATAGATTC
AGCGGCTCTGGCAGCGGCACCGACTTCACCCTGACCA
TCAGCAGACTGGAACCCGAGGACTTTGCCGTGTATTAC
TGCCAGCAGGGCCAAGTGATCCCCCCCACCTTTGGCTG
TGGCACAAAGGTGGAAATCAAA
TCGTCTGAGCTGACTCAGGACCCTGCTGTGTCTGTGGC
CTTGGGACAGACAGTCAGGATCACATGCCAAGGAGAC
AGC CTC AG AAGTT ATT ATGC A AGCTGGT AC C AGC AG A
AGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAA
AACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTG
GCTCCAGCTCAGGAAACACAGCTTCCTTGACCATCACT
GGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTA
ACTCCCTTGATAGGCGCGGTATGTGGGTATTCGGCGGA
GGGACCAAGCTGACCGTCCTAGGTCAACCCAAGGCTG
CCCCCAGCGTGACCCTGTTCCCCCCCAGCAGCGAGGA
ACTGCAGGCCAACAAGGCCACCCTGGTCTGCCTGATC
AGCGACTTCTACCCAGGCGCCGTGACCGTGGCCTGGA
AGGCCGACAGCAGCCCCGTGAAGGCCGGCGTGGAGAC
CACCACCCCCAGCAAGCAGAGCAACAACAAGTACGCC
GCCAGCAGCTACCTGAGCCTGACCCCCGAGCAGTGGA
AG AGC C AC AGGTC CT AC AGCTGC C AGGTG ACC C AC G A
GGGCAGCACCGTGGAGAAAACCGTGGCCCCCACCGAG
TGCAGC
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGAAGA
AGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGGCCTCC
GGAGGCACATTCAGCAGCTACGCTATAAGCTGGGTGC
GACAGGCCCCTGGACAAGGGCTCGAGTGGATGGGAGG
GATCATCCCTATCTTTGGTACAGCAAACTACGCACAGA
AGTTCCAGGGCAGGGTCACCATTACTGCAGACAAATC
CACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGA
TCTGAGGACACCGCCGTGTATTACTGTGCGAGATCTAC
TCTGATCTACGGTTACTTCGACTACTGGGGCCAAGGGA
CCACCGTGACCGTCTCCTCAGCTAGCACAAAGGGACC
TAGCGTGTTCCCCCTGGCCCCCAGCAGCAAGTCTACAT
CTGGCGGAACAGCCGCCCTGGGCTGCCTCGTGAAGGA
CTACTTTCCCGAGCCCGTGACCGTGTCCTGGAACTCTG
GCGCTCTGACAAGCGGCGTGCACACCTTTCCAGCCGTG
CTGCAGAGCAGCGGCCTGTACTCTCTGAGCAGCGTCGT
GACAGTGCCCAGCAGCTCTCTGGGCACCCAGACCTAC
ATCTGCAACGTGAACCACAAGCCCAGCAACACCAAGG
TGGACAAGAAGGTGGAACCCAAGAGCTGCGACGGCG
GAGGGGGATCTGGCGGCGGAGGATCCGAGGAAGATCC
3+3 TTGCGCCTGCGAGAGCCTCGTGAAGTTCCAGGCCAAG
VHCH1(
GTGGAAGGACTGCTGCAGGCCCTGACCCGGAAACTGG
4-1BB)-
AAGCCGTGTCCAAGCGGCTGGCCATCCTGGAAAACAC CMPtd- 242
CGTGGTGTCCGGAGGCGGGGGTAGCGGCGGAGGGGGC
scFv
D5/28 TCTGGCGGTGGCGGGTCTGGAGGCGGGGGTTCAGAAG HI (28H1)
TGCAGCTGCTGGAATCTGGCGGCGGACTGGTGCAGCC
TGGCGGATCTCTGAGACTGAGCTGTGCCGCCAGCGGC
TTCACCTTTAGCAGCCACGCCATGAGCTGGGTGCGCCA
GGCCCCTGGAAAGTGCCTGGAATGGGTGTCCGCCATC
TGGGCCAGCGGCGAGCAGTACTACGCCGATAGCGTGA
AGGGCCGGTTCACCATCAGCCGGGACAACAGCAAGAA
CACCCTGTACCTGCAGATGAACAGCCTGCGGGCCGAG
GACACCGCCGTGTACTATTGTGCCAAGGGCTGGCTGG
GCAACTTCGACTATTGGGGCCAGGGCACCCTCGTGAC
CGTGTCTAGCGGAGGGGGCGGAAGTGGTGGCGGGGGA
AGCGGCGGGGGTGGCAGCGGAGGGGGCGGATCTGAA
ATTGTGCTGACCCAGAGCCCTGGCACCCTGAGCCTGTC
TCCAGGCGAAAGAGCCACACTGAGCTGCAGAGCCAGC
CAGAGCGTGTCCAGAAGCTACCTGGCCTGGTATCAGC
AGAAGCCCGGACAGGCCCCCAGACTGCTGATCATCGG
CGCCTCTACAAGAGCCACCGGCATCCCCGATAGATTC
AGCGGCTCTGGCAGCGGCACCGACTTCACCCTGACCA
TCAGCAGACTGGAACCCGAGGACTTTGCCGTGTATTAC
TGCCAGCAGGGCCAAGTGATCCCCCCCACCTTTGGCTG
TGGCACAAAGGTGGAAATCAAA
GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGC
ATCTGTAGGAGACCGTGTCACCATCACTTGCCGTGCCA
GTCAGAGTATTAGTAGCTGGTTGGCCTGGTATCAGCAG
AAACCAGGGAAAGCCCCTAAGCTCCTGATCTATGATG
CCTCCAGTTTGGAAAGTGGGGTCCCATCACGTTTCAGC
GGCAGTGGATCCGGGACAGAATTCACTCTCACCATCA
GCAGCTTGCAGCCTGATGATTTTGCAACTTATTACTGC
CAACAGCTTAATTCGTATCCTCAGACGTTTGGCCAGGG
CACCAAAGTCGAGATCAAGCGTACGGTGGCTGCACCA
TCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAA
ATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACT
TCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGA
TAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTC
AC AG AGC AGG AC AGC AAGG AC AGC AC CT AC AGC CTC A
GCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAA
ACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGC
CTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAG
AGTGT
CAGGTGCAATTGGTGCAGTCTGGGGCTGAGGTGAAGA
AGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGGCCTCC
GGAGGCACATTCAGCAGCTACGCTATAAGCTGGGTGC
GACAGGCCCCTGGACAAGGGCTCGAGTGGATGGGAGG
GATCATCCCTATCTTTGGTACAGCAAACTACGCACAGA
AGTTCCAGGGCAGGGTCACCATTACTGCAGACAAATC
CACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGA
TCTGAGGACACCGCCGTGTATTACTGTGCGAGATCTTC
TGGTGCTTACCCGGGTTACTTCGACTACTGGGGCCAAG
GGACCACCGTGACCGTCTCCTCAGCTAGCACAAAGGG
ACCTAGCGTGTTCCCCCTGGCCCCCAGCAGCAAGTCTA
CATCTGGCGGAACAGCCGCCCTGGGCTGCCTCGTGAA
GGACTACTTTCCCGAGCCCGTGACCGTGTCCTGGAACT
CTGGCGCTCTGACAAGCGGCGTGCACACCTTTCCAGCC
GTGCTGCAGAGCAGCGGCCTGTACTCTCTGAGCAGCG
TCGTGACAGTGCCCAGCAGCTCTCTGGGCACCCAGAC
CTACATCTGCAACGTGAACCACAAGCCCAGCAACACC
AAGGTGGACAAGAAGGTGGAACCCAAGAGCTGCGAC
GGCGGAGGGGGATCTGGCGGCGGAGGATCCGAGGAA
+3 GATCCTTGCGCCTGCGAGAGCCTCGTGAAGTTCCAGGC
VHCH1(
CAAGGTGGAAGGACTGCTGCAGGCCCTGACCCGGAAA
4-1BB)-
CTGGAAGCCGTGTCCAAGCGGCTGGCCATCCTGGAAA CMPtd- 244
ACACCGTGGTGTCCGGAGGCGGGGGTAGCGGCGGAGG
1/28 scFv
GGGCTCTGGCGGTGGCGGGTCTGGAGGCGGGGGTTCA
I (28H1)
GAAGTGCAGCTGCTGGAATCTGGCGGCGGACTGGTGC
AGCCTGGCGGATCTCTGAGACTGAGCTGTGCCGCCAG
CGGCTTCACCTTTAGCAGCCACGCCATGAGCTGGGTGC
GCCAGGCCCCTGGAAAGTGCCTGGAATGGGTGTCCGC
CATCTGGGCCAGCGGCGAGCAGTACTACGCCGATAGC
GTGAAGGGCCGGTTCACCATCAGCCGGGACAACAGCA
AGAACACCCTGTACCTGCAGATGAACAGCCTGCGGGC
CGAGGACACCGCCGTGTACTATTGTGCCAAGGGCTGG
CTGGGCAACTTCGACTATTGGGGCCAGGGCACCCTCGT
GACCGTGTCTAGCGGAGGGGGCGGAAGTGGTGGCGGG
GGAAGCGGCGGGGGTGGCAGCGGAGGGGGCGGATCT
GAAATTGTGCTGACCCAGAGCCCTGGCACCCTGAGCC
TGTCTCCAGGCGAAAGAGCCACACTGAGCTGCAGAGC
CAGCCAGAGCGTGTCCAGAAGCTACCTGGCCTGGTAT
CAGCAGAAGCCCGGACAGGCCCCCAGACTGCTGATCA
TCGGCGCCTCTACAAGAGCCACCGGCATCCCCGATAG
ATTCAGCGGCTCTGGCAGCGGCACCGACTTCACCCTGA
CCATCAGCAGACTGGAACCCGAGGACTTTGCCGTGTA
TTACTGCCAGCAGGGCCAAGTGATCCCCCCCACCTTTG
GCTGTGGCACAAAGGTGGAAATCAAA
GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGC
ATCTGTAGGAGACCGTGTCACCATCACTTGCCGTGCCA
GTCAGAGTATTAGTAGCTGGTTGGCCTGGTATCAGCAG
AAACCAGGGAAAGCCCCTAAGCTCCTGATCTATGATG
CCTCCAGTTTGGAAAGTGGGGTCCCATCACGTTTCAGC
GGCAGTGGATCCGGGACAGAATTCACTCTCACCATCA
GCAGCTTGCAGCCTGATGATTTTGCAACTTATTACTGC
CAACAGGTTAATTCTTATCCGCAGACGTTTGGCCAGGG
CACCAAAGTCGAGATCAAGCGTACGGTGGCTGCACCA
TCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAA
ATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACT
TCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGA
TAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTC
ACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCA
GCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAA
ACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGC
CTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAG
AGTGT
Table 26. Amino acid sequences of the mature, bispecific trivalent anti-4-lBB, anti-FAP human
SEQ ID
Clone Amino acid sequences
NO.
Q VQL VQ S G AE VKKPGS S VKVS CKAS GGTFS S Y AI S WVRQ
APGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTA
YMELSSLRSEDTAVYYCARSEFRFYADFDYWGQGTTVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
VHCH1(4-
YICNVNHKPSNTKVDK VEPKSCDGGGGSGGGGSEEDPC
1BB)-
ACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVVSG CMPtd- 246
GGGSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSLRL
scFv
SCAASGFTFSSHAMSWVRQAPGKCLEWVSAIWASGEQYY
(28H1)
ADSVKGRFTISRDNSK TLYLQMNSLRAEDTAVYYCAKG
12B3 WLGNFDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGS
EIVLTQSPGTLSLSPGERATLSCRASQSVSRSYLAWYQQKP
GQAPRLLIIGASTRATGIPDRFSGSGSGTDFTLTISRLEPEDF
AVYYCQQGQVIPPTFGCGTKVEIK
DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPG
VLCL- KAPKLLIYDASSLESGVPSRFSGSGSGTEFTLTISSLQPDDF Light ATYYCQQYHSYPQTFGQGTKVEIKRTVAAPSVFIFPPSDEQ
247
chain 1 (4- LKSGT AS V VCLL NF YPRE AKVQ WKVDN ALQ S GNS QE S V 1BB) TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSS
PVTKSFNRGEC
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQA
PGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSK TLY
LQMNSLRAEDTAVYYCARDDPWPPFDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
VHCH1(4-
CNVNHKPSNTKVDK VEPKSCDGGGGSGGGGSEEDPCAC
1BB)-
ESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVVSGGG CMPtd- 248
GSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSLRLSC
scFv
AASGFTFSSHAMSWVRQAPGKCLEWVSAIWASGEQYYAD
(28H1)
SVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGWL
G7 GNFDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSEIV
LTQSPGTLSLSPGERATLSCRASQSVSRSYLAWYQQKPGQ
APRLLIIGASTRATGIPDRFSGSGSGTDFTLTISRLEPEDFAV
YYCQQGQVIPPTFGCGTKVEIK
SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPG
VLCL- QAPVLVIYGK NRPSGIPDRFSGSSSGNTASLTITGAQAED Light EADYYCNSLDRRGMWVFGGGTKLTVRTVAAPSVFIFPPSD
249
chain 1 (4- EQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE 1BB) SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL
SSPVTKSFNRGEC
Q VQL VQ S G AE VK PGS S VKVS CKAS GGTF S S Y AI S WVRQ
APGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTA
YMELSSLRSEDTAVYYCARSTLIYGYFDYWGQGTTVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
VHCH1(4-
CNVNHKPSNTKVDK VEPKSCDGGGGSGGGGSEEDPCAC
1BB)-
ESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVVSGGG CMPtd- 250
GSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSLRLSC
scFv
AASGFTFSSHAMSWVRQAPGKCLEWVSAIWASGEQYYAD
(28H1)
SVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGWL
D5 GNFDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSEIV
LTQSPGTLSLSPGERATLSCRASQSVSRSYLAWYQQKPGQ
APRLLIIGASTRATGIPDRFSGSGSGTDFTLTISRLEPEDFAV
YYCQQGQVIPPTFGCGTKVEIK
DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPG
VLCL- KAPKLLIYDASSLESGVPSRFSGSGSGTEFTLTISSLQPDDF Light ATYYCQQLNSYPQTFGQGTKVEIKRTVAAPSVFIFPPSDEQ
251
chain 1 (4- LKSGT AS V VCLL NF YPRE AKVQ WKVDN ALQ S GNS QE S V 1BB) TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSS
PVTKSFNRGEC
Q VQL VQ S G AE VKKPGS S VKVS CKAS GGTFS S Y AI S WVRQ
APGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTA
YMELSSLRSEDTAVYYCARSSGAYPGYFDYWGQGTTVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
VHCH1(4-
YICNVNHKPSNTKVDK VEPKSCDGGGGSGGGGSEEDPC
1BB)-
ACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVVSG CMPtd- 252
GGGSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSLRL
scFv
SCAASGFTFSSHAMSWVRQAPGKCLEWVSAIWASGEQYY
(28H1)
ADSVKGRFTISRDNSK TLYLQMNSLRAEDTAVYYCAKG
B11 WLGNFDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGS
EIVLTQSPGTLSLSPGERATLSCRASQSVSRSYLAWYQQKP
GQAPRLLIIGASTRATGIPDRFSGSGSGTDFTLTISRLEPEDF
AVYYCQQGQVIPPTFGCGTKVEIK
DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPG
VLCL- KAPKLLIYDASSLESGVPSRFSGSGSGTEFTLTISSLQPDDF Light ATYYCQQVNSYPQTFGQGTKVEIKRTVAAPSVFIFPPSDEQ
253
chain 1 (4- LKSGT AS V VCLL NF YPRE AKVQ WKVDN ALQ S GN SQE S V 1BB) TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSS
PVTKSFNRGEC
In addition, an "untargeted" 25G7 construct was prepared, in which the VH and VL of the anti-FAP binder were replaced by a germline control, termed DP47, which does not display binding to FAP.
The VHCH1 (4- IBB) - CMPtd - scFc (FAP) sequence (and the corresponding VLCL sequence of the anti-4-lBB Fab) are operatively fused to a recombinant chimeric MPSV
promoter for expression in mammalian cells. The used expression vectors also contain the oriP sequence for stable maintenance of plasmids in cells providing the Epstein Barr large nuclear antigen (EBNA). In addition a synthetic polyA signal sequence is located at the 3' end of the CDS.
For production of the trimeric, bispecific anti-4-lBB, anti-FAP molecules constructs were produced by co-transfecting HEK293-EBNA cells with the mammalian expression vectors using polyethylenimine. The cells were transfected with the corresponding expression vectors in a 1 : 1 ratio ("vector CH-VH CMPtd disulphide-stabilised scFv" : "vector CL-VL"). Transfection was performed as described for the anti-4-lBB, anti-FAP constructs in Example 3.1 hereinabove
The secreted protein was purified from cell culture supernatants first by affinity
chromatography via the CHI domain of human IgG antibodies, followed by size exclusion chromatography. For affinity chromatography, the supernatant was loaded on a column packed with CaptureSelect IgG-CHl matrix (Column Volume = 1 ml; BAC, The Netherlands) and
equilibrated with 5 ml 50 mM Tris(hydroxymethyl)-aminomethan (TRIS), 100 mM Glycine, 150 mM sodium chloride, pH 8.0. Unbound protein was removed by washing with at least ten column volumes 50 mM TRIS, 100 mM Glycine, 150 mM sodium chloride, pH 8.0. The bound protein was eluted in a linear pH-gradient over 20 column volumes from 50 mM TRIS, 100 mM Glycine, 150 mM sodium chloridepH 8.0 to pH 2.0. The column was subsequently washed with 10 column volume 50 mM TRIS, 100 mM Glycine, 150 mM sodium chloride, pH 2.0.
The protein solution (i.e. the collected fraction) was neutralized by addition of 1/40 (v/v) of 2M Tris, pH 8.0, and was followed by a concentration step. Finally, the protein was filtered prior to loading on a HiLoad Superdex 200 column (GE Healthcare) equilibrated with 20 mM Histidine, 140 mM sodium chloride, 0.01% (v/v) Tween-20 solution of pH 6.0.
Analysis confirmed a homogeneous preparation of the trimerized molecules (Table 27).
Table 27. Biochemical analysis of huCMP containing bispecific 4-1BB/FAP constructs.
In addition, an control molecule DP47 x FAP 3+3 was prepared, in which the VH and VL domains of the 4-lBB binding region were replaced by the germline control DP47, which does not display binding to 4- IBB.
Example 7
Binding of trimeric, bispecific antigen binding molecules targeting 4-lBB and FAP
7.1 Analysis of simultaneous binding to 4- IBB and FAP by surface plasmon resonance anaylsis
The ability of the trimeric, bispecific antibodies to bind simultaneously to human 4- IBB Fc(kih) and human FAP was assessed by surface plasmon resonance (SPR) analysis. All SPR experiments were performed on a Biacore T200 at 25 °C with HBS-EP as running buffer (0.01 M HEPES pH 7.4, 0.15 M NaCl, 3 mM EDTA, 0.005% Surfactant P20, Biacore,
Freiburg/Germany).
Biotinylated human 4- IBB Fc(kih) was directly coupled to the chip surface of a streptavidin (SA) sensor chip. Immobilization levels up to 400 resonance units (RU) were used.
The bispecific antibodies targeting 4- IBB and FAP were over the chip surface at a concentration of 200 nM, and at a flow of 30 μί/ηώηιίε for 90 seconds, with a dissociation phase set to zero sec. Human FAP was injected as the second analyte, at a concentration of 500 nM, and at a flow rate of 30 μί/ηώηιίε for 90 seconds (Figure 3B). Dissociation was monitored for 120 sec. Bulk refractive index differences were corrected for by subtracting the response obtained in a reference flow cell, where no protein was immobilized.
All trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules were found to be able to bind simultaneously to human 4-1BB and human FAP (Figure 13A to 13C).
7.2 Binding to human 4-1BB expressing cells: analysis of binding to resting (naive) and activated human peripheral mononuclear blood mononuclear cells (PBMCs)
Human PBMCs were isolated from buffy coat of healthy donors obtained from the blood donation center Zurich (Blutspendezentrum Schlieren, Switzerland) by Ficoll density gradient centrifugation. 50 mL Falcon-tubes were supplied with 15 mL Histopaque 1077 (SIGMA life science, Cat.-No. 10771). The buffy coat was diluted 1 : 1 with sterile DPBS (GIBCO life technologies, Cat-No. 14190-136) and the Histopaque 1077 was overlaid with this cell suspension. Tubes were centrifuged 30 min 450 x g at room temperature, with low acceleration and no break. PBMCs were harvested from the interphase and washed several times with DPBS. The isolated PBMCs were used in experiments either directly after isolation (for analysis of binding to resting (naive) human PBMCs), or following stimulation to provide for high expression human 4- IBB on the cell surface of T cells. For stimulation and induction of 4- IBB expression, PBMCs were resuspended to 1 x 106 cells/mL in RPMI 1640 (GIBCO life technologies, Cat-No. 42401-042) supplemented with 10% (v/v) fetal bovine serum (FBS, GIBCO life science, Cat.-No. 16000-044, Lot 941273, gamma irradiated mycoplasma free, heat inactivated 35 min 56 °C), 2 mM L-alanyl-L-glutamine (GlutaMAX-I, GIBCO life technologie, Cat.-No. 35050-038), 1% (v/v) MEM-Non essential Aminoacid Solution (lOOx, SIGMA life science, Cat.-No M7145), 1 mM Sodium-Pyruvate (100 mM stock, SIGMA-Aldrich Cat.-No. S8636), 50 uM beta-Mercaptoethanol, 2 μg/mL PHA-L (SIGMA life science, Cat.-No. L2769) and 200 U/mL Proleukin (Novartis Pharma Schweiz AG, CHCLB-P-476-700- 10340, Lot
AA4493BAL). Cells were seeded to 6-well tissue culture plates and incubated for 4 days at 37°C in a 5% C02 atmosphere. After 4 days cells were harvested, counted and resuspended in RPMI 1640 supplied with 10% (v/v) FBS, 2 mM L-alanyl-L-glutamine, 1%> (v/v) MEM-non-essential aminoacid solution 1 mM Sodium-Pyruvate, 50 μΜ beta-Mercaptoethanol, and 200 U/mL Proleukin to 106 cells/mL. Cells were seeded to 6-well tissue culture plates, which had been pre-
coated overnight with DPBS containing 10 μg/mL LEAF purified anti- human CD3 mouse IgG2a (clone OKT3, BioLegend, Cat.-No. 317315) and 2 μg/mL functional grade purified anti-human CD28 mouse IgGl (clone 28.2, BioLegend, Cat.-No. 16-0289-85). Cells were reactivated for 24 hours at 37°C and 5% C02. For the assays, naive or activated human PBMCs were resuspended to lxl 06 cells/mL in 4
°C DPBS, and 100 were seeded to wells of 96-well round bottomed suspension cell plates.
Plates were centrifuged, and supernatants were removed. If dead cells were not stained by using DAPI cells were resupended in 100 μΕΛνεΙΙ DPBS containing 1 : 1000 diluted LIVE/DEAD Fixable Aqua Dead Cell Stain Kit (Life Technologie Molecular Probes, Cat.-No. L34957), incubated for 30 min at 4°C and washed once with DPBS.
Cells were subsequently resuspended in 50 μΕΛνεΙΙ FACS buffer (DPBS containing 2% (v/v) FBS, 50 mM EDTA, 7.5 mM Sodium- Azide) containing different concentrations of 4-1BB- binding human IgGl P329G LALA, or trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules and incubated for 2 h at 4 °C. Cells were then washed three times with DPBS and resuspended in 50 μΕΛνεΙΙ FACS buffer containing 2.5 μg/mL R-Phycoerythrin AffiniPure Anti- Human IgG F(ab')2 fragment specific goat F(ab')2 fragment (Jackson immunoresearch, Cat.-No. 109-116-097) and incubated for 30 min at 4°C. If dead cells were not stained with LIVE/DEAD Fixable Aqua Dead Cell Stain Kit, cells were resuspended in 100 μΕΛνεΙΙ FACS buffer containing 0.1 μg/mL DAPI (Santa Cruz Biotec, Cat.-No. Sc-3598). If dead cells were stained with LIVE/DEAD Fixable Aqua Dead Cell Stain Kit, they were fixed for 10 min in 1 % PFA and then resuspended in 100 μΐ, FACS buffer. Cells were acquired using three-laser CantoII or five- laser LSRFortessa (BD) and analyzed using DIVA-software.
Table 28. EC50 values for binding to human 4- IBB expressed on human activated T cells
To show that trimerization of anti-4-lBB Fab via huCMP-fusion and targeting to FAP by fusion of trimeric anti-FAP (28H1) scFv did not influence the binding to human 4- IBB, binding to freshly- isolated PBMCs and activated human PBMCs was analysed (Figure 14). Because the molecules do not contain an Fc-fragment, an PE-conjugated anti-human IgG F(ab")2 fragment specific secondary antibody was used for detection. The FAP -targeted scFv- huCMP anti-4-lBB
trimerized clones 25 G7 and 12B3 were shown not bind to freshly- isolated human PBMCs, but did bind to 4-lBB-expressing activated human CD8+ and CD4+ T cells, as expected.
Engineering of the anti-human 4-1BB binding clones 25G7 and 12B3 to the FAP scFv- targeted huCMP trimerized 3+3 format was therefore shown not change their ability to bind to 4- lBB-expressing human T cells. Clone 12B3 was found to bind more strongly to 4- IBB than 25G7.
7.3 Binding to human FAP-expressing and FAP-negative tumor cells
Binding of the trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules to FAP was analysed using NIH/3T3-huFAP clone 39 cell line (described in Example 5.1). 2 x 105 of the human FAP-expressing tumor cells were added to wells of round-bottomed suspension cell 96-well plates (Greiner Bio-One, cellstar, Cat.-No. 650185). Cells were washed once with 200 μΐ. DPBS and resuspended in 100 μΕ/well 4 °C DPBS buffer containing 1 :5000 diluted Fixable Viability Dye eFluor 450 (eBioscience, Cat. No. 65 0863 18), and the cells then were incubated for 30 minutes at 4°C. Cells were subsequently washed once with 200 μΐ, 4 °C DPBS buffer, resuspended in 50 μΙ,ΛνεΙΙ of 4 °C cold FACS buffer containing different titrated concentrations of 12B3 x FAP 3+3, 25G7 x FAP 3+3, DP47 x FAP 3+3, 25G7 hulgGI P329G LALA or 12B3 hulgGI P329G LALA, followed by incubation for 1 hour at 4°C. After washing five times with with 200 μΐ, DPBS/well, cells were stained with 50 μΕ/well of 4 °C cold FACS buffer containing 2.5 μg/mL R-Phycoerythrin AffiniPure Anti-Human IgG F(ab')2 fragment specific goat F(ab')2 fragment for 30 minutes at 4 °C. Cells were washed twice with 200 μΐ, 4 °C FACS buffer, and resuspended in 50 μΕΛνεΙΙ DPBS containing 1 % Formaldehyde and stored overnight at 4 °C. The next day cells were resuspended in 100 μΐ, FACS-buffer and acquired using 5-laser LSR-Fortessa (BD Bioscience with DIVA software).
As shown in Figure 15 in the FAP -targeted molecules were found to bind efficiently to human FAP-expressing cells, but the DP47-untargeted or parental hulgGI P293G LALA 25G7 and 12B3 clones did not bind to the human FAP-expressing cells. Therefore, trimeric, bispecific anti-4-lBB, anti-FAP antigen binding molecules are efficiently targeted to FAP-expressing cells.
Example 8
Biological Activity of trimeric, bispecific antigen binding molecules targeting 4-1BB and
FAP
8.1 HeLa cells expressing human 4-1BB and reporter gene NF- B-luciferase
NF-KB-luciferase human-4-lBB HeLa clone 26 cells (described in WO 2016156291 Al) were harvested and resuspended in DMEM medium supplied with 10 % (v/v) FBS and 1 % (v/v)
GlutaMAX-I to a concentration of 0.2 x 106 cells/ml. 100 μΐ (2 x 104 cells) of this cell suspension were transferred to wells of a sterile white 96-well flat bottomed tissue culture plate with lid (Greiner Bio-One, Cat. No. 655083), and incubated at 37 °C and 5 % C02 overnight. The next day 50 of medium containing titrated 12B3 or 25G7 FAP 3+3 constructs, untargeted huCMP 12B3 or 25G7 constructs, 25G7 or 12B3 hulgGI P329G LALA parental antibodies, or DP47- untargeted hulgGI P329G LALA isotype control were added to the wells. FAP-expressing NIH/3T3-huFAP clone 39 cells were subsequently resuspended in DMEM medium
supplemented with 10 % (v/v) FBS and 1 % (v/v) GlutaMAX-I to a concentration of 2 x 106 cells/ml, 50 of the cell suspension of FAP-expressing tumor cells was added to each well (1 x 105 cells/well), and plates were incubated for 6 hours at 37 °C and at 5 % C02 in an incubator. Cells were washed three times with 200 μΕΛνεΙΙ DPBS. 40 μΐ freshly prepared Reporter Lysis Buffer (Promega, Cat-No: E3971) were added to each well, and the plates were stored overnight at -20 °C. The next day, the frozen cell plates and Detection Buffer (Luciferase 1000 Assay System, Promega, Cat. No. E4550) were thawed at room temperature. 100 μΐ, of detection buffer were added to each well, and luciferase activity was measured as soon as possible, using a SpectraMax M5/M5e microplate reader and a SoftMax Pro Software (Molecular Devices).
As shown in Figure 16B, FAP -targeted 25G7 or 12B3 3+3 constructs triggered activation of the NFkB signaling pathway in the reporter cell line in the presence of FAP-expressing tumor cells. By contrast, untargeted huCMP 12B3 or 25G7 constructs, 25G7 or 12B3 hulgGI P329G LALA parental antibodies and DP47-untargeted hulgGI P329G LALA isotype control failed to trigger an effect at any of the tested concentrations.
The activation of NF-κΒ signalling was found to be strictly dependent on the expression of FAP at the cell surface of tumor cells, as no NF-κΒ activation could be detected in the presence of FAP -negative tumor cells (data not shown).
Citations:
Aggarwal B.B. (2003), Signalling pathways of the TNF superfamily: a double-edged sword. Nat. Rev. Immunol. 3(9),745-56.
Banner D. et al (1993), Crystal structure of the soluble human 55 kd TNF receptor-human TNF beta complex: implications for TNF receptor activation. Cell 73, 431-445.
Beck K., Gambee J., Bohan C, Bachinger H.P. (1996), The C-terminal domain of cartilage matrix protein assembles into a triple-stranded a-helical coiled-coil structure. J. Mol. Biol. 256, 909-923.
Bodmer J., Schneider P. and Tschopp, J. (2002), The molecular architecture of the TNF superfamily. Trends in Biochemical Sciences 27(1), 19-26.
Broil, K., Richter, G., Pauly, S., Hofstaedter, F., and Schwarz, H. (2001). CD137 expression in tumor vessel walls. High correlation with malignant tumors. Am J Clin Pathol 115, 543-549.
Buechele, C, Baessler, T., Schmiedel, B.J., Schumacher, C.E., Grosse-Hovest, L., Rittig, K., and Salih, H.R. (2012). 4-1BB ligand modulates direct and Rituximab-induced NK-cell reactivity in chronic lymphocytic leukemia. Eur J Immunol 42, 737-748.
Choi, B.K., Kim, Y.H., Kwon, P.M., Lee, S.C., Kang, S.W., Kim, M.S., Lee, M.J., and Kwon, B.S. (2009). 4-1BB functions as a survival factor in dendritic cells. J Immunol 182, 4107-4115.
Cuadros, C, Dominguez, A.L., Lollini, P.L., Croft, M., Mittler, R.S., Borgstrom, P., and
Lustgarten, J. (2005). Vaccination with dendritic cells pulsed with apoptotic tumors in combination with anti-OX40 and anti-4-lBB monoclonal antibodies induces T cell-mediated protective immunity in Her-2/neu transgenic mice. Int J Cancer 116, 934-943.
Curran, M.A., Kim, M., Montalvo, W., Al-Shamkhani, A., and Allison, J.P. (2011). Combination CTLA-4 blockade and 4- IBB activation enhances tumor rejection by increasing T-cell infiltration, proliferation, and cytokine production. PLoS One 6, el9499. Diehl, L., van Mierlo, G.J., den Boer, A.T., van der Voort, E., Fransen, M., van Bostelen, L., Krimpenfort, P., Melief, C.J., Mittler, R., Toes, R.E., and Offringa, R. (2002). In vivo triggering through 4- IBB enables Th- independent priming of CTL in the presence of an intact CD28 costimulatory pathway. J Immunol 168, 3755-3762.
Dubrot, J., Milheiro, F., Alfaro, C, Palazon, A., Martinez-Forero, I., Perez-Gracia, J.L., Morales- Kastresana, A., Romero -Trevejo, J.L., Ochoa, M.C., Hervas-Stubbs, S., et al. (2010). Treatment with anti-CD 137 mAbs causes intense accumulations of liver T cells without selective antitumor
immunothera eutic effects in this organ. Cancer Immunol Immunother 59, 1223-1233.
Futagawa, T., Akiba, H., Kodama, T., Takeda, K., Hosoda, Y., Yagita, H., and Okumura, K. (2002). Expression and function of 4-1BB and 4-1BB ligand on murine dendritic cells. Int Immunol 14, 275-286. Guo, Z., Cheng, D., Xia, Z., Luan, M., Wu, L., Wang, G., and Zhang, S. (2013). Combined TIM- 3 blockade and CD 137 activation affords the long-term protection in a murine model of ovarian cancer. J Transl Med 11, 215.
Heinisch, I.V., Daigle, I., Knopfli, B., and Simon, H.U. (2000). CD137 activation abrogates granulocyte-macrophage colony-stimulating factor-mediated anti-apoptosis in neutrophils. Eur J Immunol 30, 3441-3446.
Ju, S.A., Cheon, S.H., Park, S.M., Tarn, N.Q., Kim, Y.M., An, W.G., and Kim, B.S. (2008).
Eradication of established renal cell carcinoma by a combination of 5-fluorouracil and anti-4- 1BB monoclonal antibody in mice. Int J Cancer 122, 2784-2790.
Kienzle, G., and von Kempis, J. (2000). CD137 (ILA/4-1BB), expressed by primary human monocytes, induces monocyte activation and apoptosis of B lymphocytes. Int Immunol 12, 73-82.
Kim, D.H., Chang, W.S., Lee, Y.S., Lee, K.A., Kim, Y.K., Kwon, B.S., and Kang, C.Y. (2008). 4- IBB engagement costimulates NKT cell activation and exacerbates NKT cell ligand- induced airway hyperresponsiveness and inflammation. J Immunol 180, 2062-2068.
Kim, Y.H., Choi, B.K., Oh, H.S., Kang, W.J., Mittler, R.S., and Kwon, B.S. (2009). Mechanisms involved in synergistic anticancer effects of anti-4-lBB and cyclophosphamide therapy. Mol Cancer Ther 8, 469-478.
Kwon, B.S., and Weissman, S.M. (1989). cDNA sequences of two inducible T-cell genes. Proc Natl Acad Sci U S A 86, 1963-1967.
Lee, FL, Park, H.J., Sohn, H.J., Kim, J.M., and Kim, S.J. (2011). Combinatorial therapy for liver metastatic colon cancer: dendritic cell vaccine and low-dose agonistic anti-4-lBB antibody co- stimulatory signal. J Surg Res 169, e43-50.
Li, F., and Ravetch, J.V. (2011). Inhibitory Fcgamma receptor engagement drives adjuvant and anti-tumor activities of agonistic CD40 antibodies. Science 333, 1030-1034.
Lin, W., Voskens, C.J., Zhang, X., Schindler, D.G., Wood, A., Burch, E., Wei, Y., Chen, L., Tian, G., Tamada, K., et al. (2008). Fc-dependent expression of CD 137 on human NK cells:
insights into "agonistic" effects of anti-CD137 monoclonal antibodies. Blood 112, 699-707.
Melero, I., Johnston, J.V., Shufford, W.W., Mittler, R.S., and Chen, L. (1998). NK1.1 cells express 4- IBB (CDwl37) costimulatory molecule and are required for tumor immunity elicited by anti-4-lBB monoclonal antibodies. Cell Immunol 190, 167-172.
Melero, I., Shuford, W.W., Newby, S.A., Aruffo, A., Ledbetter, J.A., Hellstrom, K.E., Mittler, R.S., and Chen, L. (1997). Monoclonal antibodies against the 4-1BB T-cell activation molecule eradicate established tumors. Nat Med 3, 682-685.
Merchant, A.M., Zhu, Z., Yuan, J.Q., Goddard, A., Adams, C.W., Presta, L.G., and Carter, P. (1998). An efficient route to human bispecific IgG. Nat Biotechnol 16, 677-681.
Morales-Kastresana, A., Sanmamed, M.F., Rodriguez, I., Palazon, A., Martinez-Forero, I., Labiano, S., Hervas-Stubbs, S., Sangro, B., Ochoa, C, Rouzaut, A., et al. (2013). Combined immunostimulatory monoclonal antibodies extend survival in an aggressive transgenic
hepatocellular carcinoma mouse model. Clin Cancer Res 19, 6151-6162.
Murillo, O., Dubrot, J., Palazon, A., Arina, A., Azpilikueta, A., Alfaro, C, Solano, S., Ochoa, M.C., Berasain, C, Gabari, I., et al. (2009). In vivo depletion of DC impairs the anti-tumor effect of agonistic anti-CD137 mAb. Eur J Immunol 39, 2424-2436.
Narazaki, H., Zhu, Y., Luo, L., Zhu, G., and Chen, L. (2010). CD137 agonist antibody prevents cancer recurrence: contribution of CD 137 on both hematopoietic and nonhematopoietic cells. Blood 1 15, 1941-1948.
Nishimoto, H., Lee, S.W., Hong, H., Potter, K.G., Maeda-Yamamoto, M., Kinoshita, T.,
Kawakami, Y., Mittler, R.S., Kwon, B.S., Ware, C.F., et al. (2005). Costimulation of mast cells by 4- IBB, a member of the tumor necrosis factor receptor superfamily, with the high-affinity IgE receptor. Blood 106, 4241-4248.
Olofsson, P.S., Soderstrom, L.A., Wagsater, D., Sheikine, Y., Ocaya, P., Lang, F., Rabu, C, Chen, L., Rudling, M., Aukrust, P., et al. (2008). CD137 is expressed in human atherosclerosis and promotes development of plaque inflammation in hypercholesterolemic mice. Circulation 117, 1292-1301.
Palazon, A., Teijeira, A., Martinez-Forero, I., Hervas-Stubbs, S., Roncal, C, Penuelas, I., Dubrot, J., Morales-Kastresana, A., Perez-Gracia, J.L., Ochoa, M.C., et al. (2011). Agonist anti-CD137 mAb act on tumor endothelial cells to enhance recruitment of activated T lymphocytes. Cancer Res 71, 801-811.
Schwarz, H., Valbracht, J., Tuckwell, J., von Kempis, J., and Lotz, M. (1995). ILA, the human 4- 1BB homologue, is inducible in lymphoid and other cell lineages. Blood 85, 1043-1052.
Shao, Z., and Schwarz, H. (2011). CD137 ligand, a member of the tumor necrosis factor family, regulates immune responses via reverse signal transduction. J Leukoc Biol 89, 21-29.
Shi, W., and Siemann, D.W. (2006). Augmented antitumor effects of radiation therapy by 4-lBB antibody (BMS-469492) treatment. Anticancer Res 26, 3445-3453. Simeone, E., and Ascierto, P.A. (2012). Immunomodulating antibodies in the treatment of metastatic melanoma: the experience with anti-CTLA-4, anti-CD 137, and anti-PDl . J
Immunotoxicol 9, 241-247.
Snell, L.M., Lin, G.H., McPherson, A.J., Moraes, T.J., and Watts, T.H. (2011). T-cell intrinsic effects of GITR and 4-lBB during viral infection and cancer immunotherapy. Immunol Rev 244, 197-217.
Stagg, J., Loi, S., Divisekera, U., Ngiow, S.F., Duret, H., Yagita, H., Teng, M.W., and Smyth, M.J. (2011). Anti-ErbB-2 mAb therapy requires type I and II interferons and synergizes with anti-PD-1 or anti-CD137 mAb therapy. Proc Natl Acad Sci U S A 108, 7142-7147.
Teng, M.W., Sharkey, J., McLaughlin, N.M., Exley, M.A., and Smyth, M.J. (2009). CDld-based combination therapy eradicates established tumors in mice. J Immunol 183, 1911-1920. von Kempis, J., Schwarz, FL, and Lotz, M. (1997). Differentiation-dependent and stimulus- specific expression of ILA, the human 4-lBB-homologue, in cells of mesenchymal origin.
Osteoarthritis Cartilage 5, 394-406.
Watts, T.H. (2005). TNF/TNFR family members in costimulation of T cell responses. Annu. Rev. Immunol. 23, 23-68
Wei, H., Zhao, L., Li, W., Fan, K., Qian, W., Hou, S., Wang, H., Dai, M., Hellstrom, I.,
Hellstrom, K.E., and Guo, Y. (2013). Combinatorial PD-1 blockade and CD137 activation has therapeutic efficacy in murine cancer models and synergizes with cisplatin. PLoS One 8, e84927.
Weinberg A.D., Evans D.E., Thalhofer C, Shi T., and Prell R.A. (2004). The generation of T cell memory: a review describing the molecular and cellular events following OX40 (CD 134) engagement. J. Leukoc. Biol. 75, 962-972.
Wilcox, R.A., Chapoval, A.I., Gorski, K.S., Otsuji, M., Shin, T., Flies, D.B., Tamada, K., Mittler, R.S., Tsuchiya, H., Pardoll, D.M., and Chen, L. (2002). Cutting edge: Expression of functional CD 137 receptor by dendritic cells. J Immunol 168, 4262-4267. Wilcox, R.A., Tamada, K., Flies, D.B., Zhu, G., Chapoval, A.I., Blazar, B.R., Kast, W.M., and Chen, L. (2004). Ligation of CD 137 receptor prevents and reverses established anergy of CD8+
cytolytic T lymphocytes in vivo. Blood 103, 177-184.
Wyzgol A., Miiller N., Fick A., Munkel S., Grigoleit G.U., Pfizenmaier K., Wajant H. (2009), Trimer Stabilization, Oligomerization, and Antibody-mediated cell surface immobilization improve the activity of soluble trimers of CD27L, CD40L, 41BBL and Glucocorticoid-induced TNF receptor ligand. J. Immunol. 183, 1851-1861.
Zhang, X., Voskens, C.J., Sallin, M., Maniar, A., Monies, C.L., Zhang, Y., Lin, W., Li, G., Burch, E., Tan, M., et al. (2010). CD137 promotes proliferation and survival of human B cells. J Immunol 184, 787-795.
Claims
1. A trimeric antigen binding molecule comprising three fusion polypeptides, each of the three fusion polypeptides comprising
(a) a moiety capable of specific binding to a costimulatory TNF receptor family member,
(b) a trimerization domain derived from human cartilage matrix protein (huCMP) of amino acid sequence of SEQ ID NO: l, and
(c) a moiety capable of specific binding to a target cell antigen.
2. The trimeric antigen binding molecule of claim 1, wherein the trimerization domain comprises an amino acid sequence having at least 95% identity to SEQ ID NO:2.
3. The trimeric antigen binding molecule of claim 1 or claim 2, wherein the trimerization domain comprises the amino acid sequence of SEQ ID NO:2.
4. The trimeric antigen binding molecule of any one of claims 1 to 4, wherein the costimulatory TNF receptor family member is selected from OX40 and 4- IBB.
5. The trimeric antigen binding molecule of any one of claims 1 to 4, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:3.
6. The trimeric antigen binding molecule of any one of claims 1 to 5, comprising a moiety capable of specific binding to OX40, wherein the moiety comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:4 and SEQ ID NO:5,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:6 and SEQ ID NO:7, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13 and SEQ ID NO: 14,
and a VL comprising
(iv) a CDR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16 and SEQ ID NO: 17,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 18, SEQ ID NO: 19 and SEQ ID NO:20, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25 and SEQ ID NO:26.
7. The trimeric antigen binding molecule of any one of claims 1 to 6, comprising a moiety capable of specific binding to OX40, wherein the moiety capable of specific binding to OX40 comprises a VH comprising an amino acid sequence that is at least about 95%, 96%>, 97%, 98%>, 99%o or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:27, SEQ ID NO: 29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37 and SEQ ID NO:39 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%o, 98%o, 99%o or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:28, SEQ ID NO: 30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38 and SEQ ID NO:40.
8. The trimeric antigen binding molecule of any one of claims 1 to 7, wherein the moiety capable of specific binding to OX40 comprises
(i) a VH comprising the amino acid sequence of SEQ ID NO:27 and a VL comprising the amino acid sequence of SEQ ID NO:28,
(ii) a VH comprising the amino acid sequence of SEQ ID NO:29 and a VL comprising the amino acid sequence of SEQ ID NO:30,
(iii) a VH comprising the amino acid sequence of SEQ ID NO:31 and a VL comprising the amino acid sequence of SEQ ID NO:32,
(iv) a VH comprising the amino acid sequence of SEQ ID NO:33 and a VL comprising the amino acid sequence of SEQ ID NO:34,
(v) a VH comprising the amino acid sequence of SEQ ID NO:35 and a VL comprising the amino acid sequence of SEQ ID NO:36,
(vi) a VH comprising the amino acid sequence of SEQ ID NO:37 and a VL comprising the amino acid sequence of SEQ ID NO:38, or
(vii) a VH comprising the amino acid sequence of SEQ ID NO:39 and a VL comprising the amino acid sequence of SEQ ID NO:40.
9. The trimeric antigen binding molecule of any one of claims 1 to 4, wherein the moiety capable of specific binding to a costimulatory TNF receptor family member binds to a polypeptide comprising the amino acid sequence of SEQ ID NO:41.
10. The trimeric antigen binding molecule of any one of claims 1 to 4 or 9, comprising a moiety capable of specific binding to 4- IBB, wherein the moiety comprises a VH comprising (i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:42 and SEQ ID NO:43,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:44 and SEQ ID NO:45, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49 and SEQ ID NO:50,
and a VL comprising
(iv) a CDR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NO:51 and SEQ ID NO:52,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:53 and SEQ ID NO:54, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58 and SEQ ID NO:59.
11. The trimeric antigen binding molecule of any one of claims 1 to 4, 9 or 10, comprising a moiety capable of specific binding to 4- IBB, wherein the moiety capable of specific binding to 4-1BB comprises a VH comprising an amino acid sequence that is at least about 95%, 96%,
97%), 98%o, 99%) or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, SEQ ID NO:66 and SEQ ID NO:68 and a VL comprising an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100%) identical to an amino acid sequence selected from the group consisting of SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:65, SEQ ID NO:67 and SEQ ID NO:69.
12. The trimeric antigen binding molecule of any one of claims 1 to 4 or 9 to 11, wherein the moiety capable of specific binding to 4-1BB comprises
(i) a VH comprising the amino acid sequence of SEQ ID NO: 60 and a VL comprising the amino acid sequence of SEQ ID NO:61,
(ii) a VH comprising the amino acid sequence of SEQ ID NO: 62 and a VL comprising the amino acid sequence of SEQ ID NO: 63,
(iii) a VH comprising the amino acid sequence of SEQ ID NO: 64 and a VL comprising the amino acid sequence of SEQ ID NO:65,
(iv) a VH comprising the amino acid sequence of SEQ ID NO: 66 and a VL comprising the amino acid sequence of SEQ ID NO:67, or
(v) a VH comprising the amino acid sequence of SEQ ID NO:68 and a VL comprising the amino acid sequence of SEQ ID NO:69.
13. The trimeric antigen binding molecule of any one of claims 1 to 12, wherein the target cell antigen is selected from the group consisting of Fibroblast Activation Protein (FAP), Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), Carcinoembryonic Antigen (CEA), CD 19, CD20 and CD33.
14. The trimeric antigen binding molecule of any one of claims 1 to 13, comprising a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to FAP comprises a VH comprising
(i) a CDR-H1 comprising the amino acid sequence selected from the group consisting of SEQ ID NO:70 and SEQ ID NO:76,
(ii) a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:71 and SEQ ID NO:77, and
(iii) a CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:72 and SEQ ID NO:78,
and a VL comprising
(iv) a CDR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NO:73 and SEQ ID NO:79,
(v) a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:74 and SEQ ID NO:80, and
(vi) a CDR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:75 and SEQ ID NO:81.
15. The trimeric antigen binding molecule of any one of claims 1 to 14, comprising a moiety capable of specific binding to FAP, wherein the moiety capable of specific binding to
FAP comprises a VH comprising an amino acid sequence that is at least about 95%, 96%>, 97%, 98%o, 99%o or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 82 and SEQ ID NO: 84, and a VL comprising an amino acid sequence that is at least about 95%o, 96%o, 97%, 98%>, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 83 and SEQ ID NO: 85.
16. A polynucleotide encoding the trimeric antigen binding molecule of any one of claims 1 to 15.
17. An expression vector comprising the polynucleotide of claim 16.
18. A host cell comprising the polynucleotide of claim 16 or the expression vector of claim
17.
19. A method of producing a trimeric antigen binding molecule, comprising culturing the host cell of claim 18 under conditions suitable for the expression of the trimeric antigen binding molecule, and isolating the trimeric antigen binding molecule.
20. A pharmaceutical composition comprising the trimeric antigen binding molecule of any one of claims 1 to 15 and at least one pharmaceutically acceptable excipient
21. The trimeric antigen binding molecule of claims 1 to 15for use as a medicament.
22. The trimeric antigen binding molecule of claims 1 to 15 for use
(i) in stimulating T cell response,
(ii) in supporting survival of activated T cells,
(iii) in the treatment of infections,
(iv) in the treatment of cancer,
(v) in delaying progression of cancer, or
(vi) in prolonging the survival of a patient suffering from cancer.
23. The trimeric antigen binding molecule of any one of claims 1 to 15, or the
pharmaceutical composition of claim 20 for use in the treatment of cancer.
24. Use of the trimeric antigen binding molecule of any one of claims 1 to 15, or the pharmaceutical composition of claim 20, in the manufacture of a medicament for the treatment of cancer.
25. A method of treating an individual having cancer comprising administering to the individual an effective amount of the trimeric antigen binding molecule of any one of claims 1 to 15, or the pharmaceutical composition of claim 20.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP17163619 | 2017-03-29 | ||
| EP17163619.4 | 2017-03-29 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018178074A1 true WO2018178074A1 (en) | 2018-10-04 |
Family
ID=58464257
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2018/057767 Ceased WO2018178074A1 (en) | 2017-03-29 | 2018-03-27 | Trimeric antigen binding molecules specific for a costimulatory tnf receptor |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2018178074A1 (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110452294A (en) * | 2019-08-06 | 2019-11-15 | 复旦大学 | Five kinds of hinge areas and its Chimeric antigen receptor and immunocyte |
| WO2021030680A1 (en) * | 2019-08-15 | 2021-02-18 | Regeneron Pharmaceuticals, Inc. | Multispecific antigen-binding molecules for cell targeting and uses thereof |
| WO2025113643A1 (en) | 2023-12-01 | 2025-06-05 | Gilead Sciences Inc. | Anti-fap-light fusion protein and use thereof |
Citations (41)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4186567A (en) | 1977-04-18 | 1980-02-05 | Hitachi Metals, Ltd. | Ornament utilizing rare earth-cobalt magnet |
| EP0404097A2 (en) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| WO2001049866A1 (en) | 1999-12-30 | 2001-07-12 | Apotech Research And Development Ltd. | Di- or oligomer of a dimer, trimer, quatromer or pentamer of recombinant fusion proteins |
| US6267958B1 (en) | 1995-07-27 | 2001-07-31 | Genentech, Inc. | Protein formulation |
| WO2002020565A2 (en) | 2000-09-08 | 2002-03-14 | Universität Zürich | Collections of repeat proteins comprising repeat modules |
| US6420548B1 (en) | 1999-10-04 | 2002-07-16 | Medicago Inc. | Method for regulating transcription of foreign genes |
| US6818418B1 (en) | 1998-12-10 | 2004-11-16 | Compound Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| WO2005056764A2 (en) | 2003-12-05 | 2005-06-23 | Compound Therapeutics, Inc. | Inhibitors of type 2 vascular endothelial growth factor receptors |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| EP1641818A1 (en) | 2003-07-04 | 2006-04-05 | Affibody AB | Polypeptides having binding affinity for her2 |
| WO2006044908A2 (en) | 2004-10-20 | 2006-04-27 | Genentech, Inc. | Antibody formulation in histidine-acetate buffer |
| US20060104968A1 (en) | 2003-03-05 | 2006-05-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| US7166697B1 (en) | 1998-03-06 | 2007-01-23 | Diatech Pty. Ltd. | V-like domain binding molecules |
| WO2007014744A2 (en) | 2005-08-03 | 2007-02-08 | Universität Stuttgart | C-terminal tnf-family ligand (ctl) -prodrug |
| US7250297B1 (en) | 1997-09-26 | 2007-07-31 | Pieris Ag | Anticalins |
| US20070224633A1 (en) | 2003-08-25 | 2007-09-27 | Pieris Ag | Muteins of Tear Lipocalin |
| US20080139791A1 (en) | 1998-12-10 | 2008-06-12 | Adnexus Therapeutics, Inc. | Pharmaceutically acceptable Fn3 Polypeptides for human treatments |
| WO2008098796A1 (en) | 2007-02-16 | 2008-08-21 | Nascacell Technologies Ag | Polypeptide comprising a knottin protein moiety |
| WO2009000538A1 (en) | 2007-06-26 | 2008-12-31 | Apogenix Gmbh | Trimeric death ligands with enhanced activity (tenascin) |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| WO2012020006A2 (en) | 2010-08-13 | 2012-02-16 | Roche Glycart Ag | Anti-fap antibodies and methods of use |
| WO2012130831A1 (en) | 2011-03-29 | 2012-10-04 | Roche Glycart Ag | Antibody fc variants |
| WO2014180754A1 (en) | 2013-05-07 | 2014-11-13 | F. Hoffmann-La Roche Ag | Trimeric antigen binding molecules |
| WO2015183902A1 (en) | 2014-05-29 | 2015-12-03 | Medimmune, Llc | Ox40l fusion proteins and uses thereof |
| WO2016156291A1 (en) | 2015-03-31 | 2016-10-06 | F. Hoffmann-La Roche Ag | Antigen binding molecules comprising a trimeric tnf family ligand |
| WO2017025610A1 (en) | 2015-08-12 | 2017-02-16 | Medimmune Limited | Gitrl fusion proteins and uses thereof |
-
2018
- 2018-03-27 WO PCT/EP2018/057767 patent/WO2018178074A1/en not_active Ceased
Patent Citations (45)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4186567A (en) | 1977-04-18 | 1980-02-05 | Hitachi Metals, Ltd. | Ornament utilizing rare earth-cobalt magnet |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| EP0404097A2 (en) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US6417429B1 (en) | 1989-10-27 | 2002-07-09 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5821333A (en) | 1995-03-01 | 1998-10-13 | Genetech, Inc. | Method for making heteromultimeric polypeptides |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US7695936B2 (en) | 1995-03-01 | 2010-04-13 | Genentech, Inc. | Knobs and holes heteromeric polypeptides |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6267958B1 (en) | 1995-07-27 | 2001-07-31 | Genentech, Inc. | Protein formulation |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| US7250297B1 (en) | 1997-09-26 | 2007-07-31 | Pieris Ag | Anticalins |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| US7166697B1 (en) | 1998-03-06 | 2007-01-23 | Diatech Pty. Ltd. | V-like domain binding molecules |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US6818418B1 (en) | 1998-12-10 | 2004-11-16 | Compound Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| US20080139791A1 (en) | 1998-12-10 | 2008-06-12 | Adnexus Therapeutics, Inc. | Pharmaceutically acceptable Fn3 Polypeptides for human treatments |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| US6420548B1 (en) | 1999-10-04 | 2002-07-16 | Medicago Inc. | Method for regulating transcription of foreign genes |
| WO2001049866A1 (en) | 1999-12-30 | 2001-07-12 | Apotech Research And Development Ltd. | Di- or oligomer of a dimer, trimer, quatromer or pentamer of recombinant fusion proteins |
| WO2002020565A2 (en) | 2000-09-08 | 2002-03-14 | Universität Zürich | Collections of repeat proteins comprising repeat modules |
| US20040132028A1 (en) | 2000-09-08 | 2004-07-08 | Stumpp Michael Tobias | Collection of repeat proteins comprising repeat modules |
| US20060104968A1 (en) | 2003-03-05 | 2006-05-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases |
| EP1641818A1 (en) | 2003-07-04 | 2006-04-05 | Affibody AB | Polypeptides having binding affinity for her2 |
| US20070224633A1 (en) | 2003-08-25 | 2007-09-27 | Pieris Ag | Muteins of Tear Lipocalin |
| WO2005056764A2 (en) | 2003-12-05 | 2005-06-23 | Compound Therapeutics, Inc. | Inhibitors of type 2 vascular endothelial growth factor receptors |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| WO2006044908A2 (en) | 2004-10-20 | 2006-04-27 | Genentech, Inc. | Antibody formulation in histidine-acetate buffer |
| WO2007014744A2 (en) | 2005-08-03 | 2007-02-08 | Universität Stuttgart | C-terminal tnf-family ligand (ctl) -prodrug |
| WO2008098796A1 (en) | 2007-02-16 | 2008-08-21 | Nascacell Technologies Ag | Polypeptide comprising a knottin protein moiety |
| WO2009000538A1 (en) | 2007-06-26 | 2008-12-31 | Apogenix Gmbh | Trimeric death ligands with enhanced activity (tenascin) |
| WO2012020006A2 (en) | 2010-08-13 | 2012-02-16 | Roche Glycart Ag | Anti-fap antibodies and methods of use |
| WO2012130831A1 (en) | 2011-03-29 | 2012-10-04 | Roche Glycart Ag | Antibody fc variants |
| WO2014180754A1 (en) | 2013-05-07 | 2014-11-13 | F. Hoffmann-La Roche Ag | Trimeric antigen binding molecules |
| WO2015183902A1 (en) | 2014-05-29 | 2015-12-03 | Medimmune, Llc | Ox40l fusion proteins and uses thereof |
| WO2016156291A1 (en) | 2015-03-31 | 2016-10-06 | F. Hoffmann-La Roche Ag | Antigen binding molecules comprising a trimeric tnf family ligand |
| WO2017025610A1 (en) | 2015-08-12 | 2017-02-16 | Medimmune Limited | Gitrl fusion proteins and uses thereof |
Non-Patent Citations (175)
| Title |
|---|
| "Monoclonal Antibody Production Techniques and Applications", 1987, MARCEL DEKKER, INC., pages: 51 - 63 |
| "NCBI", Database accession no. NP _004451.2 |
| "NCBI", Database accession no. NP _032012.1 |
| "Remington's Pharmaceutical Sciences", 1990, MACK PRINTING COMPANY |
| "UniProt", Database accession no. P06731 |
| "UniProt", Database accession no. P97321 |
| "UniProt", Database accession no. Q12884 |
| A. D. WEINBERG ET AL., J. LEUKOC. BIOL., vol. 75, no. 6, 2004, pages 962 - 972 |
| AGGARWAL B.B.: "Signalling pathways of the TNF superfamily: a double-edged sword", NAT. REV. IMMUNOL., vol. 3, no. 9, 2003, pages 745 - 56 |
| ALMAGRO; FRANSSON, FRONT BIOSCI, vol. 13, 2008, pages 1619 - 1633 |
| ALMAGRO; FRANSSON: "Front. Biosci.", vol. 13, 2008, pages: 1619 - 1633 |
| ARMOUR, K.L. ET AL., EUR. J. IMMUNOL., vol. 29, 1999, pages 2613 - 2624 |
| AUSUBEL ET AL.: "CURRENT PROTOCOLS IN MOLECULAR BIOLOGY", 1989, GREENE PUBLISHING ASSOCIATES AND WILEY INTERSCIENCE |
| BANNER D. ET AL.: "Crystal structure of the soluble human 55 kd TNF receptor-human TNF beta complex: implications for TNF receptor activation", CELL, vol. 73, 1993, pages 431 - 445 |
| BAUMANN R. ET AL., EUR. J. IMMUNOL., vol. 34, 2004, pages 2268 - 2275 |
| BECK ET AL., J. MOL. BIOL., vol. 256, 1996, pages 909 - 923 |
| BECK K.; GAMBEE J.; BOHAN C.; BACHINGER H.P.: "The C-terminal domain of cartilage matrix protein assembles into a triple-stranded a-helical coiled-coil structure", J. MOL. BIOL., vol. 256, 1996, pages 909 - 923 |
| BERINSTEIN N. L., J CLIN ONCOL., vol. 20, 2002, pages 2197 - 2207 |
| BIOCHIM BIOPHYS ACTA, vol. 1482, 2000, pages 337 - 350 |
| BODMER J.; SCHNEIDER P.; TSCHOPP, J.: "The molecular architecture of the TNF superfamily", TRENDS IN BIOCHEMICAL SCIENCES, vol. 27, no. 1, 2002, pages 19 - 26, XP004332356 |
| BOWIE, J. U. ET AL., SCIENCE, vol. 247, 1990, pages 1306 - 10 |
| BROIL, K.; RICHTER, G.; PAULY, S.; HOFSTAEDTER, F.; SCHWARZ, H.: "CD137 expression in tumor vessel walls. High correlation with malignant tumors", AM J CLIN PATHOL, vol. 115, 2001, pages 543 - 549, XP009028982 |
| BROLL K. ET AL., AM. J. CLIN. PATHOL., vol. 115, 2001, pages 543 - 549 |
| BUECHELE C. ET AL., EUR. J. IMMUNOL., vol. 42, 2012, pages 737 - 748 |
| BUECHELE, C ET AL: "4-1BB ligand modulates direct and Rituximab-induced NK-cell reactivity in chronic lymphocytic leukemia", EUR J IMMUNOL, vol. 42, 2012, pages 737 - 748 |
| CAPEL, P.J. ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34 |
| CARTER, J IMMUNOL METH, vol. 248, 2001, pages 7 - 15 |
| CARTER, J IMMUNOL METHODS, vol. 248, 2001, pages 7 - 15 |
| CHAU I. ET AL., J CLIN ONCOL., vol. 22, 2004, pages 1420 - 1429 |
| CHOI B. K. ET AL., J. IMMUNOL., vol. 182, 2009, pages 4107 - 4115 |
| CHOI, B.K ET AL: "4-1BB functions as a survival factor in dendritic cells", J IMMUNOL, vol. 182, 2009, pages 4107 - 4115 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| CROFT M. ET AL., IMMUNOLOGICAL REVIEWS, vol. 229, 2009, pages 173 - 191 |
| CUADROS, C ET AL: "Vaccination with dendritic cells pulsed with apoptotic tumors in combination with anti-OX40 and anti-4-1BB monoclonal antibodies induces T cell-mediated protective immunity in Her-2/neu transgenic mice", INT J CANCER, vol. 116, 2005, pages 934 - 943 |
| CUNNINGHAM; WELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| CURR OPIN CHEM BIOL, vol. 13, 2009, pages 245 - 255 |
| CURRAN, M.A.; KIM, M.; MONTALVO, W.; AL-SHAMKHANI, A.; ALLISON, J.P.: "Combination CTLA-4 blockade and 4-1BB activation enhances tumor rejection by increasing T-cell infiltration, proliferation, and cytokine production", PLOS ONE, vol. 6, 2011, pages e19499, XP055136232 |
| DALL'ACQUA ET AL., METHODS, vol. 36, 2005, pages 43 - 60 |
| DE HAAS, M. ET AL., J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 341 |
| DIEHL L. ET AL., J. IMMUNOL., vol. 168, 2002, pages 3755 - 3762 |
| DIEHL, L ET AL: "In vivo triggering through 4-1BB enables Th-independent priming of CTL in the presence of an intact CD28 costimulatory pathway", J IMMUNOL, vol. 168, 2002, pages 3755 - 3762, XP002238986 |
| DUBROT J. ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 59, 2010, pages 1223 - 1233 |
| DUBROT, J ET AL: "Treatment with anti-CD 137 mAbs causes intense accumulations of liver T cells without selective antitumor immunotherapeutic effects in this organ", CANCER IMMUNOL IMMUNOTHER, vol. 59, 2010, pages 1223 - 1233, XP019842192 |
| EXPERT OPIN. BIOL. THER., vol. 5, 2005, pages 783 - 797 |
| EXPERT OPINION ON INVESTIGATIONAL DRUGS, vol. 16, no. 6, June 2007 (2007-06-01), pages 909 - 917 |
| FINGL ET AL.: "The Pharmacological Basis of Therapeutics", 1975, pages: 1 |
| FLAMINI ET AL., CLIN CANCER RES, vol. 12, no. 23, 2006, pages 6985 - 6988 |
| FUTAGAWA T. ET AL., INT. IMMUNOL., vol. 14, 2002, pages 275 - 286 |
| FUTAGAWA, T.; AKIBA, H.; KODAMA, T.; TAKEDA, K.; HOSODA, Y.; YAGITA, H.; OKUMURA, K.: "Expression and function of 4-1BB and 4-1BB ligand on murine dendritic cells", INT IMMUNOL, vol. 14, 2002, pages 275 - 286, XP002486148 |
| GERNGROSS: "Nat Biotech", vol. 22, 2004, pages: 1409 - 1414 |
| GESSNER, J.E. ET AL., ANN. HEMATOL., vol. 76, 1998, pages 231 - 248 |
| GOLD; FREEDMAN, J EXP MED., vol. 121, 1965, pages 439 - 462 |
| GOLDENBERG D M., THE INTERNATIONAL JOURNAL OF BIOLOGICAL MARKERS, vol. 7, 1992, pages 183 - 188 |
| GRAHAM ET AL., J GEN VIROL, vol. 36, 1977, pages 59 |
| GRAMAGLIA ET AL., J. IMMUNOL., vol. 161, no. 12, 1998, pages 6510 - 6517 |
| GUO, Z ET AL: "Combined TIM-3 blockade and CD137 activation affords the long-term protection in a murine model of ovarian cancer", J TRANSL MED, vol. 11, 2013, pages 215, XP021164386 |
| HAMMARSTROM S., SEMIN CANCER BIOL., vol. 9, no. 2, 1999, pages 67 - 81 |
| HARBURY ET AL., SCIENCE, vol. 262, 1993, pages 1401 - 1407 |
| HARLOW; LANE: "Antibodies, a laboratory manual", 1988, COLD SPRING HARBOR LABORATORY |
| HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| HEELEY, ENDOCR RES, vol. 28, 2002, pages 217 - 229 |
| HEINISCH I.V. ET AL., EUR. J. IMMUNOL., vol. 30, 2000, pages 3441 - 3446 |
| HEINISCH, I.V.; DAIGLE, I.; KNOPFLI, B.; SIMON, H.U.: "CD137 activation abrogates granulocyte-macrophage colony-stimulating factor-mediated anti-apoptosis in neutrophils", EUR J IMMUNOL, vol. 30, 2000, pages 3441 - 3446 |
| HOLLINGER ET AL., PROC NATL ACAD SCI USA, vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOM ET AL.: "Methods in Molecular Biology", vol. 178, 2001, HUMAN PRESS, pages: 1 - 37 |
| HOUSTON, J.S., METHODS IN ENZYMOL., vol. 203, 1991, pages 46 - 96 |
| HUDSON ET AL., NAT MED, vol. 9, 2003, pages 129 - 134 |
| J. BIOL. CHEM, vol. 274, 1999, pages 24066 - 24073 |
| J. MOL. BIOL., vol. 332, 2003, pages 489 - 503 |
| J. MOL. BIOL., vol. 369, 2007, pages 1015 - 1028 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| JOURNAL OF IMMUNOLOGICAL METHODS, vol. 248, no. 1-2, 2001, pages 31 - 45 |
| JU, S.A.; CHEON, S.H.; PARK, S.M.; TAM, N.Q.; KIM, Y.M.; AN, W.G.; KIM, B.S.: "Eradication of established renal cell carcinoma by a combination of 5-fluorouracil and anti-4-1BB monoclonal antibody in mice", INT J CANCER, vol. 122, 2008, pages 2784 - 2790 |
| KABAT ET AL.: "Sequence of Proteins of Immunological Interest", 1983, U.S. DEPT. OF HEALTH AND HUMAN SERVICES |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1983, U.S. DEPT. OF HEALTH AND HUMAN SERVICES |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION |
| KASHMIRI ET AL., METHODS, vol. 36, 2005, pages 25 - 34 |
| KEMPIS J. ET AL., OSTEOARTHRITIS CARTILAGE, vol. 5, 1997, pages 394 - 406 |
| KEMPIS, J.; SCHWARZ, H.; LOTZ, M.: "Differentiation-dependent and stimulus-specific expression of ILA, the human 4-1BB-homologue, in cells of mesenchymal origin", OSTEOARTHRITIS CARTILAGE, vol. 5, 1997, pages 394 - 406, XP009005285 |
| KIENZLE G.; VON KEMPIS J., INT. IMMUNOL., vol. 12, 2000, pages 73 - 82 |
| KIENZLE, G.; VON KEMPIS, J.: "CD137 (ILA/4-1BB), expressed by primary human monocytes, induces monocyte activation and apoptosis of B lymphocytes", INT IMMUNOL, vol. 12, 2000, pages 73 - 82 |
| KIM D.H. ET AL., J. IMMUNOL., vol. 180, 2008, pages 2062 - 2068 |
| KIM, D.H.; CHANG, W.S.; LEE, Y.S.; LEE, K.A.; KIM, Y.K.; KWON, B.S.; KANG, C.Y.: "4-1BB engagement costimulates NKT cell activation and exacerbates NKT cell ligand-induced airway hyperresponsiveness and inflammation", J IMMUNOL, vol. 180, 2008, pages 2062 - 2068 |
| KIM, Y.H.; CHOI, B.K.; OH, H.S.; KANG, W.J.; MITTLER, R.S.; KWON, B.S.: "Mechanisms involved in synergistic anticancer effects of anti-4-IBB and cyclophosphamide therapy", MOL CANCER THER, vol. 8, 2009, pages 469 - 478 |
| KINDT ET AL.: "Kuby Immunology", 2007, W.H. FREEMAN AND CO., pages: 91 |
| KLIMKA ET AL., BR J CANCER, vol. 83, 2000, pages 252 - 260 |
| KWON Y.H.; WEISSMAN S.M., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 1963 - 1967 |
| KWON, B.S.; WEISSMAN, S.M.: "cDNA sequences of two inducible T-cell genes", PROC NATL ACAD SCI U S A, vol. 86, 1989, pages 1963 - 1967 |
| LEE, H.; PARK, H.J.; SOHN, H.J.; KIM, J.M.; KIM, S.J.: "Combinatorial therapy for liver metastatic colon cancer: dendritic cell vaccine and low-dose agonistic anti-4-1BB antibody co-stimulatory signal", J SURG RES, vol. 169, 2011, pages e43 - 50, XP028376489 |
| LI ET AL., NAT BIOTECH, vol. 24, 2006, pages 210 - 215 |
| LI F.; RAVETCH J.V., SCIENCE, vol. 333, 2011, pages 1030 - 1034 |
| LI, F.; RAVETCH, J.V.: "Inhibitory Fcgamma receptor engagement drives adjuvant and anti-tumor activities of agonistic CD40 antibodies", SCIENCE, vol. 333, 2011, pages 1030 - 1034, XP002720021 |
| LILJEBLAD ET AL., GLYCO J, vol. 17, 2000, pages 323 - 329 |
| LIN W. ET AL., BLOOD, vol. 112, 2008, pages 699 - 707 |
| LIN, W ET AL: "Fc-dependent expression of CD137 on human NK cells: insights into ''agonistic'' effects of anti-CD137 monoclonal antibodies", BLOOD, vol. 112, 2008, pages 699 - 707, XP055037053 |
| LONBERG, CURR OPIN IMMUNOL, vol. 20, 2008, pages 450 - 459 |
| LONBERG, NAT BIOTECH, vol. 23, 2005, pages 1117 - 1125 |
| M. CROFT ET AL., IMMUNOL. REV., vol. 229, no. 1, 2009, pages 173 - 191 |
| MANIATIS ET AL.: "MOLECULAR CLONING: A LABORATORY MANUAL", 1989, COLD SPRING HARBOR LABORATORY |
| MARSHALL J., SEMIN ONCOL., vol. 30, no. 8, 2003, pages 30 - 6 |
| MATHER ET AL., ANNALS N.Y. ACAD SCI, vol. 383, 1982, pages 44 - 68 |
| MATHER, BIOL REPROD, vol. 23, 1980, pages 243 - 251 |
| MCCAFFERTY ET AL., NATURE, vol. 348, pages 552 - 554 |
| MELERO I. ET AL., NAT. MED., vol. 3, 1997, pages 682 - 685 |
| MELERO L ET AL., CELL IMMUNOL., vol. 190, 1998, pages 167 - 172 |
| MELERO, I ET AL: "Monoclonal antibodies against the 4-1BB T-cell activation molecule eradicate established tumors", NAT MED, vol. 3, 1997, pages 682 - 685, XP002104261 |
| MELERO, I.; JOHNSTON, J.V.; SHUFFORD, W.W.; MITTLER, R.S.; CHEN, L.: "NK1.1 cells express 4-1BB (CDwl37) costimulatory molecule and are required for tumor immunity elicited by anti-4-1BB monoclonal antibodies", CELL IMMUNOL, vol. 190, 1998, pages 167 - 172 |
| MERCHANT, A.M.; ZHU, Z.; YUAN, J.Q.; GODDARD, A.; ADAMS, C.W.; PRESTA, L.G.; CARTER, P.: "An efficient route to human bispecific IgG", NAT BIOTECHNOL, vol. 16, 1998, pages 677 - 681, XP002141015 |
| MORALES-KASTRESANA, A ET AL: "Combined immunostimulatory monoclonal antibodies extend survival in an aggressive transgenic hepatocellular carcinoma mouse model", CLIN CANCER RES, vol. 19, 2013, pages 6151 - 6162, XP055176308 |
| MORRIS: "Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS, article "Epitope Mapping Protocols" |
| MORRISON ET AL., PROC NATL ACAD SCI, vol. 81, 1984, pages 6851 - 6855 |
| MORRISON; OI, ADV IMMUNOL, vol. 44, 1988, pages 65 - 92 |
| MURILLO O. ET AL., EUR. J. IMMUNOL., vol. 39, 2009, pages 2424 - 2436 |
| MURILLO, O ET AL: "In vivo depletion of DC impairs the anti-tumor effect of agonistic anti-CD137 mAb", EUR J IMMUNOL, vol. 39, 2009, pages 2424 - 2436 |
| N. P. MORRIS ET AL., MOL. IMMUNOL., vol. 44, no. 12, 2007, pages 3112 - 3121 |
| NAP ET AL., CANCER RES., vol. 52, no. 8, 1992, pages 2329 - 23339 |
| NAP ET AL., TUMOUR BIOL., vol. 9, no. 2-3, 1988, pages 145 - 53 |
| NARAZAKI H. ET AL., BLOOD, vol. 115, 2010, pages 1941 - 1948 |
| NARAZAKI, H.; ZHU, Y.; LUO, L.; ZHU, G.; CHEN, L.: "CD137 agonist antibody prevents cancer recurrence: contribution of CD 137 on both hematopoietic and nonhematopoietic cells", BLOOD, vol. 115, 2010, pages 1941 - 1948, XP055034669 |
| NATURE BIOTECHNOLOGY, vol. 23, no. 12, 2005, pages 1556 - 1561 |
| NISHIMOTO H. ET AL., BLOOD, vol. 106, 2005, pages 4241 - 4248 |
| NISHIMOTO, H ET AL: "Costimulation of mast cells by 4-1BB, a member of the tumor necrosis factor receptor superfamily, with the high-affinity IgE receptor", BLOOD, vol. 106, 2005, pages 4241 - 4248 |
| OLOFSSON P.S. ET AL., CIRCULATION, vol. 117, 2008, pages 1292 - 1301 |
| OLOFSSON, P.S ET AL: "CD137 is expressed in human atherosclerosis and promotes development of plaque inflammation in hypercholesterolemic mice", CIRCULATION, vol. 117, 2008, pages 1292 - 1301, XP055052079 |
| OSBOURN ET AL., METHODS, vol. 36, 2005, pages 61 - 68 |
| PADLAN, MOL IMMUNOL, vol. 28, 1991, pages 489 - 498 |
| PADLAN, MOLEC IMMUN, vol. 31, no. 3, 1994, pages 169 - 217 |
| PALAZON A. ET AL., CANCER RES., vol. 71, 2011, pages 801 - 811 |
| PALAZON, A ET AL: "Agonist anti-CD137 mAb act on tumor endothelial cells to enhance recruitment of activated T lymphocytes", CANCER RES, vol. 71, 2011, pages 801 - 811 |
| PLUCKTHUN: "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, pages: 269 - 315 |
| PNAS, vol. 100, no. 4, 2003, pages 1700 - 1705 |
| PROTEIN ENG. DES. SEL., vol. 17, 2004, pages 455 - 462 |
| PROTEIN ENG. DES. SEL., vol. 18, 2005, pages 435 - 444 |
| QUEEN ET AL., PROC NATL ACAD SCI USA, vol. 86, 1989, pages 10029 - 10033 |
| RAVETCH, J.V.; KINET, J.P., ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492 |
| RIDGWAY ET AL., PROT ENG, vol. 9, 1996, pages 617 - 621 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329 |
| S. M. JENSEN ET AL., SEMINARS IN ONCOLOGY, vol. 37, no. 5, 2010, pages 524 - 532 |
| SAMBROOK ET AL.: "Molecular cloning: A laboratory manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SCHWARZ H. ET AL., BLOOD, vol. 85, 1995, pages 1043 - 1052 |
| SCHWARZ, H.; VALBRACHT, J.; TUCKWELL, J.; VON KEMPIS, J.; LOTZ, M.: "ILA, the human 4-1BB homologue, is inducible in lymphoid and other cell lineages", BLOOD, vol. 85, 1995, pages 1043 - 1052 |
| SHAO, Z.; SCHWARZ, H.: "CD137 ligand, a member of the tumor necrosis factor family, regulates immune responses via reverse signal transduction", J LEUKOC BIOL, vol. 89, 2011, pages 21 - 29 |
| SHI, W.; SIEMANN, D.W.: "Augmented antitumor effects of radiation therapy by 4-1BB antibody (BMS-469492) treatment", ANTICANCER RES, vol. 26, 2006, pages 3445 - 3453 |
| SHIELDS, R.L. ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 6591 - 6604 |
| SIMEONE E.; ASCIERTO P.A., J. IMMUNOTOXICOLOGY, vol. 9, 2012, pages 241 - 247 |
| SIMEONE, E.; ASCIERTO, P.A.: "Immunomodulating antibodies in the treatment of metastatic melanoma: the experience with anti-CTLA-4, anti-CD 137, and anti-PDl", J IMMUNOTOXICOL, vol. 9, 2012, pages 241 - 247, XP009181173 |
| SNELL L.M. ET AL., IMMUNOL. REV., vol. 244, 2011, pages 197 - 217 |
| SNELL, L.M.; LIN, G.H.; MCPHERSON, A.J.; MORAES, T.J.; WATTS, T.H.: "T-cell intrinsic effects of GITR and 4-1BB during viral infection and cancer immunotherapy", IMMUNOL REV, vol. 244, 2011, pages 197 - 217, XP055525322 |
| SONG J. ET AL., J. IMMUNOLOGY, vol. 180, no. 11, 2008, pages 7240 - 7248 |
| STAGG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 108, 2011, pages 7142 - 7147 |
| STAGG, J ET AL: "Anti-ErbB-2 mAb therapy requires type I and II interferons and synergizes with anti-PD-1 or anti-CD 137 mAb therapy", PROC NATL ACAD SCI USA, vol. 108, 2011, pages 7142 - 7147, XP055079201 |
| STUMPP ET AL.: "Darpins: A new generation of protein therapeutics", DRUG DISCOVERY TODAY, vol. 13, 2008, pages 695 - 701, XP023440383 |
| TENG M.W. ET AL., J. IMMUNOL., vol. 183, 2009, pages 1911 - 1920 |
| TENG, M.W.; SHARKEY, J.; MCLAUGHLIN, N.M.; EXLEY, M.A.; SMYTH, M.J.: "CDld-based combination therapy eradicates established tumors in mice", J IMMUNOL, vol. 183, 2009, pages 1911 - 1920 |
| URLAUB ET AL., PROC NATL ACAD SCI USA, vol. 77, 1980, pages 4216 |
| VAN DE WINKEL, J.G.; ANDERSON, C.L.; J. LEUKOC, BIOL., vol. 49, 1991, pages 511 - 524 |
| VAN DIJK; VAN DE WINKEL, CURR OPIN PHARMACOL, vol. 5, 2001, pages 368 - 74 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VINAY DS ET AL., CELL BIOL INT., vol. 33, no. 4, 2009, pages 453 - 65 |
| WATTS T.H., ANNU. REV. IMMUNOL., vol. 23, 2005, pages 23 - 68 |
| WATTS, T.H.: "TNF/TNFR family members in costimulation of T cell responses", ANNU. REV. IMMUNOL., vol. 23, 2005, pages 23 - 68, XP055552286 |
| WEI, H ET AL: "Combinatorial PD-1 blockade and CD137 activation has therapeutic efficacy in murine cancer models and synergizes with cisplatin", PLOS ONE, vol. 8, 2013, pages e84927, XP055132841 |
| WEINBERG A.D.; EVANS D.E.; THALHOFER C; SHI T.; PRELL R.A.: "The generation of T cell memory: a review describing the molecular and cellular events following OX40 (CD 134) engagement", J. LEUKOC. BIOL., vol. 75, 2004, pages 962 - 972 |
| WEINBERG ET AL., J. IMMUNOL., vol. 164, 2000, pages 2160 - 2169 |
| WILCOX R. A. ET AL., J. IMMUNOL., vol. 168, 2002, pages 4262 - 4267 |
| WILCOX R.A. ET AL., BLOOD, vol. 103, 2004, pages 177 - 184 |
| WILCOX, R.A ET AL: "Cutting edge: Expression of functional CD137 receptor by dendritic cells", J IMMUNOL, vol. 168, 2002, pages 4262 - 4267 |
| WILCOX, R.A.; TAMADA, K.; FLIES, D.B.; ZHU, G.; CHAPOVAL, A.I.; BLAZAR, B.R.; KAST, W.M.; CHEN, L.: "Ligation of CD137 receptor prevents and reverses established anergy of CD8+ cytolytic T lymphocytes in vivo", BLOOD, vol. 103, 2004, pages 177 - 184 |
| WYZGOL A ET AL: "Trimer Stabilization, Oligomerization, and Antibody-mediated cell surface immobilization improve the activity of soluble trimers of CD27L, CD40L, 41BBL and Glucocorticoid-induced TNF receptor ligand", J. IMMUNOL., vol. 183, 2009, pages 1851 - 1861, XP055015511 |
| YAZAKI; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 255 - 268 |
| ZHANG X. ET AL., J. IMMUNOL., vol. 184, 2010, pages 787 - 795 |
| ZHANG, X ET AL: "CD137 promotes proliferation and survival of human B cells", J IMMUNOL, vol. 184, 2010, pages 787 - 795 |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110452294A (en) * | 2019-08-06 | 2019-11-15 | 复旦大学 | Five kinds of hinge areas and its Chimeric antigen receptor and immunocyte |
| CN110452294B (en) * | 2019-08-06 | 2020-08-07 | 复旦大学 | Five hinge regions and their chimeric antigen receptors and immune cells |
| WO2021030680A1 (en) * | 2019-08-15 | 2021-02-18 | Regeneron Pharmaceuticals, Inc. | Multispecific antigen-binding molecules for cell targeting and uses thereof |
| CN114302893A (en) * | 2019-08-15 | 2022-04-08 | 瑞泽恩制药公司 | Multispecific antigen binding molecules for cell targeting and uses thereof |
| US11952430B2 (en) | 2019-08-15 | 2024-04-09 | Regeneron Pharmaceuticals, Inc. | Multispecific antigen-binding molecules for cell targeting and uses thereof |
| US12065508B2 (en) | 2019-08-15 | 2024-08-20 | Regeneron Pharmaceuticals, Inc. | Multispecific antigen-binding molecules for cell targeting and uses thereof |
| US12077603B2 (en) | 2019-08-15 | 2024-09-03 | Regeneron Pharmaceuticals, Inc. | Multispecific antigen-binding molecules for cell targeting and uses thereof |
| CN114302893B (en) * | 2019-08-15 | 2025-01-28 | 瑞泽恩制药公司 | Multispecific antigen-binding molecules for cell targeting and uses thereof |
| WO2025113643A1 (en) | 2023-12-01 | 2025-06-05 | Gilead Sciences Inc. | Anti-fap-light fusion protein and use thereof |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12202870B2 (en) | Antigen binding molecules comprising a trimeric TNF family ligand and encoding polynucleotides thereof | |
| US12441812B2 (en) | Methods of treating cancer by administering tumor necrosis factor (TNF) family ligand trimer-containing antigen-binding molecules | |
| US12240911B2 (en) | Bispecific antibodies specific for OX40 | |
| US20220073646A1 (en) | Bispecific antibodies with tetravalency for a costimulatory tnf receptor | |
| US20190016771A1 (en) | Trimeric costimulatory tnf family ligand-containing antigen binding molecules | |
| US11453722B2 (en) | Bispecific antigen binding molecule for a costimulatory TNF receptor | |
| JP7285076B2 (en) | Antigen-binding molecule comprising a TNF family ligand trimer and a tenascin-binding portion | |
| WO2018178055A1 (en) | Bispecific antigen binding molecule for a costimulatory tnf receptor | |
| CN111465619A (en) | Combination therapy of tumor-targeted ICOS agonists with T cell bispecific molecules | |
| CA2963718C (en) | Antigen binding molecules comprising a tnf family ligand trimer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18715586 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 18715586 Country of ref document: EP Kind code of ref document: A1 |

















