WO2018165494A1 - Small molecule bax inhibitors and uses thereof - Google Patents

Small molecule bax inhibitors and uses thereof Download PDF

Info

Publication number
WO2018165494A1
WO2018165494A1 PCT/US2018/021644 US2018021644W WO2018165494A1 WO 2018165494 A1 WO2018165494 A1 WO 2018165494A1 US 2018021644 W US2018021644 W US 2018021644W WO 2018165494 A1 WO2018165494 A1 WO 2018165494A1
Authority
WO
WIPO (PCT)
Prior art keywords
disease
cancer
bai
carcinoma
bax
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/021644
Other languages
French (fr)
Inventor
Evripidis Gavathiotis
Richard N. KITSIS
Thomas Peter GARNER
Dulguun AMGALAN
Lorrie KIRSHENBAUM
Felix Kopp
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Manitoba
Albert Einstein College of Medicine
Original Assignee
University of Manitoba
Albert Einstein College of Medicine
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Manitoba, Albert Einstein College of Medicine filed Critical University of Manitoba
Priority to US16/492,300 priority Critical patent/US11938128B2/en
Publication of WO2018165494A1 publication Critical patent/WO2018165494A1/en
Anticipated expiration legal-status Critical
Priority to US18/595,808 priority patent/US20240350482A1/en
Priority to US18/826,495 priority patent/US20250000857A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D295/00Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms
    • C07D295/04Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms
    • C07D295/12Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly or doubly bound nitrogen atoms
    • C07D295/125Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly or doubly bound nitrogen atoms with the ring nitrogen atoms and the substituent nitrogen atoms attached to the same carbon chain, which is not interrupted by carbocyclic rings
    • C07D295/13Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly or doubly bound nitrogen atoms with the ring nitrogen atoms and the substituent nitrogen atoms attached to the same carbon chain, which is not interrupted by carbocyclic rings to an acyclic saturated chain
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/496Non-condensed piperazines containing further heterocyclic rings, e.g. rifampin, thiothixene or sparfloxacin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D209/00Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom
    • C07D209/56Ring systems containing three or more rings
    • C07D209/80[b, c]- or [b, d]-condensed
    • C07D209/82Carbazoles; Hydrogenated carbazoles
    • C07D209/86Carbazoles; Hydrogenated carbazoles with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to carbon atoms of the ring system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D209/00Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom
    • C07D209/56Ring systems containing three or more rings
    • C07D209/80[b, c]- or [b, d]-condensed
    • C07D209/82Carbazoles; Hydrogenated carbazoles
    • C07D209/88Carbazoles; Hydrogenated carbazoles with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to carbon atoms of the ring system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D279/00Heterocyclic compounds containing six-membered rings having one nitrogen atom and one sulfur atom as the only ring hetero atoms
    • C07D279/101,4-Thiazines; Hydrogenated 1,4-thiazines
    • C07D279/141,4-Thiazines; Hydrogenated 1,4-thiazines condensed with carbocyclic rings or ring systems
    • C07D279/18[b, e]-condensed with two six-membered rings
    • C07D279/22[b, e]-condensed with two six-membered rings with carbon atoms directly attached to the ring nitrogen atom
    • C07D279/24[b, e]-condensed with two six-membered rings with carbon atoms directly attached to the ring nitrogen atom with hydrocarbon radicals, substituted by amino radicals, attached to the ring nitrogen atom
    • C07D279/26[b, e]-condensed with two six-membered rings with carbon atoms directly attached to the ring nitrogen atom with hydrocarbon radicals, substituted by amino radicals, attached to the ring nitrogen atom without other substituents attached to the ring system

Definitions

  • Apoptosis is an evolutionarily conserved process that plays a critical role in embryonic development and tissue homeostasis.
  • the dysregulation of apoptosis is pivotal to a number of high mortality human pathogenesis including cardiovascular diseases and neurodegenerative diseases.
  • the pro-apoptotic Bcl-2-associated x-protein (BAX) induces mitochondrial outer-membrane permeabilization and represents a key gatekeeper and effector of mitochondrial apoptosis.
  • BAX facilitates opening of the mitochondrial inner membrane permeability transition pore, thereby functioning as a pivotal activator of necrosis.
  • BAX is a central mediator of both necrosis and apoptosis (17).
  • MI Myocardial infarction
  • MI/R myocardial infarction / reperfusion
  • Necrosis is responsible for the drastic decrease in cellularity within the infarct zone and for eliciting downstream tissue responses such as inflammation, matrix remodeling, and later fibrosis (4), and apoptosis in the peri-infarct zone is a major component of early post-infarct remodeling (5).
  • the amount of cardiac damage over the first -24-48 h of MI, "infarct size”, is the major determinant of post-MI chronic heart failure and mortality in humans and experimental animals (6,7).
  • therapeutic interventions to limit cardiac damage sustained over just the first 24-48 hours present an opportunity to impact the incidence of heart failure.
  • the present invention address the need for inhibitors of BAX that can be used to treat MI and other indications in which inhibition of premature or unwanted cell death is desirable, such as, for example, chemotherapy -induced cardiomyopathy.
  • the invention provides compounds having the structure of formula
  • compositions comprising compounds, and methods of using these compounds for treating a disease or disorder in which it is desirable to inhibit BAX, such as a cardiovascular disease or disorder.
  • FIG. 1 Deletion of BAX in knockout mice reduces myocardial infarct size in vivo. Number of mice shown in circles. Left column in each pair represents data from wild type mice, while right column represents data from BAX knock-out mice. AAR - area at risk, INF - infarct size, LV - left ventricle.
  • FIG. 2 Compounds BAI-1 and BAI-2 inhibit membrane permeabilization induced by tBID-activated BAX. Maximum permeabilization of tBID-induced BAX activation was recorded at - 60%. Maximum permeabilization of BAX alone was recorded at -10%. Another compound, BAI-3, was not effective to inhibit tBID-induced BAX activation. tBID, BAI-1, BAI-2, and BAI-3 alone do not stimulate fluorophore release (not shown). Structures of BAI-1 and BAI-2 are illustrated in FIG. 3 A; structure of BAI-3 shown in FIG. 3C.
  • FIG. 3A-3C Structures of compounds.
  • FIG. 4 NMR CSP-guided docking of BAI-1 with the BAX monomer structure using Glide (Shrodinger).
  • BAI-1 molecules form a number of hydrophobic contacts, cation- ⁇ and electrostatic interactions in the proposed binding site, stabilizing interactions of the hydrophobic core of the BAX structure.
  • FIG. 5 Effects of BAI-1 on tBID-induced BAX oligomerization.
  • FIG. 6A-6C BAI-1 potently inhibits primary (A) neonatal and (B) adult cardiomyocyte death induced by hypoxia and hypoxia/reoxygenation (H/R), respectively. Cell death was assessed using calcein AM (alive) and ethidium homodimer (dead) staining. (C) BAI1 inhibits hypoxia-induced loss of inner mitochondrial membrane potential ( ⁇ ) in neonatal cardiomyocytes.
  • FIG. 7 BAI-A19 inhibition of BAX activation in vivo assayed with 6A7 antibody staining.
  • FIG. 8 BAI compounds tested in BAX inhibition assay using tBID-induced BAX activation in liposomal membranes. Structures of the compounds are shown in Fig. 3.
  • FIG. 9. BAI-A19 potently inhibits primary neonatal cardiomyocyte death induced by hypoxia, whereas the inactive analog, BAI1-A20, does not. Cell death was assessed using calcein AM (alive) and ethidium homodimer (dead) staining.
  • FIG. 10 BAI-A22 potently inhibits primary neonatal cardiomyocyte death induced by hypoxia.
  • FIG. 11A-11B BAI-A22 pharmacokinetics.
  • BAI-A22 was injected intravenously in male Sprague Dawley ® rats at 1 mg/kg dose and blood plasma and heart tissue were collected at different time points, and drug levels measured by LC-MS/MS.
  • A Average BAI-A22 concentrations in blood plasma.
  • B Average BAI-A22 concentrations in heart tissue.
  • FIG. 12 Simulated heart concentration of BAI-A22. Dose Regimen to reach 3000 ⁇ g/mL heart concentration: 650 ⁇ g of IV bolus and 132 ⁇ g/h IV infusion. Dotted lines indicate the therapeutic window.
  • FIG. 13 BAI-1 inhibits tBID-induced BAX mediated cytochrome c release from isolated cardiac mitochondria. The levels of cytochrome c were quantified in mitochondrial and soluble fractions after incubation of mitochondria with tBID, BAX without and with BAI-1.
  • FIG. 14 BAI-1 inhibits TNFa-induced BAX-mediated apoptotic cell death in mouse embryonic fibroblasts. Inhibition of BAI-1 required BAX but not BAK.
  • FIG. 15. BAI-1 inhibits Ionomycin-induced BAX-mediated necrotic cell death in mouse embryonic fibroblasts as measured by the loss of TMRE fluorescence using FACS analysis.
  • FIG. 16 BAI-1 inhibits doxorubicin-induced cell death in rat neonetal cardiomyocytes. Cell death was assessed using calcein AM (alive) and ethidium homodimer (dead) staining.
  • FIG. 17 BAI-1 inhibits doxorubicin-induced cell death in human cardiomyocytes derived from human induced pluripotent stem cells. Cell death was assessed using annexin V staining.
  • FIG. 18 BAI-A22 inhibits doxorubicin-induced apoptosis in mouse embryonic fibroblasts. Apoptosis was induced with either staurosporine (STS) or pro-apoptotic ABT- 737 drug.
  • STS staurosporine
  • ABT- 737 drug pro-apoptotic ABT- 737 drug.
  • FIG. 19A-19C BAX inhibitor effect on heart function in doxorubicin-treated mice.
  • A Effects of doxorubicin with or without BAX inhibitors BAI-1, BAI-A2, and BAI- A22 on ejection fraction in acute doxorubicin model. Groups were compared using one-way ANOVA followed by Tukey's multiple comparisons test.
  • B Effect of doxorubicin with or without BAX inhibitor BAI-1 on ejection fraction in acute doxorubicin model. Groups were compared using one-way ANOVA followed Dunnett's multiple comparisons test.
  • C Effect of doxorubicin with or without BAX inhibitor BAI-A22 on ejection fraction in acute doxorubicin model. Groups were compared using one-way ANOVA followed Dunnett's multiple comparisons test.
  • FIG. 20A-20B BAI-1 inhibits cardiomyocyte apoptosis and necrotic cell death.
  • A TUNEL assay was used to measure apoptosis in neonatal rat cardiomyocytes (NRCM) under normoxia and hypoxia with or without 1 ⁇ BAI-1. Quantification of percentage of TUNEL positive cells.
  • B NRCM were pre-treated with varying concentrations of BAI-1 and cultured under normoxic or hypoxic conditions. BAI-1 dose response. Percentage of dead cells represents percentage of ethidium homodimer- l(EthD) positive cells.
  • FIG. 21A-21C BAI-A1, BAI-A2 and BAI-A21 inhibit cardiomyocyte necrotic cell death.
  • NRCM were pre-treated with varying concentrations of BAI-A1 (A), BAI-A2 (B) or BAI-A21 (C) and cultured under normoxic or hypoxic conditions. Percentage of dead cells represents percentage of EthD positive cells.
  • FIG. 22A-22B BAI-1 and BAI-A1 inhibit adult cardiomyocyte necrosis.
  • Adult rat cardiomyocytes were pre-treated with varying concentrations of BAI-1 (A) or BAI-A1 (B) and subjected to hypoxia and reoxygenation (H/R). Percentage of dead cells represents percentage of EthD positive cells.
  • FIG. 23 BAI-A2 inhibits doxorubicin-induced cardiomyocyte necrosis.
  • NRCM were pre-treated with varying concentrations of A2 and then stimulated with 10 ⁇ doxorubicin for 18 hr.
  • FIG. 24A-24C BAI-1 reduces doxorubicin-induced cardiac fibrosis, apoptosis and necrosis.
  • A Hearts were collected from mice in the acute doxorubicin model and sectioned to measure fibrosis using Masson Trichrome staining. Percentage of area with blue collagenous stain per field.
  • B Hearts were collected from mice in the acute doxorubicin model and sectioned to stain for apoptosis marker, TUNEL. Percentage of TUNEL positive nuclei per field.
  • C Hearts were collected from mice in the acute doxorubicin model and sectioned to immunostain for high motility group box 1 (HMGBl), loss of which indicates necrosis. Percentage of nuclei that lost HMGBl per field.
  • HMGBl high motility group box 1
  • FIG. 25A-25B BAI-1 effects on doxorubicin-induced cardiac apoptosis in chronic model.
  • A Hearts were collected from mice in the chronic doxorubicin model and sectioned to stain for the apoptosis marker, TUNEL. Percentage of TUNEL positive nuclei per field.
  • B Hearts were collected from mice in the chronic doxorubicin model and sectioned to immunostain for HMGBl, loss of which indicates necrosis. Percentage of nuclei that lost HMGBl per field.
  • FIG. 26 Chronic model of doxorubicin and trastuzumab combination therapy. Experimental scheme for chronic model of doxorubicin and trastuzumab-induced cardiomyopathy. In doxorubicin group, mice were administered 3 mg/kg doxorubicin for 8 injections. In doxorubicin plus trastuzumab group, mice were administered 1 week later with 2 mg/kg trastuzumab for 6 injections. Echocardiography was performed at week 8 from the start of experiment. Trastuzumab (TRZ).
  • TRZ Trastuzumab
  • EF Ejection fraction
  • FS fractional shortening
  • SV stroke volume
  • TRZ Trastuzumab
  • FIG. 28 BAI-1 does not inhibit doxorubicin-induced breast cancer cell death.
  • Human breast cancer cell lines LM2, MDA-MB-231, 3475 and MCF-7 were treated with doxorubicin without or with varying concentrations of BAI-1. Percentage of cell viability is relative to 100% viability of an untreated control group (not shown). BAI-1 did not interfere with doxorubicin-induced killing of any of the breast cancer cells. Cell viability was assessed using CytoTox-Glo Cytotoxicity Assay (Promega).
  • FIG. 29 Effects of BAI-1 on doxorubicin-induced AML cell viability in vitro.
  • Human AML cell lines THP-1, HL-60 and MOLM-13 were treated with doxorubicin without or with varying concentrations of BAI-1. Percentage of cell viability is relative to 100% viability of an untreated control group (not shown). BAI-1 did not interfere with doxorubicin-induced killing of any of the AML cells.
  • the invention provides a method of treating a disease or condition in a subject in which it is desirable to inhibit Bcl-2-associated x-protein (BAX) comprising administering to the subject one or more of the compounds of formula (I) and/or formula (IV) in an amount effective to treat the disease or condition in a subject, wherein formula (I) and formula (IV) have the structure
  • A is phenyl or a 6-membered heteroaromatic ring having 1 , 2 or 3 N atoms in the heteroaromatic ring;
  • B is phenyl, or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring; or a 6-membered aliphatic ring with up to 3 heteroatoms;
  • Rl and R2 are independently none, C1-C5 alkyl, F, CI, Br, I, CN, N0 2 , NR4, NR4 2 , OR4, CF 3 , COOH, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S0 2 R4;
  • X is H, NH 2 , OH, O, F, CI, Br, I, CN, SH, N0 2 , NR4, NR4 2 , OR, CF 3 , COOH, R4, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S0 2 R4; wherein the bond between X and the le bond or a double bond, depending on the definition of X;
  • R4 is H or Cl-C3 alkyl
  • each R5 is independently OH, SH, NR4 2 or R4;
  • Y is O, S, N or CH;
  • Z is O, S, NR4, CHR4, S(0) 2 , C(Me) 2 or C(O);
  • each 1, m, n, o and p is independently 1-3;
  • compound can have, for example, the structure of formula (II), (III), (IV) or (VI)
  • the compound can have a structure, for example, selected from the group consisting of
  • the one or more compounds is administered in an amount effective to inhibit BAX in a subject.
  • the invention also provides a method of inhibiting Bcl-2-associated x-protein (BAX) in a subject comprising contacting the BAX with one or more of the compounds of formula (I) and/or formula (IV) in an amount effective to inhibit BAX, wherein formula (I) and formula (IV) have the structure as defined herein.
  • BAX Bcl-2-associated x-protein
  • BAX Bcl-2-associated x-protein
  • a method of inhibiting Bcl-2-associated x-protein comprising contacting BAX with one or more of any of the compounds or pharmaceutical compositions disclosed herein in an amount effective to inhibit BAX.
  • the BAX is in a subject, and the one or more compounds or compositions is administered to the subject.
  • the subject being administered the compound, and being treated may have, for example, a disease or condition is selected from the group consisting of hypoxic cardiomyocytes, cardiac ischemia, cardiac ischemia-reperfusion injury, myocardial infarction, myocardial infarction and reperfusion injury, chemotherapy -induced cardiotoxicity, arteriosclerosis, heart failure, heart transplantation, aneurism, chronic pulmonary disease, ischemic heart disease, hypertension, pulmonary hypertension, thrombosis, cardiomyopathy, stroke, a neurodegenerative disease or disorder, an immunological disorder, ischemia, ischemia-reperfusion injury, infertility, a hematological disorder, renal hypoxia, hepatitis, a liver disease, a kidney disease, an intestinal disease, liver ischemia, intestinal ischemia, asthma, AIDS, Alzheimer's disease, Parkinson's disease, Huntington's disease, retinitis pigmentosa, spinal muscular atrophy, cerebellar degeneration, amyotrophic
  • the compound does not interfere with the ability of the chemotherapeutic agent to treat cancer.
  • the chemotherapeutic agent can be, for example, one or more of doxorubicin and trastuzumab.
  • the cancer can be, for example, one or more of a leukemia, a solid tumor, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML), breast cancer, prostate cancer, lymphoma, skin cancer, pancreatic cancer, colon cancer, melanoma, malignant melanoma, ovarian cancer, brain or spinal cord cancer, primary brain carcinoma, medulloblastoma, neuroblastoma, glioma, head-neck cancer, glioma, glioblastoma, liver cancer, bladder cancer, stomach cancer, kidney cancer, placental cancer, cancer of the gastrointestinal tract, non-small cell lung cancer (NSCLC), head or neck carcinoma, breast carcinoma, endocrine cancer, eye cancer, genitourinary cancer, cancer of the vulva, ovary, uterus or cervix, hematopoietic cancer, myelom
  • Also provided is a method of treating a myocardial infarction or a myocardial infarction and reperfusion injury in a subject comprising administering to the subject one or more of the compounds or pharmaceutical compositions disclosed herein in an amount effective to treat a myocardial infarction or a myocardial infarction and reperfusion injury in a subject in need thereof.
  • the one or more compounds or the pharmaceutical composition is administered in an amount effective to inhibit Bcl-2-associated x-protein (BAX) in a subject.
  • BAX Bcl-2-associated x-protein
  • the subject can be, for example, a mammal, and is preferably a human.
  • treating means to alleviate or ameliorate or eliminate a sign or symptom of the disease or disorder that is being treated.
  • the compound or composition can prevent or reduce the severity of the disease or disorder.
  • administration of the compound to a subject can prevent or reduce the severity of chemotherapy -induced cardiotoxicity that would occur in the absence of administration of the compound.
  • Administration of the compound can include preventive and/or therapeutic administration.
  • the compounds and compositions of the present invention can be administered to subjects using routes of administration known in the art.
  • the administration can be systemic or localized to a specific site.
  • Routes of administration include, but are not limited to, intravenous, intramuscular, intrathecal or subcutaneous injection, oral or rectal administration, and injection into a specific site.
  • the compounds and compositions disclosed herein are administered acutely to treat a disease or disorder, due to potential hazards of long-term inhibition of cell death, e.g. cancer.
  • the therapy can be used in conjunction with effective existing therapies for treating the disease or disorder, such as, e.g., angioplasty/stenting for cardiovascular disease.
  • the invention provides a compound having the structure of formula (VII)
  • A is phenyl or a 6-membered heteroaromatic ring having 1 , 2 or 3 N atoms in the heteroaromatic ring;
  • B is phenyl, or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring; or a 6-membered aliphatic ring with up to 3 heteroatoms;
  • Rl and R2 are independently none, C1-C5 alkyl, F, CI, Br, I, CN, N0 2 , NR4, NR4 2 , OR4, CF 3 , COOH, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S0 2 R4;
  • X is H, NH 2 , OH, O, F, CI, Br, I, CN, SH, N0 2 , NR4, NR4 2 , OR, CF 3 , COOH, R4, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S0 2 R4; wherein the bond between X and the main scaffold is a single bond or a double bond, depending on the definition of X;
  • Q is (CH 2 ) m N((CH 2 ) 0 R5) 2 , COH, COOH, or CH 2 NH(CH 2 ) ! OH;
  • R4 is H or Cl-C3 alkyl
  • each R5 is independently OH, SH, NR4 2 or R4;
  • Y is O, S, N or CH;
  • each 1, m, n, o and p is independently 1-3;
  • the compound can have, for example, the structure of formula (VIII) or (IX)
  • the compound can have, for example, a structure selected from the group consisting of
  • the invention also provides a compound having the structure of formula (X) or (XI)
  • A is phenyl or a 6-membered heteroaromatic ring having 1 , 2 or 3 N atoms in the heteroaromatic ring;
  • B is phenyl, or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring; or a 6-membered aliphatic ring with up to 3 heteroatoms;
  • Rl and R2 are independently none, C 1-C5 alkyl, F, CI, Br, I, CN, N0 2 , NR4, NR4 2 , OR4, CF 3 , COOH, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S0 2 R4;
  • X is H, NH 2 , OH, O, F, CI, Br, I, CN, SH, N0 2 , NR4, NR4 2 , OR, CF 3 , COOH, R4, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S0 2 R4; wherein the bond between X and the le bond or a double bond, depending on the definition of X;
  • R4 is H or Cl -C3 alkyl
  • each R5 is independently OH, SH, NR4 2 or R4;
  • Y is O, S, N or CH;
  • Z is O, S, NR4, CHR4, S(0) 2 , C(Me) 2 or C(O);
  • each 1, m, n, o and p is independently 1 -3;
  • Z is O, NR4, CHR4, S(0) 2 , C(Me) 2 or C(O).
  • the invention also provides a pharmaceutical composition
  • a pharmaceutical composition comprising one or more of the compounds disclosed herein and a pharmaceutically acceptable carrier.
  • Pharmaceutically acceptable carriers and diluents that can be used herewith encompasses any of the standard pharmaceutical carriers or diluents, such as, for example, a sterile isotonic saline, phosphate buffered saline solution, water, and emulsions, such as an oil/water or water/oil emulsions.
  • the pharmaceutical compositions can be formulated to be advantageous for the selected route of administration to a subject.
  • BAX is Bcl-2-associated x-protein.
  • the BAX is mammalian.
  • the BAX is a human BAX.
  • the BAX comprises consecutive amino acid residues having the following sequence:
  • BAX inhibitors are defined as compounds that bind to BAX and inhibit its function.
  • BAX is a therapeutic target for MI/R
  • BAX knockout mice were subjected to 45 min ischemia/24 h reperfusion. These KO mice have a generalized deletion of BAX making them a good model for the antagonism of BAX in both cardiomyocytes and non-myocytes.
  • Area at risk (AAR) was measured by Evans blue dye and infarct size by tetrazolium chloride (TTC) staining (Fig. 1). Consistent with a previous study in isolated hearts (18), BAX deletion markedly reduced infarcts indicating that BAX plays an important role in the pathogenesis of infarction in vivo.
  • TTC tetrazolium chloride
  • BAX Activation Inhibitor 1 (BAI- 1) (Fig. 3 A)
  • BAI-2 a lead small molecule, termed BAX Activation Inhibitor 1
  • BAI-1 a lead small molecule, termed BAX Activation Inhibitor 1 (Fig. 3 A)
  • BAI-2 another compound, inhibited BAX- induced liposomal release (Fig. 2).
  • NMR data highlight a binding site for BAI-1 in a region of the BAX structure distinct from the trigger site and for which information does not currently exist regarding effects on BAX activation.
  • NMR data were used to guide molecular docking studies.
  • Fig. 5 shows a close-up view of the novel BAX binding site and the bound docked structure of BAI-1.
  • BAI-1 stabilizes the interactions among these helices and the BAX structure and, through this mechanism, inhibits BAX conformational activation by BH3-only proteins.
  • BAX oligomerization (which is downstream of activation) was tested using immunoblotting after cross-linking with BMH (Fig. 5).
  • BAI-1 inhibited tBID-induced BAX oligomerization (lane 8 versus lane 6). Since BAI-1 does not inhibit the binding of BH3-only activator proteins to BAX (not shown), the most likely model is that BAI-1 functions as an allosteric inhibitor of BAX activation.
  • a key event in BAX activation is exposure of a helix 9 containing a transmembrane domain that inserts tightly into the outer mitochondrial membrane (OMM).
  • OMM outer mitochondrial membrane
  • BAX insertion into the OMM can be assessed by treating isolated mitochondria with strong alkali, which separates loosely attached proteins from mitochondria but fails to extract membrane-inserted proteins.
  • Staurosporine (STS) treatment of mouse embryonic fibroblasts resulted in a pool of BAX that could not be retrieved by treatment of isolated mitochondria with strong alkali.
  • Treatment of cells with BAI-1 significantly decreased the inserted pool.
  • BAI-1 can inhibit STS- induced BAX translocation. Translocation was assessed by immunostaining for mitochondrial BAX puncta. BAI-1 significantly decreased BAX translocation to the mitochondria in a dose-dependent fashion. A similar result was observed with BAI-A22. (Data not shown.)
  • BAI-1 inhibits apoptotic cell death and necrotic cell death
  • BAI-1 inhibits TNFa-induced BAX-mediated apoptotic cell death in mouse embryonic fibroblasts (Fig. 14). Inhibition of BAI-1 required BAX but not BAK. Nuclear fragmentation was also inhibited, as shown using BAI-1 and BAI-A22; extemalization of phosphatidylserine was reduced as shown using BAI-1 (data not shown). BAI-1 also inhibits Ionomycin-induced BAX-mediated necrotic cell death in mouse embryonic fibroblasts as measured by the loss of TMRE fluorescence using FACS analysis (Fig. 15).
  • BAI-1 inhibits cardiomyocyte death
  • BAI-1 can inhibit cell death in cardiomyocytes challenged with a noxious stimuli relevant to MI/R. At -10 nM concentrations, BAI-1 inhibited cell death in neonatal and adult cardiomyocytes challenged with 18 h of 3% hypoxia and lh hypoxia/2h reoxygenation, respectively, both effects occurring in a dose-dependent manner (Fig. 6A,B). To explore the mechanism by which BAI-1 inhibits cardiomyocyte death, TMRM staining was used to assess its effect on loss of inner mitochondrial membrane potential ( ⁇ ), which occurs with opening of the mPTP. BAI-1 markedly inhibited loss of ⁇ (Fig. 6C).
  • BAI-1 also inhibits tBID-induced BAX mediated cytochrome c release from isolated cardiac mitochondria. The levels of cytochrome c were quantified in mitochondrial and soluble fractions after incubation of mitochondria with tBID, BAX without and with BAI-1 (Fig. 13). It was also demonstrated that BAI-1 inhibits doxorubicin-induced cell death in rat neonetal cardiomyocytes (Fig. 16) and that BAI-1 inhibits doxorubicin-induced cell death in human cardiomyocytes derived from human induced pluripotent stem cells (Fig. 17). These data demonstrate that BAI-1 potently inhibits neonatal and adult cardiomyocyte death and that mitochondrial mechanisms are involved. BAI-1 inhibits cardiomyocyte apoptosis and necrotic cell death (Fig. 20A-B). BAI-A2 was also tested and shown to inhibit doxorubicin- induced cardiomyocyte necrosis (Fig. 23).
  • BAI-A1 inhibits BAX during MI/R in vivo
  • BAI-1 potently inhibited cell death in isolated cardiomyocytes
  • BAI-1 is 99.9% bound to plasma proteins in mouse plasma (not shown).
  • BAI-1 was re-engineered by removing both bromines to lower its hydrophobicity and, thereby, reduce its plasma protein binding.
  • the resulting BAI-A1 (Fig. 3A) exhibited 89.4% plasma protein binding.
  • BAI-A1 exhibited less BAX binding than BAI-1 (not shown).
  • BAI-A1 Despite this, its ability to protect neonatal and adult cardiomyocytes against hypoxia and hypoxia/reoxygenation was only modestly decreased (not shown).
  • BAI-A1 potently blocks BAX conformational activation as assessed by immunostaining with 6A7, an antibody that recognizes only the active conformer of BAX. This was assessed following 45 min ischemia/6h reperfusion, the time point that BAX is activated maximally in the absence of drug. It was concluded that BAI- Al can access myocardial cells and is effective at inhibiting BAX activation during MI/R in vivo.
  • the pharmacokinetics of BAI-A1 were measured in the mouse by injecting 1 mg/kg into a cohort of mice and harvesting plasma and heart tissue 0, 1, 6, and 24 h. The half-life of BAI-A1 was -3.5 h in both plasma and heart tissue.
  • Fig. 8 and Table 1 show IC50 values for BAI compounds tested in a BAX inhibition assay using tBID-induced BAX activation in liposomal membranes. The structures of the compounds are shown in Fig. 3.
  • Fig. 9 shows that BAI-A19 potently inhibits primary neonatal cardiomyocyte death induced by hypoxia, whereas the inactive analog, BAI-A20, does not.
  • Fig. 18 shows that BAI-A22 inhibits doxorubicin-induced apoptosis in mouse embryonic fibroblasts.
  • Fig. 10 shows that BAI-A22 potently inhibits primary neonatal cardiomyocyte death induced by hypoxia.
  • Fig. 11 shows BAI-A22 pharmacokinetics in blood plasma and heart tissue. Pharmacokinetic parameters for BAI-A22 are shown in Table 2. Plasma protein binding was measured in rats for BAI-A22, which was found to be 95.6% bound.
  • Fig 12 shows the simulated heart concentration of BAI-A22.
  • Compounds BAI-1 (Fig. 22A), BAI-A1 (Figs. 21A, 22B), BAI-A2 (Fig. 21B) and BAI-A21 (Fig. 21C) inhibit necrosis in cardiomyocytes in a dose-dependent manner.
  • Doxorubicin is extensively used for both adults and children to treat many types of cancers, including solid tumors, such as breast cancer, leukemia and lymphomas (27). It is considered as one of the most potent of the Food and Drug Administration (FDA)- approved cancer drugs (28). Doxorubicin's clinical use is limited by its severe dose- dependent and often lethal heart failure (27), even emerging years after termination of treatment (29).
  • FDA Food and Drug Administration
  • doxorubicin-induced cardiotoxicity is known to increase BAX levels and drive apoptosis in cardiac cells and is a real clinical problem.
  • a number of new chemotherapy drugs have the same side-effect and cardiotoxicity prevents their use at more effective doses.
  • Fig. 19A-C illustrates the effects of three BAX inhibitors on heart function in doxorubicin-treated mice.
  • An acute heart failure model was generated by a single intraperitoneal injection of doxorubicin (20 mg/kg) dissolved in saline.
  • BAI-1, BAI-A2 and BAI-A22 were administered to mice by a single intraperitoneal injection of 2mg/kg dose. Both BAI-1 (Fig. 19B) and BAI-22 (Fig. 19C) were therapeutically effective at the dose used. Similar therapeutic effects were observed with BAI-21 (data not shown).
  • Hearts were collected from mice in the acute doxorubicin model and sectioned to measure fibrosis using Masson Trichrome staining, or stained for the apoptosis marker, TU EL, or immunostained for HMGB1, loss of which indicates necrosis. BAI-1 reduced doxorubicin-induced cardiac fibrosis, apoptosis and cardiac necrosis (Fig. 24A-C).
  • mice typically receive several "cycles" of doxorubicin administered at lower doses.
  • the exact protocol depends on the cancer being treated. For example, some leukemias are treated with 4 cycles of 60 mg/m 2 (which would be the equivalent of 1.5 mg/kg) IV administered every 21-28 days. Cumulative doxorubicin dose of 20-25 mg/kg has been shown to induce a clinically relevant cardiomyopathy in mice (30-32). Based on this experience, a chronic protocol was used in which mice receive 3 mg/kg doxorubicin IP every other day x 8 doses (i.e. over a two-week period) for a cumulative dose of 24 mg/kg.
  • BAI-1 and BAI-A22 were tested for their ability to protect the heart against doxorubicin-induced cardiomyopathy, using a dose of 2 mg/kg.
  • BAI1 and A22 significantly protected the heart from cardiac dysfunction as assessed by fractional shortening, ejection fraction and systolic wall thickening.
  • Doxorubicin-induced apoptotic and necrotic cardiac cell death were largely abrogated as tested using BAI-1, as shown by TUNEL (Fig. 25 A) and HMGB1 loss (Fig. 25B), respectively.
  • trastuzumab is a humanized monoclonal antibody against the human epidermal growth factor receptor 2 (HER2) receptor and was approved by the FDA in 1998 as a therapy for HER2-positive breast cancer patients (33, 34).
  • the combination of doxorubicin with tratuzumab increases treatment efficacy but also is often accompanied by increased cardiotoxicity (35).
  • the effects of BAI-1 were tested using the chronic doxorubicin model followed by the initiation one week later of trastuzumab (Fig. 26). Echocardiography was performed at week 8 following initiation of doxorubicin. Results show that doxorubicin+trastuzumab induced cardiac dysfunction was inhibited by BAI-1 as assessed using ejection fraction, fractional shortening and stroke volume (Fig. 27).
  • BAI-1 does not inhibit doxorubicin-induced cancer cell death
  • Fig. 28 illustrates human breast cancer cell lines LM2, MDA-MB-231, 3475 and MCF-7 treated with doxorubicin without or with varying concentrations of BAI-1.
  • BAI-1 did not interfere with doxorubicin-induced killing of any of the breast cancer cells.
  • Co- treatment with BAI-1 also did not compromise the cytotoxic effect of doxorubicin in an in vivo breast cancer xenograft mouse model (data not shown).
  • BAI-1 also did not effect of the ability of doxorubicin to kill acute myeloid leukemia (AML) cell lines in culture (Fig. 29). Co-treatment with BAI-1 also did not compromise the cytotoxic effect of doxorubicin in an in vivo AML heterograft mouse model (data not shown). BAI-1 protected against doxorubicin-induced cardiomyopathy in the same mice whose leukemia burden was successfully reduced by doxorubicin. These results indicate that BAI-1 can protect against doxorubicin-induced cardiomyopathy without interfering with reduction of leukemia burden in the same animals.
  • AML acute myeloid leukemia
  • BAX levels were assessed in the adult heart versus the 4 breast cancer and 3 AML cell lines that were studied above. BAX levels were uniformly increased in the cancer cell lines compared with the heart.
  • BAX levels were knocked down in THP-1 AML cells using siRNA. While 73% reduction in BAX levels did not affect basal killing by doxorubicin, it resulted in BAI-1 interfering with doxorubicin-induced apoptosis (data not shwon).
  • IC50 values were measured using liposome release experiments using a minimum of 4 inhibitor concentrations around the IC50. Normalized inhibition values are the percentage inhibition of each compound normalized to BAIl, averaged over 5 and 10 ⁇ inhibitor concentrations. IC50 were predicted based on of "Normalized inhibition values" correlated with measured IC50 values.
  • Analytical thin layer chromatography was performed on aluminum-backed Silicycle silica gel plates (250 ⁇ film thickness, indicator F254). Compounds were visualized using a dual wave length (254 and 365 nm) UV lamp, and/or staining with CAM (cerium ammonium molybdate) or KMnC ⁇ stains. NMR spectra were recorded on Bruker DRX 300 and DRX 600 spectrometers.
  • the acetate had presumably formed on the loading column from the desired product and ethyl acetate, triggered by heat formed when DMF remainders in the crude material came in contact with the silica. This behavior was not observed on a significant level in smaller scale reactions and can be avoided by more thorough drying of the crude in high vacuum (10 ⁇ 3 mbar).
  • the acetate can be conveniently hydrolyzed by treatment with potassium carbonate (2.0 equiv) in methanol (0.11 M) for 2h to give another crop of the desired product (685mg, 35 %).
  • Final products can be converted into their (e.g., HC1) salts.
  • C57bl/6 mice are more appropriate than balb/c mice in inducing dilated cardiomyopathy with short-term doxorubicin treatment. Acta Cardiologica Sinica, 28(3):236-240.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

Compounds, compositions and method of using these compounds are disclosed for treating a disease or disorder in which it is desirable to inhibit BAX, such as a cardiovascular disease or disorder.

Description

SMALL MOLECULE BAX INHIBITORS AND USES THEREOF
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional patent application No. 62/469,551, filed on March 10, 2017, the contents of which is herein incorporated by reference in its entirety.
BACKGROUND OF THE INVENTION
[0002] Throughout this application various publications are referred to by number in parentheses. Full citations for these references may be found at the end of the specification. The disclosures of these publications, and all patents, patent application publications and books referred to herein, are hereby incorporated by reference in their entirety into the subject application to more fully describe the art to which the subject invention pertains.
[0003] Apoptosis is an evolutionarily conserved process that plays a critical role in embryonic development and tissue homeostasis. The dysregulation of apoptosis is pivotal to a number of high mortality human pathogenesis including cardiovascular diseases and neurodegenerative diseases. The pro-apoptotic Bcl-2-associated x-protein (BAX) induces mitochondrial outer-membrane permeabilization and represents a key gatekeeper and effector of mitochondrial apoptosis. In addition, BAX facilitates opening of the mitochondrial inner membrane permeability transition pore, thereby functioning as a pivotal activator of necrosis. Thus, inhibition of pro-apoptotic BAX impairs the cells' ability to initiate premature or unwanted cell death in terminally differentiated cells, including cardiomyocytes and neurons. BAX is a central mediator of both necrosis and apoptosis (17).
[0004] Myocardial infarction (MI) is a sudden event in which prolonged ischemia precipitates the deaths of myocardial cells. In ST-segment elevation MI, myocardial ischemia is precipitated by acute thrombotic occlusion of a coronary artery. In the infarct zone, necrotic deaths of cardiomyocytes and non-myocytes predominate, beginning within ~1 h of ischemia and continuing for <1 day. In addition, a delayed wave of apoptosis takes place in the peri-infarct zone peaking at -24 h in myocardial infarction / reperfusion (MI/R). Both forms of cell death play important roles in the evolution of the infarct (1-3). Necrosis is responsible for the drastic decrease in cellularity within the infarct zone and for eliciting downstream tissue responses such as inflammation, matrix remodeling, and later fibrosis (4), and apoptosis in the peri-infarct zone is a major component of early post-infarct remodeling (5). The amount of cardiac damage over the first -24-48 h of MI, "infarct size", is the major determinant of post-MI chronic heart failure and mortality in humans and experimental animals (6,7). As Mis are the proximate cause of -50% of heart failure cases, therapeutic interventions to limit cardiac damage sustained over just the first 24-48 hours present an opportunity to impact the incidence of heart failure.
[0005] Current treatments for MI include: (a) drugs that reduce myocardial oxygen demand (e.g. β-adrenergic receptor blockers) (8-10); and (b) reperfusion, usually through angioplasty/stenting. While both therapies demonstrate efficacy (1 1 -12), considerable mortality remains. The development of effective treatments has proved challenging. Unsuccessful examples include anti-oxidants such as superoxide dismutase (13), Na+/H+ exchange inhibitors (14), and various anti-neutrophil antibodies (15,16).
[0006] The present invention address the need for inhibitors of BAX that can be used to treat MI and other indications in which inhibition of premature or unwanted cell death is desirable, such as, for example, chemotherapy -induced cardiomyopathy.
SUMMARY OF THE INVENTION
[0007] The invention provides compounds having the structure of formula
Figure imgf000003_0001
compositions comprising compounds, and methods of using these compounds for treating a disease or disorder in which it is desirable to inhibit BAX, such as a cardiovascular disease or disorder.
BRIEF DESCRIPTION OF THE DRAWINGS
[0008] FIG. 1. Deletion of BAX in knockout mice reduces myocardial infarct size in vivo. Number of mice shown in circles. Left column in each pair represents data from wild type mice, while right column represents data from BAX knock-out mice. AAR - area at risk, INF - infarct size, LV - left ventricle.
[0009] FIG. 2. Compounds BAI-1 and BAI-2 inhibit membrane permeabilization induced by tBID-activated BAX. Maximum permeabilization of tBID-induced BAX activation was recorded at - 60%. Maximum permeabilization of BAX alone was recorded at -10%. Another compound, BAI-3, was not effective to inhibit tBID-induced BAX activation. tBID, BAI-1, BAI-2, and BAI-3 alone do not stimulate fluorophore release (not shown). Structures of BAI-1 and BAI-2 are illustrated in FIG. 3 A; structure of BAI-3 shown in FIG. 3C.
[0010] FIG. 3A-3C. Structures of compounds.
[0011] FIG. 4. NMR CSP-guided docking of BAI-1 with the BAX monomer structure using Glide (Shrodinger). BAI-1 molecules form a number of hydrophobic contacts, cation- π and electrostatic interactions in the proposed binding site, stabilizing interactions of the hydrophobic core of the BAX structure.
[0012] FIG. 5. Effects of BAI-1 on tBID-induced BAX oligomerization.
[0013] FIG. 6A-6C. BAI-1 potently inhibits primary (A) neonatal and (B) adult cardiomyocyte death induced by hypoxia and hypoxia/reoxygenation (H/R), respectively. Cell death was assessed using calcein AM (alive) and ethidium homodimer (dead) staining. (C) BAI1 inhibits hypoxia-induced loss of inner mitochondrial membrane potential (Δψηι) in neonatal cardiomyocytes.
[0014] FIG. 7. BAI-A19 inhibition of BAX activation in vivo assayed with 6A7 antibody staining.
[0015] FIG. 8. BAI compounds tested in BAX inhibition assay using tBID-induced BAX activation in liposomal membranes. Structures of the compounds are shown in Fig. 3.
[0016] FIG. 9. BAI-A19 potently inhibits primary neonatal cardiomyocyte death induced by hypoxia, whereas the inactive analog, BAI1-A20, does not. Cell death was assessed using calcein AM (alive) and ethidium homodimer (dead) staining.
[0017] FIG. 10. BAI-A22 potently inhibits primary neonatal cardiomyocyte death induced by hypoxia.
[0018] FIG. 11A-11B. BAI-A22 pharmacokinetics. BAI-A22 was injected intravenously in male Sprague Dawley® rats at 1 mg/kg dose and blood plasma and heart tissue were collected at different time points, and drug levels measured by LC-MS/MS. (A) Average BAI-A22 concentrations in blood plasma. (B) Average BAI-A22 concentrations in heart tissue.
[0019] FIG. 12. Simulated heart concentration of BAI-A22. Dose Regimen to reach 3000 μg/mL heart concentration: 650 μg of IV bolus and 132 μg/h IV infusion. Dotted lines indicate the therapeutic window.
[0020] FIG. 13. BAI-1 inhibits tBID-induced BAX mediated cytochrome c release from isolated cardiac mitochondria. The levels of cytochrome c were quantified in mitochondrial and soluble fractions after incubation of mitochondria with tBID, BAX without and with BAI-1.
[0021] FIG. 14. BAI-1 inhibits TNFa-induced BAX-mediated apoptotic cell death in mouse embryonic fibroblasts. Inhibition of BAI-1 required BAX but not BAK.
[0022] FIG. 15. BAI-1 inhibits Ionomycin-induced BAX-mediated necrotic cell death in mouse embryonic fibroblasts as measured by the loss of TMRE fluorescence using FACS analysis.
[0023] FIG. 16. BAI-1 inhibits doxorubicin-induced cell death in rat neonetal cardiomyocytes. Cell death was assessed using calcein AM (alive) and ethidium homodimer (dead) staining.
[0024] FIG. 17. BAI-1 inhibits doxorubicin-induced cell death in human cardiomyocytes derived from human induced pluripotent stem cells. Cell death was assessed using annexin V staining.
[0025] FIG. 18. BAI-A22 inhibits doxorubicin-induced apoptosis in mouse embryonic fibroblasts. Apoptosis was induced with either staurosporine (STS) or pro-apoptotic ABT- 737 drug.
[0026] FIG. 19A-19C. BAX inhibitor effect on heart function in doxorubicin-treated mice. (A) Effects of doxorubicin with or without BAX inhibitors BAI-1, BAI-A2, and BAI- A22 on ejection fraction in acute doxorubicin model. Groups were compared using one-way ANOVA followed by Tukey's multiple comparisons test. (B) Effect of doxorubicin with or without BAX inhibitor BAI-1 on ejection fraction in acute doxorubicin model. Groups were compared using one-way ANOVA followed Dunnett's multiple comparisons test. (C) Effect of doxorubicin with or without BAX inhibitor BAI-A22 on ejection fraction in acute doxorubicin model. Groups were compared using one-way ANOVA followed Dunnett's multiple comparisons test.
[0027] FIG. 20A-20B. BAI-1 inhibits cardiomyocyte apoptosis and necrotic cell death. (A) TUNEL assay was used to measure apoptosis in neonatal rat cardiomyocytes (NRCM) under normoxia and hypoxia with or without 1 μΜ BAI-1. Quantification of percentage of TUNEL positive cells. (B) NRCM were pre-treated with varying concentrations of BAI-1 and cultured under normoxic or hypoxic conditions. BAI-1 dose response. Percentage of dead cells represents percentage of ethidium homodimer- l(EthD) positive cells.
[0028] FIG. 21A-21C. BAI-A1, BAI-A2 and BAI-A21 inhibit cardiomyocyte necrotic cell death. NRCM were pre-treated with varying concentrations of BAI-A1 (A), BAI-A2 (B) or BAI-A21 (C) and cultured under normoxic or hypoxic conditions. Percentage of dead cells represents percentage of EthD positive cells.
[0029] FIG. 22A-22B. BAI-1 and BAI-A1 inhibit adult cardiomyocyte necrosis. Adult rat cardiomyocytes were pre-treated with varying concentrations of BAI-1 (A) or BAI-A1 (B) and subjected to hypoxia and reoxygenation (H/R). Percentage of dead cells represents percentage of EthD positive cells.
[0030] FIG. 23. BAI-A2 inhibits doxorubicin-induced cardiomyocyte necrosis. NRCM were pre-treated with varying concentrations of A2 and then stimulated with 10 μΜ doxorubicin for 18 hr. A2 dose response. Percentage of dead cells represents percentage of EthD positive cells.
[0031] FIG. 24A-24C. BAI-1 reduces doxorubicin-induced cardiac fibrosis, apoptosis and necrosis. (A) Hearts were collected from mice in the acute doxorubicin model and sectioned to measure fibrosis using Masson Trichrome staining. Percentage of area with blue collagenous stain per field. (B) Hearts were collected from mice in the acute doxorubicin model and sectioned to stain for apoptosis marker, TUNEL. Percentage of TUNEL positive nuclei per field. (C) Hearts were collected from mice in the acute doxorubicin model and sectioned to immunostain for high motility group box 1 (HMGBl), loss of which indicates necrosis. Percentage of nuclei that lost HMGBl per field.
[0032] FIG. 25A-25B. BAI-1 effects on doxorubicin-induced cardiac apoptosis in chronic model. (A) Hearts were collected from mice in the chronic doxorubicin model and sectioned to stain for the apoptosis marker, TUNEL. Percentage of TUNEL positive nuclei per field. (B) Hearts were collected from mice in the chronic doxorubicin model and sectioned to immunostain for HMGBl, loss of which indicates necrosis. Percentage of nuclei that lost HMGBl per field.
[0033] FIG. 26. Chronic model of doxorubicin and trastuzumab combination therapy. Experimental scheme for chronic model of doxorubicin and trastuzumab-induced cardiomyopathy. In doxorubicin group, mice were administered 3 mg/kg doxorubicin for 8 injections. In doxorubicin plus trastuzumab group, mice were administered 1 week later with 2 mg/kg trastuzumab for 6 injections. Echocardiography was performed at week 8 from the start of experiment. Trastuzumab (TRZ).
[0034] FIG. 27. BAI-1 protects the heart against doxorubicin and trastuzumab combination therapy. Echocardiographic assessment of cardiac function and dimensions showing significant rescue by BAI-1. Ejection fraction (EF); fractional shortening (FS); stroke volume (SV). Trastuzumab (TRZ). Saline, n=6; DOX, n=8; DOX+TRZ, n=8; DOX+TRZ+BAI1, n=8 mice.
[0035] FIG. 28. BAI-1 does not inhibit doxorubicin-induced breast cancer cell death. Human breast cancer cell lines LM2, MDA-MB-231, 3475 and MCF-7 were treated with doxorubicin without or with varying concentrations of BAI-1. Percentage of cell viability is relative to 100% viability of an untreated control group (not shown). BAI-1 did not interfere with doxorubicin-induced killing of any of the breast cancer cells. Cell viability was assessed using CytoTox-Glo Cytotoxicity Assay (Promega).
[0036] FIG. 29. Effects of BAI-1 on doxorubicin-induced AML cell viability in vitro. Human AML cell lines THP-1, HL-60 and MOLM-13 were treated with doxorubicin without or with varying concentrations of BAI-1. Percentage of cell viability is relative to 100% viability of an untreated control group (not shown). BAI-1 did not interfere with doxorubicin-induced killing of any of the AML cells.
DETAILED DESCRIPTION OF THE INVENTION
[0037] The invention provides a method of treating a disease or condition in a subject in which it is desirable to inhibit Bcl-2-associated x-protein (BAX) comprising administering to the subject one or more of the compounds of formula (I) and/or formula (IV) in an amount effective to treat the disease or condition in a subject, wherein formula (I) and formula (IV) have the structure
Figure imgf000007_0001
wherein
A is phenyl or a 6-membered heteroaromatic ring having 1 , 2 or 3 N atoms in the heteroaromatic ring;
B is phenyl, or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring; or a 6-membered aliphatic ring with up to 3 heteroatoms;
the dashed line between A and B indicates an optional bond;
Rl and R2 are independently none, C1-C5 alkyl, F, CI, Br, I, CN, N02, NR4, NR42, OR4, CF3, COOH, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4; X is H, NH2, OH, O, F, CI, Br, I, CN, SH, N02, NR4, NR42, OR, CF3, COOH, R4, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4; wherein the bond between X and the le bond or a double bond, depending on the definition of X;
Q
Figure imgf000008_0001
(CH2)mN((CH2)0R5)2, COH, COOH, or CH2NH(CH2)iOH
R3 is none, H, C1-C6 alkyl, R4(C=0), or (CH2)pOH;
R4 is H or Cl-C3 alkyl;
each R5 is independently OH, SH, NR42 or R4;
Y is O, S, N or CH;
Z is O, S, NR4, CHR4, S(0)2, C(Me)2 or C(O);
each 1, m, n, o and p is independently 1-3;
or a pharmaceutically acceptable salt thereof.
[0038] In one embodiment of the methods and compounds disclosed herein, compound can have, for example, the structure of formula (II), (III), (IV) or (VI)
Figure imgf000008_0002
Figure imgf000008_0003
or a pharmaceutically acceptable salt thereof. [0039] In one embodiment of the methods and compounds disclosed herein, there is no bond between A and B. In one embodiment, Rl and/or R2 are in the para position with respect to the bond to the N atom.
[0040] In one embodiment of the methods and compounds disclosed herein, the compound can have a structure, for example, selected from the group consisting of
Figure imgf000009_0001
Figure imgf000009_0002
Figure imgf000010_0001
10
Figure imgf000011_0001
and
Figure imgf000012_0001
, or a pharmaceutically acceptable salt thereof.
[0041] Preferably, the one or more compounds is administered in an amount effective to inhibit BAX in a subject.
[0042] The invention also provides a method of inhibiting Bcl-2-associated x-protein (BAX) in a subject comprising contacting the BAX with one or more of the compounds of formula (I) and/or formula (IV) in an amount effective to inhibit BAX, wherein formula (I) and formula (IV) have the structure as defined herein.
[0043] Also provided is a method of inhibiting Bcl-2-associated x-protein (BAX) comprising contacting BAX with one or more of any of the compounds or pharmaceutical compositions disclosed herein in an amount effective to inhibit BAX. Preferably, the BAX is in a subject, and the one or more compounds or compositions is administered to the subject.
[0044] The subject being administered the compound, and being treated, may have, for example, a disease or condition is selected from the group consisting of hypoxic cardiomyocytes, cardiac ischemia, cardiac ischemia-reperfusion injury, myocardial infarction, myocardial infarction and reperfusion injury, chemotherapy -induced cardiotoxicity, arteriosclerosis, heart failure, heart transplantation, aneurism, chronic pulmonary disease, ischemic heart disease, hypertension, pulmonary hypertension, thrombosis, cardiomyopathy, stroke, a neurodegenerative disease or disorder, an immunological disorder, ischemia, ischemia-reperfusion injury, infertility, a hematological disorder, renal hypoxia, hepatitis, a liver disease, a kidney disease, an intestinal disease, liver ischemia, intestinal ischemia, asthma, AIDS, Alzheimer's disease, Parkinson's disease, Huntington's disease, retinitis pigmentosa, spinal muscular atrophy, cerebellar degeneration, amyotrophic lateral sclerosis, organ transplant rejection, arthritis, lupus, irritable bowel disease, Crohn's disease, asthma, multiple sclerosis, diabetes, premature menopause, ovarian failure, follicular atresia, fanconi anemia, aplastic anemia, thalassemia, congenital neutropenia, myelodysplasia, and a disease or disorder involving cell death and/or tissue damage.
[0045] In the case where the disease or condition is chemotherapy -induced cardiotoxicity, preferably the compound does not interfere with the ability of the chemotherapeutic agent to treat cancer. The chemotherapeutic agent can be, for example, one or more of doxorubicin and trastuzumab. The cancer can be, for example, one or more of a leukemia, a solid tumor, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML), breast cancer, prostate cancer, lymphoma, skin cancer, pancreatic cancer, colon cancer, melanoma, malignant melanoma, ovarian cancer, brain or spinal cord cancer, primary brain carcinoma, medulloblastoma, neuroblastoma, glioma, head-neck cancer, glioma, glioblastoma, liver cancer, bladder cancer, stomach cancer, kidney cancer, placental cancer, cancer of the gastrointestinal tract, non-small cell lung cancer (NSCLC), head or neck carcinoma, breast carcinoma, endocrine cancer, eye cancer, genitourinary cancer, cancer of the vulva, ovary, uterus or cervix, hematopoietic cancer, myeloma, leukemia, lymphoma, ovarian carcinoma, lung carcinoma, small-cell lung carcinoma, Wilms' tumor, cervical carcinoma, testicular carcinoma, bladder carcinoma, pancreatic carcinoma, stomach carcinoma, colon carcinoma, prostatic carcinoma, genitourinary carcinoma, thyroid carcinoma, esophageal carcinoma, myeloma, multiple myeloma, adrenal carcinoma, renal cell carcinoma, endometrial carcinoma, adrenal cortex carcinoma, malignant pancreatic insulinoma, malignant carcinoid carcinoma, choriocarcinoma, mycosis fungoides, malignant hypercalcemia, cervical hyperplasia, leukemia, acute lymphocytic leukemia, chronic lymphocytic leukemia, chronic granulocytic leukemia, acute granulocytic leukemia, acute myelogenous leukemia, chronic myelogenous leukemia, hairy cell leukemia, neuroblastoma, rhabdomyosarcoma, Kaposi's sarcoma, polycythemia vera, essential thrombocytosis, Hodgkin's disease, non-Hodgkin's lymphoma, soft tissue cancer, soft-tissue sarcoma, osteogenic sarcoma, sarcoma, primary macroglobulinemia, central nervous system cancer and retinoblastoma.
[0046] Also provided is a method of treating a myocardial infarction or a myocardial infarction and reperfusion injury in a subject comprising administering to the subject one or more of the compounds or pharmaceutical compositions disclosed herein in an amount effective to treat a myocardial infarction or a myocardial infarction and reperfusion injury in a subject in need thereof. Preferably, the one or more compounds or the pharmaceutical composition is administered in an amount effective to inhibit Bcl-2-associated x-protein (BAX) in a subject.
[0047] The subject can be, for example, a mammal, and is preferably a human.
[0048] As used herein, "treating" or to "treat" a disease or disorder means to alleviate or ameliorate or eliminate a sign or symptom of the disease or disorder that is being treated. When the compound or composition is administered to a subject before or at the onset of a disease or disorder, the compound or composition can prevent or reduce the severity of the disease or disorder. For example, administration of the compound to a subject can prevent or reduce the severity of chemotherapy -induced cardiotoxicity that would occur in the absence of administration of the compound. Administration of the compound can include preventive and/or therapeutic administration.
[0049] The compounds and compositions of the present invention can be administered to subjects using routes of administration known in the art. The administration can be systemic or localized to a specific site. Routes of administration include, but are not limited to, intravenous, intramuscular, intrathecal or subcutaneous injection, oral or rectal administration, and injection into a specific site.
[0050] Preferably, the compounds and compositions disclosed herein are administered acutely to treat a disease or disorder, due to potential hazards of long-term inhibition of cell death, e.g. cancer. The therapy can be used in conjunction with effective existing therapies for treating the disease or disorder, such as, e.g., angioplasty/stenting for cardiovascular disease.
[0051] The invention provides a compound having the structure of formula (VII)
Figure imgf000014_0001
wherein
A is phenyl or a 6-membered heteroaromatic ring having 1 , 2 or 3 N atoms in the heteroaromatic ring;
B is phenyl, or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring; or a 6-membered aliphatic ring with up to 3 heteroatoms; Rl and R2 are independently none, C1-C5 alkyl, F, CI, Br, I, CN, N02, NR4, NR42, OR4, CF3, COOH, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4;
X is H, NH2, OH, O, F, CI, Br, I, CN, SH, N02, NR4, NR42, OR, CF3, COOH, R4, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4; wherein the bond between X and the main scaffold is a single bond or a double bond, depending on the definition of X;
Q is
Figure imgf000015_0001
(CH2)mN((CH2)0R5)2, COH, COOH, or CH2NH(CH2)!OH;
R3 is none, H, C1-C6 alkyl, R4(C=0), or (CH2)pOH;
R4 is H or Cl-C3 alkyl;
each R5 is independently OH, SH, NR42 or R4;
Y is O, S, N or CH;
each 1, m, n, o and p is independently 1-3;
or a pharmaceutically acceptable salt thereof.
[0052] The compound can have, for example, the structure of formula (VIII) or (IX)
Figure imgf000015_0002
or a pharmaceutically acceptable salt thereof.
[0053] The compound can have, for example, a structure selected from the group consisting of
Figure imgf000016_0001
or a pharmaceutically acceptable salt thereof.
[0054] The invention also provides a compound having the structure of formula (X) or (XI)
Figure imgf000016_0002
wherein A is phenyl or a 6-membered heteroaromatic ring having 1 , 2 or 3 N atoms in the heteroaromatic ring;
B is phenyl, or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring; or a 6-membered aliphatic ring with up to 3 heteroatoms;
with the proviso that at least one of A and B is not phenyl;
the dashed line between A and B indicates an optional bond;
Rl and R2 are independently none, C 1-C5 alkyl, F, CI, Br, I, CN, N02, NR4, NR42, OR4, CF3, COOH, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4;
X is H, NH2, OH, O, F, CI, Br, I, CN, SH, N02, NR4, NR42, OR, CF3, COOH, R4, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4; wherein the bond between X and the le bond or a double bond, depending on the definition of X;
Q
Figure imgf000017_0001
(CH2)mN((CH2)0R5)2, COH, COOH, or CH2NH(CH2; OH;
R3 is none, H, C 1-C6 alkyl, R4(C=0), or (CH2)pOH;
R4 is H or Cl -C3 alkyl;
each R5 is independently OH, SH, NR42 or R4;
Y is O, S, N or CH;
Z is O, S, NR4, CHR4, S(0)2, C(Me)2 or C(O);
each 1, m, n, o and p is independently 1 -3;
or a pharmaceutically acceptable salt thereof.
[0055] In one embodiment, Z is O, NR4, CHR4, S(0)2, C(Me)2 or C(O).
[0056] Pharmaceutically acceptable salts that can be used with compounds of the present invention include, e.g., non-toxic salts derived, for example, from inorganic or organic acids including, but not limited to, salts derived from hydrochloric, sulfuric, phosphoric, acetic, lactic, fumaric, succinic, tartaric, gluconic, citric, methanesulphonic and p-toluenesulphonic acids.
[0057] The invention also provides a pharmaceutical composition comprising one or more of the compounds disclosed herein and a pharmaceutically acceptable carrier. Pharmaceutically acceptable carriers and diluents that can be used herewith encompasses any of the standard pharmaceutical carriers or diluents, such as, for example, a sterile isotonic saline, phosphate buffered saline solution, water, and emulsions, such as an oil/water or water/oil emulsions. The pharmaceutical compositions can be formulated to be advantageous for the selected route of administration to a subject.
[0058] As used herein, "BAX" is Bcl-2-associated x-protein. In an embodiment, the BAX is mammalian. In a preferred embodiment, the BAX is a human BAX. In an embodiment, the BAX comprises consecutive amino acid residues having the following sequence:
MDGSGEQPRGGGPTS SEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRI G DELDSNMELQRMIAAVDTDS PREVFFRVAADMFSDGNFNWGRWALFYFASKLVLKALCTKVPEL I R TIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVT I FVAGVLTASLT IWKKMG (SEQ ID NO: l).
[0059] As used herein, small molecule BAX inhibitors are defined as compounds that bind to BAX and inhibit its function.
[0060] All combinations of the various elements described herein are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
[0061] This invention will be better understood from the Experimental Details, which follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
EXPERIMENTAL DETAILS
BAX is a therapeutic target for MI/R
[0062] To determine whether BAX provides a therapeutic target for MI/R in vivo, wild type and BAX knockout (KO) mice were subjected to 45 min ischemia/24 h reperfusion. These KO mice have a generalized deletion of BAX making them a good model for the antagonism of BAX in both cardiomyocytes and non-myocytes. Area at risk (AAR) was measured by Evans blue dye and infarct size by tetrazolium chloride (TTC) staining (Fig. 1). Consistent with a previous study in isolated hearts (18), BAX deletion markedly reduced infarcts indicating that BAX plays an important role in the pathogenesis of infarction in vivo. These KO mice have a generalized deletion of BAX making them a good model for the antagonism of BAX in both cardiomyocytes and non-myocytes.
Identification of a small molecule inhibitor of BAX
[0063] Previously, a small molecule screen using isolated mitochondria, revealed compounds that inhibit tBID-induced cytochrome c release. These compounds were hypothesized, but never shown, to work through BAX inhibition (19, 20). Accordingly, it was first investigated whether several of these small molecules inhibit BAX-mediated permeabilization of artificial membranes of similar lipid composition to the outer mitochondrial membrane (OMM). A liposome release assay (21), in which liposomes that contain a fluorophore are created, was used. Incorporation of tBID-activated BAX into the liposome membrane stimulates release of the fluorophore, providing a system to study BAX-mediated membrane permeabilization in isolation of other mitochondrial and cellular factors. Using this assay, a lead small molecule, termed BAX Activation Inhibitor 1 (BAI- 1) (Fig. 3 A), was shown to inhibit liposomal release of fluorophore in a dose-dependent and BAX-dependent manner (Fig. 2). Moreover, another compound, BAI-2, inhibited BAX- induced liposomal release (Fig. 2). These results indicate that inhibition of tBID-induced cytochrome c release from mitochondria by BAI-1 involves antagonism of BAX.
[0064] Next, it was tested whether BAI-1 binds to recombinant, purified BAX using 1H-NMR, and this was found to be the case (data not shown). To identify the mechanism of BAI-1 binding to BAX, 15Ν-ΧΗ HSQC NMR analysis of BAX was performed upon titration of BAI-1. BAI-1 induced significant chemical shift perturbations on HSQC spectra of BAX, which were localized in the region formed by a-helices 3, 4, and 5 and the loop between a- helices 3 and 4 (data not shown). A few chemical shift changes in other regions of the structure were not localized and occurred predominantly in hydrophobic residues at the hydrophobic core of the BAX structure. These NMR data highlight a binding site for BAI-1 in a region of the BAX structure distinct from the trigger site and for which information does not currently exist regarding effects on BAX activation. To identify precisely how BAI-1 binds to and inhibits BAX, NMR data were used to guide molecular docking studies. Fig. 5 shows a close-up view of the novel BAX binding site and the bound docked structure of BAI-1.
[0065] It was hypothesized that BAI-1 stabilizes the interactions among these helices and the BAX structure and, through this mechanism, inhibits BAX conformational activation by BH3-only proteins. To assess inhibition of BAX activation by BAI-1, BAX oligomerization (which is downstream of activation) was tested using immunoblotting after cross-linking with BMH (Fig. 5). BAI-1 inhibited tBID-induced BAX oligomerization (lane 8 versus lane 6). Since BAI-1 does not inhibit the binding of BH3-only activator proteins to BAX (not shown), the most likely model is that BAI-1 functions as an allosteric inhibitor of BAX activation. BAI-1 mechanism of action
[0066] A key event in BAX activation is exposure of a helix 9 containing a transmembrane domain that inserts tightly into the outer mitochondrial membrane (OMM). BAX insertion into the OMM can be assessed by treating isolated mitochondria with strong alkali, which separates loosely attached proteins from mitochondria but fails to extract membrane-inserted proteins. Staurosporine (STS) treatment of mouse embryonic fibroblasts resulted in a pool of BAX that could not be retrieved by treatment of isolated mitochondria with strong alkali. Treatment of cells with BAI-1 significantly decreased the inserted pool. These data indicate that BAI-1 inhibits STS-induced exposure of BAX a helix 9. One important result of BAX conformational activation is its translocation from cytosol to mitochondria. Thus, it was also evaluated whether BAI-1 can inhibit STS- induced BAX translocation. Translocation was assessed by immunostaining for mitochondrial BAX puncta. BAI-1 significantly decreased BAX translocation to the mitochondria in a dose-dependent fashion. A similar result was observed with BAI-A22. (Data not shown.)
BAI-1 inhibits apoptotic cell death and necrotic cell death
[0067] BAI-1 inhibits TNFa-induced BAX-mediated apoptotic cell death in mouse embryonic fibroblasts (Fig. 14). Inhibition of BAI-1 required BAX but not BAK. Nuclear fragmentation was also inhibited, as shown using BAI-1 and BAI-A22; extemalization of phosphatidylserine was reduced as shown using BAI-1 (data not shown). BAI-1 also inhibits Ionomycin-induced BAX-mediated necrotic cell death in mouse embryonic fibroblasts as measured by the loss of TMRE fluorescence using FACS analysis (Fig. 15).
BAI-1 inhibits cardiomyocyte death
[0068] It was tested if BAI-1 can inhibit cell death in cardiomyocytes challenged with a noxious stimuli relevant to MI/R. At -10 nM concentrations, BAI-1 inhibited cell death in neonatal and adult cardiomyocytes challenged with 18 h of 3% hypoxia and lh hypoxia/2h reoxygenation, respectively, both effects occurring in a dose-dependent manner (Fig. 6A,B). To explore the mechanism by which BAI-1 inhibits cardiomyocyte death, TMRM staining was used to assess its effect on loss of inner mitochondrial membrane potential (Δψιτι), which occurs with opening of the mPTP. BAI-1 markedly inhibited loss of Δψπι (Fig. 6C). BAI-1 also inhibits tBID-induced BAX mediated cytochrome c release from isolated cardiac mitochondria. The levels of cytochrome c were quantified in mitochondrial and soluble fractions after incubation of mitochondria with tBID, BAX without and with BAI-1 (Fig. 13). It was also demonstrated that BAI-1 inhibits doxorubicin-induced cell death in rat neonetal cardiomyocytes (Fig. 16) and that BAI-1 inhibits doxorubicin-induced cell death in human cardiomyocytes derived from human induced pluripotent stem cells (Fig. 17). These data demonstrate that BAI-1 potently inhibits neonatal and adult cardiomyocyte death and that mitochondrial mechanisms are involved. BAI-1 inhibits cardiomyocyte apoptosis and necrotic cell death (Fig. 20A-B). BAI-A2 was also tested and shown to inhibit doxorubicin- induced cardiomyocyte necrosis (Fig. 23).
BAI-A1 inhibits BAX during MI/R in vivo
[0069] While BAI-1 potently inhibited cell death in isolated cardiomyocytes, it was discovered that BAI-1 is 99.9% bound to plasma proteins in mouse plasma (not shown). Based on its chemical structure, BAI-1 was re-engineered by removing both bromines to lower its hydrophobicity and, thereby, reduce its plasma protein binding. The resulting BAI-A1 (Fig. 3A) exhibited 89.4% plasma protein binding. As expected from the hypothesized role of the bromines in the BAI-1 -BAX interaction, BAI-A1 exhibited less BAX binding than BAI-1 (not shown). Despite this, its ability to protect neonatal and adult cardiomyocytes against hypoxia and hypoxia/reoxygenation was only modestly decreased (not shown). Accordingly, the ability of BAI-A1 to inhibit BAX activation during MI/R was tested in vivo (Fig. 7). BAI-A1 potently blocks BAX conformational activation as assessed by immunostaining with 6A7, an antibody that recognizes only the active conformer of BAX. This was assessed following 45 min ischemia/6h reperfusion, the time point that BAX is activated maximally in the absence of drug. It was concluded that BAI- Al can access myocardial cells and is effective at inhibiting BAX activation during MI/R in vivo. The pharmacokinetics of BAI-A1 were measured in the mouse by injecting 1 mg/kg into a cohort of mice and harvesting plasma and heart tissue 0, 1, 6, and 24 h. The half-life of BAI-A1 was -3.5 h in both plasma and heart tissue.
Studies with additional compounds
[0070] Fig. 8 and Table 1 show IC50 values for BAI compounds tested in a BAX inhibition assay using tBID-induced BAX activation in liposomal membranes. The structures of the compounds are shown in Fig. 3.
[0071] Fig. 9 shows that BAI-A19 potently inhibits primary neonatal cardiomyocyte death induced by hypoxia, whereas the inactive analog, BAI-A20, does not. [0072] Fig. 18 shows that BAI-A22 inhibits doxorubicin-induced apoptosis in mouse embryonic fibroblasts. Fig. 10 shows that BAI-A22 potently inhibits primary neonatal cardiomyocyte death induced by hypoxia. Fig. 11 shows BAI-A22 pharmacokinetics in blood plasma and heart tissue. Pharmacokinetic parameters for BAI-A22 are shown in Table 2. Plasma protein binding was measured in rats for BAI-A22, which was found to be 95.6% bound. Fig 12 shows the simulated heart concentration of BAI-A22.
[0073] Compounds BAI-1 (Fig. 22A), BAI-A1 (Figs. 21A, 22B), BAI-A2 (Fig. 21B) and BAI-A21 (Fig. 21C) inhibit necrosis in cardiomyocytes in a dose-dependent manner.
[0074] Pharmacokinetic properties were determined for compounds BAI-1, BAI-A1 and BAI-A22. Their half-life in plasma was, respectively, 45 hours, 3.5 hours and 5 hours.
In vivo studies
Effects of B AX inhibitors on chemotherapy-induced car diotoxicity.
[0075] Doxorubicin is extensively used for both adults and children to treat many types of cancers, including solid tumors, such as breast cancer, leukemia and lymphomas (27). It is considered as one of the most potent of the Food and Drug Administration (FDA)- approved cancer drugs (28). Doxorubicin's clinical use is limited by its severe dose- dependent and often lethal heart failure (27), even emerging years after termination of treatment (29).
[0076] Studies using BAX knockout mice showed that deletion of Bax protected mice from doxorubicin-induced cardiac dysfunction as measured by improvements in fractional shortening and systolic wall thickening and decreases in apoptotic and necrotic cardiac cell death (data not shown).
[0077] Doxorubicin-induced cardiotoxicity is known to increase BAX levels and drive apoptosis in cardiac cells and is a real clinical problem. A number of new chemotherapy drugs have the same side-effect and cardiotoxicity prevents their use at more effective doses. Fig. 19A-C illustrates the effects of three BAX inhibitors on heart function in doxorubicin-treated mice. C57BL/6 male mice 8 weeks of age were purchased from Charles River Laboratories and randomly grouped (n = 8 to 13). An acute heart failure model was generated by a single intraperitoneal injection of doxorubicin (20 mg/kg) dissolved in saline. BAI-1, BAI-A2 and BAI-A22 were administered to mice by a single intraperitoneal injection of 2mg/kg dose. Both BAI-1 (Fig. 19B) and BAI-22 (Fig. 19C) were therapeutically effective at the dose used. Similar therapeutic effects were observed with BAI-21 (data not shown). [0078] Hearts were collected from mice in the acute doxorubicin model and sectioned to measure fibrosis using Masson Trichrome staining, or stained for the apoptosis marker, TU EL, or immunostained for HMGB1, loss of which indicates necrosis. BAI-1 reduced doxorubicin-induced cardiac fibrosis, apoptosis and cardiac necrosis (Fig. 24A-C).
Chronic doxorubicin-induced cardiomyopathy mouse model
[0079] Patients typically receive several "cycles" of doxorubicin administered at lower doses. The exact protocol depends on the cancer being treated. For example, some leukemias are treated with 4 cycles of 60 mg/m2 (which would be the equivalent of 1.5 mg/kg) IV administered every 21-28 days. Cumulative doxorubicin dose of 20-25 mg/kg has been shown to induce a clinically relevant cardiomyopathy in mice (30-32). Based on this experience, a chronic protocol was used in which mice receive 3 mg/kg doxorubicin IP every other day x 8 doses (i.e. over a two-week period) for a cumulative dose of 24 mg/kg.
[0080] BAI-1 and BAI-A22 were tested for their ability to protect the heart against doxorubicin-induced cardiomyopathy, using a dose of 2 mg/kg. BAI1 and A22 significantly protected the heart from cardiac dysfunction as assessed by fractional shortening, ejection fraction and systolic wall thickening. Doxorubicin-induced apoptotic and necrotic cardiac cell death were largely abrogated as tested using BAI-1, as shown by TUNEL (Fig. 25 A) and HMGB1 loss (Fig. 25B), respectively.
[0081] Trastuzumab is a humanized monoclonal antibody against the human epidermal growth factor receptor 2 (HER2) receptor and was approved by the FDA in 1998 as a therapy for HER2-positive breast cancer patients (33, 34). The combination of doxorubicin with tratuzumab increases treatment efficacy but also is often accompanied by increased cardiotoxicity (35). The effects of BAI-1 were tested using the chronic doxorubicin model followed by the initiation one week later of trastuzumab (Fig. 26). Echocardiography was performed at week 8 following initiation of doxorubicin. Results show that doxorubicin+trastuzumab induced cardiac dysfunction was inhibited by BAI-1 as assessed using ejection fraction, fractional shortening and stroke volume (Fig. 27).
BAI-1 does not inhibit doxorubicin-induced cancer cell death
[0082] Fig. 28 illustrates human breast cancer cell lines LM2, MDA-MB-231, 3475 and MCF-7 treated with doxorubicin without or with varying concentrations of BAI-1. BAI-1 did not interfere with doxorubicin-induced killing of any of the breast cancer cells. Co- treatment with BAI-1 also did not compromise the cytotoxic effect of doxorubicin in an in vivo breast cancer xenograft mouse model (data not shown).
[0083] BAI-1 also did not effect of the ability of doxorubicin to kill acute myeloid leukemia (AML) cell lines in culture (Fig. 29). Co-treatment with BAI-1 also did not compromise the cytotoxic effect of doxorubicin in an in vivo AML heterograft mouse model (data not shown). BAI-1 protected against doxorubicin-induced cardiomyopathy in the same mice whose leukemia burden was successfully reduced by doxorubicin. These results indicate that BAI-1 can protect against doxorubicin-induced cardiomyopathy without interfering with reduction of leukemia burden in the same animals.
[0084] BAX levels were assessed in the adult heart versus the 4 breast cancer and 3 AML cell lines that were studied above. BAX levels were uniformly increased in the cancer cell lines compared with the heart. Next, to test the functional significance of the high BAX levels in tumor cells as a mechanism to escape BAI-1 from inhibiting doxorubicin-induced killing, BAX levels were knocked down in THP-1 AML cells using siRNA. While 73% reduction in BAX levels did not affect basal killing by doxorubicin, it resulted in BAI-1 interfering with doxorubicin-induced apoptosis (data not shwon). These data suggest that high BAX levels in tumors compared to the heart may be one mechanism by which BAI-1 protects the heart against doxorubicin without interfering with its killing of tumor cells.
[0085] Table 1. BAX inhibition activity of BAI compounds in liposomal assays upon tBID-induced BAX activation.
Inhibitor Predicted IC50/ μΜ Measu red IC !
BAIl 4.0 4.0
BAI 2 4.8 5.0
BAI-A1 >20 40.0
BAI-A2 9.4 9.0
BAI-A4 8.6 -
BAI-A5 9.8 -
BAI-A6 12.8 -
BAI-A7 10.5 -
BAI-A8 14.0 -
BAI-A9 9.7 -
BAI-A10 10.8 -
BAI-A11 10.4 -
BAI-A12 8.8 -
BAI-A13 13.8 13.0
BAI-A14 15.3 -
BAI-A15 11.7 6.0
BAI-A16 - 18.0
BAI-A17 - 27.0
BAI-A18 - 15.0
BAI-A19 - 26.0
BAI-A20 - »100
BAI-A21 - 4.5
BAI-A22 - 11
IC50 values were measured using liposome release experiments using a minimum of 4 inhibitor concentrations around the IC50. Normalized inhibition values are the percentage inhibition of each compound normalized to BAIl, averaged over 5 and 10 μΜ inhibitor concentrations. IC50 were predicted based on of "Normalized inhibition values" correlated with measured IC50 values.
Table 2. BAI-A22 pharmacokinetic parameter estimates from NCA
Units Estimate
5.G4
A y
c 318
Λ !¾*
nr. 2,15
131
V i/¼ 10. S
Figure imgf000026_0001
.l r*Hg/rot 524
Pharmacokinetic parameters from non-compartmental analysis using WinNonLin software. Co: maximum plasma concentration extrapolated to t=0; tmaX: time of maximum plasma concentration; ti/2: half-life; MRTiast: mean residence time, calculated to the last observable time point; CL: clearance; Vss: steady state volume of distribution; AUCiast: area under the curve, calculated to the last observable time point; AUC: area under the curve, extrapolated to infinity.
Materials and Methods for the Chemical Syntheses
[0086] All chemical reagents and solvents were obtained from commercial sources (Aldrich, Acros, Fisher) and used without further purification unless otherwise noted. Anhydrous solvents (tetrahydrofurane, toluene, dichloromethane, diethyl ether) were obtained using a Pure Solv™ AL-258 solvent purification system. N,N- Dimethylformamide was degassed and dried over freshly activated 4A molecular sieves. Chromatography was performed on a Teledyne ISCO CombiFlash Rf 200i using disposable silica cartridges (4, 12, and 24 g). Analytical thin layer chromatography (TLC) was performed on aluminum-backed Silicycle silica gel plates (250 μιτι film thickness, indicator F254). Compounds were visualized using a dual wave length (254 and 365 nm) UV lamp, and/or staining with CAM (cerium ammonium molybdate) or KMnC^ stains. NMR spectra were recorded on Bruker DRX 300 and DRX 600 spectrometers. XH and 1 C chemical shifts (δ) are reported relative to tetramethyl silane (TMS, 0.00/0.00 ppm) as internal standard or to residual solvent (CD30D: 3.31/49.00 ppm; CDCI3: 7.26/77.16 ppm; dmso-<¾: 2.50/39.52 ppm; acetone-<¾: 2.05/29.84 ppm; acetonitrile-<¾: 1.94/1.32 ppm). Mass spectra were recorded on a Shimadzu LCMS 2010EV (direct injection unless otherwise noted).
[0087] 3,6-difluoro-9H-carbazole (22), 3,6-bis(trifluoromethyl)-9H-carbazole (23), 3,6- dimethyl-9H-carbazole (24) , and tert-butyl piperazine-1 -carboxylate (25) were synthesized according to literature procedures. As an alternative to Pd-catalyzed animations, requisite diaryl amnines can be conveniently prepared using KnochePs procedure (26).
Typical synthetic procedure - synthesis of BAI-A22
Figure imgf000027_0001
TFA R' = Boc
ΟΗ2ΟΙ2 ^- R' = H
Scheme 1: Synthesis of BAI-A22 and its analogs. tert-Butyl piperazine-1 -carboxylate was added to 2-(bromomethyl)oxirane to give intermediate. Amines were deprotonated using sodium hydride and used to open the epoxide. The resulting secondary alcohol was subjected to standard Boc deprotection conditions to obtain BAI-A22 and its analogs. (THF = tetrahydrofurane; DMF = Ν,Ν-dimethylformamide, TFA = trifluoroacetic acid; Boc = tert-butylcarboxylate)
Figure imgf000027_0002
Synthesis of tert-butyl 4-(3-((4-bromophenyl)(phenyl)amino)-2-hydroxypropyl)piperazine-l- carboxylate. In a flame-dried 60mL Centrifuge tube with septum and stir bar, sodium hydride (60% dispersion in mineral oil) (258 mg, 6.45 mmol, 1.60 equiv) was suspended in dry DMF (5.7 mL) under an argon atmosphere. In a separate dry and argon-flushed tube, 4- bromo-N-phenylaniline (1.50 g, 6.05 mmol, 1.50 equiv) was dissolved in dry DMF (18.4 mL). The NaH-suspension was cooled to 0 °C (ice bath) and the diphenylamine solution was slowly added over ca 10-15 min. A color change to bright yellow, later green was observed. After 20 min, the mixture was warmed to room temperatue (RT) and stirred for an additional 30 min. The mixture then was cooled to 0° C again. [0088] A solution of tert-butyl 4-(oxiran-2-ylmethyl)piperazine-l -carboxylate (0.977 g, 4.03 mmol) in dry DMF (2.83 mL) was added over 5 min. The mixture was stirred at 0 °C for 10 min, then warmed to RT and stirred at this temperature. Thin layer chromatography (TLC; 1 : 1 hex:EtOAc) was used to monitor the reaction progress. After TLC indicated full conversion, the mixture was poured onto satd. aq. sodium bicarbonate (75.0 mL), extracted with EtOAc (150 mL and 2x75. OmL). Combined organic layers were dried (MgSC^), filtered and evaporated in vacuo. The crude residue was purified on an Isco CombiFlash (silica gel, EtOAc in hexanes, 30 %→ 60 %) (BAI-A22; 605 mg, 1.23 mmol, 31 %) was obtained as off-white solid. The corresponding O-acetate (1.01 g) was isolated as a side- product. The acetate had presumably formed on the loading column from the desired product and ethyl acetate, triggered by heat formed when DMF remainders in the crude material came in contact with the silica. This behavior was not observed on a significant level in smaller scale reactions and can be avoided by more thorough drying of the crude in high vacuum (10~3 mbar). The acetate can be conveniently hydrolyzed by treatment with potassium carbonate (2.0 equiv) in methanol (0.11 M) for 2h to give another crop of the desired product (685mg, 35 %).
[0089] TLC: Rf 0.37 (1 : 1, hex:EtOAc). Ti-NMR (600 MHz, CDC13): δ 7.32-7.28 (m, 4H), 7.08 (d, J = 7.9 Hz, 2H), 7.03 (t, J = 7.4 Hz, 1H), 6.88 (d, J = 8.9 Hz, 2H), 4.00 (dd, J = 10.3, 5.7 Hz, 1H), 3.79-3.71 (m, 2H), 3.44-3.38 (m, 4H), 3.31 (s, 1H), 2.53-2.52 (m, 2H), 2.41 (dd, J = 12.4, 3.5 Hz, 1H), 2.34 (m, 3H), 1.45 (s, 9H). 1 C-NMR (151 MHz, CDC13): δ 154.8, 147.9, 147.8, 132.2, 129.7, 122.9, 122.7, 121.6, 113.2, 80.0, 65.1, 62.27, 56.8, 53.2, 43.8 (d, br), 28.6. ESI-MS m/z (rel int): (pos) 514.1 ([M(81Br)+Na]+, 18), 512.1 ([M(79Br)+Na]+, 14), 492.1 ([M(81Br)+H]+, 100), 490.1 ([M(79Br)+H]+, 95), 436.0 (14), 435.0 (18).
Figure imgf000028_0001
[0090] Synthesis of l-((4-bromophenyl)(phenyl)amino)-3-(piperazin-l-yl)propan-2-ol (BAI-A22). tert-Butyl 4-(3-((4-bromophenyl)(phenyl)amino)-2-hydroxypropyl)piperazine-l- carboxylate (605 mg, 1.23 mmol) was dissolved in dichloromethane (20.6 mL). The flask was purged with argon for a few minutes, and TFA (5.23 mL, 67.8 mmol, 55.0 equiv) was added at RT and the mixture stirred at the same temperature. TLC analysis of a reaction aliquot (micro-workup, satd. aq. NaHC03/ EtOAc) indicated complete conversion after lh 05'. The mixture was poured on sodium bicarbonate (6.22 g, 74.0 mmol, 60.0 equiv) in 20.0 mL water and stirred vigorously at RT for 40 min. More sodium bicarbonate was added as needed to bring the aqueous layer to pH = 8. The layers were separated and the aqueous layer was extracted with EtOAc (2 χ 75.0 mL). The combined organic layers were washed with satd. aq. NaHC03 (50.0 mL) and brine (50.0 mL), dried (MgS04), filtered and evaporated in vacuo. The residue was taken up in CH2CI2, filtered through syringe filter (pore size), then evaporated in vacuo and dried in high vacuum (foams heavily!). Ethyl-3- oxo-3-phenyl-2-(2-(thiazol-2-yl)hydrazono)propanoate (470 mg, 1.20 mmol, 98 %) was obtained as a sticky, light brown solid.
[0091] TLC: Rf 0.09 (95:5, CH2Cl2:MeOH). XH-NMR (600 MHz, CDC13): δ 7.33-7.28 (m, 4H), 7.09 (dd, J = 8.6, 1.1 Hz, 2H), 7.03 (tt, J = 7.3, 1.1 Hz, 1H), 6.89 (d, J = 9.0 Hz, 2H), 4.03-3.98 (m, 1H), 3.78-3.70 (m, J = 5.7 Hz, 2H), 2.94-2.87 (m, 4H), 2.63-2.60 (m, 2H), 2.44-2.38 (m, 3H), 2.30 (dd, J = 12.4, 10.1 Hz, 1H). 1 C-NMR (151 MHz, CDC13): δ 147.9, 147.8, 132.2, 129.7, 122.9, 122.7, 121.6, 113.2, 64.8, 62.7, 56.9, 54.2, 46.0. ESI-MS m/z (rel int): (pos) 392.09 ([M(81Br)+H]+, 100), 389.9 ([M(79Br)+H]+, 99).
[0092] Final products can be converted into their (e.g., HC1) salts.
Synthesis of Additional Compounds
[0093] The following compounds were prepared in an analogous fashion.
Figure imgf000029_0001
[0094] TLC: Rf 0.20 (1 : 1, hex:EtOAc). XH-NMR (600 MHz, CDC13): δ 8.10 (dt, J = 7.7, 0.9 Hz, 2H), 7.50-7.46 (m, 4H), 7.26 (ddd, J = 7.7, 6.0, 1.8 Hz, 3H), 4.40 (d, J = 5.4 Hz, 2H), 4.28 (m, J = 5.3 Hz, 1H), 3.45-3.36 (m, J = 3.3 Hz, 4H), 2.54-2.45 (m, 4H), 2.32 (s, 2H), 1.44 (s, 9H). 1 C-NMR (151 MHz, CDC13): δ 154.8, 141.1, 125.9, 123.2, 120.4, 119.3, 109.2, 80.0, 66.5, 62.0, 53.1, 47.2, 43.7 (d, br), 28.5. ESI-MS m/z (rel int): (pos) 432.1 ([M+Na]+, 100); (neg) 444.2 ([M+Clf, 100).
Figure imgf000030_0001
[0095] TLC: Rf 0.24 (95:5, CH2Cl2:MeOH). XH-NMR (600 MHz, dmso-d6): δ 8.13 (d, J = 7.7 Hz, 2H), 7.63 (d, J = 8.2 Hz, 2H), 7.43 (t, J = 7.7 Hz, 2H), 7.18 (t, J = 7.4 Hz, 2H), 4.99-4.91 (m, 1H), 4.48-4.45 (m, 1H), 4.29 (dd, J = 14.8, 6.9 Hz, 1H), 4.10-4.03 (m, 1H), 2.86-2.80 (m, 4H), 2.44-2.32 (m, 6H). 1 C-NMR (151 MHz, dmso-i¾): δ 131.0, 115.7, 112.4, 110.3, 108.9, 100.2, 57.36, 52.5, 43.3, 37.9, 34.8. ESI-MS m/z (rel int): (pos) 310.0 ([M+H]+, 100).
Figure imgf000030_0002
[0096] TLC: Rf 0.29 (1 : 1, hex:EtOAc). XH-NMR (600 MHz, CDC13): δ 7.84 (s, 2H), 7.33 (d, J = 7.1 Hz, 2H), 7.26 (d, J = 7.1 Hz, 2H), 4.37-4.31 (m, 2H), 4.22-4.22 (br s, 1H), 3.39 (br s, 4H), 2.52-2.41 (m, 11H), 2.29 (br s, 2H). 1 C-NMR (151 MHz, CDC13): δ 154.8, 139.7, 128.4, 127.0, 123.1, 120.4, 108.8, 80.0, 66.5, 62.0, 53.1, 47.2 (br d), 43.6, 28.5, 21.5. ESI-MS m/z (rel int): (pos) 460.2 ([M+Na]+, 34), 438.1 ([M+H]+, 100); (neg) 472.3 ([M+C1]~ 45), 436.4 ([M-H]~ 10).
Figure imgf000030_0003
7
[0097] TLC: Rf 0.02 (95:5, CH2Cl2:MeOH). XH-NMR (600 MHz, acetone-c¾): δ 7.86 (s, 2H), 7.49 (d, J = 8.3 Hz, 2H), 7.23 (dd, J = 8.3, 1.4 Hz, 2H), 4.48 (dd, J = 14.8, 4.7 Hz, 1H), 4.35 (dd, J = 14.8, 6.6 Hz, 1H), 4.30 (dddd, J = 7.0, 6.6, 5.0, 4.7 Hz, 1H), 3.30-3.25 (m, 4H), 2.85-2.83 (m, 2H), 2.76 (dd, J = 11.4, 6.2 Hz, 2H), 2.62 (dd, J = 12.8, 5.0 Hz, 1H), 2.54 (dd, J = 12.8, 7.0 Hz, 1H), 2.48 (s, 6H). 1 C-NMR (151 MHz, acetone- d6): δ 140.6, 128.4, 127.5, 123.6, 120.6, 110.3, 68.27, 62.5, 51.5, 48.3, 44.37, 21.4. ESI-MS m/z (rel int): (pos) 338.00 ([M+Na]+, 100).
Figure imgf000031_0001
[0098] TLC: Rf 0.29 (1 : 1, hex:EtOAc). XH-NMR (600 MHz, CDC13): δ 7.66 (dd, J = 8.7, 2.5 Hz, 2H), 7.39 (dd, J = 8.9, 4.1 Hz, 2H), 7.20 (ddd, J = 8.9, 8.7, 2.5 Hz, 2H), 4.35 (dd, J = 15.3, 4.5 Hz, 1H), 4.29 (dd, J = 15.3, 5.7 Hz, 1H), 4.18 (ddt, J = 9.1, 5.6, 4.6 Hz, 1H), 3.46-3.35 (m, 5H), 2.53 (s, 2H), 2.45-2.39 (m, 2H), 2.30 (s, 2H), 1.44 (s, 9H). 1 C- NMR (151 MHz, CDC13): δ 157.4 (d, J = 236.4 Hz), 154.8, 138.4, 123.0 (dd, J = 9.5, 4.1 Hz) , 114.3 (d, J = 25.4 Hz), 110.2 (d, J = 8.9 Hz), 106.2 (d, J = 23.4 Hz), 80.0, 66.6, 61.7, 53.1, 47.5, 43.7 (d, br), 28.5. ESI-MS m/z (rel int): (pos) 446.0 ([M+H]+, 100); (neg) 480.1
Figure imgf000031_0002
[0099] TLC: Rf 0.02 (95:5, CH2Cl2:MeOH). XH-NMR (600 MHz, acetone-c¾): δ 7.89 (dd, J = 9.1, 2.6 Hz, 2H), 7.69 (dd, J = 9.0, 4.3 Hz, 2H), 7.27 (ddd, J = 9.1, 9.0, 2.6 Hz, 2H), 4.59 (dd, J = 15.1, 4.0 Hz, 1H), 4.45 (dd, J = 15.1, 7.0 Hz, 1H), 4.34-4.30 (m, 1H), 3.34- 3.24 (m, 4H), 2.89-2.78 (m, 4H), 2.67 (dd, J = 12.8, 5.5 Hz, 1H), 2.56 (dd, J = 12.8, 6.9 Hz, 1H). 1 C-NMR (151 MHz, acetone-c¾): δ 157.9 (d, J = 233.3 Hz, ), 139.5, 123.5 (dd, J = 9.9, 4.3 Hz), 114.6 (d, J = 25.4 Hz), 112.1 (d, J = 8.9 Hz), 106.6 (d, J = 24.1 Hz), 68.4, 62.4 , 51.7, 48.6, 44.5. ESI-MS m/z (rel ([M+H]+, 100).
Figure imgf000031_0003
[00100] TLC: Rf 0.33 (4: 1, hex:EtOAc). XH-NMR (600 MHz, CDC13): δ 8.39 (t, J = 1.0 Hz, 2H), 7.75 (dd, J = 8.6, 1.0 Hz, 2H), 7.61 (d, J = 8.6 Hz, 2H), 4.47 (dd, J = 15.3, 4.0 Hz, 1H), 4.38 (dd, J = 15.3, 5.9 Hz, 1H), 4.21 (dddd, J = 10.2, 6.0, 4.0, 3.8 Hz, 1H), 3.47 (br s, 1H), 3.50-3.36 (m, J = 4.1 Hz, 4H), 2.58-2.53 (m, 2H), 2.49 (dd, J = 12.3, 3.8 Hz, 1H), 2.41 (dd, J = 12.3, 10.2 Hz, 1H), 2.34-2.30 (m, 2H), 1.44 (s, 9H). 1 C-NMR (151 MHz, CDC13): δ 154.8, 143.3, 125.1 (q, J = 272.0 Hz), 123.6 (q, J = 3.5 Hz), 122.6 (q, J = 32.5 Hz), 122.4, 118.3 (q, J = 4.0 Hz), 110.1, 80.1, 66.5, 61.6, 53.1, 47.5, 43.7 (d, br), 28.5. ESI- MS m/z (rel int): (pos) 546.1 ([M+H]+, 100).
Figure imgf000032_0001
[00101] TLC: Rf 0.00 (1 : 1, hex:EtOAc). XH-NMR (600 MHz, acetone-c¾): δ 8.74 (t, J = 0.8 Hz, 2H), 7.98 (d, J = 8.7 Hz, 2H), 7.84 (dd, J = 8.7, 1.5 Hz, 2H), 4.76 (dd, J = 15.1, 3.5 Hz, 1H), 4.61 (dd, J = 15.1, 7.4 Hz, 1H), 4.38 (dddd, J = 7.4, 6.8, 6.0, 3.5 Hz, 1H), 3.20 (t, J = 5.1 Hz, 4H), 2.79-2.74 (m, 4H), 2.70 (dd, J = 12.7, 6.0 Hz, 1H), 2.59 (dd, J = 12.7, 6.8 Hz, 1H). 1 C-NMR (151 MHz, acetone-c¾): δ 143.7, 125.5 (q, J = 270.6 Hz), 123.0 (q, J = 3.5 Hz), 122.1, 121.3 (q, J = 31.9 Hz), 118.3 (q, J = 4.3 Hz), 111.2, 67.4, 61.7, 52.1, 47.9, 44.3. ESI-MS m/z (rel int): (pos) 446.0 ([M+H]+, 100).
Figure imgf000032_0002
[00102] TLC: Rf 0.30 (1 : 1, hex:EtOAc). XH-NMR (600 MHz, CDC13): δ (d, J = 7.8 Hz, 1H), 7.30 (d, J = 8.2 Hz, 1H), 7.20 (t, J = 7.6 Hz, 1H), 7.10 (t, J = 7.4 Hz, 1H), 6.94 (s, 1H), 4.15 (dd, J = 14.7, 4.7 Hz, 1H), 4.11 (dd, J = 14.7, 5.5 Hz, 1H), 4.05 (dq, J = 9.5, 4.8 Hz, 1H), 3.48-3.34 (m, 4H), 2.53-2.49 (m, 2H), 2.36-2.30 (m, 7H), 1.44 (s, 9H). 1 C-NMR (151 MHz, CDCI3): δ 154.8, 137.0, 128. 9, 126.5, 121.7, 119.2, 118.8, 110.9, 109.3, 80.0, 66.6, 61.5, 53.1, 49.7, 43.8 (d, br), 28.5, 9.8. ESI-MS m/z (rel int): (pos) 396.1 ([M+Na]+, 63), 374.0 ([M+H]+, 100).
Figure imgf000032_0003
BAI-A20 [00103] TLC: Rf 0.03 (95:5, CH2Cl2:MeOH). XH-NMR (600 MHz, acetone-c 6): δ 7.49 (dd, J = 7.8, 0.8 Hz, 1H), 7.43 (d, J = 8.2 Hz, 1H), 7.12 (ddd, J = 8.2, 7.1, 1.1 Hz, 1H), 7.07 (s, 1H), 7.02 (ddd, J = 7.8, 7.1, 0.8 Hz, 1H), 4.68-4.64 (m, 1H), 4.32 (dd, J = 14.7, 4.4 Hz, 1H), 4.23 (dd, J = 14.7, 7.0 Hz, 1H), 3.98-3.86 (m, 4H), 3.81 (t, J = 9.7 Hz, 4H), 3.57 (d, J = 12.6 Hz, 1H), 3.39 (dd, J = 12.6, 10.3 Hz, 1H), 2.26 (s, 3H), 2.05 (s, 4H). 1 C-NMR (151 MHz, acetone-c¾): δ 137.9, 129.8, 127.5, 122.1, 122.1, 119.4 (2 carbons, confirmed by HSQC), 110.8, 110.4, 66.4, 61.1, 50.5, 50.3, 41.8, 9.6. ESI-MS m/z (rel int): (pos) 274.1 ([M+H]+, 100).
Figure imgf000033_0001
[00104] TLC: Rf 0.46 (1 : 1, hex:EtOAc). XH-NMR (600 MHz, CDC13): δ 7.05 (d, J = 8.3 Hz, 4H), 6.91 (d, J = 8.3 Hz, 4H), 4.01 (dtd, J = 9.6, 5.9, 3.5 Hz, 1H), 3.73 (d, J = 5.9 Hz, 2H), 3.43-3.36 (m, 4H), 2.54-2.48 (m, 2H), 2.45 (dd, J = 12.5, 3.5 Hz, 1H), 2.37-2.30 (m, J = 10.2 Hz, 3H), 2.29 (s, 6H), 1.45 (s, 9H). 1 C-NMR (151 MHz, CDC13): δ 154.8, 146.4, 131.0, 130.0, 121.2, 79.9, 65.3, 62.4, 57.1, 53.3, 43.7 (d, br), 28.6, 20.8. ESI-MS m/z (rel int): (pos) 462.1 ([M+Na]+, 41), 440.1 ([M+H]+, 100).
Figure imgf000033_0002
[00105] TLC: Rf 0.00 (1 : 1, hex:EtOAc). XH-NMR (600 MHz, acetone-c¾): δ 7.05 (d, J = 8.3 Hz, 4H), 6.96 (d, J = 8.3 Hz, 4H), 4.03 (dddd, J = 7.5, 6.8, 4.9, 4.4 Hz, 1H), 3.91 (dd, J = 14.9, 4.9 Hz, 1H), 3.62 (dd, J = 14.9, 6.8 Hz, 1H), 3.20 (t, J = 5.1 Hz, 4H), 2.83-2.79 (m, 2H), 2.73-2.70 (m, 2H), 2.58 (dd, J = 12.8, 4.4 Hz, 1H), 2.48 (dd, J = 12.8, 7.5 Hz, 1H), 2.25 (s, 6H). 1 C-NMR (151 MHz, acetone-c¾): δ 147.4, 131.0, 130.4, 121.9, 66.9, 62.9, 57.7, 51.9, 44.6, 20.6. ESI-MS m/z (rel int): (pos) 340.0 ([M+H]+, 100).
Figure imgf000033_0003
[00106] TLC: Rf 0.60 (1 : 1, hex:EtOAc). XH-NMR (600 MHz, CDC13): δ 7.35 (d, J = 7.1 Hz, 4H) 6.94 (d, J = 7.1 Hz, 4H), 3.99-3.95 (m, 1H), 3.75 (dd, J = 15.3, 4.1 Hz, 1H), 3.66 (dd, J = 15.3, 7.1 Hz, 1H), 3.44-3.38 (m, 4H), 2.54 (m, 2H), 2.39 (dd, J = 12.4, 3.7 Hz, 1H), 2.36-2.29 (m, 3H), 1.45 (s, 9H). 1 C-NMR (151 MHz, CDC13): δ 154.6, 147.0, 132.3, 122.9, 114.4, 79.8, 64.7, 62.0, 56.6, 53.1, 43.6 (d, br), 28.4. ESI-MS m/z (rel int): (pos) 568.0 ([M(81Br,81Br)+H]+,50) 570.0 ([M(81Br,79Br)+H]+, 100), 572.1 ([M(79Br,79Br)+H]+, 50).
Figure imgf000034_0001
[00107] TLC: Rf 0.00 (1 : 1, hex:EtOAc). XH-NMR (600 MHz, CD3CN): δ 7.38 (d, J = 8.9 Hz, 4H), 7.00 (d, J = 8.9 Hz, 4H), 3.94-3.90 (m, 1H), 3.86 (dd, J = 15.3, 3.7 Hz, 1H), 3.57 (dd, J = 15.3, 7.7 Hz, 1H), 3.14 (q, J = 5.9 Hz, 4H), 2.75-2.73 (m, 2H), 2.66-2.64 (m, 2H), 2.46 (dd, J = 12.6, 4.0 Hz, 2H), 2.40 (dd, J = 12.6, 8.1 Hz, 2H). 1 C-NMR (151 MHz, CD3CN): δ 148.3, 133.0, 124.1, 114.3, 66.5, 62.1, 57.3, 51.1, 44.4, 1.32, 1.18. ESI-MS m/z (rel int): (pos) 471.9 ([M(81Br,81Br)+H]+,50) 469.9 ([M(81Br,79Br)+H]+, 100), 467.9 ([M(79Br,79Br)+H]+, 50).
REFERENCES
1. Whelan RS, Kaplinskiy V and Kitsis RN. Cell death in the pathogenesis of heart disease: mechanisms and significance. Annual review of physiology. 2010;72: 19-44.
2. Kung G, Konstantinidis K and Kitsis RN. Programmed necrosis, not apoptosis, in the heart. Circulation research. 2011;108: 1017-36.
3. Konstantinidis K, Whelan RS and Kitsis RN. Mechanisms of cell death in heart disease. Arteriosclerosis, thrombosis, and vascular biology . 2012;32: 1552-62.
4. Christia P and Frangogiannis NG. Targeting inflammatory pathways in myocardial infarction. European Journal of Clinical Investigation. 2013;43:986-995.
5. Diwan A, Krenz M, Syed FM, Wansapura J, Ren X, Koesters AG, Li H, Kirshenbaum LA, Hahn HS, Robbins J, Jones WK and Ii GWD. Inhibition of ischemic cardiomyocyte apoptosis through targeted ablation of Bnip3 restrains postinfarction remodeling in mice. The Journal of clinical investigation. 2007;117:2825-2833. 6. Pfeffer MA and Braunwald E. Ventricular remodeling after myocardial infarction. Experimental observations and clinical implications. Circulation. 1990;81: 1161-72.
7. Miller TD, Christian TF, Hopfenspirger MR, Hodge DO, Gersh BJ and Gibbons RJ. Infarct Size After Acute Myocardial Infarction Measured by Quantitative Tomographic 99mTc Sestamibi Imaging Predicts Subsequent Mortality. Circulation. 1995;92:334-341.
8. Levy S. Secondary prevention after myocardial infarction: in favor of beta-blockers. Journal of cardiovascular pharmacology. 1990; 16 Suppl 6:S50-4.
9. Yusuf S, Peto R, Lewis J, Collins R and Sleight P. Beta blockade during and after myocardial infarction: an overview of the randomized trials. Progress in cardiovascular diseases. 1985;27:335-71.
10. Yusuf S. Early intravenous beta blockade in acute myocardial infarction.
Postgraduate medicine. 1988;Spec No:90-5.
11. Braunwald E. The Open- Artery Theory Is Alive and Well - Again. New Engl J Med. 1993;329: 1650-1652.
12. Feit F, Mueller HS, Braunwald E, Ross R, Hodges M, Herman MV and Knatterud GL. Thrombolysis in Myocardial Infarction (TIMI) phase II trial: Outcome comparison of a "conservative strategy" in community versus tertiary hospitals. Journal of the American College of Cardiology. 1990; 16: 1529- 1534.
13. Chi LG, Tamura Y, Hoff PT, Macha M, Gallagher KP, Schork MA and Lucchesi BR. Effect of superoxide dismutase on myocardial infarct size in the canine heart after 6 hours of regional ischemia and reperfusion: a demonstration of myocardial salvage. Circulation research. 1989;64:665-75.
14. Rupprecht HJ, vom Dahl J, Terres W, Seyfarth KM, Richardt G, Schultheibeta HP, Buerke M, Sheehan FH and Drexler H. Cardioprotective effects of the Na(+) H(+) exchange inhibitor cariporide in patients with acute anterior myocardial infarction undergoing direct PTCA. Circulation. 2000;101 :2902-8.
15. Arai M, Lefer DJ, So T, DiPaula A, Aversano T and Becker LC. An anti-CD18 antibody limits infarct size and preserves left ventricular function in dogs with ischemia and 48-hour reperfusion. J Am Coll Cardiol. 1996;27: 1278-85.
16. Williams FM, Kus M, Tanda K and Williams TJ. Effect of duration of ischaemia on reduction of myocardial infarct size by inhibition of neutrophil accumulation using an anti- CD18 monoclonal antibody. British Journal of Pharmacology . 1994;111: 1123-1128. 17. Whelan RS, Konstantinidis K, Wei AC, Chen Y, Reyna DE, Jha S, Yang Y, Calvert JW, Lindsten T, Thompson CB, Crow MT, Gavathiotis E, Dorn GW, 2nd, O'Rourke B and Kitsis RN. Bax regulates primary necrosis through mitochondrial dynamics. Proceedings of the National Academy of Sciences of the United States of America. 2012;109:6566-71.
18. Hochhauser E, Kivity S, Offen D, Maulik N, Otani H, Barhum Y, Pannet H, Shneyvays V, Shainberg A, Goldshtaub V, Tobar A and Vidne BA. Bax ablation protects against myocardial ischemia-reperfusion injury in transgenic mice. American journal of physiology Heart and circulatory physiology. 2003;284:H2351 -9.
19. Peixoto PM, Ryu SY, Bombrun A, Antonsson B and Kinnally KW. MAC inhibitors suppress mitochondrial apoptosis. The Biochemical journal. 2009;423:381-7.
20. Bombrun A, Gerber P, Casi G, Terradillos O, Antonsson B and Halazy S. 3,6- dibromocarbazole piperazine derivatives of 2-propanol as first inhibitors of cytochrome c release via Bax channel modulation. Journal of medicinal chemistry. 2003;46:4365-8.
21. Gavathiotis E, Reyna DE, Bellairs JA, Leshchiner ES and Walensky LD. Direct and selective small-molecule activation of proapoptotic BAX. Nature chemical biology. 2012;8:639-45.
22. Bedford, R. B.;Betham, M.; Charmant, J. P. H.; Weeks, A. L.; Tetrahedron 2008, 64, 6038-6050.
23. McKnight, Steven L.; Pieper, Andrew A.; Ready, Joseph M.; De Brabander, Jef K.; U.S. Pat. Appl. Publ. 2012, US 20120022096 Al; Jan 26, 2012.
24. Mudadu, M. S.; Singh, A. N.; Thummel, R. P.; J. Org. Chem 2008, 73, 6513-6520.
25. Bombrun,A.; Gerber, P.; Casi, G; Terradillos, 0.;Antonsson, B.; Halazy, S.; J. Med. Chem, 2003, 46, 4365-4368.
26. Sapountzis, I.; Knochel, P.; J. Am. Chem. Soc. 2002, 124, 9390-9391.
27. Ky, B., Vejpongsa, P., Yeh, E. T., Force, T., and Moslehi, J. J. (2013). Emerging paradigms in cardiomyopathies associated with cancer therapies. Circulation Research, 113(6):754-764.
28. Carvalho, C, Santos, R. X., Cardoso, S., Correia, S., Oliveira, P. J., Santos, M. S., and Moreira, P. I. (2009). Doxorubicin: the good, the bad and the ugly effect. Current medicinal chemistry, 16(25):3267-3285.
29. Cardinale, D., Colombo, A., Bacchiani, G, Tedeschi, I., Meroni, C. A., Veglia, F., Civelli, M., Lamantia, G, Colombo, N., Curigliano, G, et al. (2015). Early detection of anthracycline cardiotoxicity and improvement with heart failure therapy. Circulation, pages CIRCULATIONAHA-114.
30. Delgado, R. M., Nawar, M. A., Zewail, A. M., Kar, B., Vaughn, W. K., Wu, K. K., Aleksic, N., Sivasubramanian, N., McKay, K., Mann, D. L., et al. (2004). Cyclooxygenase- 2 inhibitor treatment improves left ventricular function and mortality in a murine model of doxorubicin-induced heart failure. Circulation, 109(11): 1428-1433.
31. Liu, X.-J., Wang, X.-G., Zhang, X., Xie, Y.-Q., Chen, R.-Z., and Chen, H.-Z. (2012). C57bl/6 mice are more appropriate than balb/c mice in inducing dilated cardiomyopathy with short-term doxorubicin treatment. Acta Cardiologica Sinica, 28(3):236-240.
32. Milano, G., Raucci, A., Scopece, A., Daniele, R., Guerrini, U., Sironi, L., Cardinale, D., Capogrossi, M. C, and Pompilio, G. (2014). Doxorubicin and trastuzumab regimen induces biventricular failure in mice. Journal of the American Society of Echocardiography, 27(5):568-579.
33. Ky, B., Vejpongsa, P., Yeh, E. T., Force, T., and Moslehi, J. J. (2013). Emerging paradigms in cardiomyopathies associated with cancer therapies. Circulation Research, 113(6):754-764.
34. Moja, L., Tagliabue, L., Balduzzi, S., Parmelli, E., Pistotti, V., Guarneri, V., and D'amico, R. (2006). Trastuzumab containing regimens for early breast cancer. Cochrane Database Syst Rev, 4.
35. Slamon, D. J., Leyland-Jones, B., Shak, S., Fuchs, H., Paton, V., Bajamonde, A., Fleming, T., Eiermann, W.,Wolter, J., Pegram, M., et al. (2001). Use of chemotherapy plus a monoclonal antibody against her2 for metastatic breast cancer that overexpresses her2. New England Journal of Medicine, 344(11):783-792.

Claims

What is claimed is:
1. A method of treating a disease or condition in a subject in which it is desirable to inhibit Bcl-2-associated x-protein (BAX) comprising administering to the subject one or more of the compounds of formula (I) and/or formula (IV) in an amount effective to treat the disease or condition in a subject, wherein formula (I) and formula (IV) have the structure
Figure imgf000038_0001
wherein
A is phenyl or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring;
B is phenyl, or a 6-membered heteroaromatic ring having 1 , 2 or 3 N atoms in the heteroaromatic ring; or a 6-membered aliphatic ring with up to 3 heteroatoms; the dashed line between A and B indicates an optional bond;
Rl and R2 are independently none, C1-C5 alkyl, F, CI, Br, I, CN, N02, NR4, NR42, OR4, CF3, COOH, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4;
X is H, NH2, OH, O, F, CI, Br, I, CN, SH, N02, NR4, NR42, OR, CF3, COOH, R4, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4; wherein the bond between X and the main scaffold is a single bond or a double bond, depending on the definition of X; Q is
Figure imgf000039_0001
, (CH2)mN((CH2)0R5)2, COH, COOH, or CH2NH(CH2)!OH;
R3 is none, H, C1-C6 alkyl, R4(C=0), or (CH2)pOH; R4 is H or Cl-C3 alkyl; each R5 is independently OH, SH, NR42 or R4; Y is O, S, N or CH;
Z is O, S, NR4, CHR4, S(0)2, C(Me)2 or C(O); each 1, m, n, o and p is independently 1-3; or a pharmaceutically acceptable salt thereof.
2. The method of claim 1, wherein there is no bond between A and B.
3. The method of claim 1, wherein the compound has the structure of formula (II),
(III), (V
Figure imgf000039_0002
Figure imgf000040_0001
or a pharmaceutically acceptable salt thereof.
4. The method of claim 1, wherein the compound is selected from the group consisting of
Figure imgf000040_0002
Figure imgf000040_0003
Figure imgf000041_0001
41
Figure imgf000042_0001
Figure imgf000043_0001
5. The method of claim 1, wherein the one or more compounds is administered in an amount effective to inhibit BAX in a subject.
6. The method of claim 1, wherein the disease or condition is selected from the group consisting of hypoxic cardiomyocytes, cardiac ischemia, cardiac ischemia-reperfusion injury, myocardial infarction, myocardial infarction and reperfusion injury, chemotherapy- induced cardiotoxicity, arteriosclerosis, heart failure, heart transplantation, aneurism, chronic pulmonary disease, ischemic heart disease, hypertension, pulmonary hypertension, thrombosis, cardiomyopathy, stroke, a neurodegenerative disease or disorder, an immunological disorder, ischemia, ischemia-reperfusion injury, infertility, a hematological disorder, renal hypoxia, hepatitis, a liver disease, a kidney disease, an intestinal disease, liver ischemia, intestinal ischemia, asthma, AIDS, Alzheimer's disease, Parkinson's disease, Huntington's disease, retinitis pigmentosa, spinal muscular atrophy, cerebellar degeneration, amyotrophic lateral sclerosis, organ transplant rejection, arthritis, lupus, irritable bowel disease, Crohn's disease, asthma, multiple sclerosis, diabetes, premature menopause, ovarian failure, follicular atresia, fanconi anemia, aplastic anemia, thalassemia, congenital neutropenia, myelodysplasia, and a disease or disorder involving cell death and/or tissue damage.
7. The method of claim 6, wherein the disease or condition is chemotherapy -induced cardiotoxicity, and wherein the compound does not interfere with the ability of the chemotherapeutic agent to treat cancer.
8. The method of claim 7, wherein the chemotherapeutic agent is one or more of doxorubicin and trastuzumab.
9. The method of claim 7, wherein the cancer is one or more of a leukemia, a solid tumor, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML), breast cancer, prostate cancer, lymphoma, skin cancer, pancreatic cancer, colon cancer, melanoma, malignant melanoma, ovarian cancer, brain or spinal cord cancer, primary brain carcinoma, medulloblastoma, neuroblastoma, glioma, head-neck cancer, glioma, glioblastoma, liver cancer, bladder cancer, stomach cancer, kidney cancer, placental cancer, cancer of the gastrointestinal tract, non-small cell lung cancer (NSCLC), head or neck carcinoma, breast carcinoma, endocrine cancer, eye cancer, genitourinary cancer, cancer of the vulva, ovary, uterus or cervix, hematopoietic cancer, myeloma, leukemia, lymphoma, ovarian carcinoma, lung carcinoma, small-cell lung carcinoma, Wilms' tumor, cervical carcinoma, testicular carcinoma, bladder carcinoma, pancreatic carcinoma, stomach carcinoma, colon carcinoma, prostatic carcinoma, genitourinary carcinoma, thyroid carcinoma, esophageal carcinoma, myeloma, multiple myeloma, adrenal carcinoma, renal cell carcinoma, endometrial carcinoma, adrenal cortex carcinoma, malignant pancreatic insulinoma, malignant carcinoid carcinoma, choriocarcinoma, mycosis fungoides, malignant hypercalcemia, cervical hyperplasia, leukemia, acute lymphocytic leukemia, chronic lymphocytic leukemia, chronic granulocytic leukemia, acute granulocytic leukemia, acute myelogenous leukemia, chronic myelogenous leukemia, hairy cell leukemia, neuroblastoma, rhabdomyosarcoma, Kaposi's sarcoma, polycythemia vera, essential thrombocytosis, Hodgkin's disease, non-Hodgkin's lymphoma, soft tissue cancer, soft-tissue sarcoma, osteogenic sarcoma, sarcoma, primary macroglobulinemia, central nervous system cancer and retinoblastoma.
10. The method of claim 1, where Rl and/or R2 are in the para position with respect to the bond to the N atom.
11. The method of claim 1, wherein the subject is human.
12. A method of inhibiting Bcl-2-associated x-protein (BAX) in a subject comprising contacting the BAX with one or more of the compounds of formula (I) and/or formula (IV) in an amount effective to inhibit BAX, wherein formula (I) and formula (IV) have the structure
Figure imgf000045_0001
wherein
A is phenyl or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring;
B is phenyl, or a 6-membered heteroaromatic ring having 1 , 2 or 3 N atoms in the heteroaromatic ring; or a 6-membered aliphatic ring with up to 3 heteroatoms; the dashed line between A and B indicates an optional bond;
Rl and R2 are independently none, C1-C5 alkyl, F, CI, Br, I, CN, N02, NR4, NR42, OR4, CF3, COOH, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4;
X is H, NH2, OH, O, F, CI, Br, I, CN, SH, N02, NR4, NR42, OR, CF3, COOH, R4, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4; wherein the bond between X and the main scaffold is a single bond or a double bond, depending on the definition of X; Q is
Figure imgf000046_0001
, (CH2)mN((CH2)0R5)2, COH, COOH, or CH2NH(CH2)!OH;
R3 is none, H, C1-C6 alkyl, R4(C=0), or (CH2)pOH;
R4 is H or Cl-C3 alkyl; each R5 is independently OH, SH, NR42 or R4; Y is O, S, N or CH;
Z is O, S, NR4, CHR4, S(0)2, C(Me)2 or C(O); each 1, m, n, o and p is independently 1-3; or a pharmaceutically acceptable salt thereof.
13. The method of claim 12, wherein the subject has hypoxic cardiomyocytes, cardiac ischemia, cardiac ischemia-reperfusion injury, myocardial infarction, myocardial infarction and reperfusion injury, chemotherapy -induced cardiotoxicity, arteriosclerosis, heart failure, heart transplantation, aneurism, chronic pulmonary disease, ischemic heart disease, hypertension, pulmonary hypertension, thrombosis, cardiomyopathy, stroke, a neurodegenerative disease or disorder, an immunological disorder, ischemia, ischemia- reperfusion injury, infertility, a hematological disorder, renal hypoxia, hepatitis, a liver disease, a kidney disease, an intestinal disease, liver ischemia, intestinal ischemia, asthma, AIDS, Alzheimer's disease, Parkinson's disease, Huntington's disease, retinitis pigmentosa, spinal muscular atrophy, cerebellar degeneration, amyotrophic lateral sclerosis, organ transplant rejection, arthritis, lupus, irritable bowel disease, Crohn's disease, asthma, multiple sclerosis, diabetes, premature menopause, ovarian failure, follicular atresia, fanconi anemia, aplastic anemia, thalassemia, congenital neutropenia, myelodysplasia, or a disease or disorder involving cell death and/or tissue damage.
14. The method of claim 12, wherein there is no bond between A and B.
15. The method of claim 12, wherein the compound has the structure of formula (II), (III), (V
Figure imgf000047_0001
or a pharmaceutically acceptable salt thereof.
16. The method of claim 12, wherein the compound is selected from the group consisting of
47
Figure imgf000048_0001
Figure imgf000048_0002
48
Figure imgf000049_0001
49
Figure imgf000050_0001
17. The method of claim 12, where Rl and/or R2 are in the para position with respect to the bond to the N atom.
18. The method of claim 12, wherein the subject is human.
19. A compound having the structure of formula (VII)
Figure imgf000051_0001
wherein
A is phenyl or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring;
B is phenyl, or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring; or a 6-membered aliphatic ring with up to 3 heteroatoms;
Rl and R2 are independently none, C1-C5 alkyl, F, CI, Br, I, CN, N02, NR4, NR42, OR4, CF3, COOH, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4;
X is H, NH2, OH, O, F, CI, Br, I, CN, SH, N02, NR4, NR42, OR, CF3, COOH, R4, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4; wherein the bond between X and the main scaffold is a single bond or a double bond, depending on the definition of X;
Q is
Figure imgf000051_0002
, (CH2)mN((CH2)0R5)2, COH, COOH, or CH2NH(CH2; OH;
R3 is none, H, C1-C6 alkyl, R4(C=0), or (CH2)pOH;
R4 is H or Cl-C3 alkyl; each R5 is independently OH, SH, NR42 or R4;
Y is O, S, N or CH;
each 1, m, n, o and p is independently 1 -3;
or a pharmaceutically acceptable salt thereof.
20. The compound of claim 19 having the structure of formula (VIII) or (IX)
Figure imgf000052_0001
or a pharmaceutically acceptable salt thereof.
21. The compound of claim 19 selected from the group consisting of
Figure imgf000052_0002
Figure imgf000053_0001
or a pharmaceutically acceptable salt thereof.
22. The compound of claim 19, where Rl and/or R2 are in the para position with respect to the bond to the N atom.
23. A pharmaceutical composition comprising one or more of the compounds of claim 19, and a pharmaceutically acceptable carrier.
24. A compound having the structure of formula (X) or (XI)
Figure imgf000053_0002
wherein A is phenyl or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring;
B is phenyl, or a 6-membered heteroaromatic ring having 1, 2 or 3 N atoms in the heteroaromatic ring; or a 6-membered aliphatic ring with up to 3 heteroatoms; with the proviso that at least one of A and B is not phenyl; the dashed line between A and B indicates an optional bond;
Rl and R2 are independently none, C1-C5 alkyl, F, CI, Br, I, CN, N02, NR4, NR42, OR4, CF3, COOH, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4;
X is H, NH2, OH, O, F, CI, Br, I, CN, SH, N02, NR4, NR42, OR, CF3, COOH, R4, COOR4, NHR4, OCR4, OCOR4, OR4, SR4, SOR4, or S02R4; wherein the bond between X and the main scaffold is a single bond or a double bond, depending on the definition of X;
Q is
Figure imgf000054_0001
, (CH2)mN((CH2)0R5)2, COH, COOH, or CH2NH(CH2)iOH;
R3 is none, H, C1-C6 alkyl, R4(C=0), or (CH2)pOH;
R4 is H or Cl-C3 alkyl; each R5 is independently OH, SH, NR42 or R4;
Y is O, S, N or CH;
Z is O, S, NR4, CHR4, S(0)2, C(Me)2 or C(O); each 1, m, n, o and p is independently 1 -3; or a pharmaceutically acceptable salt thereof.
25. The compound of claim 24, wherein Z is O, NR4, CHR4, S(0)2, C(Me)2 or C(O).
26. A pharmaceutical composition comprising one or more of the compounds of claim 24, and a pharmaceutically acceptable carrier.
PCT/US2018/021644 2017-03-10 2018-03-09 Small molecule bax inhibitors and uses thereof Ceased WO2018165494A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US16/492,300 US11938128B2 (en) 2017-03-10 2018-03-09 Small molecule BAX inhibitors and uses thereof
US18/595,808 US20240350482A1 (en) 2017-03-10 2024-03-05 Small molecule bax inhibitors and uses thereof
US18/826,495 US20250000857A1 (en) 2017-03-10 2024-09-06 Small molecule bax inhibitors and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762469551P 2017-03-10 2017-03-10
US62/469,551 2017-03-10

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/492,300 A-371-Of-International US11938128B2 (en) 2017-03-10 2018-03-09 Small molecule BAX inhibitors and uses thereof
US18/595,808 Continuation US20240350482A1 (en) 2017-03-10 2024-03-05 Small molecule bax inhibitors and uses thereof

Publications (1)

Publication Number Publication Date
WO2018165494A1 true WO2018165494A1 (en) 2018-09-13

Family

ID=63448781

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/021644 Ceased WO2018165494A1 (en) 2017-03-10 2018-03-09 Small molecule bax inhibitors and uses thereof

Country Status (2)

Country Link
US (2) US11938128B2 (en)
WO (1) WO2018165494A1 (en)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10745358B2 (en) 2017-11-20 2020-08-18 Silicon Swat, Inc. Oxoacridinyl acetic acid derivatives and methods of use
CN111803504A (en) * 2019-04-11 2020-10-23 军事科学院军事医学研究院生物医学分析中心 Application of iMAC1 in preparation of products for treating cancers
WO2021026185A1 (en) * 2019-08-08 2021-02-11 New York University Indole compounds as modulators of rage activity and uses thereof
WO2021211819A1 (en) * 2020-04-16 2021-10-21 Albert Einstein College Of Medicine Inhibition of bax-mediated cell death by eltrombopag
US11414387B2 (en) 2017-11-20 2022-08-16 Stingthera, Inc. Oxoacridinyl acetic acid derivatives and methods of use
WO2023079141A3 (en) * 2021-11-05 2023-06-15 Tienush Rassaf Amelioration and treatment of infarction damage

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023023316A1 (en) * 2021-08-20 2023-02-23 Albert Einstein College Of Medicine Compositions for organ and tissue preservation

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8053436B1 (en) * 1999-10-18 2011-11-08 Merck Serono Sa 9-(piperazinylalkyl) carbazoles as bax-modulators
WO2017008060A1 (en) * 2015-07-08 2017-01-12 Unity Biotechnology, Inc. Compositions and methods for treating senescence-associated diseases and disorders

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1187071A (en) * 1967-04-14 1970-04-08 Toraude Lab N-Amino-Substituted 4-Anilino-Pyridines
US4292321A (en) * 1979-05-24 1981-09-29 Warner-Lambert Company 1,3,8-Triazaspirodecane-4-ones, pharmaceutical compositions thereof and method of use thereof
JP2007223916A (en) * 2006-02-21 2007-09-06 Institute Of Physical & Chemical Research Antibacterial agent
CA2770302A1 (en) * 2008-09-17 2010-03-25 Burnham Institute For Medical Research Small molecule compounds for stem cell differentiation
US20150335671A1 (en) * 2013-01-14 2015-11-26 Albert Einstein College Of Medicine Of Yeshiva University Small-molecule binding site on pro-apoptotic bax regulates inhibition of bax activity

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8053436B1 (en) * 1999-10-18 2011-11-08 Merck Serono Sa 9-(piperazinylalkyl) carbazoles as bax-modulators
US20120040933A1 (en) * 1999-10-18 2012-02-16 Applied Research Systems Ars Holding N.V. 9-(piperazinylalkyl) carbazoles as bax-modulators
WO2017008060A1 (en) * 2015-07-08 2017-01-12 Unity Biotechnology, Inc. Compositions and methods for treating senescence-associated diseases and disorders

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10745358B2 (en) 2017-11-20 2020-08-18 Silicon Swat, Inc. Oxoacridinyl acetic acid derivatives and methods of use
US11414387B2 (en) 2017-11-20 2022-08-16 Stingthera, Inc. Oxoacridinyl acetic acid derivatives and methods of use
CN111803504A (en) * 2019-04-11 2020-10-23 军事科学院军事医学研究院生物医学分析中心 Application of iMAC1 in preparation of products for treating cancers
CN111803504B (en) * 2019-04-11 2022-11-01 军事科学院军事医学研究院生物医学分析中心 Application of iMAC1 in preparation of product for treating cancer
WO2021026185A1 (en) * 2019-08-08 2021-02-11 New York University Indole compounds as modulators of rage activity and uses thereof
WO2021211819A1 (en) * 2020-04-16 2021-10-21 Albert Einstein College Of Medicine Inhibition of bax-mediated cell death by eltrombopag
WO2023079141A3 (en) * 2021-11-05 2023-06-15 Tienush Rassaf Amelioration and treatment of infarction damage
US12344644B2 (en) 2021-11-05 2025-07-01 Bimyo GmbH Amelioration and treatment of infarction damage with a polypeptide segement of BNIP3

Also Published As

Publication number Publication date
US11938128B2 (en) 2024-03-26
US20200009132A1 (en) 2020-01-09
US20240350482A1 (en) 2024-10-24

Similar Documents

Publication Publication Date Title
US20240350482A1 (en) Small molecule bax inhibitors and uses thereof
TWI389895B (en) Compounds and methods for inhibiting the interaction of bcl proteins with binding partners
JP7016809B2 (en) Tetracyclic pyridone compound as an antiviral agent
US11459312B2 (en) Sulphur substituted 3-oxo-2,3-dihydropyridazine-4-carboxamides
KR102373017B1 (en) N-{6-(2-hydroxypropan-2-yl)-2-[2-(methylsulfonyl)ethyl]-2H-indazol-5-ylb-6-(trifluoromethyl)pyridin- Polymorphic Forms of 2-Carboxamide
CA3183097A1 (en) Lpa receptor antagonists and uses thereof
AU2022273702B2 (en) Lpa receptor antagonists and uses thereof
CA3127448C (en) Mtorc modulators and uses thereof
ES2594378T3 (en) Benzylidenoguanidine derivatives and therapeutic use for the treatment of diseases due to poor protein folding
JP2020525513A (en) N-(3-(2-(4-chlorophenoxy)acetamidobicyclo[1.1.1]pentan-1-yl)-2-cyclobutane-1 as an ATF4 inhibitor for treating cancer and other diseases -Carboxamide derivatives and related compounds
NZ617987A (en) Fused heterocyclic compounds as sodium channel modulators
KR20210134351A (en) Inhibitors of the Integrated Stress Response Pathway
KR20240109977A (en) Spiroindoline inhibitor of KIF18A
WO2020042995A1 (en) Highly active sting protein agonist compound
CA2325389A1 (en) Compounds for inhibiting beta-amyloid peptide release and/or its synthesis
CN116322677B (en) MTORC1 regulators and uses thereof
IL303297A (en) The use of sgc activators for the treatment of ophthalmologic diseases
EP4444707A1 (en) Lpa receptor antagonists and uses thereof
US20020198189A1 (en) New use
WO2011028571A1 (en) Taxane analogues, their use, pharmaceutical compositions containing them, and processes for their preparation
UA123836C2 (en) ALIPHATIC DERIVATIVES OF PROLINAMIDE
TW201726651A (en) 2,3,4,5-tetrahydropyridin-6-amine derivatives
US20250163062A1 (en) Wnt pathway inhibitor compounds
JP2023175554A (en) Pharmaceutical composition and autophagy activator
KR20070107039A (en) Cyclohepta [b] pyridine-3-carbonylguanidine derivatives and pharmaceutical products containing the same

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18763784

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 18763784

Country of ref document: EP

Kind code of ref document: A1