WO2018156697A1 - Specific gnai:giv interaction screening assays, methods and compositions - Google Patents
Specific gnai:giv interaction screening assays, methods and compositions Download PDFInfo
- Publication number
- WO2018156697A1 WO2018156697A1 PCT/US2018/019127 US2018019127W WO2018156697A1 WO 2018156697 A1 WO2018156697 A1 WO 2018156697A1 US 2018019127 W US2018019127 W US 2018019127W WO 2018156697 A1 WO2018156697 A1 WO 2018156697A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- giv
- gnai
- peptide
- interaction
- daple
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6803—General methods of protein analysis not limited to specific proteins or families of proteins
- G01N33/6845—Methods of identifying protein-protein interactions in protein mixtures
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
- A61K31/19—Carboxylic acids, e.g. valproic acid
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/72—Receptors; Cell surface antigens; Cell surface determinants for hormones
- C07K14/723—G protein coupled receptor, e.g. TSHR-thyrotropin-receptor, LH/hCG receptor, FSH receptor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/72—Assays involving receptors, cell surface antigens or cell surface determinants for hormones
- G01N2333/726—G protein coupled receptor, e.g. TSHR-thyrotropin-receptor, LH/hCG receptor, FSH
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/02—Screening involving studying the effect of compounds C on the interaction between interacting molecules A and B (e.g. A = enzyme and B = substrate for A, or A = receptor and B = ligand for the receptor)
Definitions
- the present invention generally relates to the G-protein system and methods of identifying selective inhibitors thereof.
- GIV-GEF provides a strategy to annihilate pathologic signaling downstream of multiple receptors.
- Fig. 4 Structural basis for nucleotide exchange by GIV-GEM.
- FIGs. 5A-5C GIV-GEM binding that activates G proteins via mechanisms unlike GPCRs.
- Fig. 6A HTS-compatible assay development for the GIV-Gai interaction providing a positive control for inhibition.
- FIGs. 8A-8B Expansion of the GIV:Gai3 inhibitor screening to 30,000 compounds. "Re-test" plate of hits identified by the HTS-FP assay along side DMSO (negative) and ALF4- (positive).
- Fig. 9B Secondary/counter-screen assay (2) validation of hits from pilot screen, suitable to filter false positives.
- Fig. 15 Schematic shows how canonical signaling from GPCR to cAMP at the plasma membrane (PM) lasts for a finite time period whereas non-canonical cAMP, activity through RTK-GIV-GEM interactions and compartmentalization of Gai and Gas at the PM and endosome respectively, can lead to prolonged signals.
- Fig. 16. Schematics summarizing the role of cyclic AMP (cAMP) in diverse biological processes.
- the language "pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration.
- solvents dispersion media, coatings, isotonic and absorption delaying agents, and the like.
- the use of such media and agents for pharmaceutically active substances is well known in the art.
- the C-terminal GIV peptide comprises the amino acid sequence of SEQ ID NO: l.
- the DAPLE peptide comprises the amino acid sequence of SEQ ID NO:2.
- the determining steps are detected by fluorescent polarization.
- the invention further provides a method of specifically modulating GNAI to treat a patient in need thereof, comprising administering to the patient an effective amount of a compound that inhibits GNAI interaction with a C-terminal GIV peptide, and does not inhibit GNAI interaction with DAPLE.
- the compound is ATA, or a functional analog or derivative thereof.
- the compound is NF023, or a functional analog or derivative thereof.
- the method is effective to treat cancer, fibrogenesis, diabetes, aging, or infertility.
- the invention further provides a pharmaceutical composition comprising a pharmaceutically acceptable excipient and an effective amount of a compound that inhibits GNAI interaction with a C-terminal GIV peptide, and does not inhibit GNAI interaction with DAPLE.
- the compound is ATA, or a functional analog or derivative thereof.
- the compound is NF023, or a functional analog or derivative thereof.
- the method is effective to treat cancer, fibrogenesis, diabetes, aging, or infertility.
- the invention provides an assay and method for screening for drug candidates which act as specific inhibitors against the GNALGIV interface.
- the invention provides an assay and method for screening a drug candidate using GIV or a fragment thereof comprising or consisting essentially of a small part of the GIV molecule (at least 31 aa on its C-terminus) (such as GIV peptide: KTGSPGSEVVTLQQFLEESNKLTSVQIKSSS (SEQ ID NO: 1)).
- GIV peptide KTGSPGSEVVTLQQFLEESNKLTSVQIKSSS (SEQ ID NO: 1)
- GIV GBA peptide gives information on the GNALGIV interface and can be disrupted with small molecule drug candidates.
- SASPSSEMVTLEEFLEESNRSSPTHDTPSCRDDL (SEQ ID NO:2)). This will ensure identifying specific inhibitors that will not cross-inhibit the GNALDAPLE interface (with which GNALGIV interface shares similarities), because DAPLE' s ability to bind and activate GNAI is critical for tumor suppression and inhibiting that interface (as a potential side effect of inhibitors against the GNAI: GIV interface) is highly undesirable.
- GIV can be referred to as a GEM because of its ability to serve as a GEF
- GEMs like GIV can activate monomeric GNAI or inhibit monomeric GNAS by either capturing them during the cyclical activation-inactivation process or by generating monomers of alpha subunit from trimers or GDI bound complexes [in the case of GNAI].
- Last, but not least, signaling via GEM like GIV is prolonged, and can occur on internal membranes. This makes GEMs more versatile, and signaling via them more robust.
- cAMP is most important in the biological activities shown in Fig. 16.
- cAMP plays an important role in regulating many physiological conditions ranging from blood pressure to memory formation.
- cAMP is largely protective as it inhibits proliferation, invasion, chemoresistance, and promotes apoptosis and differentiation of tumor cells.
- cAMP is a potent anti-fibrotic agent because it inhibits proliferation and migration and triggers apoptosis and return to quiescence for myofibroblasts, the major cell type implicated in fibrogenic disorders.
- GIV- GEMs release free Gbg subunits from GNAI and GNAS, has been shown to be important for signaling via PI3K, Racl and other such intermediates. Therefore, GIV- GEM initiates two pronged signaling: cAMP via GNAI/GNAS [alpha subunits of heterotrimeric G proteins] and Gbetagamma signaling via its own intermediates. Both components are important for the holistic impact of GIV-GEM in disease states.
- GEM has prolonged time scales due to both PM and endosomal signaling as compared to canonical GPCR mediated cAMP activation at the PM alone.
- the interrupted line at ⁇ 5 min indicates the time period when ligand activated EGFR is typically rapidly endocytosed, marking a watershed between end of PM and beginning of endosomal phase of signaling.
- FIGs. 21A-21B provide schematic displays of the workings of GIV-GEM within cellular signaling circuit.
- Fig. 21A shows a variety of environmental stimuli [input signals; left] are integrated into core proteins [center] that activate downstream target proteins such as transcription factors [output signals; right]. The flow of information [left to right] is believed to conform to a bow tie structure.
- GIV-GEM serves as a tunable valve, allowing cells to fine-tune the concentrations of cAMP in cells as shown in Fig.
- GIV-GEM shows altered expression and/or function of GIV-GEM allows tunability of cAMP signals such that when GEM expression/activity is lowest, increasing input signals can trigger some of the highest levels of cellular cAMP, thereby conferring sensitivity.
- GEM expression/activity is highest, cAMP levels are lowest, regardless of the amount of input signals, thereby conferring robustness.
- the addition of PDE inhibitors to GIV-inhibitors should provide adjuvant benefit PDE inhibitors will reduce cAMP removal, and further augment cAMP cone in cells.
- the preferred molecules will be those that can bind GIV and alter the exposure of the GEM module on GIV which has a dual role and can serve as GEF and GDI on two G proteins. This should be possible because it has been published earlier [Lin C et al., MBoC 2014] that GIV's CT is intrinsically disordered, and when bound to proteins, it is known to change conformation.
- the preferred molecules will also be those which can bind GIV and target it for degradation, effectively reducing the copy numbers in cells.
- Step 1 -Protein-protein interaction assay any kind [by any assay, FP, or others] i. pre-incubate GIV-CT with small molecules. One may pre-screen at this stage to find which molecules are binding to GIV using either CD spectroscopy or other methods; ii. add G proteins, either Gai and Gas to the reaction; and iii. identify some negative or some positive allosteric modulators of GEM function (NAMs and some PAMs).
- NAMs and some PAMs some negative or some positive allosteric modulators of GEM function
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Physics & Mathematics (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Biotechnology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
- Microbiology (AREA)
- Bioinformatics & Computational Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Endocrinology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Investigating Or Analysing Biological Materials (AREA)
Abstract
Research tool assay for identifying a specific modulator of GNAI, compositions and methods of use. The assay includes combining a drug candidate with GNAI and a C-terminal GIV peptide and determining if the drug candidate inhibits GNAI interaction with the C-terminal GIV peptide; and combining the drug candidate with GNAI and a DAPLE peptide and determining if the drug candidate inhibits GNAI interaction with DAPLE peptide. Also provided are compositions and methods of treatment relating to the same.
Description
SPECIFIC GNALGIV INTERACTION SCREENING ASSAYS, METHODS AND
COMPOSITIONS
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the priority benefit of U.S. Provisional Patent Application Nos. 62/461,925 and 62/502,029, filed February 22 and May 5, 2017, respectively, the entire contents of which are incorporated herein by reference.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on February 20, 2018, is named 24978-0380_SL.txt and is 1,034 bytes in size.
GOVERNMENT SPONSORSHIP
[0003] This invention was made with government support under grant CA160911 awarded by the National Institutes of Health. The government has certain rights in the invention.
FIELD OF THE INVENTION
[0004] The present invention generally relates to the G-protein system and methods of identifying selective inhibitors thereof.
SUMMARY OF THE INVENTION [0005] The inventions disclosed are high-throughput screening assays to identify small molecule specific inhibitors of G protein interactions, in particular inhibitors of the GNALGIV interface, as drug candidates, methods of use and compositions resulting therefrom. The invention provides high-throughput (HTP) screening assays for compounds which act as an inhibitor of interactions between GNALGIV, and do not act as an inhibitor of interactions between GNALDAPLE.
BRIEF DESCRIPTION OF THE DRAWINGS
[0006] Fig 1. GIV-GEF provides a strategy to annihilate pathologic signaling downstream of multiple receptors.
[0007] Fig. 2. GIV and GPCRs bind to G protein at different sites.
[0008] Fig. 3. GIV binding site is a hydrophobic cleft with predicted druggable pockets.
[0009] Fig. 4. Structural basis for nucleotide exchange by GIV-GEM.
[0010] Figs. 5A-5C. GIV-GEM binding that activates G proteins via mechanisms unlike GPCRs.
[0011] Fig. 6A. HTS-compatible assay development for the GIV-Gai interaction providing a positive control for inhibition.
[0012] Fig. 6B. HTS-compatible assay development for the GIV-Gai interaction showing robustness.
[0013] Fig. 7. GIV-Gai inhibitor pilot screen LOPAC 1280 library (known bioactives).
[0014] Figs. 8A-8B. Expansion of the GIV:Gai3 inhibitor screening to 30,000 compounds. "Re-test" plate of hits identified by the HTS-FP assay along side DMSO (negative) and ALF4- (positive).
[0015] Fig. 9A. Secondary/counter-screen assay (1) AlphaScreen: orthogonal to primary assay.
[0016] Fig. 9B. Secondary/counter-screen assay (2) validation of hits from pilot screen, suitable to filter false positives.
[0017] Fig. 10. Further analysis of confirmed hits validate the assay to identify inhibitors of the target.
[0018] Figs 11A-11E. A HTS-compatible fluorescence polarization (FP) assay to monitor the GIV:Gai3 interaction.
[0019] Fig. 12. GI-2E is a candidate.
[0020] Fig. 13A. Follow-up assays (1) flowchart. [0021] Fig. 13B. Follow-up assays (2) validation of a "humanized" yeast-based system to monitor G protein activation by GIV.
[0022] Fig. 13C. Follow-up assays (3) validation of a "humanized" yeast-based system to monitor G protein activation by GIV.
[0023] Fig. 14. Kd's determined from fluorescence polarization assays with FITC peptides and hGcu3.
[0024] Fig. 15. Schematic shows how canonical signaling from GPCR to cAMP at the plasma membrane (PM) lasts for a finite time period whereas non-canonical cAMP, activity through RTK-GIV-GEM interactions and compartmentalization of Gai and Gas at the PM and endosome respectively, can lead to prolonged signals. [0025] Fig. 16. Schematics summarizing the role of cyclic AMP (cAMP) in diverse biological processes.
[0026] Fig. 17. Non-canonical growth factor-dependent cAMP signaling is prolonged and largely on internal membranes.
[0027] Fig. 18. Simulations identify the two distinct regimes of GIV GEM's effect on cAMP dynamics.
[0028] Fig. 19. The area under the curve (AUC) for cAMP dynamics was calculated for different time points after EGF stimulation.
[0029] Figs. 20A-20C. Fig. 20A is GIV concentration is high (5 μΜ ), simulations predict that cAMP concentration does not vary much in response to increasing EGFR copy number. Fig. 20B is an increase in cAMP AUC over time is pronounced for GIV=0 μΜ
(green bars) while Fig. 20C is a very small change in the AUC over time for GIV = 5 μΜ (red bars).
[0030] Figs. 21A-21B. Schematic displays the workings of GIV-GEM within cellular signaling circuit. DETAILED DESCRIPTION
[0031] The present invention provides high-throughput screening assays to identify small molecule specific inhibitors of the GNAI:GIV interface as drug candidates, compositions and methods of use resulting therefrom. The screening assays of the present invention provide non-naturally occurring specific in vitro applications of inventive concepts in the form of unique research tools to identify drug candidates for further in vivo testing and therapeutic use.
[0032] It is to be understood that the invention is not limited in its application to the details of construction and the arrangement of components set forth in the following description or illustrated in the drawings. [0033] When introducing elements of the present invention or the preferred embodiment(s) thereof, the articles "a", "an", "the" and "said" are intended to mean that there are one or more of the elements. The terms "comprising", "including" and "having" are intended to be inclusive and mean that there may be additional elements other than the listed elements.
[0034] As used herein, "inhibit" or "inhibition" or "inhibits" refers to a reduction in normal activity, in embodiments a reduction below average minus 3 standard deviations, or minus 5 standard deviations.
[0035] As used herein, the term "pharmaceutical composition" contemplates compositions comprising one or more therapeutic compounds, agents or drugs as described below, and one or more pharmaceutically acceptable excipients, carriers, or vehicles.
[0036] As used herein, the term "pharmaceutically acceptable excipients, carriers, or vehicles" comprises any acceptable materials, and/or any one or more additives known
in the art. As used herein, the term "excipients," "carriers," or "vehicle" refer to materials suitable for drug administration through various conventional administration routes known in the art. Excipients, carriers, and vehicles useful herein include any such materials known in the art, which are nontoxic and do not interact with other components of the composition in a deleterious manner, and generally refers to an excipient, diluent, preservative, solubilizer, emulsifier, adjuvant, and/or vehicle with which an active agent or drug is administered. Such carriers may be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents. Antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; and agents for the adjustment of tonicity such as sodium chloride or dextrose may also be a carrier. Methods for producing compositions in combination with carriers are known to those of skill in the art. In some embodiments, the language "pharmaceutically acceptable carrier" is intended to include any and all solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art.
[0037] The present invention provides a research tool assay for identifying a specific modulator of GNAI, comprising: (a) combining a drug candidate with GNAI and a C-terminal GIV peptide and determining if the drug candidate inhibits GNAI interaction with the C-terminal GIV peptide; and (b) combining the drug candidate with GNAI and a DAPLE peptide and determining if the drug candidate inhibits GNAI interaction with DAPLE peptide. In enbodiments, the drug candidate is identified as a specific modulator of GNAI when the drug candidate inhibits interaction with the C-terminal GIV peptide, and does not inhibit GNAI interaction with the DAPLE peptide.
[0038] In embodiments, the C-terminal GIV peptide comprises the amino acid sequence of SEQ ID NO: l. In embodiments, the DAPLE peptide comprises the amino acid sequence of SEQ ID NO:2. [0039] In embodiments, the determining steps are detected by fluorescent polarization.
[0040] The invention further provides a method of specifically modulating GNAI to treat a patient in need thereof, comprising administering to the patient an effective amount of a compound that inhibits GNAI interaction with a C-terminal GIV peptide, and does not inhibit GNAI interaction with DAPLE. In embodiments, the compound is ATA, or a functional analog or derivative thereof. In embodiments, the compound is NF023, or a functional analog or derivative thereof. In embodiments, the method is effective to treat cancer, fibrogenesis, diabetes, aging, or infertility.
[0041] The invention further provides a pharmaceutical composition comprising a pharmaceutically acceptable excipient and an effective amount of a compound that inhibits GNAI interaction with a C-terminal GIV peptide, and does not inhibit GNAI interaction with DAPLE. In embodiments, the compound is ATA, or a functional analog or derivative thereof. In embodiments, the compound is NF023, or a functional analog or derivative thereof. In embodiments, the method is effective to treat cancer, fibrogenesis, diabetes, aging, or infertility. [0042] In embodiments, the invention provides an assay and method for screening for drug candidates which act as specific inhibitors against the GNALGIV interface. In embodiments, the invention provides an assay and method for screening a drug candidate using GIV or a fragment thereof comprising or consisting essentially of a small part of the GIV molecule (at least 31 aa on its C-terminus) (such as GIV peptide: KTGSPGSEVVTLQQFLEESNKLTSVQIKSSS (SEQ ID NO: 1)). The identified GIV GBA peptide gives information on the GNALGIV interface and can be disrupted with small molecule drug candidates.
[0043] In a subsequent step, drug candidates that inhibit the GNALGIV interface are tested in a secondary screen involving GNALDAPLE, which will eliminate small molecules that do not have specificity against GNALGIV interface. Therefore, in this step, the drug candidate is screened for its inability to inhibit the GNALDAPLE interface using DAPLE or a fragment thereof comprising or consisting essentially of a small part of the molecule (such as DAPLE peptide:
SASPSSEMVTLEEFLEESNRSSPTHDTPSCRDDL (SEQ ID NO:2)). This will ensure identifying specific inhibitors that will not cross-inhibit the GNALDAPLE interface (with which GNALGIV interface shares similarities), because DAPLE' s ability to bind and
activate GNAI is critical for tumor suppression and inhibiting that interface (as a potential side effect of inhibitors against the GNAI: GIV interface) is highly undesirable.
[0044] As for the first step in the assay, this small region of 31 aa GIV peptide:
KTGSPGSEVVTLQQFLEESNKLTSVQIKSSS (SEQ ID NO: 1) was arrived at after careful biochemistry determined that anything less than this is less efficient in binding or activation the G protein, GNAI. The invention provides that this peptide sequence can be adapted in HTP screens to accurately pick up the effective agonists/antagonists against the druggable interface GNAI: GIV.
[0045] As for the second step, it is not common knowledge that the orthologue of GIV, DAPLE, also binds GNAI and uses a similar hydrophobic binding cleft on which GIV docks. It was discovered that DAPLE's ability to bind GNAI has differences from how GIV binds GNAI. It is these differences that achieve specificity of molecular inhibitors to target the GNAI:GIV interface, without affecting the GNALDAPLE interface. The DAPLE peptide SASPSSEMVTLEEFLEESNRSSPTHDTPSCRDDL (SEQ ID NO: 2) is the appropriate secondary screen to eliminate the molecules that non- specifically target both GNAI:GIV and GNALDAPLE interfaces.
[0046] As will be appreciated, performing the first step described above initially will insure the second step is screening for effective inhibitors, however, the invention contemplates that the order of the steps can be reversed. The invention contemplates compositions comprising the tools and reagents necessary for conducting the screening assays, in particular screening for molecules which selectively inhibit the GNAI interface with molecules comprising, or consisting essentially of, the GIV peptide KTGSPGSEVVTLQQFLEESNKLTSVQIKSSS (SEQ ID NO: 1) or the DAPLE peptide SASPSSEMVTLEEFLEESNRSSPTHDTPSCRDDL (SEQ ID NO:2), and a detectable moiety.
EXAMPLES
EXAMPLE 1
[0047] A pilot screen of the LOP AC 1280 library (collection of known bioactive compounds) was conducted and identified lead compounds with inhibitory activity (FIG.
11 A). A virtual ligand screen (VLS) of the same library (LOPAC1280) was conducted using in silico docking methods [33-35] (FIG. 11B). The results from both screens were compared. From the FP assay only three "hits" (FIG. 11C) were identified, i.e, a -0.25%, hit rate, indicating that the assay is not non-specifically affected by too many compounds. From the virtual screen 7 'hits' (FIG. 11B) were identified. Importantly, 2 of the virtual screen hits matched the results from the FP assay and a third was validated as a GIV:Gai inhibitor. Compounds were validated by dose response curves (FIG. 11D). ATA and NF023 (identified by both screens) displayed ICso's of ~5 μΜ while suramin (found only in virtual screen) had lower potency (IC50 ~ 805 μΜ), consistent with why it was not detected by the FP screen (FIG. 11A). None of the other 4 hits predicted by the VLS inhibited binding. Using a GST-pulldown assay, it was confirmed that ATA and NF023 are true hits while topotecan was as a false positive (FIG. HE). Interestingly, the virtual screen correctly predicts topotecan as an ineffective/non-binding compound (FIG. 11B).
[0048] The invention provides therapeutic compositions comprising compounds identified by the screening methods, and analogs and derivatives thereof, in a pharmaceutically acceptable excipient. Exemplary compounds provided by the screening assay of the present invention are aurintricarboxylic acid (ATA) and 8,8'- [carbonylbis(imino-3,l-phenylenecarbonylimino)]bis(l,3,5-naphthalene-trisulfonic acid) hexasodium salt (NF-023) and 4-[3-(4-Acetyl-3-hydroxy-2- propylphenoxy)propxylphenoxyacetic acid (L-165,041). ATA is listed as a DNA topoisomerase II inhibitor in the Sigma LOPAC library database, and it has also been shown to inhibit cysteine proteases such as calpain and caspases 3, 6, 7, and 9. NF-023 is listed as a potent, selective P2X1 receptor antagonist in the Sigma LOPAC library database, and is an analog of suramin, a hexasulfonated naphthylurea.
DISCUSSION
[0049] GIV can be referred to as a GEM because of its ability to serve as a GEF
[activator] of GNAI as well as a GDI [inhibitor] for GNAS. By working in this sort of dual mode, GIV-GEM can coordinately lower cellular cAMP levels by activating the inhibitor of adenylyl cyclase [GNAI] and inhibiting the stimulator of adenylyl cyclase [GNAS]. This is unlike what happens in the case of GPCRs, the most drugged/targeted component of cAMP signaling to date, (see Figs. 15A-15B). Key differences also include the fact that while GPCRs can only either activate only trimeric forms of Gi or Gs at a time, and such signaling is finite and only initiated at the PM by ligand-bound receptors, GEMs like GIV can activate monomeric GNAI or inhibit monomeric GNAS by either capturing them during the cyclical activation-inactivation process or by generating monomers of alpha subunit from trimers or GDI bound complexes [in the case of GNAI].
Last, but not least, signaling via GEM like GIV is prolonged, and can occur on internal membranes. This makes GEMs more versatile, and signaling via them more robust.
[0050] Fig. 15 shows schematic [modified from Ghosh P et al., Cell Cycle, 2017] shows how canonical signaling from GPCR to cAMP at the plasma membrane (PM) lasts for a finite time period whereas non-canonical cAMP activity, through RTK-GIV-GEM interactions and compartmentalization of Gai and Gas at the PM and endosome respectively, can lead to prolonged signals.
[0051] The reason GIV-GEM and other GEMs can be major targetable components is because cAMP is most important in the biological activities shown in Fig. 16. cAMP plays an important role in regulating many physiological conditions ranging from blood pressure to memory formation. Particularly, in the context of cancers (top right), cAMP is largely protective as it inhibits proliferation, invasion, chemoresistance, and promotes apoptosis and differentiation of tumor cells. Similarly, in the context of organ fibrosis, cAMP is a potent anti-fibrotic agent because it inhibits proliferation and migration and triggers apoptosis and return to quiescence for myofibroblasts, the major cell type implicated in fibrogenic disorders. It is noteworthy that although cAMP modulatory drugs, either targeting GPCRs or phosphodiesterases [PDEs] are available for most of the diseases noted in the bottom of Fig. 16, no such therapy has reached fruition in the case of organ fibrosis and cancers. [0052] The Gbetagamma dependent component of signaling that is initiated when
GIV- GEMs release free Gbg subunits from GNAI and GNAS, has been shown to be important for signaling via PI3K, Racl and other such intermediates. Therefore, GIV- GEM initiates two pronged signaling: cAMP via GNAI/GNAS [alpha subunits of heterotrimeric G proteins] and Gbetagamma signaling via its own intermediates. Both components are important for the holistic impact of GIV-GEM in disease states.
[0053] Recent work using systems biology has shown that levels of GIV-GEM being high vs low acts like a tunable valve for cAMP flow in signaling circuits. Briefly, systems approach was used to build a circuit for growth factor dependent cAMP signaling via G proteins, GNAI and GNAS. The model was first validated using cell based and biochemical assays for key reaction steps. The model captured the key observed dynamics
of EGFR-GIV-G protein complex formation, GNAS-GIV complex formation, and then cAMP, PKA and pCREB signaling. This model inquires as to what impact does high vs low GIV have on cAMP signaling downstream of growth factors. Results of such simulations are shown in Fig. 17. [0054] Non-canonical growth factor-dependent cAMP signaling is prolonged and largely on internal membranes.
[0055] Fig. 17 shows non-canonical RTK mediated cAMP dynamics through GIV-
GEM has prolonged time scales due to both PM and endosomal signaling as compared to canonical GPCR mediated cAMP activation at the PM alone. The interrupted line at ~5 min indicates the time period when ligand activated EGFR is typically rapidly endocytosed, marking a watershed between end of PM and beginning of endosomal phase of signaling.
[0056] Using systems approaches determined that GIV-GEM operates in 2 regimes. See figures and legend below. The GEF effect on GNAI is a predominant effect early on. The GDI effect on GNAS is the predominant effect later.
[0057] Fig. 18 shows that simulations identify the two distinct regimes of GIV
GEM's effect on cAMP dynamics. The early 0-5 min phase is characterized by a dip in cAMP concentration; GIV's GEF function on Gai dominates in this phase. This is followed by a delayed -10-60 min phase which is characterized by an increase in the concentration of cAMP; GIV's GDI function on Gas dominates this phase. Simulations predict that cAMP dynamics will decrease with increasing GIV expression. Compare the control GIV in the model with the high GIV and the low GIV lines. In high GIV states, the transition from GIV-GEF dominant (early, -0-5 min) to GIV-GDI dominant (late, -10-60 min) regimes is evident as the line transitions from negative to positive. Simulations for cAMP dynamics are also displayed for 3 other conditions: 1) GIV in the absence of its GEF effect on Gai (the GIV-DD mutant), in the absence of its GDI effect (as would be mimicked by a constitutively active Gas R201C mutant), and in the absence of both its GEF and GDI effects (GIV-FA mutant). GIV-DD doesn't show the initial decrease in cAMP concentration (dashed line), while loss of GIV's GDI function results in an initial decrease in cAMP concentration but also a prolonged increase in cAMP (dot dashed line).
The effect of GIV-FA (dashed lines) on cAMP concentration is the same as that of low GIV (line).
[0058] Fig. 19 shows the area under the curve (AUC) for cAMP dynamics was calculated for different time points after EGF stimulation. The transition from GIV-GEF dominant (early, -0-5 min) to GIV-GDI dominant (late, -10-60 min) regimes is evident in the transition from AUC going from negative to positive [in high GIV states]. The AUC remains negative at all times for GIV=10 μΜ, indicating that cAMP levels do not increase when GIV is high.
[0059] Figs. 20A-20C demonstrate a systems approach showing that low GIV states are very sensitive, i.e., increasing growth factors elicits higher cAMP responses. However, when GIV levels are high, increasing stimuli does not elicit higher cAMP response. When the concentration of GIV is zero, simulations predict that increasing EGFR copy number results in increasing cAMP (Fig. 20A) When GIV concentration is high (5 μΜ ), simulations predict that cAMP concentration does not vary much in response to increasing EGFR copy number (Fig. 20B) The increase in cAMP AUC over time is pronounced for GIV=0 μΜ (green bars) while there is a very small change in the AUC over time for GIV = 5 μΜ (Fig. 20C).
[0060] Based on the above, it can be concluded that GIV-GEM serves as a tunable valve for cAMP signaling: [0061] Figs. 21A-21B provide schematic displays of the workings of GIV-GEM within cellular signaling circuit. Fig. 21A shows a variety of environmental stimuli [input signals; left] are integrated into core proteins [center] that activate downstream target proteins such as transcription factors [output signals; right]. The flow of information [left to right] is believed to conform to a bow tie structure. Cellular concentrations of cAMP is a key determinant of robustness at the core of information flow [Friedlander and Alon; PLoS Computational Biology; 2015; journals.plos.org/ploscompbiol/article?id=10.1371/ journal.pcbi.1004055]; levels are antagonistically balanced by GailGas and AC production and degradation by PDEs [sink pipe]. GIV-GEM serves as a tunable valve, allowing cells to fine-tune the concentrations of cAMP in cells as shown in Fig. 21B shows altered expression and/or function of GIV-GEM allows tunability of cAMP signals
such that when GEM expression/activity is lowest, increasing input signals can trigger some of the highest levels of cellular cAMP, thereby conferring sensitivity. When GEM expression/activity is highest, cAMP levels are lowest, regardless of the amount of input signals, thereby conferring robustness. [0062] Therefore, the invention provides strategies for drug development in GIV- driven diseases.
[0063] The best drugs to target this novel modulator of cAMP and elevate cAMP levels in disorders characterized by HIGH-GIV and low-cAMP [like invasive cancers and fibrogenic diseases] is to tackle both GEF and GDI functions of GIV. The Gbetagamma side of signaling will be automatically stopped if GIV can be inhibited from activating trimeric G proteins Gi or inhibiting trimeric Gs.
[0064] So as to not block any G protein signaling via canonical pathways, avoid targeting the G protein, or finding molecules that can sit in transient pockets created during nucleotide exchange. Finding such molecules may be acceptable for some biochemical research use, but will derail canonical G protein signaling cascades via GPCRs.
[0065] The addition of PDE inhibitors to GIV-inhibitors should provide adjuvant benefit PDE inhibitors will reduce cAMP removal, and further augment cAMP cone in cells. [0066] The preferred molecules will be those that can bind GIV and alter the exposure of the GEM module on GIV which has a dual role and can serve as GEF and GDI on two G proteins. This should be possible because it has been published earlier [Lin C et al., MBoC 2014] that GIV's CT is intrinsically disordered, and when bound to proteins, it is known to change conformation. [0067] The preferred molecules will also be those which can bind GIV and target it for degradation, effectively reducing the copy numbers in cells. This is a possibility because the protein may be rendered as 'poorly folded or wrongly folded' when bound to 'drug,' and such forms may be targeted by cells for degradation. Thus, a part of small molecule drug candidate screening, levels of GIV mRNA and protein can be measured in
cells, such as by qPCR and Immunoblotting; while proteins should be reduced, in proteasome -dependent manner, mRNA could remain detectable/constant/ go down due to the loss of positive feedback loop between STAT3 [transcriptional activator of GIV] and GIV [which activates STAT3 signaling via GEM function] (Dunkel Y et al., JBC 2011).
[0068] In embodiments, the invention provides a screen for small molecules that disrupt GIV-CT' s [-210 aa] ability to bind or modulate nucleotide exchange in Gai or Gas. This screening research tool assay can comprise the following steps.
Step 1 -Protein-protein interaction assay: any kind [by any assay, FP, or others] i. pre-incubate GIV-CT with small molecules. One may pre-screen at this stage to find which molecules are binding to GIV using either CD spectroscopy or other methods; ii. add G proteins, either Gai and Gas to the reaction; and iii. identify some negative or some positive allosteric modulators of GEM function (NAMs and some PAMs).
In Step 2 - Measure enzyme activity [by GTPase assays- HTP methods].
[0069] If STEP 2 is carried out before STEP 1, then do pre-incubation with small molecules, then remove excess of the unbound molecules, before exposing the G proteins to exchanging conditions. This will avoid the possible jamming of some of the molecules in pockets of G proteins exposed during transition states of exchange.
[0070] If the above caution cannot be done, then extra step should be included that
G proteins Gai and Gas with small molecule alone should be incubated and tested for their ability to inhibit or alter in any way the basal nucleotide exchange observed in monomeric alpha subunits in vitro.
In Step 3- Cell-based assays: i. GIV protein levels by immunoblotting, ii. GIV mRNA by qPCR,
iii. cAMP assays- kits commercial, iv. pAkt, other signaling pathways, AND v. cell invasion, apoptosis, proliferation, differentiation, stemness.
[0071] These and other features of the embodiments of the invention will become apparent to the skilled artisan upon a review of the present disclosure and appended claims.
Claims
claimed is:
A research tool assay for identifying a specific modulator of GNAI, comprising a. combining a drug candidate with GNAI and a C-terminal GIV peptide and determining if the drug candidate inhibits GNAI interaction with the C- terminal GIV peptide; and b. combining the drug candidate with GNAI and a DAPLE peptide and determining if the drug candidate inhibits GNAI interaction with DAPLE peptide, wherein the drug candidate is identified as a specific modulator of GNAI when the drug candidate inhibits interaction with the C-terminal GIV peptide, and does not inhibit GNAI interaction with the DAPLE peptide.
The assay of claim 1, wherein the C-terminal GIV peptide comprises the amino acid sequence of SEQ ID NO:l.
The assay of claim 1, wherein the DAPLE peptide comprises the amino acid sequence of SEQ ID NO:2.
The assay of claim 1, wherein the determining steps are detected by fluorescent polarization.
A method of specifically modulating GNAI to treat a patient in need thereof, comprising administering to the patient an effective amount of a compound that inhibits GNAI interaction with a C-terminal GIV peptide, and does not inhibit GNAI interaction with DAPLE.
The method of claim 5, wherein the compound is ATA. The method of claim 5, wherein the compound is NF023.
The method of claim 5, wherein the method is effective to treat cancer, fibrogenesis, diabetes, aging, or infertility.
9. A pharmaceutical composition comprising a pharmaceutically acceptable excipient and an effective amount of a compound that inhibits GNAI interaction with a C- terminal GIV peptide, and does not inhibit GNAI interaction with DAPLE.
10. The pharmaceutical composition of claim 9, wherein the compound is ATA.
11. The pharmaceutical composition of claim 9, wherein the compound is NF023.
12. The pharmaceutical composition of claim 9, wherein the amount is effective to treat cancer, fibrogenesis, diabetes, aging, or infertility.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/487,462 US11366121B2 (en) | 2017-02-22 | 2018-02-22 | Specific GNAI:GIV interaction screening assays, methods and compositions |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762461925P | 2017-02-22 | 2017-02-22 | |
| US62/461,925 | 2017-02-22 | ||
| US201762502029P | 2017-05-05 | 2017-05-05 | |
| US62/502,029 | 2017-05-05 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018156697A1 true WO2018156697A1 (en) | 2018-08-30 |
Family
ID=63254032
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/019127 Ceased WO2018156697A1 (en) | 2017-02-22 | 2018-02-22 | Specific gnai:giv interaction screening assays, methods and compositions |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US11366121B2 (en) |
| WO (1) | WO2018156697A1 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019222071A3 (en) * | 2018-05-14 | 2020-08-13 | The Regents Of The University Of California | Biosensors for measuring metastatic potential and chemoresistance of single cancer cells |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016168702A1 (en) * | 2015-04-16 | 2016-10-20 | The Regents Of The University Of California | Targeting giv-gef-gi signaling for treating diverse diseases |
| US20160362464A1 (en) * | 2015-06-09 | 2016-12-15 | The Regents Of The University Of California | Novel therapeutic targets for cancer progression |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6277874B1 (en) * | 1996-07-09 | 2001-08-21 | University Of Cincinnati And Apologic, Incorporated | Methods for the treatment of apolipoprotein E related diseases |
-
2018
- 2018-02-22 WO PCT/US2018/019127 patent/WO2018156697A1/en not_active Ceased
- 2018-02-22 US US16/487,462 patent/US11366121B2/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016168702A1 (en) * | 2015-04-16 | 2016-10-20 | The Regents Of The University Of California | Targeting giv-gef-gi signaling for treating diverse diseases |
| US20180104307A1 (en) * | 2015-04-16 | 2018-04-19 | Pradipta Ghosh | Targeting GIV-GEF-GI Signaling for Treating Diverse Diseases |
| US20160362464A1 (en) * | 2015-06-09 | 2016-12-15 | The Regents Of The University Of California | Novel therapeutic targets for cancer progression |
Non-Patent Citations (3)
| Title |
|---|
| BLAZER ET AL.: "A nanomolar-potency small molecule inhibitor of Regulator of G-protein Signaling (RGS) proteins", BIOCHEMISTRY, vol. 50, no. 15, 19 April 2011 (2011-04-19), pages 3181 - 3192, XP055537794 * |
| DIGIACOMO V., ET AL.: "The Gαi-GIV binding interface is a druggable protein-protein interaction", SCIENTIFIC REPORTS, vol. 7, 17 August 2017 (2017-08-17), XP055537799 * |
| FITZGERALD K., ET AL.: "Chemical Genetics Reveals an RGS/G-Protein Role in the Action of a Compound", PLOS GENETICS, vol. 2, no. 4, April 2006 (2006-04-01), pages e57, XP055537797 * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019222071A3 (en) * | 2018-05-14 | 2020-08-13 | The Regents Of The University Of California | Biosensors for measuring metastatic potential and chemoresistance of single cancer cells |
| US12405269B2 (en) | 2018-05-14 | 2025-09-02 | The Regents Of The University Of California | Biosensors for measuring metastatic potential and chemoresistance of single cancer cells |
Also Published As
| Publication number | Publication date |
|---|---|
| US11366121B2 (en) | 2022-06-21 |
| US20200064352A1 (en) | 2020-02-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12286413B2 (en) | Compounds and methods for treating cancer | |
| Whitesell et al. | Inhibiting HSP90 to treat cancer: a strategy in evolution | |
| US12370185B2 (en) | TRPV2 antagonists | |
| US20250325553A1 (en) | Methods of treating cancer | |
| WO2009059994A2 (en) | Methods and compositions for measuring wnt activation and for treating wnt-related cancers | |
| US10632123B2 (en) | Use of BRaf inhibitors for treating cutaneous reactions | |
| Raghubir et al. | Endoplasmic reticulum stress in brain damage | |
| Fusi et al. | Cav1. 2 channel current block by the PKA inhibitor H-89 in rat tail artery myocytes via a PKA-independent mechanism: Electrophysiological, functional, and molecular docking studies | |
| Goncalves et al. | Relevance of breast cancer resistance protein to brain distribution and central acting drugs: a pharmacokinetic perspective | |
| US11366121B2 (en) | Specific GNAI:GIV interaction screening assays, methods and compositions | |
| WO2019173683A1 (en) | Discovery of novel molecules and repurposed drugs for ras family gtpases | |
| JP7676323B2 (en) | GPCR heteromeric inhibitors and uses thereof | |
| WO2017117386A1 (en) | Methods of treating cancer using network brakes | |
| US20210041441A1 (en) | DISCOVERY OF NOVEL MOLECULES AND REPURPOSED DRUGS FOR RAS FAMILY GTPases | |
| CA3106622A1 (en) | Allosteric modulators of the mu opioid receptor | |
| Faber | Overcoming Resistance to EGFR Inhibitors in EGFR-Mutant NSCLC | |
| Lackner et al. | BPS2025-Targeting the NLRP3 pyrin domain: Novel inhibitors that block inflammasome activation via oxidized DNA | |
| Stephen et al. | BPS2025-Biophysical characterization of small molecule inhibitors binding to KRAS | |
| WO2023091900A1 (en) | Compositions and methods for modulating the effect of beta-blocker activity in a subject | |
| Pepermans | Identification of a Novel Class of ER-Selective Ligands Lacking Cross-reactivity to GPER | |
| WO2023079556A1 (en) | Compositions and methods for cancer treatment | |
| EA046182B1 (en) | TRPV2 ANTAGONISTS | |
| Ampey | Cyclic Nucleotides Locally Modulate Uterine Vascular Intercellular Gap Junction Communication to Maintain Uterine Blood Flow during Pregnancy | |
| HK40031033A (en) | Trpv2 antagonists | |
| HK40031033B (en) | Trpv2 antagonists |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18756687 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 18756687 Country of ref document: EP Kind code of ref document: A1 |


