WO2018126111A1 - Hv1 modulators and uses - Google Patents

Hv1 modulators and uses Download PDF

Info

Publication number
WO2018126111A1
WO2018126111A1 PCT/US2017/068896 US2017068896W WO2018126111A1 WO 2018126111 A1 WO2018126111 A1 WO 2018126111A1 US 2017068896 W US2017068896 W US 2017068896W WO 2018126111 A1 WO2018126111 A1 WO 2018126111A1
Authority
WO
WIPO (PCT)
Prior art keywords
hvl
modulating agent
sequence
polypeptide
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/068896
Other languages
French (fr)
Inventor
Steven Alan GOLDSTEIN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Individual filed Critical Individual
Priority to US16/474,906 priority Critical patent/US11274130B2/en
Publication of WO2018126111A1 publication Critical patent/WO2018126111A1/en
Anticipated expiration legal-status Critical
Priority to US17/684,346 priority patent/US12084481B2/en
Priority to US18/815,668 priority patent/US20250115647A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/06Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43513Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae
    • C07K14/43518Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae from spiders
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43513Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae
    • C07K14/43522Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae from scorpions
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/41Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a Myc-tag

Definitions

  • Voltage-gated ion channels facilitate the transfer of ions across cell membranes and function as key components of essential cellular processes.
  • One particular type of voltage-gated ion channel is the voltage-gated proton channel (Hvl).
  • Hvl is a transmembrane protein that regulates the transfer of protons across cell membranes. When the Hvl channel is open, protons permeate the channel and cross the cellular membrane.
  • Hvl channel is expressed in many different tissues and is associated with a wide variety of physiological and pathological processes.
  • Hvl channels may play a role in immune defense, sperm activity, and cancer progression.
  • Hvl may be an attractive drug target (Seredenina, T., et al. "Voltage-gated proton channels as novel drug targets: from NADPH oxidase regulation to sperm biology. "Antioxid Redox Signal. 10;23(5): 490-513 (2015)).
  • clinically compatible Hvl activators or inhibitors are not known. For these reasons, there is a need for the development of activators and inhibitors of Hvl channels.
  • the present disclosure provides technologies relating to modulation of Hvl channels. Among other things, the present disclosure provides Hvl modulating agents, and various compositions and methods relating thereto.
  • an Hvl modulating agent is or comprises an engineered polypeptide component having an inhibitor cysteine knot (ICK)-like structural motif.
  • ICK inhibitor cysteine knot
  • an Hvl modulating agent shares one or more cysteines with a wild-type toxin sequence. In some embodiments, an Hvl modulating agent shares the same approximate relative position of cysteines with a wild-type toxin.
  • an Hvl modulating agent is or comprises a polypeptide sequence set forth in Tables 2A, 3A, and 4.
  • an Hvl modulating agent is encoded by a nucleotide sequence that is or comprises a sequence set forth in Tables 2C and 3B.
  • an Hvl modulating agent can be expressed from a vector including a nucleic acid sequence encoding the Hvl modulating agent.
  • an Hvl modulating agent binds to the external surface of human Hvl . In some embodiments, an Hvl modulating agent binds to the S3-S4 external loop region of human Hvl.
  • an Hvl modulating agent inhibits human Hvl function. For example, in some embodiments, an Hvl modulating agent may decrease or block proton current. In some embodiments, an Hvl modulating agent may reduce the number or likelihood of Hvl channel opening. In some embodiments, an Hvl modulating agent may increase the rate of Hvl channel closing. [14] In some embodiments, an Hvl modulating agent activates human Hvl function. For example, in some embodiments, an Hvl modulating agent increases proton current. In some embodiments, an Hvl modulating agent increase the rate of Hvl channel opening. In some embodiments, an Hvl modulating agent slows the rate of Hvl channel closing.
  • an Hvl modulating agent inhibits sperm capacitation.
  • an Hvl modulating agent decreases reactive oxygen species (ROS) production in white blood cells.
  • ROS reactive oxygen species
  • the present invention further provides various reagents and methods associated with Hvl modulating agents including, for example, systems for identifying and characterizing them, strategies for preparing them, and various therapeutic compositions and methods relating to them. Further description of certain embodiments of these aspects, and others, of the present invention, is presented below.
  • FIG. 1 Presents an amino acid sequence alignment of exemplary Hvl modulating agents C5 and C6. Six conserved cysteine residues and three disulfide bridges of an inhibitor cysteine knot (ICK)-like structural motif are indicated.
  • ICK inhibitor cysteine knot
  • FIG. 2 Presents the amino acid sequences of exemplary Hvl modulating agents C5 and C6 and the amino acid sequence of hanatoxin (HaTxl). Sequence elements corresponding to sequences in Table 3A are labeled. conserveed cysteine residues are highlighted. NT, N-terminus. CT, C-terminus.
  • FIG. 3 Presents exemplary T-toxin amino acid sequences and effects of T- toxins on hHvl function.
  • FIG. 3 A depicts an exemplary T-toxin comprising the amino acid sequence of Hvl modulating agent C6 linked to a trypsin secretory signal sequence at the N- terminus, a 16 amino acid linker with embedded C-Myc epitope tag at the C-terminus, and a hydrophobic sequence for GPI attachment from the mammalian Lynxl peptide.
  • FIG. 3 A depicts an exemplary T-toxin comprising the amino acid sequence of Hvl modulating agent C6 linked to a trypsin secretory signal sequence at the N- terminus, a 16 amino acid linker with embedded C-Myc epitope tag at the C-terminus, and a hydrophobic sequence for GPI attachment from the mammalian Lynxl peptide.
  • FIG. 3B depicts an exemplary T-toxin comprising an N-terminal trypsin secretory signal sequence, the amino acid sequence of HaTxl linked by a flexible 7 amino acid linker to C6, a C-Myc epitope embedded into a 6 amino acid linker at the C-terminus, and a hydrophobic sequence for GPI attachment.
  • FIG. 3C depicts an exemplary T-toxin comprising an N-terminal trypsin secretory signal sequence, C6 dimers linked by a rigid 10 amino acid linker, a C- Myc epitope embedded into a 6 amino acid linker at the C-terminus, and a hydrophobic sequence for GPI attachment.
  • FIG. 3C depicts an exemplary T-toxin comprising an N-terminal trypsin secretory signal sequence, C6 dimers linked by a rigid 10 amino acid linker, a C- Myc epitope embedded into a 6 amino acid linker at the C-terminus, and a hydrophobic
  • FIG. 3D depicts an exemplary T-toxin comprising an N- terminal trypsin secretory signal sequence, C6 dimers linked by a flexible 10 amino acid linker, a C-Myc epitope embedded into a 6 amino acid linker at the C-terminus, and a hydrophobic sequence for GPI attachment.
  • FIG. 3E depicts an exemplary T-toxin comprising an N-terminal trypsin secretory signal sequence, C6 dimers linked by long flexible 38 amino acid linker, a C-Myc epitope embedded into a 6 amino acid linker at the C-terminus, and a hydrophobic sequence for GPI attachment.
  • FIG. 3F shows inhibition of wild-type hHvl measured as unblocked fractional current in oocytes expressing only hHvl or both hHvl and T-toxin.
  • FIG. 4 Illustrates activating and inhibiting effects of exemplary Hvl modulators C5 and C6 on hHvl .
  • Whole-cell patch clamp recordings were performed on HEK-293T cells over-expressing hHvl .
  • Proton currents are shown with C5 (FIG. 4A) and C6 (FIG. 4B) versus current without any peptide or modifications (black traces).
  • FIG. 5 Illustrates that Hvl modulating agent C6 affects response of sperm to progesterone, but not other changes related to sperm capacitation.
  • C6 did not affect the vitality (FIG. 5A), the protein tyrosine phosphorylation (FIG. 5F and FIG. 5G), or the cholesterol content of the membranes (FIG. 5H).
  • C6 did not significantly alter the mobility of sperm (FIGS. 5B-5E).
  • C6 did affect the response of sperm to progesterone.
  • the increase of cytosolic calcium triggered by progesterone is diminished in the presence of the Hvl modulating agent and the acrosome reaction induced by the hormone is inhibited (FIGS. 51- 5K).
  • VSL velocity straight line
  • PROG progression
  • VAP velocity average path
  • Capac capacitating medium (Human tubal fluid (HTF) media supplemented with 5 mg/mL BSA; as described, for example, in
  • FIG. 6 Demonstrates that Hvl modulating agent C6 blocks production of
  • FIG. 6A shows relative fluorescence intensity, measured at 590 nM (excited at 530 nM) using Amplex Red, which reacts with ROS to give a fluorescent product, for whole blood alone, PMA-stimulated whole blood, and PMA-stimulated whole blood with various inhibitors.
  • FIG. 6B shows dose response curve plotted as the percentage of fluorescence from PMA-stimulated whole blood blocked versus concentration of C6 present.
  • MOKA toxin and KTX were used as controls and showed no effect at 10 ⁇ .
  • FIG. 7 Presents an exemplary T-toxin nucleotide (FIG. 7A; SEQ ID NO:
  • FIG. 7B amino acid sequence comprising a PDGFR transmembrane helix which links an internal mVenus fluorescent protein to an external C6.
  • FIG. 8 Illustrates effects of Hvl modulating agent C6 tethered to HEK-293T cell surfaces via a PDGFR transmembrane link.
  • FIG. 8A shows current recordings for WT Hvl without any tether or peptide (top), expressed with the transmembrane mVenus without a peptide sequence (middle), or expressed with tethered mVenus-C6 (bottom).
  • FIG. 8B shows WT Hvl current with various amounts of tethered toxin plasmid normalized to current with the transmembrane tether without peptide (I(C6)/I(notox)) or to WT Hvl with no tether expressed (I(C6)/I(Hvl)).
  • FIG. 8C demonstrates small shifts observed in g-V normalized to the maximum seen for each condition.
  • Black line is WT Hvl
  • Green line is WT Hvl with transmembrane without tether
  • Red line is WT-Hvl with tethered C6.
  • FIG. 8D demonstrates current-voltage (I-V) showing the decrease in current in WT (black), WT with tether without toxin (green) or WT with tethered C6 (red).
  • FIG. 8E shows amount of current blocked by 1 ⁇ g of expressed tethered C6 in peak (end of pulse) or tail current. Current is normalized to the maximum of either WT alone (I(C6)/I(Hvl)) or the WT co- expressed with a tether without toxin (I(C6)/I(notox)).
  • FIG. 8F shows FRET
  • FIG. 8G shows average taus measured with the tether without toxin and with the tether with C6 from the fit in FIG. 8F. Increase in decay rate indicates FRET and indicates an interaction between C6 and Hvl.
  • FIG. 9 Demonstrates that Hvl modulating agent C6 targets an S3-S4 external loop region of hHvl .
  • Ciona intestinalis Hvl (CiHvl, yellow), human Hvl (hHvl, cyan), a chimeric Hvl where an S3-S4 external loop region from hHvl replaces a corresponding region from CiHvl
  • hS3S4CiHvl a chimeric Hvl where an S3-S4 external loop region from CiHvl replaces an hHvl loop region, as well as other examples of chimeric sequences. If C6 blocks (YES) or does not (NO) block the channel is indicated. X indicates that proton currents were not measurable. (FIG.
  • Component refers to a relevant part, portion, or moiety of an entity of interest.
  • an entity of interest may be a polypeptide component.
  • composition or method described herein as “comprising” one or more named elements or steps is open-ended, meaning that the named elements or steps are essential, but other elements or steps may be added within the scope of the composition or method.
  • any composition or method described as “comprising” (or which "comprises") one or more named elements or steps also describes the corresponding, more limited composition or method “consisting essentially of (or which "consists essentially of) the same named elements or steps, meaning that the composition or method includes the named essential elements or steps and may also include additional elements or steps that do not materially affect the basic and novel characteristic(s) of the composition or method.
  • composition or method described herein as “comprising” or “consisting essentially of one or more named elements or steps also describes the corresponding, more limited, and closed-ended composition or method “consisting of (or “consists of) the named elements or steps to the exclusion of any other unnamed element or step.
  • known or disclosed equivalents of any named essential element or step may be substituted for that element or step.
  • a monomelic residue in a polymer e.g., an amino acid residue in a polypeptide or a nucleic acid residue in a polynucleotide
  • a monomelic residue in a polymer may be identified as
  • residues in a polypeptide are often designated using a canonical numbering system based on a reference related polypeptide, so that an amino acid "corresponding to" a residue at position 190, for example, need not actually be the 190 th amino acid in a particular amino acid chain but rather corresponds to the residue found at 190 in the reference polypeptide; those of ordinary skill in the art readily appreciate how to identify "corresponding" amino acids.
  • an engineered polynucleotide in general, refers to the aspect of having been manipulated by the hand of man.
  • a polynucleotide is considered to be “engineered” when two or more sequences, that are not linked together in that order in nature, are manipulated by the hand of man to be directly linked to one another in the engineered polynucleotide.
  • an engineered polynucleotide comprises a regulatory sequence that is found in nature in operative association with a first coding sequence but not in operative association with a second coding sequence, is linked by the hand of man so that it is operatively associated with the second coding sequence.
  • a cell or organism is considered to be "engineered” if it has been manipulated so that its genetic information is altered (e.g., new genetic material not previously present has been introduced, for example by transformation, mating, somatic hybridization, transfection, transduction, or other mechanism, or previously present genetic material is altered or removed, for example by substitution or deletion mutation, or by mating protocols).
  • new genetic material not previously present has been introduced, for example by transformation, mating, somatic hybridization, transfection, transduction, or other mechanism, or previously present genetic material is altered or removed, for example by substitution or deletion mutation, or by mating protocols.
  • progeny of an engineered polynucleotide or cell are typically still referred to as
  • Hvl associated disease or condition refers to a disease, disorder, or condition in which cells exhibit relatively abnormal, uncontrolled, or undesired Hvl channel function.
  • Abnormal or uncontrolled Hvl function may arise from, among other mechanisms, dysregulatd phosphorylation, differential isoform expression, or single nucleotide polymorphisms (SNPs) that alter Hvl properties.
  • abnormal or uncontrolled Hvl function includes abnormal activation or opening of Hvl channels.
  • abnormal or uncontrolled Hvl function includes abnormal closing of Hvl channels.
  • cells that exhibit abnormal or uncontrolled Hvl function display an abnormal level or regulation of transmembrane proton flux, transmembrane voltage and/or transmembrane pH gradient ( ⁇ , defined as pH 0 -pHi). In some embodiments, such cells display an abnormal level or regulation of NOX enzyme activity and/or reactive oxygen species (ROS) production.
  • Hvl associated diseases or conditions may exist, for example, inflammation, autoimmunity, cancer, asthma, brain damage in ischemic stroke, Alzheimer's disease, infertility, and numerous other conditions.
  • an Hvl associated disease or condition refers to a condition in which Hvl channel function is within normal, but undesired range.
  • an Hvl associated disease or condition may refer to a condition in which changing Hvl function would achieve a more preferred physiological outcome than not changing Hvl function.
  • suppression of Hvl function in human sperm may be used as a form of birth control to block fertilization.
  • Library refers to a collection of members.
  • a library may be comprised of any type of members.
  • a library comprises a collection of phage particles.
  • a library comprises a collection of peptides.
  • a library comprises a collection of cells.
  • a library typically includes diverse members (i.e., members of a library differ from each other by virtue of variability in an element, such as a peptide sequence, between members).
  • a library of phage particles can include phage particles that express unique peptides.
  • a library of peptides can include peptides having diverse sequences.
  • a library can include, for example, at least 10 1 , 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , 10 7 , 10 8 , 10 9 , or more unique members.
  • modulate is used to refer to the characteristic of changing the state and/or nature of an entity of interest. For example, a particular agent is considered to modulate an entity of interest if the presence, level, and/or form of the agent correlates with a change in the presence, level, and/or form of the entity of interest.
  • to modulate means to increase activity.
  • to modulate means to antagonize, inhibit, or reduce activity.
  • modulation involves binding or direct interaction between a modulator and the entity of interest.
  • to modulate means to affect level of a target entity of interest; alternatively or additionally, in some embodiments, to modulate means to affect activity of a target entity without affecting level of the target entity. In some embodiments, to modulate means to affect both level and activity of a target entity of interest. In some embodiments, effects of a modulator are apparent at the level of the whole-cell, tissue, system (e.g. immune system), or whole organism.
  • composition refers to a composition that is suitable for administration to a human or animal subject.
  • a pharmaceutical composition comprises an active agent formulated together with one or more pharmaceutically acceptable carriers.
  • the active agent is present in a unit dose amount appropriate for
  • a therapeutic regimen comprises one or more doses administered according to a schedule that has been determined to show a statistically significant probability of achieving a desired therapeutic effect when administered to a subject or population in need thereof.
  • a pharmaceutical composition may be specially formulated for administration in solid or liquid form, including those adapted for the following: oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin, lungs, or oral cavity; intravaginally or intrarectally, for example,
  • Polypeptide refers to any polymeric chain of amino acids.
  • a polypeptide has an amino acid sequence that occurs in nature.
  • a polypeptide has an amino acid sequence that does not occur in nature.
  • a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man.
  • a polypeptide may comprise or consist of natural amino acids, non- natural amino acids, or both.
  • a polypeptide may comprise or consist of only natural amino acids or only non-natural amino acids.
  • a polypeptide may comprise D-amino acids, L-amino acids, or both. In some embodiments, a polypeptide may comprise only D-amino acids. In some embodiments, a polypeptide may comprise only L-amino acids. In some embodiments, a polypeptide is referred to as a "peptide.”
  • nucleic acid sequences As used herein, the term “substantial identity” refers to a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be “substantially identical” if they contain identical residues in corresponding positions. As is well known in this art, amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences. Exemplary such programs are described in Altschul et al, Basic local alignment search tool, J. Mol.
  • two sequences are considered to be substantially identical if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of their corresponding residues are identical over a relevant stretch of residues.
  • the relevant stretch is a complete sequence.
  • the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 or more residues.
  • Substantial structural similarity refers to presence of shared structural features such as presence and/or identity of particular amino acids at particular positions.
  • substantially structural similarity refers to presence and/or identity of structural elements (for example: loops, sheets, helices, H-bond donors, H-bond acceptors, glycosylation patterns, salt bridges, and disulfide bonds).
  • substantially structural similarity refers to three dimensional arrangement and/or orientation of atoms or moieties relative to one another (for example: distance and/or angles between or among them between an agent of interest and a reference agent).
  • Toxin refers to all peptides and/or proteins, of any amino acid length and sequence, in either monomeric or multimeric forms, naturally present in animal venoms or poisons and their non-venom homologues.
  • Non-venom homologues include any molecule present outside of a venom gland or not used as a venom component but similar in sequence, structure and/or function to toxins.
  • Animal toxins include all molecules identified or inferred by any means (e.g., physical, chemical, biochemical, genetic, genomic, proteomic) from animal venoms or poisons, including but not limited to isolation from crude venoms, isolation from venom gland tissues or extracts, identification based on venom gland proteome/proteomics, venome/venomics,
  • a toxin is a toxin from a venom or poison of a centipede, lizard, scorpion, sea anemone, snail, snake, spider, or toad.
  • the amino acid sequence of a toxin can be a sequence that encodes an expressed and/or active toxin, or a sequence showing substantial identity thereto.
  • the amino acid sequence of a toxin is substantially identical to that of a wild- type toxin.
  • the amino acid sequence of a toxin is less than 100, 90, 80, 70, 60, 50, 40, 30, 20 or fewer amino acids long.
  • the amino acid sequence of a toxin is more than 5, 6, 7, 8 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acids long.
  • Representative toxins, and their amino acid sequences and source designations are presented in Table 1.
  • Toxin Sequence Element The phrase "toxin sequence element" is used herein to refer to a stretch of amino acid sequence, typically at least 5 amino acids in length, that corresponds to an element found in a wild-type toxin.
  • a toxin sequence element has a length within a range of about 5 to about 100 amino acids.
  • a toxin sequence has a length of about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more amino acids.
  • a toxin sequence element has a length within a range of about 5 to about 25 amino acids.
  • a toxin sequence element differs from a corresponding sequence element found in the wild-type toxin; for example, in some embodiments, a toxin sequence element differs from its corresponding wild-type sequence element, by a sequence variation that includes an addition, substitution, or deletion of at least one amino acid residue. In some embodiments, the variation alters (e.g., adds, substitutes or deletes) 1, 2, 3, 4, 5 or more residues. In some embodiments, the variation alters exactly 1 residue. In some
  • the variation alters exactly 2 residues. In some embodiments, the variation alters exactly 3 residues. In some embodiments, the variation alters not more than 5, 4, 3, 2, or 1 residues. In some embodiments, the variation alters fewer than 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1% of the relevant residues.
  • a toxin sequence element corresponds to a full-length toxin. In some embodiments, a toxin sequence element corresponds to a full-length reference wild-type toxin. In some embodiments, a toxin sequence element corresponds to a portion of a reference wild-type toxin.
  • a toxin sequence element corresponds to a portion of a wild-type reference toxin, which portion is bounded on at least one end by a cysteine residue (e.g., a cysteine residue that, in the wild-type toxin, may participate in a disulfide bond).
  • a cysteine residue e.g., a cysteine residue that, in the wild-type toxin, may participate in a disulfide bond.
  • Wild-type As used herein, the term “wild-type” refers to a form of an entity
  • a polypeptide or nucleic acid e.g., a polypeptide or nucleic acid
  • a polypeptide or nucleic acid that has a structure and/or activity as found in nature in a "normal” (as contrasted with mutant, diseased, altered) state or context.
  • more than one "wild type" form of a particular polypeptide or nucleic acid may exist in nature, for example as “alleles” of a particular gene or normal variants of a particular polypeptide.
  • that form (or those forms) of a particular polypeptide or nucleic acid that is most commonly observed in a population is the "wild-type" form.
  • the voltage-gated proton channel also known as the hydrogen voltage-gated channel 1 (HVCN1), is a protein that in humans is encoded by the HVCN1 gene.
  • HVCN1 hydrogen voltage-gated channel 1
  • Hvl transports protons (H + ) across cell membranes (DeCoursey, T.E. "The voltage-gated proton channel: a riddle, wrapped in a mystery, inside an enigma.”
  • Hvl protein is expressed in a variety of tissues and body systems, including the immune system, the circulatory system, and the reproductive system. In these and other areas, Hvl plays important physiological functions, such as regulation of cell charge and pH. In the present disclosure the terms Hvl channel and Hvl are equivalent.
  • Hvl belongs to a superfamily of voltage-gated ion channels. Similar to other voltage-gated ion channels, Hvl is a transmembrane protein that facilitates the transfer of ions (e.g. H + ) across cell membranes. Also like other voltage-gated ion channels, Hvl has a voltage sensor domain (VSD). However, Hvl channels also have several unique features that distinguish them from other voltage-gated ion channels. For example, Hvl channels are somewhat selective for protons, whereas other ion channels such as potassium channels have some permeability to other ions besides K + .
  • VSD voltage sensor domain
  • variant 2 (NM_001040107.1) represents the longest transcript.
  • Variant 2 (NM_032369.3) differs in the 5' untranslated region (UTR) compared to variant 1.
  • Variants 1 and 2 encode the same protein (isoform 1), which is 273 amino acids.
  • Variant 3 (NM_001256413.1) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at a downstream start codon compared with variant 1.
  • the resulting protein (isoform 2) is shorter (253 amino acids) and has a distinct N-terminus compared to isoform 1.
  • isoform 1 The longer isoform (isoform 1) is considered to be most widely expressed, while the shorter isoform (isoform 2) has been found only in B-lymphocytes and exhibits functionally important differences compared to the full-length protein.
  • Hvl isoform Hvl Sper, post-translationally cleaved
  • SNPs single- nucleotide polymorphisms
  • Hvl channel differs from other voltage-gated ion channels.
  • Other voltage-gated ion channels consist of six transmembrane segments, with segments S1-S4 constituting the VSD that detects changes in membrane potential and S5-S6 forming the pore domain responsible for selective ion permeation.
  • Hvl channels lack the pore domain (S5-S6). Instead, Hvl channels have the first four transmembrane segments (S1-S4) and assemble as a dimer with each subunit containing its own permeation pathway.
  • the N-terminus and C-terminus of Hvl are on the cytoplasmic side.
  • the main region of attachment of the Hvl channel dimer is in the intracellular C-terminus.
  • Ciona intestinalis exist as dimers, whereas Hvl in several unicellular species are predicted to exist as monomers.
  • Hvl from species with dimeric channels are forced to express as monomers, the channels open (activate) several-fold faster than dimeric forms and their gu-V relationship is somewhat (10-15 mV) more positive.
  • the promoters of each monomer in an Hvl channel dimer gate cooperatively, such that both promoters must undergo voltage- induced conformational change before either conduction pathway is open. Consequently, the probability that dimeric Hvl will open is more dependent on voltage compared to the monomeric form.
  • Certain amino acids may be important for Hvl selectivity for protons.
  • the acidic amino acid aspartate at position 112 (Asp 112), which is located in the middle of the SI transmembrane helix, is one such amino acid important for Hvl proton selectivity.
  • protons can travel with a water molecule and to transfer readily and reversibly with other groups.
  • Proton selectivity can also be preserved when Asp is replaced with Glu, or when Arg is replaced with Lys.
  • Hvl channels are uniquely selective for protons, with detectably no other ion permeation. The requirement of such selectivity is crucial because the concentration of protons in mammalian cells or bodily fluids is orders of magnitude lower than that of other major cations like Na + and K + . As already discussed above, Hvl channel selectivity is dependent on specific amino acids, including Aspl 12 and Arg208.
  • Hvl The primary determinants of Hvl channel activation are transmembrane voltage and transmembrane pH gradient ( ⁇ , defined as pH 0 -pHi). Hvl opens at relatively positive transmembrane voltages (i.e. depolarization), but voltage-dependence is strongly modulated by pH.
  • transmembrane pH gradient
  • Parameters that are useful in determining Hvl channel activation include: (1) the membrane voltage (measured on the cytosolic side, relative to the extracellular or luminal side); (2) the cytosolic pH (whereby acidification favors activation at any given voltage); and (3) the extracellular or intra-luminal pH (whereby acidification opposes activation at any given voltage).
  • Three charged Arg residues in the S4 transmembrane segment of Hvl confer voltage dependency, while the structural basis for pH sensing is not fully understood.
  • Hvl at Thr29 located in the intracellular N-terminus phosphorylates Hvl at Thr29 located in the intracellular N-terminus.
  • a situational example of enhanced gating of Hvl is phagocyte exposure to pathogenic stimuli, such as bacteria.
  • a diversity of stimuli can induce enhanced gating, including chemotactic peptides such as fMLF in neutrophils, lipopolysaccharide (LPS) in dendritic cells, IgE in basophils, IL-5 in eosinophils, and arachidonic acid in neutrophils and eosinophils.
  • Such enhanced Hvl gating is only functional in certain cells.
  • the intensity of enhanced gating response may be associated with the presence of an active NADPH oxidase complex.
  • Hvl channels have been identified directly by voltage-clamp recordings in many primary tissue cell types, including neutrophils, basophils, eosinophils, cardiac fibroblasts, cultured myotubes, tracheal epithelium, and monocytes. Neutrophil and eosinophil granulocytes express the highest levels of Hvl .
  • Hvl is expressed in plasma membranes, though there is evidence that Hvl can also be expressed on intracellular membranes such as Golgi membranes in some cells.
  • Full-length Hvl can be detected in human granulocytes by western blot as a 30 kDa monomer or 70 kDa dimer. Based on immunocytochemistry, Hvl partially colocalizes with NOX2 in the membrane of intracellular granules and in the plasma membrane.
  • Hvl channels Functions of Hvl channels differ depending on the cells in which they are expressed.
  • Cells in which high activity and a physiological function for Hvl channels have been documented include immune cells, central nervous system cells, airway epithelia, spermatozoa, and cardiac fibroblasts.
  • H + efflux occurs and thereby increases p3 ⁇ 4, decreases pH 0 and hyperpolarizes the membrane potential.
  • Hvl channel expression and function is closely linked to expression and function of the enzyme NADPH oxidase (NOX), of which there are four isoforms: NOX1, NOX2, NOX3 and NOX4.
  • NOX is a membrane-bound enzyme that transfers electrons from NADPH across cell membranes and couples these electrons to molecular oxygen to produce superoxide anion. In some locations, superoxide can undergo further reactions to generate reactive oxygen species (ROS).
  • ROS reactive oxygen species
  • One of the functions of Hvl linked to NOX activity is the extrusion of protons to compensate for the loss of electrons, as discussed in more detail below.
  • Hvl expression and/or function has been detected in both innate and adaptive immune cells.
  • a major role of Hvl channels is in the phagosome, an intracellular organelle in white blood cells where pathogens such as bacteria are engulfed and destroyed.
  • the primary role for Hvl channels in the phagosome is to allow NOX2 (the NADPH oxidase enzyme complex) to produce large quantities of reactive oxygen species (ROS) to kill pathogens, in a process called "respiratory burst".
  • ROS reactive oxygen species
  • NOX enzymes catalyze the transfer of electrons from NADPH across the plasma membrane to reduce molecular oxygen to O 2" , generating two protons in the cytoplasm.
  • Hvl channels to sustain NOX2 activity by extruding protons from the cytoplasm, thereby maintaining physiological membrane potential and re-establishing normal pH.
  • Hvl channels to NOX2-dependent ROS release are characterized in granulocytes and in particular neutrophils. H current has also been detected in basophils. In these cells, IgE stimulates Hvl channels, which facilitate release of histamine. Hvl may also participate in ROS production and/or histamine release by mast cells.
  • B lymphocytes of the adaptive immune system which are responsible for antibody production, express Hvl protein. It has been suggested that Hvl mediates signaling in the antibody maturation process upon B-cell receptor activation by antigen binding. For example, Hvl channels may be required for ROS production by NOX2 in mature B lymphocytes upon antigen stimulation. Given the involvement of Hvl in B cell receptor signaling, inhibitors of Hvl may be useful for treating autoimmune diseases and B cell malignancies.
  • Hvl channels are also expressed in T lymphocytes, which are cells of the adaptive immune system that recognize antigens presented by major histocompatibility complex I or II.
  • Hvl may function to facilitate ROS production and help regulate the number of activated T lymphocytes, thereby opposing an autoimmune phenotype.
  • capacitation a kind of maturation process that is triggered by an increase in intracellular pH and ROS.
  • Changes related to capacitation include: changes in sperm motility, decrease of cholesterol in the membranes, increase of tyrosine
  • Hvl channels may play a neuroprotective role by extruding protons from metabolically active neurons and regulating neuronal pH homeostasis.
  • Hvl expression has been detected in human microglia, the macrophage-like cells of the central nervous system.
  • Hvl in microglia may contribute to CNS disease by supporting NOX function.
  • Microglia can become activated in acute and chronic brain disorders including brain injury, ischemia, and neurodegeneration.
  • the expression and function of Hvl is correlated with the expression and function of NOX2.
  • Hvl channels may support the activity of NOX2 in microglia by extruding excess protons from the cytoplasm. Oxidative stress, at least in part due to ROS generation by NOX, can contribute to the development of CNS disease. Hvl inhibition could be beneficial for the treatment of neurodegenerative processes accompanied by excessive production of ROS by microglia, such as stroke, Alzheimer's disease,
  • Parkinson's disease and amyotrophic lateral sclerosis, among others.
  • NOX-independent Hvl channel functions may also exist, given that certain cell types (e.g., basophil granulocytes) that exhibit Hvl channel activity are not known to express NOX.
  • certain cell types e.g., basophil granulocytes
  • Hvl also functions in airway epithelia (e.g. tracheal epithelia) in functions such as providing a protective mechanism through acidification of the airway surface liquid. Hvl may also function in cardiac fibroblasts, though its function in these cells is not fully known. Some experimental data also suggests Hvl function in monocytes and macrophages. Hvl channels may promote osteoclast cell function, for instance by promoting bone resorption by osteoclast cells. Hvl channels may also mediate antigen presentation by dendritic cells.
  • Hvl channels Many other tissues and cells not mentioned here also express Hvl channels, some at relatively low levels. For most of the cell types and tissues that have been reported to express low levels of Hvl channels, a specific function has not been assigned.
  • Hvl has been associated with Crohn's disease activity and cystic fibrosis.
  • the link between Hvl function and ROS production provides some insight on the mechanism of some Hvl -associated disorders. Excessive ROS production is thought to cause local tissue damage and contribute to several pathological conditions, including atherosclerosis, ischemic stroke, Parkinson's disease, ischemic liver disease, Alzheimer's disease, and aging.
  • Hvl channels may contribute to the malignancy of several cancers, including breast cancer, colorectal cancer and leukemia. For example, higher levels of Hvl expression occur in breast cancer cell lines with greater metastatic likelihood and knockdown of Hvl in breast cancer cell lines reduced proliferation and invasiveness. In human patients, a high level of Hvl expression was correlated with poor prognosis.
  • One mechanism by which Hvl contributes to cancer cell malignancy is related to the abnormal metabolism of cancer cells, which use glycolysis in preference to oxidative phosphorylation even in the presence of adequate oxygen. This altered metabolism creates a buildup of lactic acid that acidifies the cells, thus requiring enhanced activity of H + extrusion to prevent cell death.
  • the particular isoform of Hvl that is expressed may contribute to certain malignancies.
  • the levels of the short isoform of Hvl are higher in malignant B cell lines as compared to normal B lymphocytes.
  • the short isoform comprises approximately one-third of the Hvl protein in malignant B cells from patients with chronic lymphocytic leukemia.
  • the enhanced gating response is substantially more pronounced in the short compared to the long isoform of Hvl .
  • Hvl channel activity, proliferation and cell migration are all promoted by the expression of the short isoform.
  • Hvl channel activity is an attractive strategy for treating Hvl- related pathologies, including the ones described above.
  • agents that modulate Hvl may be expected to ameliorate inflammation, allergies, autoimmunity, cancer, asthma, brain damage from ischemic stroke, Alzheimer's disease, infertility, and numerous other conditions.
  • Hvl activation or inhibition could prove useful.
  • clinically compatible Hvl modulators are not known.
  • Hvl activation may be an attractive pharmacological strategy.
  • Unsaturated long-chain fatty acids such as oleic acid and arachidonic acid have been shown to enhance Hvl proton currents. This appears to be a direct pharmacological activation of Hvl .
  • Arachidonic acid has been observed to activate a proton conductance in phagocytes.
  • arachidonic acid can also activate multiple signaling pathways, which in certain cases can lead to activation of NOX enzymes and therefore indirectly activate H + currents.
  • Activators of enhanced gating can also enhance Hvl function. In general, ion channel activators are more difficult to identify than inhibitors since binding to the channel usually produces inhibition.
  • Zn 2+ and other polyvalent cations are known to inhibit Hvl channels.
  • Hvl channels can be blocked by Zn 2+ at concentrations ranging from 100 nM to 1 mM depending on the extracellular pH and on the presence of other polyvalent cations.
  • the mechanism by which Zn 2+ inhibits Hvl involves Zn 2+ competing with H + for binding to the external surface of Hvl channels.
  • Two His residues (His 140 and His 193) located at the interface between the channel monomers coordinate Zn 2+ in the closed channel and thereby oppose channel opening. This mechanism changes the membrane potential perceived by the channel, and therefore requires stronger voltage to elicit proton current.
  • Zn 2+ shifts the current-voltage relationship positively and slows the kinetics of Hvl channel activation.
  • Zn 2+ ions are implicated in many other physiological processes, and therefore the usefulness of Zn 2+ as a specific H + channel blocker is limited.
  • Hvl channels There are no documented high-affinity blockers of Hvl channels that originate in venom or toxin.
  • Tarantula toxins including hanatoxin
  • Tarantula toxins can inhibit Hvl at low micromolar concentrations by interacting with the S3 and S4 helices from the membrane interior and shifting the gu-V relationship in the positive direction.
  • hanatoxin is not specific for Hvl.
  • Different voltage-sensing proteins, including Hvl and other ion channels contain the highly conserved voltage sensor regions composed of S3 and S4 helices, termed the paddle motif. Binding of hanatoxin to the paddle motif inhibits ion fluxes through various voltage-dependent ion channels besides Hvl.
  • Guanidine derivatives have shown neuroprotective potential in an in vitro model of ischemia. The biggest challenge for pharmaceutical application of guanidine derivatives is their intracellular site of action.
  • Examples of such other compounds include weak bases (e.g. 4-aminopyridine, amiloride, verapamil or D600), tricyclic antidepressants (imipramine, amitryptiline, and desipramine), the selective serotonin reuptake inhibitor fluoxetine, the morphine-derivative
  • DM dextromethorphan
  • EGCG tea catechin flavonoid EGCG
  • Hvl Modulating Agent Activities [74] The present disclosure provides agents that modulate Hvl. Among other things, the present disclosure provides agents that, for example, modulate one or more Hvl activities when contacted with an Hvl channel, for example, in vitro and/or in vivo. In some embodiments, Hvl modulating agents modulate Hvl activities of Hvl monomers and dimers with similar IC5 0 . In some embodiments, Hvl modulating agents specifically bind Hvl. In some embodiments, Hvl modulating agents inhibit Hvl. In some embodiments, Hvl modulating agents activate Hvl.
  • Hvl modulating agents do not physically occlude Hvl channels. In some embodiments, Hvl modulating agents bind to Hvl but do not bind to other voltage-gated channels or other ion channels.
  • Hvl modulating agents bind to the external surface of
  • Hvl modulating agents target or bind to the S3-S4 external loop region of hHvl.
  • Hvl modulating agents may bind to hHvl at amino acid residues 1183 to L204.
  • Hvl modulating agents bind to regions of hHvl comprising an amino acid sequence corresponding to
  • Hvl modulating agent binding to Hvl is reversible.
  • Hvl modulating agent binding to Hvl may be irreversible. In some embodiments, Hvl modulating agent binding to Hvl is strong but not irreversible.
  • Hvl modulating agents bind to open Hvl channels. In some embodiments, Hvl modulating agents bind to closed channels. In some embodiments, affinity of Hvl modulating agents for closed states of Hvl is about 1 nM. In some embodiments, affinity of Hvl modulating agents is lower for open states of the channel (e.g. about 200 nM) as compared to closed states of the channel. In some embodiments, Hvl modulating agents slow opening of closed states of Hvl even as they unbind.
  • provided Hvl modulating agents may change transmembrane voltage of a cell. Hvl modulating agents may hyperpolarize the membrane potential. Hvl modulating agents may depolarize the membrane potential. Effects of Hvl modulating agents may be measured by, for example, direct electrophysiological recordings of voltage-gated proton currents, such as patch-clamp recordings. [80] In some embodiments, provided Hvl modulating agents are characterized in that, for example, they decrease or block proton current. In some embodiments, Hvl modulating agents may reduce the number or likelihood of Hvl channel opening. In some embodiments, Hvl modulating agents may speed up the rate of Hvl channel closing. In some embodiments, Hvl modulating agents may cause an Hvl channel to require stronger voltage to elicit proton current.
  • provided Hvl modulating agents are characterized in that, for example, they increase proton currents and/or slow the closing of Hvl channels.
  • Hvl modulating agents may provide an enhanced responsiveness mode, allowing more channels to open more quickly, increasing likelihood that Hvl channels will open or remain open, and/or reducing the stimulus required to activate H + flux.
  • Hvl modulating agents may increase or decrease proton (H + ) current but do not directly alter current of other ions (e.g. Na + , K 2+ , Ca 2+ ).
  • Hvl modulating agents may change the
  • provided Hvl modulating agents may increase or decrease intracellular or cytosolic pH (pHj). Thus, Hvl modulating agents may decrease or increase the cytoplasmic acidity. In some embodiments, provided Hvl modulating agents may increase or decrease the extracellular, intraluminal, or organelle pH (pH 0 ). Thus, Hvl modulating agents may decrease or increase the extracellular, intraluminal, or organelle acidity.
  • Hvl modulating agents may increase or decrease the function and/or activity of NOX enzymes, including NOX1, NOX2, NOX3, and/or NOX4. In some such embodiments, Hvl modulating agents may enhance or reduce the ability of NOX enzymes to transfer electrons. In some such embodiments, Hvl modulating agents may increase or decrease the production of superoxide anion by a cell. In some such embodiments, Hvl modulating agents may increase or decrease the quantity of ROS production mediated by NOX enzymes. In some embodiments, Hvl modulating agents may sustain NOX activity by extruding protons from the cytoplasm. [86] In some embodiments, Hvl modulating agents may alter signaling pathways that can be affected by Hvl activity.
  • Hvl modulating agents may affect cellular, physiological, or pathological processes that can be affected by Hvl activity. In some such embodiments, Hvl modulating agents may influence inflammation, allergies, autoimmunity, cancer, asthma, brain damage from ischemic stroke, Alzheimer's disease, and fertility.
  • Hvl modulating agents may alter sperm activity or fertilization. Hvl modulating agents may affect sperm mobility, capacitation, sperm-zona pellucida interaction, acrosome reaction, and sperm-oocyte fusion. In a particular example, Hvl modulating agents inhibit properties associated with sperm capacitation.
  • Hvl modulating agents may alter the ability of white blood cells to fight infections. Hvl modulating agents may alter the activity of phagosomes, NOX enzymes, or ROS production. In a particular example, Hvl modulating agents may decrease ROS production in white blood cells.
  • an Hvl modulating agent is or comprises a polypeptide.
  • a polypeptide component of an Hvl modulating agent is 10-100 amino acids in length.
  • a polypeptide component of the agent has an amino acid tertiary structure that is characterized as an inhibitor cysteine knot (ICK)-like structural motif.
  • ICK inhibitor cysteine knot
  • a polypeptide component has a structure that has substantial structural similarity to an ICK structural motif.
  • a polypeptide component has three disulfide bridges.
  • a polypeptide component has three beta strands.
  • a polypeptide component has an amino acid sequence with six conserved cysteine residues of an ICK motif (FIG. 1).
  • the polypeptide component of the agent has an amino acid sequence that includes one or more elements that is substantially identical to, but different from, that of wild-type toxin sequences (e.g., of a wild-type voltage sensor toxin).
  • a sequence element has a length of about 5 to about 20 amino acids.
  • such a sequence element shows at least 40%, 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with a corresponding element of a wild-type toxin.
  • a polypeptide component of a provided Hvl modulating agent may show significant (e.g., at least 40%, 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or higher) overall sequence identity with, while differing from, a wild-type toxin.
  • a polypeptide component has an amino acid sequence that includes a plurality of toxin sequence elements, each of which is substantially identical to a sequence element that is found in the same, or a different, reference wild-type toxin.
  • the plurality of toxin sequence elements are assembled in linear order so that the amino acid sequence shows overall correspondence with (e.g., shares one or more certain structural features, such as number and/or [relative] location of one or more cysteine residues) a full- length toxin.
  • a polypeptide component has an amino acid sequence that includes one or more residues found in a wild-type toxin that participates in binding by that wild-type toxin to a voltage-sensing protein.
  • a wild-type toxin is a venom toxin.
  • a venom toxin is a toxin found in venom of organisms such as scorpion (e.g., Pandinus imperator), sea anemone, snails (e.g. Conus marmoreus), snakes, and spiders (e.g., Grammostola rosea).
  • a wild-type toxin sequence can be a predicted wild- type toxin sequence.
  • a predicted wild-type toxin sequence is identified in public protein databases.
  • a sequence element found in a wild-type toxin sequence is identified by isolating an amino acid sequence delineated by six conserved cysteine residues that form disulfide bridges in an ICK motif of a wild-type toxin sequence.
  • a known amino acid sequence of a wild-type toxin sequence can be used as a template to align amino acid sequences from public protein databases and identify predicted wild type-toxin sequences.
  • the amino acid sequence of the Peruvian green velvet tarantula ⁇ Thrixopelma pruriens is used as a template to identify predicted wild-type toxin sequences using basic local alignment search tools in public protein databases.
  • a polypeptide component has an amino acid sequence that is substantially identical to a sequence set forth in Table 2. In some embodiments, a polypeptide component has an amino acid sequence that is substantially identical to a sequence set forth in Table 2 and an activating or inhibiting effect on Hvl as set forth in Table 2B. In some embodiments, a polypeptide component has an amino acid sequence that is encoded by a nucleotide sequence that is substantially identical to a sequence set forth in Table 2C.
  • a polypeptide component is composed of one or more polypeptide elements, each of which has an amino acid sequence that is substantially identical to a reference sequence element A, B, or C as set forth in Table 3A.
  • one or more A, B, C reference sequence elements is or comprises a wild type toxin sequence element.
  • a polypeptide component has an amino acid sequence that comprises or consists of a single sequence element corresponding to an A reference sequence element, a single sequence element corresponding to a B reference sequence element, and a single sequence element corresponding to a C reference sequence element.
  • the single sequence elements are arranged in a linear order as follows: A-B-C. Examples of Hvl modulating agents having A-B-C sequence elements are depicted in FIG. 2 and Table 2. Examples of nucleotide sequences encoding polypeptide sequence elements A, B, and C are set forth in Table 3B.
  • reference sequence element A has an amino acid sequence GCKWYLGDC (SEQ ID NO: 809). In some embodiments, reference sequence element A has an amino acid sequence SSTCIPSGQPC (SEQ ID NO: 255). In some embodiments, reference sequence element B has an amino acid sequence
  • reference sequence element C has an amino acid sequence KWVFFTSKFMCRRVWGKD (SEQ ID NO: 411).
  • a provided polypeptide component has an amino acid sequence that is or comprises
  • a provided polypeptide component has an amino acid sequence that is or comprises
  • a polypeptide component has an amino acid sequence that includes one or more cysteine residues at positions corresponding to those at which a cysteine residue is found in a relevant wild-type toxin (e.g., wild-type voltage sensor toxin) sequence or reference sequence element (e.g., as depicted in FIG. 2).
  • a polypeptide component has an amino acid sequence that includes all cysteine residues at positions corresponding to those at which cysteine residues are found in a relevant wild-type toxin sequence or reference sequence element.
  • a polypeptide component has an amino acid sequence that shares the same approximate relative position of cysteines (e.g., number of residues between them) with a relevant wild-type toxin sequence or reference sequence element.
  • a polypeptide component has an amino acid sequence that includes one or more sequence elements that are identical to or includes not more than 1, 2, 3, 4, or 5 sequence differences relative to a wild-type toxin sequence element or reference sequence element.
  • sequence difference(s) are or comprise one or more insertions, deletions, substitutions, rearrangements (e.g., inversions) or combinations thereof. In some embodiments, such sequence difference(s) do not include any insertions. In some embodiments, such sequence difference(s) do not include any deletions. In some embodiments, such sequence differences do not include any rearrangements (e.g., inversions). In some embodiments, such sequence difference(s) may include one or more random sequence alterations.
  • a polypeptide component has an amino acid sequence that includes one or more sequence elements that shares one or more cysteines with a sequence set forth in Table 1, Table 2, and/or Table 3.
  • such a sequence element has an amino acid sequence that shares all cysteines with a sequence set forth in Table 1, Table 2, and/or Table 3.
  • a sequence element shares the same approximate relative position of cysteines (e.g., number of residues between them) with a sequence set forth in Table 1, Table 2, and/or Table 3.
  • a reference sequence element has an amino acid sequence of an element found in a wild-type voltage toxin sequence that differs at residues that undergo posttranslational modifications.
  • a polypeptide component of an Hvl modulating agent may include one or more pendant groups or other modifications, e.g., modifying or attached to one or more amino acid residues (e.g., to one or more amino acid side chains), at the polypeptide component's N-terminus, at the polypeptide component's C-terminus, or any combination thereof.
  • such pendant groups or modifications may be selected from the group consisting of acetylation, amidation, glycosylation, lipidation, methylation, pegylation, phosphorylation, etc., and combinations thereof.
  • exemplary Hvl modulating agents comprise a polypeptide component whose amino acid sequence further comprises one or more tag elements (e.g., a detectable tag, a localizing tag, etc).
  • tag elements e.g., a detectable tag, a localizing tag, etc.
  • an Hvl modulating agent may be a dimer or multimer of relevant entities (e.g., of a polypeptide component as described herein); in some embodiments, an Hvl modulating agent may be or comprise heterodimer or heteromultimer. In some embodiments, an Hvl modulating agent may be or comprise a homodimer or homomultimer. Exemplary Hvl modulating agent dimers are presented in Table 4. Table 4A: Dimer Sequences (with linkers)
  • monomer components of a dimer or multimer agent may be or become covalently linked to one another.
  • such components may be or become covalently linked to one another via one or more disulfide bonds; in some embodiments, such components may be or become covalently linked to one another via one or more peptide bonds; in some embodiments, such components may be or become covalently linked to one another via a bond other than a peptide bond.
  • such components may be or become covalently linked to one another via a linker (e.g., via a polypeptide linker).
  • a linker may be comprised of any of a variety of chemical entities.
  • a linker comprises one or a plurality of amino acids, it may be of any desired length.
  • a linker has a size (e.g., a length) that is smaller than that of one or more of the monomer components.
  • a polypeptide component of an Hvl modulating agent may be connected directly or via a linker sequence to a signal peptide and/or a coat protein of a phage (for phage display methods) and/or to any other domain that may alter one or more of Hvl modulating agent expression, binding, or function.
  • an Hvl modulating agent may have structural modification(s).
  • an Hvl modulating agent may be or comprise a cyclic structure, and/or may comprise a cyclic portion.
  • a polypeptide component of an Hvl modulating agent may be cyclized such that its N-terminus is not part of the cyclic structure.
  • an Hvl modulating agent is not cyclic and/or does not comprise any cyclic portion.
  • an Hvl modulating agent is linear (e.g., one or more, or all, polypeptide components of an Hvl modulating agent is/are linear polypeptide(s)).
  • an Hvl modulating agent may be or comprise a stapled polypeptide.
  • a polypeptide component of an Hvl modulating agent is incorporated into a framework or scaffold structure.
  • a polypeptide component can be incorporated into an antibody framework.
  • a polypeptide component may be incorporated into a beta-sheet framework.
  • an Hvl modulating agent may be or comprise an antibody agent or fragment or component thereof (e.g., an antigen-binding fragment or component, such as a polypeptide including sufficient CDR sequences to bind antigen comparably to an antibody).
  • an Hvl modulating agent may be or comprise a polypeptide component that includes one or more of an immunoglobulin domain or fragment thereof.
  • an Hvl modulating agent may be or comprise a polypeptide component that includes a domain of an immunoglobulin heavy chain. Strategies for preparing such antibody fusions are known in the art (U.S. 14/152441). [111] Alternatively or additionally, in some embodiments, an Hvl modulating agent may be or comprise a nucleic acid, for example that may encode a polypeptide having Hvl modulating agent activity and/or structure, as described herein. Exemplary nucleic acid sequences for Hvl modulating agents are illustrated in Table 2C.
  • Hvl modulating agents can be produced by many methods.
  • an Hvl modulating agent is produced by recombinant expression in a cell.
  • an Hvl modulating agent is produced by peptide synthesis.
  • an Hvl modulating agent is produced by in vitro translation.
  • an Hvl modulating agent is presented on a replicable genetic package, e.g., in the form of a phage, yeast, ribosome, or nucleic acid-protein fusion.
  • an Hvl modulating agent is provided and/or utilized in the context of an expression or display system.
  • Hvl modulating agents are first synthesized as nucleic acids that encode polypeptide elements (e.g. elements A, B, and C in Table 3) and then annealed to produce nucleic acid sequences encoding polypeptide components (e.g. as in Table 2).
  • a nucleic acid sequence encoding an Hvl modulating agent may be inserted into a phagemid or phage vector, in-frame, to form a leader-linker- Hvl modulating agent-linker-coat protein construct (Clackson and Lowman, Phage display. Oxford University Press, 2004; Barbas et al., Phage display. A laboratory manual. Cold Spring Harbor Laboratory Press, 2001).
  • exemplary upstream leader and downstream amino acid sequences are MAAE and GSASSA, respectively.
  • An exemplary phage vector is pAS62.
  • An exemplary coat protein is protein III or its truncated version. Phages can be grown, prepared, titered and stored (Clackson and Lowman, Phage display. Oxford University Press, 2004; Barbas et al, Phage display. A laboratory manual. Cold Spring Harbor Laboratory Press, 2001).
  • Hvl modulating agents can be inserted into vectors for expression and/or library selection.
  • a library is presented in a polypeptide array.
  • a library is presented on a replicable genetic package, e.g., in the form of a phage display, yeast display, ribosome, or nucleic acid-protein fusion library. See, e.g., U.S. Pat. No. 5,223,409; Garrard et al. (1991) Bio/Technology 9: 1373-1377; WO 03/029456; and U.S. Pat. No. 6,207,446. Binding members of such libraries can be obtained by selection and screened in a high throughput format. See, e.g., U.S. 2003-0129659.
  • Hvl modulating agent libraries for phage display can be generated by standard methods (Clackson and Lowman, Phage display. Oxford University Press, 2004; Barbas et al., Phage display. A laboratory manual. Cold Spring Harbor Laboratory Press, 2001).
  • Hvl modulating agent libraries for phage display with a combinatorial arrangement of sequence elements are generated by designing overlapping or non- overlapping oligonucleotides corresponding to each individual element.
  • oligonucleotides are phosphorylated, annealed, mixed in a desired combination and concentration and ligated into a phagemid vector with or without linker sequences to create a library by standard methods (Sambrook et al, Molecular Cloning: A Laboratory Manual. Vols 1-3. Cold Spring Harbor Laboratory Press, 1989). Combinatorial arrangement of sequence elements to yield phage particles expressing a library of Hvl modulating agents is demonstrated in Example 1A.
  • Identification and/or characterization of Hvl modulating agents can include determining effects of candidate agents on Hvl, including Hvl that is naturally or recombinantly expressed.
  • Hvl is expressed in cells.
  • Hvl is immobilized (e.g., immobilized on a solid support, an artificial membrane, or a plasma membrane of a cell).
  • Hvl is purified.
  • Hvl modulating agents can include the use of libraries of candidate agents.
  • an Hvl modulating agent is identified from a candidate library incorporated into a phage display system.
  • candidate Hvl modulating agents are functionally displayed on the surface of phage and nucleic acid sequences encoding candidate Hvl modulating agents are enclosed inside phage particles.
  • Functional display permits selection of Hvl modulating agents that interact with a target or targets (e.g. Hvl channels). Selection of Hvl modulating agents from the library can be based on the Hvl modulating agent type (e.g., toxin type) and/or target biochemistry, pharmacology, immunology and/or other physicochemical or biological property.
  • Hvl modulating agent type e.g., toxin type
  • a phage library can be transfected into Escherichia coli (E. coli) or other suitable bacterial species, propagated, and the phages purified.
  • Hvl modulating agents or candidate agents can be functionally expressed on the surface of the phage and physically linked to their respective genes inside of the phage particle.
  • a library is brought into contact with a target, such as Hvl channels.
  • a phage library can be brought into contact with Hvl channels that are immobilized on magnetic beads, as described in Example 2. After incubation with the target, those phages that express candidate Hvl modulating agents with no or weak recognition for the target are washed away.
  • the remaining Hvl modulating agents that interact with the target are dissociated and can be (i) genotyped to establish the Hvl modulating agent identity, or (ii) processed for one or more rounds of panning, or (iii) otherwise quantified and/or identified (e.g., ELISA, microbiological titering, functional testing).
  • Panning may be performed by the binding of candidate modulating agents to
  • Panning may be repeated until the desired enrichment is achieved.
  • libraries can be pre-depleted on surfaces or cells that contain no Hvl or on an Hvl where the putative modulating agent binding domain may be directly or indirectly altered.
  • any and all conditions of panning may be varied, altered or changed to achieve optimal results, such as the isolation of a specific Hvl modulating agent.
  • Panning variations include, but are not limited to, the presence of competing polypeptide(s), presence of excess target(s), length and temperature of binding, pre-absorption of the library on one or more different receptor(s) or cells or surfaces, composition of binding solution (e.g., ionic strength), stringency of washing, and recovery procedures.
  • Phages recovered from panning may be processed for further rounds of panning, functional analysis, and/or sequencing/genotyping to deduce the resulting Hvl modulating agent's amino acid sequence or biological properties (Clackson and Lowman, Phage display. Oxford University Press, 2004; Barbas et al, Phage display. A laboratory manual. Cold Spring Harbor Laboratory Press, 2001 ).
  • Hvl modulating agents of interest may be produced in native form by standard methods of peptide/protein synthesis/production (Sambrook et al, Molecular Cloning: A Laboratory Manual. Vols 1-3. Cold Spring Harbor Laboratory Press, 1989; Albericio, Solid-Phase Synthesis: A Practical Guide. CRC, 2000; Howl, Peptide Synthesis and Applications. Humana Press, 2005).
  • Hvl modulating agents are tested for activity toward recombinant or functional Hvl.
  • Samples that include functional channels e.g., cells or artificial membranes
  • Hvl modulating agent can be treated with an Hvl modulating agent and compared to control samples (e.g., samples without the Hvl modulating agent), to examine the extent of modulation.
  • Hvl may be naturally expressed.
  • cells may be stably or transiently transfected with functional Hvl .
  • Hvl e.g. human Hvl or human Hvl tagged with a fluorescent protein
  • HEK-293T cells transiently expressing hHvl tagged with teal fluorescent protein are used in patch clamp electrophysiology to determine effects of the Hvl modulating agents C5 or C6 on proton currents.
  • Changes in proton flux may be assessed by determining changes in polarization (i.e., electrical potential) of a cell or membrane expressing Hvl .
  • a change in cellular polarization is measured by measuring changes in current (thereby measuring changes in polarization) with voltage-clamp and patch-clamp techniques, e.g., the "cell-attached" mode, the "inside-out” mode, and the "whole cell” mode (see, e.g., Ackerman et al, New Engl. J. Med. 336: 1575-1595, 1997).
  • Whole cell currents can be determined using standard methodology (see, e.g., Hamil et al, PFlugers. Archiv.
  • candidate Hvl modulating agents are present in the range from 1 pM to 100 mM. Other methods for assessing Hvl modulating agent effects on proton flux are described in the Examples herein.
  • Hvl modulating agents can also be identified or characterized by evaluating processes at the cellular, tissue and/or organism level. For example, Hvl modulating agents can be evaluated for effects downstream of Hvl activity or signaling. Various effects of Hvl modulating agents that may be determined using intact cells or animals include
  • Hvl modulating agents can be evaluated for effects on human sperm.
  • Hvl modulating agents can be evaluated for effects on sperm capacitation-related processes, including changes in sperm motility, decrease of cholesterol in the membranes, increase of tyrosine phosphorylation in several proteins, or maturation of the sperm response to progesterone.
  • Capacitation of spermatozoa occurs along with an increase in the amplitude of voltage-gated proton current.
  • Known Hvl inhibitor, Zn 2+ ' reduces H + current in sperm cells. Accordingly, an Hvl modulating agent can be evaluated for suppression of such sperm capacitation-related processes.
  • an Hvl modulating agent can be evaluated for enhancing sperm capacitation-related processes.
  • an Hvl modulating agent can be evaluated for non- capacitation-related processes that affect sperm activation, mobility, and/or fertilization.
  • Hvl modulating agents can be evaluated for effects on cells that function in the immune system.
  • Hvl is expressed in white blood cells (WBCs).
  • WBCs white blood cells
  • Hvl in WBCs has been shown to compensate charge buildup on the cell membrane during production of ROS.
  • Hvl knockout or inhibition impairs ROS production in these cells.
  • an Hvl modulating agent can be evaluated for suppression of ROS production in WBCs.
  • Hvl modulating agents can be selected for their potency and selectivity of modulation of Hvl.
  • compositions that include and/or deliver
  • a composition is a pharmaceutically acceptable composition that includes and/or delivers an Hvl modulating agent described herein.
  • a provided composition includes an Hvl modulating agent polypeptide component.
  • a provided composition includes a nucleic acid that encodes an Hvl modulating agent polypeptide component, a cell that expresses (or is adapted to express) an Hvl modulating agent polypeptide component, etc.
  • Hvl modulating agents having any of the modifications of the present disclosure are included in pharmaceutical compositions.
  • compositions may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, microemulsions, liposomes and suppositories.
  • liquid solutions e.g., injectable and infusible solutions
  • dispersions or suspensions e.g., dispersions or suspensions
  • microemulsions e.g., liposomes and suppositories.
  • the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • the preferred form of pharmaceutical composition depends on the intended mode of administration and therapeutic application. Typical compositions are in
  • the pharmaceutical composition can include a pharmaceutically acceptable carrier.
  • pharmaceutical compositions can include a therapeutic agent in addition to one or more inactive agents such as a sterile, biocompatible carrier.
  • Exemplary carriers include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • carriers may include sterile water, saline, buffered saline, or dextrose solution.
  • the composition can contain any of a variety of additives, such as stabilizers, buffers, excipients (e.g., sugars, amino acids, etc.), or preservatives.
  • the carrier is suitable for oral, intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion).
  • the pharmaceutical composition can include a pharmaceutically acceptable salt, e.g., a salt that retains the desired biological activity of the Hvl modulating agent and does not impart any undesired toxicological effects (see e.g., Berge, S.M., et al, J. Pharm. Sci. 66: 1-19, 1977).
  • a pharmaceutically acceptable salt e.g., a salt that retains the desired biological activity of the Hvl modulating agent and does not impart any undesired toxicological effects (see e.g., Berge, S.M., et al, J. Pharm. Sci. 66: 1-19, 1977).
  • the Hvl modulating agent may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
  • a pharmaceutical composition can include a therapeutic agent that is encapsulated, trapped, or bound within a lipid vesicle, a
  • bioavailable and/or biocompatible and/or biodegradable matrix, or other microparticles are bioavailable and/or biocompatible and/or biodegradable matrix, or other microparticles.
  • an Hvl modulating agent is prepared with a carrier that protects against rapid release, such as a controlled release formulation, including implants, and microencapsulated delivery systems.
  • a carrier that protects against rapid release, such as a controlled release formulation, including implants, and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polygly colic acid, collagen, polyorthoesters, and poly lactic acid. Many methods for the preparation of such
  • a provided pharmaceutical composition will include an Hvl modulating agent that is not aggregated.
  • an Hvl modulating agent that is not aggregated.
  • less than 1%, 2%, 5%, 10%, 20%, or 30%, by dry weight or number, of Hvl modulating agent is present in an aggregate.
  • a provided pharmaceutical composition will include an Hvl modulating agent that is not denatured. For example, less than 1%, 2%, 5%, 10%, 20%, or 30%, by dry weight or number, of Hvl modulating agents administered is denatured.
  • a provided pharmaceutical composition will include an Hvl modulating agent that is not inactive. For example, less than 1%, 2%, 5%, 10%, 20%, or 30%, by dry weight or number, of Hvl modulating agents administered is inactive.
  • the composition of the kit can include other ingredients, such as a solvent or buffer, a stabilizer or a preservative, and/or a second agent for treating a condition or disorder described herein.
  • other ingredients can be included in the kit, but in different compositions or containers than the Hvl modulating agent.
  • the kit can include instructions for admixing the Hvl modulating agent and the other ingredients, or for using the Hvl modulating agent together with the other ingredients.
  • kits may include, but are not limited to, expression plasmids containing nucleotides (or characteristic or biologically active portions) encoding Hvl modulating agents of interest (or characteristic or biologically active portions).
  • kits may contain expression plasmids that express Hvl modulating agents of interest (or characteristic or biologically active portions).
  • kits may contain isolated and stored Hvl modulating agents.
  • kits for use in accordance with the present invention may include, a reference sample, instructions for processing samples, performing tests on samples, instructions for interpreting the results, buffers and/or other reagents necessary for performing tests.
  • the kit can comprise a panel of antibodies.
  • kits for administration of pharmaceutical compositions For example, in some embodiments, the invention provides a kit comprising at least one dose of an Hvl modulating agent. In some embodiments, the invention provides a kit comprising an initial unit dose and one or more subsequent unit doses of an Hvl modulating agent. In some such embodiments, the initial unit dose is greater than the subsequent unit doses or wherein the all of the doses are equal.
  • compositions may be administered in any dose appropriate to achieve a desired outcome.
  • the desired outcome is reduction in intensity, severity, and/or frequency, and/or delay of onset of one or more symptoms of an Hvl associated disease or condition.
  • a therapeutically effective amount of an Hvl modulating agent composition can be administered, typically an amount which is effective, upon single or multiple dose administration to a subject, in treating a subject, e.g., curing, alleviating, relieving or improving at least one symptom of a disease or condition in a subject to a degree beyond that expected in the absence of such treatment.
  • a therapeutically effective amount of the composition may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the compound to elicit a desired response in the individual.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the composition is outweighed by the therapeutically beneficial effects.
  • a therapeutically effective dosage preferably modulates a measurable parameter, favorably, relative to untreated subjects.
  • the ability of an Hvl modulating agent to inhibit a measurable parameter can be evaluated in an animal model system predictive of efficacy in a human disorder.
  • compositions are administered in multiple doses. In some embodiments, pharmaceutical compositions are administered in multiple doses/day. In some embodiments, pharmaceutical compositions are administered according to a continuous dosing regimen, such that the subject does not undergo periods of less than therapeutic dosing interposed between periods of therapeutic dosing. In some embodiments, pharmaceutical compositions are administered according to an intermittent dosing regimen, such that the subject undergoes at least one period of less than therapeutic dosing interposed between two periods of therapeutic dosing.
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of ligand calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • compositions of the present invention can be administered by a variety of routes, including oral, intravenous, intramuscular, intra-arterial, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, or drops), mucosal, nasal, buccal, enteral, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol.
  • an Hvl modulating agent composition can be administered by intravenous infusion at a rate of less than 30, 20, 10, 5, or 1 mg/min to reach a dose of about 1 to 100 mg/m 2 or 7 to 25 mg/m 2 .
  • the dose could be 100 ⁇ g/Kg, 500 ⁇ g/Kg, 1 mg/Kg, 5 mg/Kg, 10 mg/Kg, or 50 mg/Kg.
  • the route and/or mode of administration will vary depending upon the desired results. In general the most appropriate route of administration will depend upon a variety of factors including the nature of the agent (e.g., its stability in the environment of the gastrointestinal tract), the condition of the patient (e.g., whether the patient is able to tolerate oral administration), etc.
  • Hvl modulating agents or pharmaceutical compositions of the present disclosure may be administered either alone or in combination with one or more other agents.
  • Hvl modulating agents or pharmaceutical compositions of the present disclosure may be administered with one or more other Hvl modulating agents.
  • Hvl modulating agents or pharmaceutical compositions of the present disclosure may be administered with one or more other pharmaceutical agent including, but not limited to, small molecules, vaccines and/or antibodies.
  • Hvl modulating agents or pharmaceutical compositions may be administered in combination with an adjuvant.
  • Combinations of agents may be administered at the same time or formulated for delivery together. Alternatively, each agent may be administered at a dose and on a time schedule determined for that agent. Additionally, the invention encompasses the delivery of the pharmaceutical compositions in combination with agents that may improve their bioavailability, reduce or modify their metabolism, inhibit their excretion, or modify their distribution within the body. Although the pharmaceutical compositions of the present invention can be used for treatment of any subject (e.g., any animal) in need thereof, they are most preferably used in the treatment of humans.
  • Hvl channels have been reported to play a role in a variety of biological processes, and to impact various diseases, disorders, and conditions.
  • Hvl modulating agents and/or Hvl modulating agent compositions described herein can be administered, alone or in combination with, another agent to a subject, e.g., a patient, e.g., a patient who has a disorder (e.g., an Hvl -associated disease or condition, e.g. immune deficiency), a symptom of a disorder or a predisposition toward a disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disorder, the symptoms of the disorder or the predisposition toward the disorder.
  • the treatment may also delay onset, e.g., prevent onset, or prevent deterioration of a condition.
  • Hvl modulating agent pharmaceutical compositions are administered to a subject suffering from or susceptible to an Hvl associated disease or condition.
  • a subject is considered to be suffering from an Hvl associated disease or condition if the subject is displaying one or more symptoms commonly associated with said disease or condition.
  • Hvl modulating agents or Hvl modulating agent compositions may be administered prior to or after development of one or more such symptoms.
  • Hvl modulating agents may be used to ameliorate
  • Hvl modulating agents may be used as a form of birth control by blocking sperm function.
  • Hvl modulating agents may be used to change any of the functions of Hvl channels described in the present disclosure to achieve a preferred or therapeutic outcome.
  • Hvl channels transport protons across cell membranes and are expressed in a variety of cells and tissues. Functions of Hvl channels differ depending on the cells in which they are expressed.
  • Uses for Hvl modulating agents can include increasing or decreasing proton current across cell membranes and/or increasing or decreasing pH in the cytosolic, extracellular, or intraluminal space of cells.
  • uses for Hvl modulating agents may include effects on Hvl-related processes.
  • Hvl modulating agents may be used to increase or decrease the expression and/or function of NOX enzymes, including NOX1, NOX2, NOX3, and/or NOX4.
  • Hvl modulating agents may be used to increase or decrease production of ROS.
  • uses for Hvl modulating agents may include altering biological functions in specific cells.
  • the function of Hvl channels in white blood cells includes extrusion of protons to facilitate ROS production via NOX activity in the phagosome. This process allows white blood cells to destroy bacteria and other pathogens.
  • uses of Hvl modulating agents may include changing these functions in white blood cells.
  • Hvl channel function in human sperm has been associated with sperm capacitation, activation and mobility to achieve fertilization.
  • Hvl modulating agent uses may include increasing or decreasing sperm function and/or fertilization ability.
  • Hvl modulating agents comprise a polypeptide component having an amino acid sequence including element(s) found in wild-type toxin polypeptides.
  • exemplary Hvl modulating agents comprise a polypeptide component whose amino acid sequence further comprises one or more tag elements (e.g., a detectable tag, a localizing tag, etc).
  • exemplary Hvl modulating agents have a structure that comprises both a polypeptide component and a non-polypeptide component (e.g., a modifying component such as a lipid-containing moiety, a sacchari de- containing moiety, etc).
  • exemplary Hvl modulating agents are multimeric in that their structure includes multiple (e.g., 2 or more) monomer components associated with one another.
  • all monomers in a multimer are structurally identical (or substantially identical) to one another.
  • a multimer may comprise 2 or more distinct monomers.
  • two or more monomers in a multimer may be covalently associated with one another (e.g., via a linker or cross-linker).
  • Hvl modulating agents provided herein have an amino acid sequence including element(s) found in wild-type toxin polypeptides.
  • Thrixopelma pruriens was used as a template to identify predicted wild-type toxin sequences using the basic local alignment search tool (BLAST) in the UniProt and Pfam databases.
  • BLAST basic local alignment search tool
  • a total of 110 predicted wild-type toxin sequences were identified (Table 1). All of these sequences encode a polypeptide characterized as having an inhibitor cysteine knot (ICK) structural motif.
  • the amino acid sequences of these 110 predicted wild-type toxins were aligned around six conserved cysteine residues of the ICK motif.
  • Three sequence elements, A, B, and C were delineated by the second and fifth of the six conserved cysteine residues in each predicted wild-type toxin sequence, resulting in 95 A, 104 B, and 106 C sequence elements (Table 3). Nucleotides were synthesized corresponding to these A, B, and C elements.
  • Ligation mixtures were transformed in SS320 electrocompetent cells (Lucigen, Middleton, WI). To verify unbiased insert utilization, 416 plaques were sequenced. The processes yielded phage particles expressing the original 110 predicted wild-type toxins and approximately 1,047,170 novel peptides. Exemplary novel peptides are listed in Table 2A and FIG. 1. Exemplary A, B and C sequence elements are listed in Table 3.
  • Hvl modulating agents were prepared by linking together two polypeptide components, each of which had an amino acid sequence comprising elements of wild-type toxin polypeptides as described above in Section A.
  • one or more signal peptides can be included in exemplary Hvl modulating agents (Table 4B).
  • Hvl modulating agents with an N-terminal trypsin secretory signal sequence can be prepared.
  • an Hvl modulating agent may be modified with an epitope tag.
  • a c-Myc epitope tag can be added near the C-terminus of a polypeptide component in an Hvl modulating agent (Table 4C).
  • an Hvl modulating agent may be modified with a tethering moiety that targets the Hvl modulating agent to a specific surface.
  • hydrophobic sequence may be added to the C-terminus of an
  • Hvl modulating agent that targets the Hvl modulating agent for covalent tethering to glycosylphosphatidylinositol (GPI) anchors inserted in the extracellular leaflet of the plasma membrane (Table 4D).
  • GPI glycosylphosphatidylinositol
  • Hvl modulating agents having signal peptides, detectable tags, and tethering moieties were generated as follows. The sequence encoding mammalian Lynxl, a toxin-like nicotinic acetylcholine receptor modulator, was replaced by cDNA of the Hvl modulating agent C6, in-frame between the secretion signal and the Lynxl hydrophobic sequence for GPI attachment. A flexible linker containing a glycine- asparagine repeat was inserted between the C6 sequence and the hydrophobic sequence for GPI attachment, and a c-Myc epitope tag was introduced in the middle of the linker.
  • T-toxins Hvl modulating agents having these modifications are also called "T-toxins.”
  • Exemplary T- toxin sequences are depicted in FIGS. 3A-3E.
  • the present disclosure appreciates that methods analogous to those described in Gui, J. et al, "A tarantula-venom peptide antagonizes the TRPA1 nociceptor ion channel by binding to the S 1-S4 gating domain," Curr Biol. 24(5):473-83 (2014) can be employed to generate GPI-tethered toxins as described herein.
  • this assay characterizes whether Hvl modulating agents are capable of binding human Hvl (hHvl) protein.
  • a phage display library expressing Hvl modulating agents was generated.
  • Phage particles from Example 1A were used to infect Escherichia coli (E. coli) XLl-Blue cells for 15 min at room temperature. The infected cells were grown overnight at 37 °C in 150 mL 2xYT in the presence of 1010/mL M13K07 helper phage, 100 g/mL ampicillin, and 0.1 mM isopropyl ⁇ - D-l-thiogalactopyranoside (IPTG). Cultures were centrifuged and the supernatant was precipitated with PEG/NaCl solution.
  • Phage particle titer was determined by serial dilution in TBS and infection of E. coli XLl-Blue followed by plating on LB plates with antibiotic and determination of colony forming units (cfu).
  • hHvl protein was biotinylated using sulfosuccinimidyl 2-(biotinamido)- ethyl-l,3-dithiopropionate (EZ-Link Sulfo-NHS-SS-Biotin, Thermo Scientific).
  • Biotinylation was verified by a pull-down assay using streptavidin MagneSphere beads (Promega). Biotinylated hHvl was adsorbed to 300 ⁇ streptavidin MagneSphere paramagnetic particles, and free streptavidin-binding sites were blocked with biotin to prevent nonspecific binding.
  • library phage particles (10 11 cfu) were added in 300 TBSB (25 mM Tris-HCl, 140 mM NaCl, 3 mM KC1, 2 mM LPPG, 0.5% bovine serum albumin, pH 7.4) and incubated on a rocking shaker for 1 h. Poorly adherent phage particles were removed by washing 2-5 times with TBSTB (TBSB with 0.1% Tween 20). The captured phages on the magnetic beads were eluted with 100 mM DTT in 20 mM Tris, pH 8.0, for 10 min, and then used to infect E. coli XLl-Blue cells (Stratagene) for phage amplification.
  • TBSB 25 mM Tris-HCl, 140 mM NaCl, 3 mM KC1, 2 mM LPPG, 0.5% bovine serum albumin, pH 7.4
  • the phage particles captured in the first round were cycled through an additional five rounds of binding and selection using an automated magnetic bead manipulator (KingFisher, Thermo Scientific). Phage particles were quantified by titering before and after selective library sorting and genotyped by DNA sequencing after six rounds of panning. Phage enrichment was observed with immobilized hHvl as the target compared with the control target streptavidin. Exemplary Hvl modulating agents enriched by this method are listed in Table 2A. In some instances, repeats of Hvl modulating agent sequences after several rounds of panning can be observed, as demonstrated by agents labeled as A6 and G2, C2 and F2, C6 and D5, and D6 and E2. Without wishing to be bound by any particular theory, any repeat may be considered significant (since the library had more than 1 million peptides initially) and may demonstrate selection and functional convergence.
  • the present example demonstrates characterization of the effects of Hvl modulating agents on hHvl using T-toxins. Specifically, the present example demonstrates inhibition of hHvl function as measured by tail current from Xenopus laevis oocytes expressing only hHvl or both hHvl and Hvl modulating agents tethered to the oocyte plasma membrane.
  • T-toxin cDNAs were cloned into the pCS2+ plasmid vector for in vitro transcription of T-toxin cRNA.
  • Capped cRNAs were prepared by restriction enzyme linearization, followed by in vitro transcription reaction with SP6 (for T-toxins) and T7 (for hHvl) RNA polymerase (mMessenger mMachine kit, Ambion). Concentrations of cRNAs were measured using NanoDrop 2000 (Thermo Scientific).
  • cRNAs for T-toxins and hHvl were mixed at 1 : 1 ratio (w/w) and injected into the Xenopus laevis oocytes. Currents were measured by Two Electrode Voltage Clamp (TEVC). Recording solution was (in mM): 90 NaCl, 1 MgCl 2 , 2 CaCl 2 , 120 HEPES, pH 7.3. Recordings were performed with constant gravity flow of solution at 2ml/min yielding chamber exchange in ⁇ 5 s. Currents were recorded 2-3 days after cRNA injection using an oocyte clamp amplifier OC-725C (Warner Instruments, Hamden, CT), and electrodes filled with 3 M KC1 with resistance of 0.3 - 1 ⁇ .
  • TEVC Two Electrode Voltage Clamp
  • the present example demonstrates characterization of Hvl modulating agent effects on hHvl using Hvl modulating agents expressed from cells via a transmembrane link.
  • the Hvl modulating agent C6 was tethered to cell surfaces using a transmembrane domain from the PDGF receptor, which links an internal mVenus fluorescent protein to an external C6 (FIG. 7). Unlike the tether in oocytes which attaches C6 to the outside of the cell (e.g. FIG. 3), this is a transmembrane link.
  • hHvl-TFP teal fluorescence protein
  • Example 5 Hvl Modulating Agents Activate or Inhibit Hvl proton current
  • the present Example documents assessing activity of the voltage-gated proton channel Hvl in response to Hvl modulating agents. Activity of Hvl was assessed by changes in proton currents.
  • hHvl-TFP teal fluorescence protein
  • Transfected cells were plated onto glass coverslips. Green or teal cells were selected for whole-cell patch clamp after 24 hours.
  • HEPES pH 7.5, 70mM NaCl, and 10 mM glucose.
  • the pipette solution was lOOmM Bis Tris buffer, pH 6.5, 70 mM NaCl and 10 mM glucose.
  • Hvl modulating agent was applied to these cells while pulsing to 40mV every 10 seconds and proton currents were measured using whole-cell patch clamp electrophysiology.
  • FIG. 4 shows activation or inhibition of Hvl proton currents by Hvl modulating agent as compared to current without addition of modulating agent.
  • Cells were incubated with either 500 nM C5 (FIG. 4A) or 250 nM C6 (FIG. 4B).
  • Activation of Hvl channels by C5 increased proton current and slowed channel closing.
  • Block of Hvl channels by C6 decreased proton currents.
  • the present example demonstrates effectiveness of certain Hvl modulating agents in suppressing maturation of the sperm response to progesterone. This example shows that activity of Hvl channels during capacitation is necessary for calcium rise and acrosomal reaction stimulation by physiological inducers required for fertilization.
  • FIG. 6 demonstrates that C6 blocks production of ROS in human blood cells in a dose-dependent manner.
  • Example 8 The Hvl modulating agent C6 targets an S3-S4 external loop region of hHvl [202]
  • the present example demonstrates identification of regions in hHvl that can bind and/or respond to modulation by the Hvl modulating agent C6.
  • the Hvl modulating agent C6 did not inhibit proton current of Ciona intestinalis (C. intestinalis) Hvl channels (CiHvl).
  • Chimeric forms of ciHvl were generated in which amino acids from human Hvl (hHvl) corresponding to the S3-S4 external loop replaced the same region of CiHvl (hS3-S4-ciHvl).
  • the resulting hS3-S4- ciHvl chimera comprised hHvl amino acids 1183 to L204: ILDIVLLFQEHQFEALGLLILL (SEQ ID NO: 111) and maintained characteristics of Hvl currents.
  • C6 blocked current for hS3-S4-ciHvl (FIGS. 9A and 9B).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Insects & Arthropods (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Cell Biology (AREA)
  • Immunology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

The present invention provides novel agents for modulation of Hv1 channels. The present invention provides agents for activating and/or inhibiting Hv1 channel function and/or activity, and reagents and methods relating thereto.

Description

Hv1 MODULATORS AND USES
Cross Reference to Related Applications
[1] This application claims benefit to U.S. Provisional Application No.
62/441,097, filed December 30, 2016 and U.S. Provisional Application No.
62/447,433, filed January 17, 2017, the contents of which are incorporated herein by reference.
Sequence Listing
[2] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety.
Background
[3] Voltage-gated ion channels facilitate the transfer of ions across cell membranes and function as key components of essential cellular processes. One particular type of voltage-gated ion channel is the voltage-gated proton channel (Hvl). Hvl is a transmembrane protein that regulates the transfer of protons across cell membranes. When the Hvl channel is open, protons permeate the channel and cross the cellular membrane.
[4] The Hvl channel is expressed in many different tissues and is associated with a wide variety of physiological and pathological processes. For example, Hvl channels may play a role in immune defense, sperm activity, and cancer progression. For these and other reasons, Hvl may be an attractive drug target (Seredenina, T., et al. "Voltage-gated proton channels as novel drug targets: from NADPH oxidase regulation to sperm biology. "Antioxid Redox Signal. 10;23(5): 490-513 (2015)). However, clinically compatible Hvl activators or inhibitors are not known. For these reasons, there is a need for the development of activators and inhibitors of Hvl channels.
Summary [5] The present disclosure provides technologies relating to modulation of Hvl channels. Among other things, the present disclosure provides Hvl modulating agents, and various compositions and methods relating thereto.
[6] In some embodiments, an Hvl modulating agent is or comprises an engineered polypeptide component having an inhibitor cysteine knot (ICK)-like structural motif.
[7] In some embodiments, an Hvl modulating agent is or comprises an engineered polypeptide component that includes one or more toxin sequence elements, each of which has an amino acid sequence that is substantially identical to, but differs from, that of a corresponding element found in a wild-type toxin.
[8] In some embodiments, an Hvl modulating agent shares one or more cysteines with a wild-type toxin sequence. In some embodiments, an Hvl modulating agent shares the same approximate relative position of cysteines with a wild-type toxin.
[9] In some embodiments, an Hvl modulating agent is or comprises a polypeptide sequence set forth in Tables 2A, 3A, and 4.
[10] In some embodiments, an Hvl modulating agent is encoded by a nucleotide sequence that is or comprises a sequence set forth in Tables 2C and 3B.
[11] In some embodiments, an Hvl modulating agent can be expressed from a vector including a nucleic acid sequence encoding the Hvl modulating agent.
[12] In some embodiments, an Hvl modulating agent binds to the external surface of human Hvl . In some embodiments, an Hvl modulating agent binds to the S3-S4 external loop region of human Hvl.
[13] In some embodiments, an Hvl modulating agent inhibits human Hvl function. For example, in some embodiments, an Hvl modulating agent may decrease or block proton current. In some embodiments, an Hvl modulating agent may reduce the number or likelihood of Hvl channel opening. In some embodiments, an Hvl modulating agent may increase the rate of Hvl channel closing. [14] In some embodiments, an Hvl modulating agent activates human Hvl function. For example, in some embodiments, an Hvl modulating agent increases proton current. In some embodiments, an Hvl modulating agent increase the rate of Hvl channel opening. In some embodiments, an Hvl modulating agent slows the rate of Hvl channel closing.
[15] In some embodiments, an Hvl modulating agent inhibits sperm capacitation.
[16] In some embodiments, an Hvl modulating agent decreases reactive oxygen species (ROS) production in white blood cells.
[17] The present invention further provides various reagents and methods associated with Hvl modulating agents including, for example, systems for identifying and characterizing them, strategies for preparing them, and various therapeutic compositions and methods relating to them. Further description of certain embodiments of these aspects, and others, of the present invention, is presented below.
Brief Description of the Drawing
[18] FIG. 1 Presents an amino acid sequence alignment of exemplary Hvl modulating agents C5 and C6. Six conserved cysteine residues and three disulfide bridges of an inhibitor cysteine knot (ICK)-like structural motif are indicated.
[19] FIG. 2 Presents the amino acid sequences of exemplary Hvl modulating agents C5 and C6 and the amino acid sequence of hanatoxin (HaTxl). Sequence elements corresponding to sequences in Table 3A are labeled. Conserved cysteine residues are highlighted. NT, N-terminus. CT, C-terminus.
[20] FIG. 3 Presents exemplary T-toxin amino acid sequences and effects of T- toxins on hHvl function. (FIG. 3 A) depicts an exemplary T-toxin comprising the amino acid sequence of Hvl modulating agent C6 linked to a trypsin secretory signal sequence at the N- terminus, a 16 amino acid linker with embedded C-Myc epitope tag at the C-terminus, and a hydrophobic sequence for GPI attachment from the mammalian Lynxl peptide. (FIG. 3B) depicts an exemplary T-toxin comprising an N-terminal trypsin secretory signal sequence, the amino acid sequence of HaTxl linked by a flexible 7 amino acid linker to C6, a C-Myc epitope embedded into a 6 amino acid linker at the C-terminus, and a hydrophobic sequence for GPI attachment. (FIG. 3C) depicts an exemplary T-toxin comprising an N-terminal trypsin secretory signal sequence, C6 dimers linked by a rigid 10 amino acid linker, a C- Myc epitope embedded into a 6 amino acid linker at the C-terminus, and a hydrophobic sequence for GPI attachment. (FIG. 3D) depicts an exemplary T-toxin comprising an N- terminal trypsin secretory signal sequence, C6 dimers linked by a flexible 10 amino acid linker, a C-Myc epitope embedded into a 6 amino acid linker at the C-terminus, and a hydrophobic sequence for GPI attachment. (FIG. 3E) depicts an exemplary T-toxin comprising an N-terminal trypsin secretory signal sequence, C6 dimers linked by long flexible 38 amino acid linker, a C-Myc epitope embedded into a 6 amino acid linker at the C-terminus, and a hydrophobic sequence for GPI attachment. (FIG. 3F) shows inhibition of wild-type hHvl measured as unblocked fractional current in oocytes expressing only hHvl or both hHvl and T-toxin.
[21] FIG. 4 Illustrates activating and inhibiting effects of exemplary Hvl modulators C5 and C6 on hHvl . Whole-cell patch clamp recordings were performed on HEK-293T cells over-expressing hHvl . Proton currents are shown with C5 (FIG. 4A) and C6 (FIG. 4B) versus current without any peptide or modifications (black traces).
[22] FIG. 5 Illustrates that Hvl modulating agent C6 affects response of sperm to progesterone, but not other changes related to sperm capacitation. C6 did not affect the vitality (FIG. 5A), the protein tyrosine phosphorylation (FIG. 5F and FIG. 5G), or the cholesterol content of the membranes (FIG. 5H). C6 did not significantly alter the mobility of sperm (FIGS. 5B-5E). C6 did affect the response of sperm to progesterone. The increase of cytosolic calcium triggered by progesterone is diminished in the presence of the Hvl modulating agent and the acrosome reaction induced by the hormone is inhibited (FIGS. 51- 5K). All responses with C6 were compared to control peptide. VSL, velocity straight line; PROG, progression; VAP, velocity average path; Capac, capacitating medium (Human tubal fluid (HTF) media supplemented with 5 mg/mL BSA; as described, for example, in
Pocognoni, C.A., et al, "PerfringolysinO as a useful tool to study human sperm
physiology," Fertility & Sterility 99(1): 99-106( 2013)).
[23] FIG. 6 Demonstrates that Hvl modulating agent C6 blocks production of
ROS in human blood cells in a dose-dependent manner. Phorbol myristate acetate (PMA) was used to stimulate ROS production as shown by the increase of fluorescence over baseline (blood). The known inhibitor of Hvl, zinc (Zn), blocks to background levels. Various concentrations of C6 also blocked fluorescence intensity in a dose-dependent manner. Two other toxins that block potassium channels with nM affinity (Moka and KTX) had no effect. FIG. 6A shows relative fluorescence intensity, measured at 590 nM (excited at 530 nM) using Amplex Red, which reacts with ROS to give a fluorescent product, for whole blood alone, PMA-stimulated whole blood, and PMA-stimulated whole blood with various inhibitors. 10 μΜ of MOKA toxin was used as a control. FIG. 6B shows dose response curve plotted as the percentage of fluorescence from PMA-stimulated whole blood blocked versus concentration of C6 present. MOKA toxin and KTX were used as controls and showed no effect at 10 μΜ.
[24] FIG. 7 Presents an exemplary T-toxin nucleotide (FIG. 7A; SEQ ID NO:
807) and amino acid (FIG. 7B; SEQ ID NO: 808) sequence comprising a PDGFR transmembrane helix which links an internal mVenus fluorescent protein to an external C6.
[25] FIG. 8 Illustrates effects of Hvl modulating agent C6 tethered to HEK-293T cell surfaces via a PDGFR transmembrane link. (FIG. 8A) shows current recordings for WT Hvl without any tether or peptide (top), expressed with the transmembrane mVenus without a peptide sequence (middle), or expressed with tethered mVenus-C6 (bottom). (FIG. 8B) shows WT Hvl current with various amounts of tethered toxin plasmid normalized to current with the transmembrane tether without peptide (I(C6)/I(notox)) or to WT Hvl with no tether expressed (I(C6)/I(Hvl)). (FIG. 8C) demonstrates small shifts observed in g-V normalized to the maximum seen for each condition. Black line is WT Hvl, Green line is WT Hvl with transmembrane without tether, Red line is WT-Hvl with tethered C6. (FIG. 8D) demonstrates current-voltage (I-V) showing the decrease in current in WT (black), WT with tether without toxin (green) or WT with tethered C6 (red). (FIG. 8E) shows amount of current blocked by 1 μg of expressed tethered C6 in peak (end of pulse) or tail current. Current is normalized to the maximum of either WT alone (I(C6)/I(Hvl)) or the WT co- expressed with a tether without toxin (I(C6)/I(notox)). (FIG. 8F) shows FRET
measurements between Hvl-TFP and mVenus transmembrane without toxin or with C6. Normalized fluorescence versus time is fit with a single exponential decay to determine the time constants for fluorescence decay with or without toxin. (FIG. 8G) shows average taus measured with the tether without toxin and with the tether with C6 from the fit in FIG. 8F. Increase in decay rate indicates FRET and indicates an interaction between C6 and Hvl. [26] FIG. 9 Demonstrates that Hvl modulating agent C6 targets an S3-S4 external loop region of hHvl . (FIG. 9A) illustrates sequence alignments of Ciona intestinalis Hvl (CiHvl, yellow), human Hvl (hHvl, cyan), a chimeric Hvl where an S3-S4 external loop region from hHvl replaces a corresponding region from CiHvl
(hS3S4CiHvl), a chimeric Hvl where an S3-S4 external loop region from CiHvl replaces an hHvl loop region, as well as other examples of chimeric sequences. If C6 blocks (YES) or does not (NO) block the channel is indicated. X indicates that proton currents were not measurable. (FIG. 9B) demonstrates a representative trace (left) for CiHvl with 1 μΜ C6 (red trace) or without (black trace), a representative trace (middle) for hS3S4CiHvl which is sensitive to C6 (red trace, 1 μΜ C6), and a representative trace (right) for CiS3S4hHvl which is insensitive to C6 (red trace, 1 μΜ C6). Black traces are current without any applied peptide. (FIG. 9C) demonstrates results from a cysteine scan of part of the transferred epitope. Bars are the amount of current with 1 μΜ C6 normalized to current without toxin (Itox/Ictr). Many residues show decreased affinity but only G199 and E192 show dramatically different effects to the WT (first bar).
Definitions
[27] Component: The term "component" as used herein refers to a relevant part, portion, or moiety of an entity of interest. For example, in some embodiments, an entity of interest may be a polypeptide component.
[28] Comprising: A composition or method described herein as "comprising" one or more named elements or steps is open-ended, meaning that the named elements or steps are essential, but other elements or steps may be added within the scope of the composition or method. To avoid prolixity, it is also understood that any composition or method described as "comprising" (or which "comprises") one or more named elements or steps also describes the corresponding, more limited composition or method "consisting essentially of (or which "consists essentially of) the same named elements or steps, meaning that the composition or method includes the named essential elements or steps and may also include additional elements or steps that do not materially affect the basic and novel characteristic(s) of the composition or method. It is also understood that any composition or method described herein as "comprising" or "consisting essentially of one or more named elements or steps also describes the corresponding, more limited, and closed-ended composition or method "consisting of (or "consists of) the named elements or steps to the exclusion of any other unnamed element or step. In any composition or method disclosed herein, known or disclosed equivalents of any named essential element or step may be substituted for that element or step.
[29] Corresponding to: As used herein, the term "corresponding to" designates the position/identity of a structural element in a compound or composition through comparison with an appropriate reference compound or composition. For example, in some embodiments, a monomelic residue in a polymer (e.g., an amino acid residue in a polypeptide or a nucleic acid residue in a polynucleotide) may be identified as
"corresponding to" a residue in an appropriate reference polymer. For example, those of ordinary skill will appreciate that, for purposes of simplicity, residues in a polypeptide are often designated using a canonical numbering system based on a reference related polypeptide, so that an amino acid "corresponding to" a residue at position 190, for example, need not actually be the 190th amino acid in a particular amino acid chain but rather corresponds to the residue found at 190 in the reference polypeptide; those of ordinary skill in the art readily appreciate how to identify "corresponding" amino acids.
[30] Engineered: In general, the term "engineered" refers to the aspect of having been manipulated by the hand of man. For example, a polynucleotide is considered to be "engineered" when two or more sequences, that are not linked together in that order in nature, are manipulated by the hand of man to be directly linked to one another in the engineered polynucleotide. For example, in some embodiments of the present invention, an engineered polynucleotide comprises a regulatory sequence that is found in nature in operative association with a first coding sequence but not in operative association with a second coding sequence, is linked by the hand of man so that it is operatively associated with the second coding sequence. Comparably, a cell or organism is considered to be "engineered" if it has been manipulated so that its genetic information is altered (e.g., new genetic material not previously present has been introduced, for example by transformation, mating, somatic hybridization, transfection, transduction, or other mechanism, or previously present genetic material is altered or removed, for example by substitution or deletion mutation, or by mating protocols). As is common practice and is understood by those in the art, progeny of an engineered polynucleotide or cell are typically still referred to as
"engineered" even though the actual manipulation was performed on a prior entity.
[31] Inhibitor Cysteine Knot (ICK)-like structural motif: As used herein, the term "inhibitor cysteine knot (ICK)-like structural motif designates a peptide structure that has substantial structural similarity to an ICK structural motif. In some embodiments, an ICK-like structural motif has three disulfide bridges. In some embodiments, an ICK-like structural motif has two, one, or zero disulfide bridges. In some embodiments, an ICK-like structural motif has three beta strands. In some embodiments, an ICK-like structural motif has two, one, or zero beta strands. In some embodiments, an ICK-like structural motif has an amino acid sequence with six conserved cysteine residues of an ICK structural motif. In some embodiments, an ICK-like structural motif has an amino acid sequence with 5, 4, 3, 2, 1, or 0 conserved cysteine residues of an ICK structural motif.
[32] Hvl associated disease or condition: As used herein, the phrase "Hvl associated disease or condition" refers to a disease, disorder, or condition in which cells exhibit relatively abnormal, uncontrolled, or undesired Hvl channel function. Abnormal or uncontrolled Hvl function may arise from, among other mechanisms, dysregulatd phosphorylation, differential isoform expression, or single nucleotide polymorphisms (SNPs) that alter Hvl properties. In some embodiments, abnormal or uncontrolled Hvl function includes abnormal activation or opening of Hvl channels. In some embodiments, abnormal or uncontrolled Hvl function includes abnormal closing of Hvl channels. In some embodiments, cells that exhibit abnormal or uncontrolled Hvl function display an abnormal level or regulation of transmembrane proton flux, transmembrane voltage and/or transmembrane pH gradient (ΔρΗ, defined as pH0-pHi). In some embodiments, such cells display an abnormal level or regulation of NOX enzyme activity and/or reactive oxygen species (ROS) production. A variety of types of Hvl associated diseases or conditions may exist, for example, inflammation, autoimmunity, cancer, asthma, brain damage in ischemic stroke, Alzheimer's disease, infertility, and numerous other conditions. In some embodiments, an Hvl associated disease or condition refers to a condition in which Hvl channel function is within normal, but undesired range. For example, an Hvl associated disease or condition may refer to a condition in which changing Hvl function would achieve a more preferred physiological outcome than not changing Hvl function. For example, suppression of Hvl function in human sperm may be used as a form of birth control to block fertilization.
[33] Library: As used herein, the term "library" refers to a collection of members.
A library may be comprised of any type of members. For example, in some embodiments, a library comprises a collection of phage particles. In some embodiments, a library comprises a collection of peptides. In some embodiments, a library comprises a collection of cells. A library typically includes diverse members (i.e., members of a library differ from each other by virtue of variability in an element, such as a peptide sequence, between members). For example, a library of phage particles can include phage particles that express unique peptides. A library of peptides can include peptides having diverse sequences. A library can include, for example, at least 101, 102, 103, 104, 105, 106, 107, 108, 109, or more unique members.
[34] Modulate: The term "modulate" is used to refer to the characteristic of changing the state and/or nature of an entity of interest. For example, a particular agent is considered to modulate an entity of interest if the presence, level, and/or form of the agent correlates with a change in the presence, level, and/or form of the entity of interest. In some embodiments, to modulate means to increase activity. In some embodiments, to modulate means to antagonize, inhibit, or reduce activity. In some embodiments, modulation involves binding or direct interaction between a modulator and the entity of interest. In some embodiments, to modulate means to affect level of a target entity of interest; alternatively or additionally, in some embodiments, to modulate means to affect activity of a target entity without affecting level of the target entity. In some embodiments, to modulate means to affect both level and activity of a target entity of interest. In some embodiments, effects of a modulator are apparent at the level of the whole-cell, tissue, system (e.g. immune system), or whole organism.
[35] Pharmaceutical Composition: As used herein, the term "pharmaceutical composition" refers to a composition that is suitable for administration to a human or animal subject. In some embodiments, a pharmaceutical composition comprises an active agent formulated together with one or more pharmaceutically acceptable carriers. In some embodiments, the active agent is present in a unit dose amount appropriate for
administration in a therapeutic regimen. In some embodiments, a therapeutic regimen comprises one or more doses administered according to a schedule that has been determined to show a statistically significant probability of achieving a desired therapeutic effect when administered to a subject or population in need thereof. In some embodiments, a pharmaceutical composition may be specially formulated for administration in solid or liquid form, including those adapted for the following: oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin, lungs, or oral cavity; intravaginally or intrarectally, for example, as a pessary, cream, or foam; sublingually; ocularly; trans dermally; or nasally, pulmonary, and to other mucosal surfaces. In some embodiments, a pharmaceutical composition is intended and suitable for administration to a human subject. In some embodiments, a pharmaceutical composition is sterile and substantially pyrogen-free.
[36] Polypeptide: As used herein, the term "polypeptide" refers to any polymeric chain of amino acids. In some embodiments, a polypeptide has an amino acid sequence that occurs in nature. In some embodiments, a polypeptide has an amino acid sequence that does not occur in nature. In some embodiments, a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man. In some embodiments, a polypeptide may comprise or consist of natural amino acids, non- natural amino acids, or both. In some embodiments, a polypeptide may comprise or consist of only natural amino acids or only non-natural amino acids. In some embodiments, a polypeptide may comprise D-amino acids, L-amino acids, or both. In some embodiments, a polypeptide may comprise only D-amino acids. In some embodiments, a polypeptide may comprise only L-amino acids. In some embodiments, a polypeptide is referred to as a "peptide."
[37] Substantial identity: As used herein, the term "substantial identity" refers to a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be "substantially identical" if they contain identical residues in corresponding positions. As is well known in this art, amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences. Exemplary such programs are described in Altschul et al, Basic local alignment search tool, J. Mol. Biol, 215(3): 403-410, 1990; Altschul et al., Methods in Enzymology; Altschul et al, Nucleic Acids Res. 25:3389-3402, 1997; Baxevanis et al., Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins, Wiley, 1998; and Misener, et al, (eds.), Bioinformatics Methods and Protocols (Methods in Molecular Biology, Vol. 132), Humana Press, 1999. In addition to identifying identical sequences, the programs mentioned above typically provide an indication of the degree of identity. In some embodiments, two sequences are considered to be substantially identical if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of their corresponding residues are identical over a relevant stretch of residues. In some embodiments, the relevant stretch is a complete sequence. In some embodiments, the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 or more residues.
[38] Substantial structural similarity: As used herein, the term "substantial structural similarity" refers to presence of shared structural features such as presence and/or identity of particular amino acids at particular positions. In some embodiments the term "substantial structural similarity" refers to presence and/or identity of structural elements (for example: loops, sheets, helices, H-bond donors, H-bond acceptors, glycosylation patterns, salt bridges, and disulfide bonds). In some embodiments, the term "substantial structural similarity" refers to three dimensional arrangement and/or orientation of atoms or moieties relative to one another (for example: distance and/or angles between or among them between an agent of interest and a reference agent).
[39] Toxin: As used herein, the term "toxin" refers to all peptides and/or proteins, of any amino acid length and sequence, in either monomeric or multimeric forms, naturally present in animal venoms or poisons and their non-venom homologues. Non-venom homologues include any molecule present outside of a venom gland or not used as a venom component but similar in sequence, structure and/or function to toxins. Animal toxins include all molecules identified or inferred by any means (e.g., physical, chemical, biochemical, genetic, genomic, proteomic) from animal venoms or poisons, including but not limited to isolation from crude venoms, isolation from venom gland tissues or extracts, identification based on venom gland proteome/proteomics, venome/venomics,
trans criptome, and/or EST analysis. In some embodiments, a toxin is a toxin from a venom or poison of a centipede, lizard, scorpion, sea anemone, snail, snake, spider, or toad. In some embodiments, the amino acid sequence of a toxin can be a sequence that encodes an expressed and/or active toxin, or a sequence showing substantial identity thereto. In some embodiments, the amino acid sequence of a toxin is substantially identical to that of a wild- type toxin. In some embodiments, the amino acid sequence of a toxin is less than 100, 90, 80, 70, 60, 50, 40, 30, 20 or fewer amino acids long. In some embodiments, the amino acid sequence of a toxin is more than 5, 6, 7, 8 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acids long. Representative toxins, and their amino acid sequences and source designations are presented in Table 1.
[40] Toxin Sequence Element: The phrase "toxin sequence element" is used herein to refer to a stretch of amino acid sequence, typically at least 5 amino acids in length, that corresponds to an element found in a wild-type toxin. In some embodiments, a toxin sequence element has a length within a range of about 5 to about 100 amino acids. In some embodiments, a toxin sequence has a length of about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more amino acids. In some embodiments, a toxin sequence element has a length within a range of about 5 to about 25 amino acids. In some embodiments, a toxin sequence element differs from a corresponding sequence element found in the wild-type toxin; for example, in some embodiments, a toxin sequence element differs from its corresponding wild-type sequence element, by a sequence variation that includes an addition, substitution, or deletion of at least one amino acid residue. In some embodiments, the variation alters (e.g., adds, substitutes or deletes) 1, 2, 3, 4, 5 or more residues. In some embodiments, the variation alters exactly 1 residue. In some
embodiments, the variation alters exactly 2 residues. In some embodiments, the variation alters exactly 3 residues. In some embodiments, the variation alters not more than 5, 4, 3, 2, or 1 residues. In some embodiments, the variation alters fewer than 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1% of the relevant residues. In some embodiments, a toxin sequence element corresponds to a full-length toxin. In some embodiments, a toxin sequence element corresponds to a full-length reference wild-type toxin. In some embodiments, a toxin sequence element corresponds to a portion of a reference wild-type toxin. In some embodiments, a toxin sequence element corresponds to a portion of a wild-type reference toxin, which portion is bounded on at least one end by a cysteine residue (e.g., a cysteine residue that, in the wild-type toxin, may participate in a disulfide bond).
[41] Wild-type: As used herein, the term "wild-type" refers to a form of an entity
(e.g., a polypeptide or nucleic acid) that has a structure and/or activity as found in nature in a "normal" (as contrasted with mutant, diseased, altered) state or context. In some embodiments, more than one "wild type" form of a particular polypeptide or nucleic acid may exist in nature, for example as "alleles" of a particular gene or normal variants of a particular polypeptide. In some embodiments, that form (or those forms) of a particular polypeptide or nucleic acid that is most commonly observed in a population (e.g., in a human population) is the "wild-type" form.
Detailed Description of Certain Embodiments
Hyl Channel
[42] The voltage-gated proton channel (Hvl), also known as the hydrogen voltage-gated channel 1 (HVCN1), is a protein that in humans is encoded by the HVCN1 gene. There are at least ten species with functionally confirmed Hvl genes, including human (hHvl) and mouse (mHvl), in addition to several species with predicted Hvl genes that have not yet been confirmed by expression and electrophysiology studies. Among its functions, Hvl transports protons (H+) across cell membranes (DeCoursey, T.E. "The voltage-gated proton channel: a riddle, wrapped in a mystery, inside an enigma."
Biochemistry 54(21): 3250-68 (2015)). In humans, the Hvl protein is expressed in a variety of tissues and body systems, including the immune system, the circulatory system, and the reproductive system. In these and other areas, Hvl plays important physiological functions, such as regulation of cell charge and pH. In the present disclosure the terms Hvl channel and Hvl are equivalent.
[43] Hvl belongs to a superfamily of voltage-gated ion channels. Similar to other voltage-gated ion channels, Hvl is a transmembrane protein that facilitates the transfer of ions (e.g. H+) across cell membranes. Also like other voltage-gated ion channels, Hvl has a voltage sensor domain (VSD). However, Hvl channels also have several unique features that distinguish them from other voltage-gated ion channels. For example, Hvl channels are exquisitely selective for protons, whereas other ion channels such as potassium channels have some permeability to other ions besides K+.
[44] According to the National Center for Biotechnology Information (NCBI)
Gene database, there are three transcript variants for human HVCN1. Variant 1
(NM_001040107.1) represents the longest transcript. Variant 2 (NM_032369.3) differs in the 5' untranslated region (UTR) compared to variant 1. Variants 1 and 2 encode the same protein (isoform 1), which is 273 amino acids. Variant 3 (NM_001256413.1) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at a downstream start codon compared with variant 1. The resulting protein (isoform 2) is shorter (253 amino acids) and has a distinct N-terminus compared to isoform 1. The longer isoform (isoform 1) is considered to be most widely expressed, while the shorter isoform (isoform 2) has been found only in B-lymphocytes and exhibits functionally important differences compared to the full-length protein. Recently, another Hvl isoform (Hvl Sper, post-translationally cleaved) was reported in human sperm. At least seven validated, nonsynonymous single- nucleotide polymorphisms (SNPs) for human HVCN1 have been identified. Only two of these seven have a frequencies above 1%.
Hyl Channel Structure
[45] The structure of the Hvl channel differs from other voltage-gated ion channels. Other voltage-gated ion channels consist of six transmembrane segments, with segments S1-S4 constituting the VSD that detects changes in membrane potential and S5-S6 forming the pore domain responsible for selective ion permeation. In contrast, Hvl channels lack the pore domain (S5-S6). Instead, Hvl channels have the first four transmembrane segments (S1-S4) and assemble as a dimer with each subunit containing its own permeation pathway. The N-terminus and C-terminus of Hvl are on the cytoplasmic side. The main region of attachment of the Hvl channel dimer is in the intracellular C-terminus.
[46] Hvl from several multicellular species (human, mouse, and the sea squirt
Ciona intestinalis) exist as dimers, whereas Hvl in several unicellular species are predicted to exist as monomers. When Hvl from species with dimeric channels are forced to express as monomers, the channels open (activate) several-fold faster than dimeric forms and their gu-V relationship is somewhat (10-15 mV) more positive. The promoters of each monomer in an Hvl channel dimer gate cooperatively, such that both promoters must undergo voltage- induced conformational change before either conduction pathway is open. Consequently, the probability that dimeric Hvl will open is more dependent on voltage compared to the monomeric form.
[47] Certain amino acids may be important for Hvl selectivity for protons. The acidic amino acid aspartate at position 112 (Asp 112), which is located in the middle of the SI transmembrane helix, is one such amino acid important for Hvl proton selectivity.
Mutating Aspl 12 to any other amino acid except Glu (another acidic amino acid) converts hHvl channel into an anion channel. Aspl 12 interacts with arginine (Arg208) in the S4 segment via two hydrogen bonds, with Asp or Arg protonated. Introducing a hydronium ion, H30+, into either configuration results in protonation of Asp, breaking of the hydrogen bonds, and resulting in a neutral water molecule that mediates interactions in AspH°-H20°- Arg+. From this protonated selectivity filter configuration, reprotonation of the water molecule results in net H+ permeation. Therefore, the unique abilities of protons to travel with a water molecule and to transfer readily and reversibly with other groups is exploited by Hvl in achieving proton selectivity. Proton selectivity can also be preserved when Asp is replaced with Glu, or when Arg is replaced with Lys.
[48] Besides the selectivity filter, there is another hydrophobic region in hHvl predicted by molecular dynamic simulations. This second region is a highly conserved Phel50. The proton may inject its own water wire through this hydrophobic region. Thus, protons are uniquely able to open the selectivity filter and to hydrate dry regions of the pore.
Hyl Channel Mechanism
[49] Hvl channels are uniquely selective for protons, with detectably no other ion permeation. The requirement of such selectivity is crucial because the concentration of protons in mammalian cells or bodily fluids is orders of magnitude lower than that of other major cations like Na+ and K+. As already discussed above, Hvl channel selectivity is dependent on specific amino acids, including Aspl 12 and Arg208.
[50] The primary determinants of Hvl channel activation are transmembrane voltage and transmembrane pH gradient (ΔρΗ, defined as pH0-pHi). Hvl opens at relatively positive transmembrane voltages (i.e. depolarization), but voltage-dependence is strongly modulated by pH. When the cytosol becomes more acidic relative to the extracellular or intraluminal space, the entire conductance-voltage relationship of the channel shifts by 40 mV to more negative voltages for each unit increase in ΔρΗ. Conversely, when the extracellular or intraluminal side becomes more acidic than the cytosol , the conductance- voltage relationship shifts by 40 mV to more positive voltages for each unitary change in ΔρΗ. Parameters that are useful in determining Hvl channel activation include: (1) the membrane voltage (measured on the cytosolic side, relative to the extracellular or luminal side); (2) the cytosolic pH (whereby acidification favors activation at any given voltage); and (3) the extracellular or intra-luminal pH (whereby acidification opposes activation at any given voltage). Three charged Arg residues in the S4 transmembrane segment of Hvl confer voltage dependency, while the structural basis for pH sensing is not fully understood.
[51] Besides voltage and ΔρΗ, other parameters can also influence Hvl channel activation. For example, phosphorylation of the channel by PKC can produce an enhanced responsiveness mode, allowing for more channels to open more quickly. PKC
phosphorylates Hvl at Thr29 located in the intracellular N-terminus. A situational example of enhanced gating of Hvl is phagocyte exposure to pathogenic stimuli, such as bacteria. A diversity of stimuli can induce enhanced gating, including chemotactic peptides such as fMLF in neutrophils, lipopolysaccharide (LPS) in dendritic cells, IgE in basophils, IL-5 in eosinophils, and arachidonic acid in neutrophils and eosinophils. Such enhanced Hvl gating is only functional in certain cells. The intensity of enhanced gating response may be associated with the presence of an active NADPH oxidase complex. Additionally, slower tail current decay (channel closing), is temporally correlated with NADPH oxidase activity. Enhanced gating makes Hvl channels more likely to open or remain open, thereby requiring a smaller stimulus to activate H+ flux. Hvl proton currents are also sensitive to temperature, and have a small (15 fF) unitary conductance.
Hyl Channel Expression
[52] Hvl channels have been identified directly by voltage-clamp recordings in many primary tissue cell types, including neutrophils, basophils, eosinophils, cardiac fibroblasts, cultured myotubes, tracheal epithelium, and monocytes. Neutrophil and eosinophil granulocytes express the highest levels of Hvl .
[53] In most cells, Hvl is expressed in plasma membranes, though there is evidence that Hvl can also be expressed on intracellular membranes such as Golgi membranes in some cells. Full-length Hvl can be detected in human granulocytes by western blot as a 30 kDa monomer or 70 kDa dimer. Based on immunocytochemistry, Hvl partially colocalizes with NOX2 in the membrane of intracellular granules and in the plasma membrane.
Hyl Channel Functions
[54] Functions of Hvl channels differ depending on the cells in which they are expressed. Cells in which high activity and a physiological function for Hvl channels have been documented include immune cells, central nervous system cells, airway epithelia, spermatozoa, and cardiac fibroblasts. Under normal circumstances, when Hvl channels open, H+ efflux occurs and thereby increases p¾, decreases pH0 and hyperpolarizes the membrane potential. These changes can have different consequences in different cells.
[55] In some cells, Hvl channel expression and function is closely linked to expression and function of the enzyme NADPH oxidase (NOX), of which there are four isoforms: NOX1, NOX2, NOX3 and NOX4. NOX is a membrane-bound enzyme that transfers electrons from NADPH across cell membranes and couples these electrons to molecular oxygen to produce superoxide anion. In some locations, superoxide can undergo further reactions to generate reactive oxygen species (ROS). One of the functions of Hvl linked to NOX activity is the extrusion of protons to compensate for the loss of electrons, as discussed in more detail below.
[56] Hvl expression and/or function has been detected in both innate and adaptive immune cells. A major role of Hvl channels is in the phagosome, an intracellular organelle in white blood cells where pathogens such as bacteria are engulfed and destroyed. The primary role for Hvl channels in the phagosome is to allow NOX2 (the NADPH oxidase enzyme complex) to produce large quantities of reactive oxygen species (ROS) to kill pathogens, in a process called "respiratory burst". During the respiratory burst, NOX enzymes catalyze the transfer of electrons from NADPH across the plasma membrane to reduce molecular oxygen to O2", generating two protons in the cytoplasm. The resulting depolarization and cytoplasmic acidification inhibits NOX2 activity. Depolarization opens Hvl channels to sustain NOX2 activity by extruding protons from the cytoplasm, thereby maintaining physiological membrane potential and re-establishing normal pH. Such contributions of Hvl channels to NOX2-dependent ROS release are characterized in granulocytes and in particular neutrophils. H current has also been detected in basophils. In these cells, IgE stimulates Hvl channels, which facilitate release of histamine. Hvl may also participate in ROS production and/or histamine release by mast cells.
[57] B lymphocytes of the adaptive immune system, which are responsible for antibody production, express Hvl protein. It has been suggested that Hvl mediates signaling in the antibody maturation process upon B-cell receptor activation by antigen binding. For example, Hvl channels may be required for ROS production by NOX2 in mature B lymphocytes upon antigen stimulation. Given the involvement of Hvl in B cell receptor signaling, inhibitors of Hvl may be useful for treating autoimmune diseases and B cell malignancies.
[58] Hvl channels are also expressed in T lymphocytes, which are cells of the adaptive immune system that recognize antigens presented by major histocompatibility complex I or II. Here, Hvl may function to facilitate ROS production and help regulate the number of activated T lymphocytes, thereby opposing an autoimmune phenotype.
[59] Expression and activity of Hvl has been confirmed in human sperm.
Functional data indicate that Hvl activity may be necessary for sperm activation and mobility of human sperm to achieve fertilization. The process that prepares sperm to fertilize an oocyte is called capacitation, a kind of maturation process that is triggered by an increase in intracellular pH and ROS. Changes related to capacitation include: changes in sperm motility, decrease of cholesterol in the membranes, increase of tyrosine
phosphorylation in several proteins, and maturation of the sperm response to progesterone. Interestingly, seminal fluid has an unusually high concentration of Zn2+ (which is known to inhibit Hvl), whereas the female reproductive tract has low Zn2+ concentrations. It is hypothesized that on arrival of sperm in the female reproductive tract, Hvl becomes activated and cooperates with the sperm-specific Ca2+ channel CatSper and NOX5 to activate sperm effector functions such as sperm movement, capacitation, sperm-zona pellucida interaction, acrosome reaction, and sperm-oocyte fusion.
[60] There is evidence to suggest the presence of Hvl channels in mammalian brain tissue. Without wishing to be bound by any particular theory, the present disclosure proposes that Hvl channels may play a neuroprotective role by extruding protons from metabolically active neurons and regulating neuronal pH homeostasis. Hvl expression has been detected in human microglia, the macrophage-like cells of the central nervous system. Hvl in microglia may contribute to CNS disease by supporting NOX function. Microglia can become activated in acute and chronic brain disorders including brain injury, ischemia, and neurodegeneration. The expression and function of Hvl is correlated with the expression and function of NOX2. Hvl channels may support the activity of NOX2 in microglia by extruding excess protons from the cytoplasm. Oxidative stress, at least in part due to ROS generation by NOX, can contribute to the development of CNS disease. Hvl inhibition could be beneficial for the treatment of neurodegenerative processes accompanied by excessive production of ROS by microglia, such as stroke, Alzheimer's disease,
Parkinson's disease, and amyotrophic lateral sclerosis, among others.
[61] The present disclosure proposes that NOX-independent Hvl channel functions may also exist, given that certain cell types (e.g., basophil granulocytes) that exhibit Hvl channel activity are not known to express NOX.
[62] Evidence indicates that Hvl also functions in airway epithelia (e.g. tracheal epithelia) in functions such as providing a protective mechanism through acidification of the airway surface liquid. Hvl may also function in cardiac fibroblasts, though its function in these cells is not fully known. Some experimental data also suggests Hvl function in monocytes and macrophages. Hvl channels may promote osteoclast cell function, for instance by promoting bone resorption by osteoclast cells. Hvl channels may also mediate antigen presentation by dendritic cells.
[63] Many other tissues and cells not mentioned here also express Hvl channels, some at relatively low levels. For most of the cell types and tissues that have been reported to express low levels of Hvl channels, a specific function has not been assigned.
[64] Given the widespread expression and function of Hvl channels, it may not be surprising that channel dysfunction can cause or enhance pathologic states. Moreover, genomic studies have identified the HVCNl gene as being relevant to multiple diseases. For example, HVCNl has been associated with Crohn's disease activity and cystic fibrosis. A study in HVCNl knockout rats indicated that Hvl may contribute to the development of hypertension and renal disease with a high-salt diet. The link between Hvl function and ROS production provides some insight on the mechanism of some Hvl -associated disorders. Excessive ROS production is thought to cause local tissue damage and contribute to several pathological conditions, including atherosclerosis, ischemic stroke, Parkinson's disease, ischemic liver disease, Alzheimer's disease, and aging. A study on ischemic stroke has confirmed that Hvl can exacerbate brain damage by facilitating production of ROS by NOX in microglia. Moreover, it was recently shown that Hvl -deficient mice are protected in models of stroke, suggesting that pharmacological inhibition of Hvl channels may have neuroprotective benefits (see Seredenina, T., et al. "Voltage-gated proton channels as novel drug targets: from NADPH oxidase regulation to sperm biology." Antioxid Redox Signal. 10;23(5): 490-513 (2015) and references cited therein).
[65] Hvl channels may contribute to the malignancy of several cancers, including breast cancer, colorectal cancer and leukemia. For example, higher levels of Hvl expression occur in breast cancer cell lines with greater metastatic likelihood and knockdown of Hvl in breast cancer cell lines reduced proliferation and invasiveness. In human patients, a high level of Hvl expression was correlated with poor prognosis. One mechanism by which Hvl contributes to cancer cell malignancy is related to the abnormal metabolism of cancer cells, which use glycolysis in preference to oxidative phosphorylation even in the presence of adequate oxygen. This altered metabolism creates a buildup of lactic acid that acidifies the cells, thus requiring enhanced activity of H+ extrusion to prevent cell death.
[66] The particular isoform of Hvl that is expressed may contribute to certain malignancies. The levels of the short isoform of Hvl are higher in malignant B cell lines as compared to normal B lymphocytes. Moreover, the short isoform comprises approximately one-third of the Hvl protein in malignant B cells from patients with chronic lymphocytic leukemia. The enhanced gating response is substantially more pronounced in the short compared to the long isoform of Hvl . Hvl channel activity, proliferation and cell migration are all promoted by the expression of the short isoform.
Hvl Channel Modulators
[67] Modulation of Hvl channel activity is an attractive strategy for treating Hvl- related pathologies, including the ones described above. For example, agents that modulate Hvl may be expected to ameliorate inflammation, allergies, autoimmunity, cancer, asthma, brain damage from ischemic stroke, Alzheimer's disease, infertility, and numerous other conditions. Depending on the disease and affected tissue, either Hvl activation or inhibition could prove useful. However, clinically compatible Hvl modulators are not known.
Therefore, there is an unmet need in identifying potent and selective modulators of Hvl .
[68] One of the challenges in creating modulators of Hvl channels stems from the channel structure. The extracellular loops of hHvl are fewer than a dozen amino acids, resulting in a relatively small extracellular portion of the Hvl molecule to which drugs can bind. For example, this limits the epitope possibilities for antibodies to bind externally. Additionally, inhibition of Hvl by physical occlusion is also a challenge, since the channel is structured to be closely packed and prevent other ions from permeating.
[69] In some instances, such as autoimmune disease and male infertility, Hvl activation may be an attractive pharmacological strategy. Unsaturated long-chain fatty acids such as oleic acid and arachidonic acid have been shown to enhance Hvl proton currents. This appears to be a direct pharmacological activation of Hvl . Arachidonic acid has been observed to activate a proton conductance in phagocytes. However, arachidonic acid can also activate multiple signaling pathways, which in certain cases can lead to activation of NOX enzymes and therefore indirectly activate H+ currents. Activators of enhanced gating can also enhance Hvl function. In general, ion channel activators are more difficult to identify than inhibitors since binding to the channel usually produces inhibition.
[70] Zn2+ and other polyvalent cations are known to inhibit Hvl channels. Hvl channels can be blocked by Zn2+ at concentrations ranging from 100 nM to 1 mM depending on the extracellular pH and on the presence of other polyvalent cations. The mechanism by which Zn2+ inhibits Hvl involves Zn2+ competing with H+ for binding to the external surface of Hvl channels. Two His residues (His 140 and His 193) located at the interface between the channel monomers coordinate Zn2+ in the closed channel and thereby oppose channel opening. This mechanism changes the membrane potential perceived by the channel, and therefore requires stronger voltage to elicit proton current. Zn2+ shifts the current-voltage relationship positively and slows the kinetics of Hvl channel activation. However, Zn2+ ions are implicated in many other physiological processes, and therefore the usefulness of Zn2+ as a specific H+ channel blocker is limited.
[71] There are no documented high-affinity blockers of Hvl channels that originate in venom or toxin. Tarantula toxins, including hanatoxin, can inhibit Hvl at low micromolar concentrations by interacting with the S3 and S4 helices from the membrane interior and shifting the gu-V relationship in the positive direction. However, hanatoxin is not specific for Hvl. Different voltage-sensing proteins, including Hvl and other ion channels, contain the highly conserved voltage sensor regions composed of S3 and S4 helices, termed the paddle motif. Binding of hanatoxin to the paddle motif inhibits ion fluxes through various voltage-dependent ion channels besides Hvl.
[72] Guanidine derivatives have been shown to inhibit depolarization-induced H+ current (see Seredenina, T., et al. "Voltage-gated proton channels as novel drug targets: from NADPH oxidase regulation to sperm biology. " Antioxid Redox Signal. 10;23(5): 490-513 (2015); DeCoursey, T.E. "The voltage-gated proton channel: a riddle, wrapped in a mystery, inside an enigma." Biochemistry 54(21): 3250-68 (2015); and references cited therein). The derivative 2GBI [2-guanidinobenzimidazole (IC50 = 38 μΜ)] was found to have an intracellular site of action and to only bind when the channel was open. Other identified derivatives include l-(l,3-benzothiasol-2-yl)guanidine and 5-chloro-2- guanidinobenzimidazole. Guanidine derivatives have shown neuroprotective potential in an in vitro model of ischemia. The biggest challenge for pharmaceutical application of guanidine derivatives is their intracellular site of action.
[73] Several other compounds have been observed to block H+ currents.
Examples of such other compounds include weak bases (e.g. 4-aminopyridine, amiloride, verapamil or D600), tricyclic antidepressants (imipramine, amitryptiline, and desipramine), the selective serotonin reuptake inhibitor fluoxetine, the morphine-derivative
dextromethorphan (DM), and a tea catechin flavonoid EGCG These other potential inhibitors have several drawbacks, including mechanisms of action that do not directly involve Hvl channels, multiple other targets, and effective concentrations that are too high to be of pharmaceutical interest.
To-date, there are no selective inhibitors of Hvl channels. There is an unmet need to develop such inhibitors, especially ones that are compatible with clinical use.
Hyl Modulating Agents
Hvl Modulating Agent Activities [74] The present disclosure provides agents that modulate Hvl. Among other things, the present disclosure provides agents that, for example, modulate one or more Hvl activities when contacted with an Hvl channel, for example, in vitro and/or in vivo. In some embodiments, Hvl modulating agents modulate Hvl activities of Hvl monomers and dimers with similar IC50. In some embodiments, Hvl modulating agents specifically bind Hvl. In some embodiments, Hvl modulating agents inhibit Hvl. In some embodiments, Hvl modulating agents activate Hvl.
[75] In some embodiments, Hvl modulating agents do not physically occlude Hvl channels. In some embodiments, Hvl modulating agents bind to Hvl but do not bind to other voltage-gated channels or other ion channels.
[76] In some embodiments, Hvl modulating agents bind to the external surface of
Hvl. In some embodiments, Hvl modulating agents target or bind to the S3-S4 external loop region of hHvl. For example, Hvl modulating agents may bind to hHvl at amino acid residues 1183 to L204. In some embodiments, Hvl modulating agents bind to regions of hHvl comprising an amino acid sequence corresponding to
ILDIVLLFQEHQFEALGLLILL (SEQ ID NO: 111).
[77] In some embodiments, Hvl modulating agent binding to Hvl is reversible.
In some embodiments, Hvl modulating agent binding to Hvl may be irreversible. In some embodiments, Hvl modulating agent binding to Hvl is strong but not irreversible.
[78] In some embodiments Hvl modulating agents bind to open Hvl channels. In some embodiments, Hvl modulating agents bind to closed channels. In some embodiments, affinity of Hvl modulating agents for closed states of Hvl is about 1 nM. In some embodiments, affinity of Hvl modulating agents is lower for open states of the channel (e.g. about 200 nM) as compared to closed states of the channel. In some embodiments, Hvl modulating agents slow opening of closed states of Hvl even as they unbind.
[79] In some embodiments, provided Hvl modulating agents may change transmembrane voltage of a cell. Hvl modulating agents may hyperpolarize the membrane potential. Hvl modulating agents may depolarize the membrane potential. Effects of Hvl modulating agents may be measured by, for example, direct electrophysiological recordings of voltage-gated proton currents, such as patch-clamp recordings. [80] In some embodiments, provided Hvl modulating agents are characterized in that, for example, they decrease or block proton current. In some embodiments, Hvl modulating agents may reduce the number or likelihood of Hvl channel opening. In some embodiments, Hvl modulating agents may speed up the rate of Hvl channel closing. In some embodiments, Hvl modulating agents may cause an Hvl channel to require stronger voltage to elicit proton current.
[81] In some embodiments, provided Hvl modulating agents are characterized in that, for example, they increase proton currents and/or slow the closing of Hvl channels. In some embodiments, Hvl modulating agents may provide an enhanced responsiveness mode, allowing more channels to open more quickly, increasing likelihood that Hvl channels will open or remain open, and/or reducing the stimulus required to activate H+ flux.
[82] In some embodiments, Hvl modulating agents may increase or decrease proton (H+) current but do not directly alter current of other ions (e.g. Na+, K2+, Ca2+).
[83] In some embodiments, Hvl modulating agents may change the
transmembrane pH gradient (ΔρΗ, defined as pH0-pHi). In some embodiments, provided Hvl modulating agents may increase or decrease intracellular or cytosolic pH (pHj). Thus, Hvl modulating agents may decrease or increase the cytoplasmic acidity. In some embodiments, provided Hvl modulating agents may increase or decrease the extracellular, intraluminal, or organelle pH (pH0). Thus, Hvl modulating agents may decrease or increase the extracellular, intraluminal, or organelle acidity.
[84] In some embodiments, Hvl modulating agents may increase or decrease cellular ROS production.
[85] In some embodiments, Hvl modulating agents may increase or decrease the function and/or activity of NOX enzymes, including NOX1, NOX2, NOX3, and/or NOX4. In some such embodiments, Hvl modulating agents may enhance or reduce the ability of NOX enzymes to transfer electrons. In some such embodiments, Hvl modulating agents may increase or decrease the production of superoxide anion by a cell. In some such embodiments, Hvl modulating agents may increase or decrease the quantity of ROS production mediated by NOX enzymes. In some embodiments, Hvl modulating agents may sustain NOX activity by extruding protons from the cytoplasm. [86] In some embodiments, Hvl modulating agents may alter signaling pathways that can be affected by Hvl activity. In some embodiments, Hvl modulating agents may affect cellular, physiological, or pathological processes that can be affected by Hvl activity. In some such embodiments, Hvl modulating agents may influence inflammation, allergies, autoimmunity, cancer, asthma, brain damage from ischemic stroke, Alzheimer's disease, and fertility.
[87] In some embodiments, Hvl modulating agents may alter sperm activity or fertilization. Hvl modulating agents may affect sperm mobility, capacitation, sperm-zona pellucida interaction, acrosome reaction, and sperm-oocyte fusion. In a particular example, Hvl modulating agents inhibit properties associated with sperm capacitation.
[88] In another example, Hvl modulating agents may alter the ability of white blood cells to fight infections. Hvl modulating agents may alter the activity of phagosomes, NOX enzymes, or ROS production. In a particular example, Hvl modulating agents may decrease ROS production in white blood cells.
Hvl Modulating Agent Structure
[89] In some embodiments, an Hvl modulating agent is or comprises a polypeptide. In some embodiments, a polypeptide component of an Hvl modulating agent is 10-100 amino acids in length.
[90] In many embodiments in which a provided Hvl modulating agent includes a polypeptide component, the polypeptide component of the agent has an amino acid tertiary structure that is characterized as an inhibitor cysteine knot (ICK)-like structural motif. In some embodiments, a polypeptide component has a structure that has substantial structural similarity to an ICK structural motif. In some embodiments, a polypeptide component has three disulfide bridges. In some embodiments, a polypeptide component has three beta strands. In some embodiments, a polypeptide component has an amino acid sequence with six conserved cysteine residues of an ICK motif (FIG. 1).
[91] In many embodiments in which a provided Hvl modulating agent includes a polypeptide component, the polypeptide component of the agent has an amino acid sequence that includes one or more elements that is substantially identical to, but different from, that of wild-type toxin sequences (e.g., of a wild-type voltage sensor toxin). In some embodiments, such a sequence element has a length of about 5 to about 20 amino acids. In some embodiments, such a sequence element shows at least 40%, 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with a corresponding element of a wild-type toxin. In some embodiments, a polypeptide component of a provided Hvl modulating agent may show significant (e.g., at least 40%, 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or higher) overall sequence identity with, while differing from, a wild-type toxin. In some embodiments, a polypeptide component has an amino acid sequence that includes a plurality of toxin sequence elements, each of which is substantially identical to a sequence element that is found in the same, or a different, reference wild-type toxin. In some such embodiments, the plurality of toxin sequence elements are assembled in linear order so that the amino acid sequence shows overall correspondence with (e.g., shares one or more certain structural features, such as number and/or [relative] location of one or more cysteine residues) a full- length toxin. In some embodiments, a polypeptide component has an amino acid sequence that includes one or more residues found in a wild-type toxin that participates in binding by that wild-type toxin to a voltage-sensing protein.
[92] Exemplary wild-type toxin sequences are presented in Table 1. In some embodiments, a wild-type toxin is a venom toxin. In some embodiments, a venom toxin is a toxin found in venom of organisms such as scorpion (e.g., Pandinus imperator), sea anemone, snails (e.g. Conus marmoreus), snakes, and spiders (e.g., Grammostola rosea).
Table 1
Figure imgf000027_0001
Figure imgf000028_0001
Figure imgf000029_0001
Figure imgf000030_0001
Figure imgf000031_0001
Figure imgf000032_0001
Figure imgf000033_0001
Figure imgf000034_0001
[93] In some embodiments, a wild-type toxin sequence can be a predicted wild- type toxin sequence. In some embodiments, a predicted wild-type toxin sequence is identified in public protein databases. In some embodiments, a sequence element found in a wild-type toxin sequence is identified by isolating an amino acid sequence delineated by six conserved cysteine residues that form disulfide bridges in an ICK motif of a wild-type toxin sequence. In some embodiments, a known amino acid sequence of a wild-type toxin sequence can be used as a template to align amino acid sequences from public protein databases and identify predicted wild type-toxin sequences. In one example, the amino acid sequence of the Peruvian green velvet tarantula {Thrixopelma pruriens) is used as a template to identify predicted wild-type toxin sequences using basic local alignment search tools in public protein databases.
[94] In some embodiments, a polypeptide component has an amino acid sequence that is substantially identical to a sequence set forth in Table 2. In some embodiments, a polypeptide component has an amino acid sequence that is substantially identical to a sequence set forth in Table 2 and an activating or inhibiting effect on Hvl as set forth in Table 2B. In some embodiments, a polypeptide component has an amino acid sequence that is encoded by a nucleotide sequence that is substantially identical to a sequence set forth in Table 2C.
Table 2A
Figure imgf000035_0002
Table 2B
Figure imgf000035_0001
Table 2C
Figure imgf000036_0001
Figure imgf000037_0002
[95] In some embodiments, a polypeptide component is composed of one or more polypeptide elements, each of which has an amino acid sequence that is substantially identical to a reference sequence element A, B, or C as set forth in Table 3A. In some embodiments, one or more A, B, C reference sequence elements is or comprises a wild type toxin sequence element. In some embodiments, a polypeptide component has an amino acid sequence that comprises or consists of a single sequence element corresponding to an A reference sequence element, a single sequence element corresponding to a B reference sequence element, and a single sequence element corresponding to a C reference sequence element. In some such embodiments, the single sequence elements are arranged in a linear order as follows: A-B-C. Examples of Hvl modulating agents having A-B-C sequence elements are depicted in FIG. 2 and Table 2. Examples of nucleotide sequences encoding polypeptide sequence elements A, B, and C are set forth in Table 3B.
Table 3A
Figure imgf000037_0001
Figure imgf000038_0001
Figure imgf000039_0001
Table 3B
Figure imgf000040_0001
Figure imgf000041_0001
Figure imgf000042_0001
Figure imgf000043_0001
Figure imgf000044_0001
Figure imgf000045_0001
Figure imgf000046_0001
Figure imgf000047_0001
[96] In some embodiments, reference sequence element A has an amino acid sequence GCKWYLGDC (SEQ ID NO: 809). In some embodiments, reference sequence element A has an amino acid sequence SSTCIPSGQPC (SEQ ID NO: 255). In some embodiments, reference sequence element B has an amino acid sequence
ADSDDCCETFHC (SEQ ID NO: 273). In some embodiments, reference sequence element C has an amino acid sequence KWVFFTSKFMCRRVWGKD (SEQ ID NO: 411).
[97] In some embodiments, a provided polypeptide component has an amino acid sequence that is or comprises
GCKWYLGDCADSDDCCETFHCKWVFFTSKFMCRRVWGKD (SEQ ID NO: 128), as is found in the Hvl modulating agent labeled as "C5" in Table 2A.
[98] In some embodiments, a provided polypeptide component has an amino acid sequence that is or comprises
SSTCIPSGQPCADSDDCCETFHCKWVFFTSKFMCRRVWGKD (SEQ ID NO: 129), as is found in the Hvl modulating agent labeled as "C6" in Table 2A.
[99] In some embodiments, a polypeptide component has an amino acid sequence that includes one or more cysteine residues at positions corresponding to those at which a cysteine residue is found in a relevant wild-type toxin (e.g., wild-type voltage sensor toxin) sequence or reference sequence element (e.g., as depicted in FIG. 2). In some embodiments, a polypeptide component has an amino acid sequence that includes all cysteine residues at positions corresponding to those at which cysteine residues are found in a relevant wild-type toxin sequence or reference sequence element. In some embodiments, a polypeptide component has an amino acid sequence that shares the same approximate relative position of cysteines (e.g., number of residues between them) with a relevant wild-type toxin sequence or reference sequence element.
[100] In some embodiments, a polypeptide component has an amino acid sequence that includes one or more sequence elements that are identical to or includes not more than 1, 2, 3, 4, or 5 sequence differences relative to a wild-type toxin sequence element or reference sequence element.
[101] In some embodiments, such sequence difference(s) are or comprise one or more insertions, deletions, substitutions, rearrangements (e.g., inversions) or combinations thereof. In some embodiments, such sequence difference(s) do not include any insertions. In some embodiments, such sequence difference(s) do not include any deletions. In some embodiments, such sequence differences do not include any rearrangements (e.g., inversions). In some embodiments, such sequence difference(s) may include one or more random sequence alterations.
[102] In some embodiments, a polypeptide component has an amino acid sequence that includes one or more sequence elements that shares one or more cysteines with a sequence set forth in Table 1, Table 2, and/or Table 3. In some embodiments, such a sequence element has an amino acid sequence that shares all cysteines with a sequence set forth in Table 1, Table 2, and/or Table 3. In some embodiments, a sequence element shares the same approximate relative position of cysteines (e.g., number of residues between them) with a sequence set forth in Table 1, Table 2, and/or Table 3.
[103] In some embodiments, a reference sequence element has an amino acid sequence of an element found in a wild-type voltage toxin sequence that differs at residues that undergo posttranslational modifications.
[104] In some embodiments, a polypeptide component of an Hvl modulating agent may include one or more pendant groups or other modifications, e.g., modifying or attached to one or more amino acid residues (e.g., to one or more amino acid side chains), at the polypeptide component's N-terminus, at the polypeptide component's C-terminus, or any combination thereof. In some embodiments, such pendant groups or modifications may be selected from the group consisting of acetylation, amidation, glycosylation, lipidation, methylation, pegylation, phosphorylation, etc., and combinations thereof.
[105] In some embodiments, exemplary Hvl modulating agents comprise a polypeptide component whose amino acid sequence further comprises one or more tag elements (e.g., a detectable tag, a localizing tag, etc).
[106] In some embodiments, an Hvl modulating agent may be a dimer or multimer of relevant entities (e.g., of a polypeptide component as described herein); in some embodiments, an Hvl modulating agent may be or comprise heterodimer or heteromultimer. In some embodiments, an Hvl modulating agent may be or comprise a homodimer or homomultimer. Exemplary Hvl modulating agent dimers are presented in Table 4. Table 4A: Dimer Sequences (with linkers)
Figure imgf000050_0001
Table 4B: Monomer C6 + signal AND dimer + signal
Figure imgf000050_0002
Table 4C: Monomer + Myc tag, dimer + Myc tag, either/both plus signal and tag
Figure imgf000050_0003
Figure imgf000051_0002
Table 4D: Monomer + GPI targeting, dimer + GPI targeting, either/both plus signal, tag and linker
Figure imgf000051_0001
[107] Optionally, monomer components of a dimer or multimer agent may be or become covalently linked to one another. In some embodiments, such components may be or become covalently linked to one another via one or more disulfide bonds; in some embodiments, such components may be or become covalently linked to one another via one or more peptide bonds; in some embodiments, such components may be or become covalently linked to one another via a bond other than a peptide bond. In some embodiments, such components may be or become covalently linked to one another via a linker (e.g., via a polypeptide linker). Those skilled in the art will appreciate that a linker may be comprised of any of a variety of chemical entities. In those embodiments in which a linker comprises one or a plurality of amino acids, it may be of any desired length. In some embodiments, a linker has a size (e.g., a length) that is smaller than that of one or more of the monomer components.
[108] In some embodiments, a polypeptide component of an Hvl modulating agent may be connected directly or via a linker sequence to a signal peptide and/or a coat protein of a phage (for phage display methods) and/or to any other domain that may alter one or more of Hvl modulating agent expression, binding, or function.
[109] In some embodiments, an Hvl modulating agent may have structural modification(s). For example, an Hvl modulating agent may be or comprise a cyclic structure, and/or may comprise a cyclic portion. For example, a polypeptide component of an Hvl modulating agent may be cyclized such that its N-terminus is not part of the cyclic structure. In some embodiments, an Hvl modulating agent is not cyclic and/or does not comprise any cyclic portion. In some embodiments, an Hvl modulating agent is linear (e.g., one or more, or all, polypeptide components of an Hvl modulating agent is/are linear polypeptide(s)). In some embodiments, an Hvl modulating agent may be or comprise a stapled polypeptide.
[110] In some embodiments, a polypeptide component of an Hvl modulating agent is incorporated into a framework or scaffold structure. For example, such a polypeptide component can be incorporated into an antibody framework. Alternatively or additionally, a polypeptide component may be incorporated into a beta-sheet framework. In some embodiments, an Hvl modulating agent may be or comprise an antibody agent or fragment or component thereof (e.g., an antigen-binding fragment or component, such as a polypeptide including sufficient CDR sequences to bind antigen comparably to an antibody). In some embodiments, an Hvl modulating agent may be or comprise a polypeptide component that includes one or more of an immunoglobulin domain or fragment thereof. In some embodiments, an Hvl modulating agent may be or comprise a polypeptide component that includes a domain of an immunoglobulin heavy chain. Strategies for preparing such antibody fusions are known in the art (U.S. 14/152441). [111] Alternatively or additionally, in some embodiments, an Hvl modulating agent may be or comprise a nucleic acid, for example that may encode a polypeptide having Hvl modulating agent activity and/or structure, as described herein. Exemplary nucleic acid sequences for Hvl modulating agents are illustrated in Table 2C.
Production of Hyl Modulating Agents
[112] Hvl modulating agents can be produced by many methods. In some embodiments, an Hvl modulating agent is produced by recombinant expression in a cell. In some embodiments, an Hvl modulating agent is produced by peptide synthesis. In some embodiments, an Hvl modulating agent is produced by in vitro translation.
[113] Exemplary methods of designing and producing Hvl modulating agents are presented in Example 1.
[114] In some embodiments, an Hvl modulating agent is presented on a replicable genetic package, e.g., in the form of a phage, yeast, ribosome, or nucleic acid-protein fusion.
[115] In some embodiments, an Hvl modulating agent is provided and/or utilized in the context of an expression or display system.
[116] In some embodiments, Hvl modulating agents are first synthesized as nucleic acids that encode polypeptide elements (e.g. elements A, B, and C in Table 3) and then annealed to produce nucleic acid sequences encoding polypeptide components (e.g. as in Table 2).
[117] In some embodiments, a nucleic acid sequence encoding an Hvl modulating agent may be inserted into a phagemid or phage vector, in-frame, to form a leader-linker- Hvl modulating agent-linker-coat protein construct (Clackson and Lowman, Phage display. Oxford University Press, 2004; Barbas et al., Phage display. A laboratory manual. Cold Spring Harbor Laboratory Press, 2001). Exemplary upstream leader and downstream amino acid sequences are MAAE and GSASSA, respectively. An exemplary phage vector is pAS62. An exemplary coat protein is protein III or its truncated version. Phages can be grown, prepared, titered and stored (Clackson and Lowman, Phage display. Oxford University Press, 2004; Barbas et al, Phage display. A laboratory manual. Cold Spring Harbor Laboratory Press, 2001).
[118] In some embodiments, Hvl modulating agents can be inserted into vectors for expression and/or library selection. In some embodiments, a library is presented in a polypeptide array. In some embodiments, a library is presented on a replicable genetic package, e.g., in the form of a phage display, yeast display, ribosome, or nucleic acid-protein fusion library. See, e.g., U.S. Pat. No. 5,223,409; Garrard et al. (1991) Bio/Technology 9: 1373-1377; WO 03/029456; and U.S. Pat. No. 6,207,446. Binding members of such libraries can be obtained by selection and screened in a high throughput format. See, e.g., U.S. 2003-0129659.
[119] Hvl modulating agent libraries for phage display can be generated by standard methods (Clackson and Lowman, Phage display. Oxford University Press, 2004; Barbas et al., Phage display. A laboratory manual. Cold Spring Harbor Laboratory Press, 2001). For example, Hvl modulating agent libraries for phage display with a combinatorial arrangement of sequence elements are generated by designing overlapping or non- overlapping oligonucleotides corresponding to each individual element. These
oligonucleotides are phosphorylated, annealed, mixed in a desired combination and concentration and ligated into a phagemid vector with or without linker sequences to create a library by standard methods (Sambrook et al, Molecular Cloning: A Laboratory Manual. Vols 1-3. Cold Spring Harbor Laboratory Press, 1989). Combinatorial arrangement of sequence elements to yield phage particles expressing a library of Hvl modulating agents is demonstrated in Example 1A.
Identification and/or Characterization of Hyl Modulating Agents
[120] Identification and/or characterization of Hvl modulating agents can include determining effects of candidate agents on Hvl, including Hvl that is naturally or recombinantly expressed. In some embodiments, Hvl is expressed in cells. In some embodiments, Hvl is immobilized (e.g., immobilized on a solid support, an artificial membrane, or a plasma membrane of a cell). In some embodiments, Hvl is purified.
[121] Identification and/or characterization of Hvl modulating agents can include the use of libraries of candidate agents. [122] In some embodiments, an Hvl modulating agent is identified from a candidate library incorporated into a phage display system. In phage display, candidate Hvl modulating agents are functionally displayed on the surface of phage and nucleic acid sequences encoding candidate Hvl modulating agents are enclosed inside phage particles. Functional display permits selection of Hvl modulating agents that interact with a target or targets (e.g. Hvl channels). Selection of Hvl modulating agents from the library can be based on the Hvl modulating agent type (e.g., toxin type) and/or target biochemistry, pharmacology, immunology and/or other physicochemical or biological property.
[123] A phage library can be transfected into Escherichia coli (E. coli) or other suitable bacterial species, propagated, and the phages purified. At this stage, Hvl modulating agents or candidate agents can be functionally expressed on the surface of the phage and physically linked to their respective genes inside of the phage particle. A library is brought into contact with a target, such as Hvl channels. For example, a phage library can be brought into contact with Hvl channels that are immobilized on magnetic beads, as described in Example 2. After incubation with the target, those phages that express candidate Hvl modulating agents with no or weak recognition for the target are washed away. The remaining Hvl modulating agents that interact with the target are dissociated and can be (i) genotyped to establish the Hvl modulating agent identity, or (ii) processed for one or more rounds of panning, or (iii) otherwise quantified and/or identified (e.g., ELISA, microbiological titering, functional testing).
[124] Panning may be performed by the binding of candidate modulating agents to
Hvl, followed by washes and modulating agent recovery. Panning may be repeated until the desired enrichment is achieved. In addition, libraries can be pre-depleted on surfaces or cells that contain no Hvl or on an Hvl where the putative modulating agent binding domain may be directly or indirectly altered. Additionally, any and all conditions of panning may be varied, altered or changed to achieve optimal results, such as the isolation of a specific Hvl modulating agent. Panning variations include, but are not limited to, the presence of competing polypeptide(s), presence of excess target(s), length and temperature of binding, pre-absorption of the library on one or more different receptor(s) or cells or surfaces, composition of binding solution (e.g., ionic strength), stringency of washing, and recovery procedures. Phages recovered from panning may be processed for further rounds of panning, functional analysis, and/or sequencing/genotyping to deduce the resulting Hvl modulating agent's amino acid sequence or biological properties (Clackson and Lowman, Phage display. Oxford University Press, 2004; Barbas et al, Phage display. A laboratory manual. Cold Spring Harbor Laboratory Press, 2001 ).
[125] Following recovery after panning, Hvl modulating agents of interest may be produced in native form by standard methods of peptide/protein synthesis/production (Sambrook et al, Molecular Cloning: A Laboratory Manual. Vols 1-3. Cold Spring Harbor Laboratory Press, 1989; Albericio, Solid-Phase Synthesis: A Practical Guide. CRC, 2000; Howl, Peptide Synthesis and Applications. Humana Press, 2005).
[126] In some embodiments, Hvl modulating agents are tested for activity toward recombinant or functional Hvl. Samples that include functional channels (e.g., cells or artificial membranes) can be treated with an Hvl modulating agent and compared to control samples (e.g., samples without the Hvl modulating agent), to examine the extent of modulation. In some embodiments, Hvl may be naturally expressed.
[127] In some embodiments, cells may be stably or transiently transfected with functional Hvl . For example, HEK-293T (mammalian human embryonic kidney) cells may be transfected with Hvl (e.g. human Hvl or human Hvl tagged with a fluorescent protein) for transient expression. In one example, HEK-293T cells transiently expressing hHvl tagged with teal fluorescent protein are used in patch clamp electrophysiology to determine effects of the Hvl modulating agents C5 or C6 on proton currents.
[128] Changes in proton flux may be assessed by determining changes in polarization (i.e., electrical potential) of a cell or membrane expressing Hvl . In some embodiments, a change in cellular polarization is measured by measuring changes in current (thereby measuring changes in polarization) with voltage-clamp and patch-clamp techniques, e.g., the "cell-attached" mode, the "inside-out" mode, and the "whole cell" mode (see, e.g., Ackerman et al, New Engl. J. Med. 336: 1575-1595, 1997). Whole cell currents can be determined using standard methodology (see, e.g., Hamil et al, PFlugers. Archiv. 391 :85, 1981). Other assays include radiolabeled rubidium flux assays and fluorescence assays using voltage sensitive dyes (see, e.g., Vestergarrd-Bogind et al, J. Membrane Biol. 88:67-75, 1988; Daniel et al, J. Pharmacol. Meth. 25: 185-193, 1991 ; Holevinsky et al, J. Membrane Biology 137:59-70, 1994). In some embodiments, candidate Hvl modulating agents are present in the range from 1 pM to 100 mM. Other methods for assessing Hvl modulating agent effects on proton flux are described in the Examples herein.
[129] Hvl modulating agents can also be identified or characterized by evaluating processes at the cellular, tissue and/or organism level. For example, Hvl modulating agents can be evaluated for effects downstream of Hvl activity or signaling. Various effects of Hvl modulating agents that may be determined using intact cells or animals include
transcriptional changes, changes in cell metabolism, and changes in intracellular second messengers.
[130] In some embodiments, Hvl modulating agents can be evaluated for effects on human sperm. For example, Hvl modulating agents can be evaluated for effects on sperm capacitation-related processes, including changes in sperm motility, decrease of cholesterol in the membranes, increase of tyrosine phosphorylation in several proteins, or maturation of the sperm response to progesterone. Capacitation of spermatozoa occurs along with an increase in the amplitude of voltage-gated proton current. Known Hvl inhibitor, Zn2+' reduces H+ current in sperm cells. Accordingly, an Hvl modulating agent can be evaluated for suppression of such sperm capacitation-related processes. Alternatively, an Hvl modulating agent can be evaluated for enhancing sperm capacitation-related processes. Alternatively or additionally, an Hvl modulating agent can be evaluated for non- capacitation-related processes that affect sperm activation, mobility, and/or fertilization.
[131] In some embodiments, Hvl modulating agents can be evaluated for effects on cells that function in the immune system. For example, Hvl is expressed in white blood cells (WBCs). Hvl in WBCs has been shown to compensate charge buildup on the cell membrane during production of ROS. Hvl knockout or inhibition impairs ROS production in these cells. Accordingly, an Hvl modulating agent can be evaluated for suppression of ROS production in WBCs.
[132] Hvl modulating agents can be selected for their potency and selectivity of modulation of Hvl. For example, an Hvl modulating agent that demonstrates low IC50 value for Hvl, and a higher IC50 value for other ion channels within the test panel, is considered to be selective toward Hvl . Compositions
[133] The present disclosure also features compositions that include and/or deliver
Hvl modulating agents.
[134] In some embodiments, a composition is a pharmaceutically acceptable composition that includes and/or delivers an Hvl modulating agent described herein. For example, in some embodiments, a provided composition includes an Hvl modulating agent polypeptide component. Alternatively or additionally, in some embodiments, a provided composition includes a nucleic acid that encodes an Hvl modulating agent polypeptide component, a cell that expresses (or is adapted to express) an Hvl modulating agent polypeptide component, etc. In some embodiments Hvl modulating agents having any of the modifications of the present disclosure are included in pharmaceutical compositions.
[135] General considerations in the formulation and manufacture of pharmaceutical agents may be found, for example, in Remington 's Pharmaceutical Sciences, 19th ed., Mack Publishing Co., Easton, PA, 1995.
[136] Pharmaceutical compositions may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, microemulsions, liposomes and suppositories. The proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin. The preferred form of pharmaceutical composition depends on the intended mode of administration and therapeutic application. Typical compositions are in the form of injectable or infusible solutions, such as compositions similar to those used for administration of antibodies to humans.
[137] The pharmaceutical composition can include a pharmaceutically acceptable carrier. For example, pharmaceutical compositions can include a therapeutic agent in addition to one or more inactive agents such as a sterile, biocompatible carrier.
[138] Exemplary carriers include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. For example, carriers may include sterile water, saline, buffered saline, or dextrose solution. Alternatively or additionally, the composition can contain any of a variety of additives, such as stabilizers, buffers, excipients (e.g., sugars, amino acids, etc.), or preservatives. Preferably, the carrier is suitable for oral, intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion).
[139] The pharmaceutical composition can include a pharmaceutically acceptable salt, e.g., a salt that retains the desired biological activity of the Hvl modulating agent and does not impart any undesired toxicological effects (see e.g., Berge, S.M., et al, J. Pharm. Sci. 66: 1-19, 1977).
[140] Depending on the route of administration, the Hvl modulating agent may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
[141] In certain embodiments, a pharmaceutical composition can include a therapeutic agent that is encapsulated, trapped, or bound within a lipid vesicle, a
bioavailable and/or biocompatible and/or biodegradable matrix, or other microparticles.
[142] In certain embodiments, an Hvl modulating agent is prepared with a carrier that protects against rapid release, such as a controlled release formulation, including implants, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polygly colic acid, collagen, polyorthoesters, and poly lactic acid. Many methods for the preparation of such
formulations are patented or generally known. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
Pharmaceutical formulation is a well-established art, and is further described in Gennaro (ed.), Remington: The Science and Practice of Pharmacy, 20.sup.th ed., Lippincott, Williams & Wilkins, 2000 (ISBN: 0683306472); Ansel et al, Pharmaceutical Dosage Forms and Drug Delivery Systems, 7.sup.th Ed., Lippincott Williams & Wilkins Publishers, 1999 (ISBN: 0683305727); and Kibbe (ed.), Handbook of Pharmaceutical Excipients American
Pharmaceutical Association, 3rd ed., 2000 (ISBN: 091733096X). [143] In some embodiments, a provided pharmaceutical composition will include an Hvl modulating agent that is not aggregated. For example, in some embodiments, less than 1%, 2%, 5%, 10%, 20%, or 30%, by dry weight or number, of Hvl modulating agent is present in an aggregate.
[144] In some embodiments, a provided pharmaceutical composition will include an Hvl modulating agent that is not denatured. For example, less than 1%, 2%, 5%, 10%, 20%, or 30%, by dry weight or number, of Hvl modulating agents administered is denatured.
[145] In some embodiments, a provided pharmaceutical composition will include an Hvl modulating agent that is not inactive. For example, less than 1%, 2%, 5%, 10%, 20%, or 30%, by dry weight or number, of Hvl modulating agents administered is inactive.
[146] In some embodiments, pharmaceutical compositions are formulated to reduce immunogenicity of provided Hvl modulating agents. For example, in some embodiments, a provided Hvl modulating agent is associated with (e.g., bound to ) an agent, such as polyethylene glycol and/or carboxymethyl cellulose, that masks its immunogenicity. In some embodiments, a provided binding agent has additional glycosylating that reduces immunogenicity.
Kits
[147] Also provided by the present disclosure are kits that include an Hvl modulating agent described herein and instructions for use, e.g., treatment, prophylactic, or diagnostic use.
[148] In addition to the Hvl modulating agent, the composition of the kit can include other ingredients, such as a solvent or buffer, a stabilizer or a preservative, and/or a second agent for treating a condition or disorder described herein. Alternatively, other ingredients can be included in the kit, but in different compositions or containers than the Hvl modulating agent. In such embodiments, the kit can include instructions for admixing the Hvl modulating agent and the other ingredients, or for using the Hvl modulating agent together with the other ingredients. [149] Alternatively or additionally, contents of kits may include, but are not limited to, expression plasmids containing nucleotides (or characteristic or biologically active portions) encoding Hvl modulating agents of interest (or characteristic or biologically active portions). Alternatively or additionally, kits may contain expression plasmids that express Hvl modulating agents of interest (or characteristic or biologically active portions).
Alternatively or additionally, kits may contain isolated and stored Hvl modulating agents.
[150] In certain embodiments, kits for use in accordance with the present invention may include, a reference sample, instructions for processing samples, performing tests on samples, instructions for interpreting the results, buffers and/or other reagents necessary for performing tests. In certain embodiments the kit can comprise a panel of antibodies.
[151] The present invention provides kits for administration of pharmaceutical compositions. For example, in some embodiments, the invention provides a kit comprising at least one dose of an Hvl modulating agent. In some embodiments, the invention provides a kit comprising an initial unit dose and one or more subsequent unit doses of an Hvl modulating agent. In some such embodiments, the initial unit dose is greater than the subsequent unit doses or wherein the all of the doses are equal.
Methods of Administration
[152] Pharmaceutical compositions may be administered in any dose appropriate to achieve a desired outcome. In some embodiments, the desired outcome is reduction in intensity, severity, and/or frequency, and/or delay of onset of one or more symptoms of an Hvl associated disease or condition.
[153] A therapeutically effective amount of an Hvl modulating agent composition can be administered, typically an amount which is effective, upon single or multiple dose administration to a subject, in treating a subject, e.g., curing, alleviating, relieving or improving at least one symptom of a disease or condition in a subject to a degree beyond that expected in the absence of such treatment. A therapeutically effective amount of the composition may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the compound to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the composition is outweighed by the therapeutically beneficial effects. A therapeutically effective dosage preferably modulates a measurable parameter, favorably, relative to untreated subjects. The ability of an Hvl modulating agent to inhibit a measurable parameter can be evaluated in an animal model system predictive of efficacy in a human disorder.
[154] In some embodiments, pharmaceutical compositions are administered in multiple doses. In some embodiments, pharmaceutical compositions are administered in multiple doses/day. In some embodiments, pharmaceutical compositions are administered according to a continuous dosing regimen, such that the subject does not undergo periods of less than therapeutic dosing interposed between periods of therapeutic dosing. In some embodiments, pharmaceutical compositions are administered according to an intermittent dosing regimen, such that the subject undergoes at least one period of less than therapeutic dosing interposed between two periods of therapeutic dosing.
[155] Dosage regimens can be adjusted to provide the optimum desired response
(e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of ligand calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
[156] An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of an Hvl modulating agent described herein is 0.1-20 mg/Kg, more preferably 1-10 mg/Kg. In some embodiments, an agent can be administered by parenteral (e.g., intravenous or subcutaneous) infusion at a rate of less than 20, 10, 5, or 1 mg/min to reach a dose of about 1 to 50 mg/m2 or about 5 to 20 mg/m2. It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions (e.g., the supervising physician), and that dosage ranges set forth herein are only exemplary. [157] Pharmaceutical compositions of the present invention can be administered by a variety of routes, including oral, intravenous, intramuscular, intra-arterial, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, or drops), mucosal, nasal, buccal, enteral, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol. For example, for therapeutic applications, an Hvl modulating agent composition can be administered by intravenous infusion at a rate of less than 30, 20, 10, 5, or 1 mg/min to reach a dose of about 1 to 100 mg/m2 or 7 to 25 mg/m2. Alternatively, the dose could be 100 μg/Kg, 500 μg/Kg, 1 mg/Kg, 5 mg/Kg, 10 mg/Kg, or 50 mg/Kg. The route and/or mode of administration will vary depending upon the desired results. In general the most appropriate route of administration will depend upon a variety of factors including the nature of the agent (e.g., its stability in the environment of the gastrointestinal tract), the condition of the patient (e.g., whether the patient is able to tolerate oral administration), etc.
[158] A common mode of administration is parenteral (e.g., intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrastemal injection and infusion). In one embodiment, the Hvl modulating agent composition is administered by intravenous infusion or injection. In another embodiment, the Hvl modulating agent composition is administered by intramuscular or subcutaneous injection. In another embodiment, the Hvl modulating agent composition is administered orally. In some embodiments, the Hvl modulating agent composition is administered topically. In some embodiments, the Hvl modulating agent composition is administered transdermally. Pharmaceutical compositions typically must be sterile and stable under the conditions of manufacture and storage.
[159] Hvl modulating agents or pharmaceutical compositions of the present disclosure may be administered either alone or in combination with one or more other agents. In some embodiments, Hvl modulating agents or pharmaceutical compositions of the present disclosure may be administered with one or more other Hvl modulating agents. In some embodiments, Hvl modulating agents or pharmaceutical compositions of the present disclosure may be administered with one or more other pharmaceutical agent including, but not limited to, small molecules, vaccines and/or antibodies. In some embodiments, Hvl modulating agents or pharmaceutical compositions may be administered in combination with an adjuvant.
[160] Combinations of agents may be administered at the same time or formulated for delivery together. Alternatively, each agent may be administered at a dose and on a time schedule determined for that agent. Additionally, the invention encompasses the delivery of the pharmaceutical compositions in combination with agents that may improve their bioavailability, reduce or modify their metabolism, inhibit their excretion, or modify their distribution within the body. Although the pharmaceutical compositions of the present invention can be used for treatment of any subject (e.g., any animal) in need thereof, they are most preferably used in the treatment of humans.
Uses
[161] As described herein, Hvl channels have been reported to play a role in a variety of biological processes, and to impact various diseases, disorders, and conditions.
[162] The present disclosure encompasses treatment of Hvl associated diseases or conditions. Hvl modulating agents and/or Hvl modulating agent compositions described herein can be administered, alone or in combination with, another agent to a subject, e.g., a patient, e.g., a patient who has a disorder (e.g., an Hvl -associated disease or condition, e.g. immune deficiency), a symptom of a disorder or a predisposition toward a disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disorder, the symptoms of the disorder or the predisposition toward the disorder. The treatment may also delay onset, e.g., prevent onset, or prevent deterioration of a condition.
[163] In some embodiments, Hvl modulating agent pharmaceutical compositions are administered to a subject suffering from or susceptible to an Hvl associated disease or condition. In some embodiments, a subject is considered to be suffering from an Hvl associated disease or condition if the subject is displaying one or more symptoms commonly associated with said disease or condition. Hvl modulating agents or Hvl modulating agent compositions may be administered prior to or after development of one or more such symptoms. [164] For example Hvl modulating agents may be used to ameliorate
inflammation, allergies, autoimmunity, cancer, asthma, brain damage from ischemic stroke, Alzheimer's disease, infertility, and numerous other conditions. In some embodiments, the desired outcome is reduction in intensity, severity, and/or frequency, and/or delay of onset of one or more of these conditions. Additionally or alternatively, Hvl modulating agents may be used as a form of birth control by blocking sperm function.
[165] Additionally, Hvl modulating agents may be used to change any of the functions of Hvl channels described in the present disclosure to achieve a preferred or therapeutic outcome. As described herein, Hvl channels transport protons across cell membranes and are expressed in a variety of cells and tissues. Functions of Hvl channels differ depending on the cells in which they are expressed. Uses for Hvl modulating agents can include increasing or decreasing proton current across cell membranes and/or increasing or decreasing pH in the cytosolic, extracellular, or intraluminal space of cells.
[166] In some embodiments, uses for Hvl modulating agents may include effects on Hvl-related processes. For example, in some embodiments, Hvl modulating agents may be used to increase or decrease the expression and/or function of NOX enzymes, including NOX1, NOX2, NOX3, and/or NOX4. In some embodiments, Hvl modulating agents may be used to increase or decrease production of ROS.
[167] In some embodiments, uses for Hvl modulating agents may include altering biological functions in specific cells. For example, the function of Hvl channels in white blood cells includes extrusion of protons to facilitate ROS production via NOX activity in the phagosome. This process allows white blood cells to destroy bacteria and other pathogens. In some embodiments, uses of Hvl modulating agents may include changing these functions in white blood cells. Alternatively, Hvl channel function in human sperm has been associated with sperm capacitation, activation and mobility to achieve fertilization. In some embodiments, Hvl modulating agent uses may include increasing or decreasing sperm function and/or fertilization ability.
[168] While various aspects and examples have been described, it will be apparent to those of ordinary skill in the art that many more examples and implementations are possible within the scope of this disclosure. Accordingly, the disclosure is not to be restricted except in light of the attached claims and their equivalents. Exemplification
Example 1 : Designing Hvl Modulating Agents
[169] The present Example describes certain Hvl modulating agents provided herein. Certain Hvl modulating agents provided herein comprise a polypeptide component having an amino acid sequence including element(s) found in wild-type toxin polypeptides. In some embodiments, exemplary Hvl modulating agents comprise a polypeptide component whose amino acid sequence further comprises one or more tag elements (e.g., a detectable tag, a localizing tag, etc). In some embodiments, exemplary Hvl modulating agents have a structure that comprises both a polypeptide component and a non-polypeptide component (e.g., a modifying component such as a lipid-containing moiety, a sacchari de- containing moiety, etc). Alternatively or additionally, in some embodiments, exemplary Hvl modulating agents are multimeric in that their structure includes multiple (e.g., 2 or more) monomer components associated with one another. In some embodiments, all monomers in a multimer are structurally identical (or substantially identical) to one another. In some embodiments, a multimer may comprise 2 or more distinct monomers. In some embodiments, two or more monomers in a multimer may be covalently associated with one another (e.g., via a linker or cross-linker).
A. Toxin sequences
[170] As noted above, certain Hvl modulating agents provided herein have an amino acid sequence including element(s) found in wild-type toxin polypeptides.
Representative such agents were designed as described below.
[171] The amino acid sequence of the Peruvian green velvet tarantula
(Thrixopelma pruriens) was used as a template to identify predicted wild-type toxin sequences using the basic local alignment search tool (BLAST) in the UniProt and Pfam databases. A total of 110 predicted wild-type toxin sequences were identified (Table 1). All of these sequences encode a polypeptide characterized as having an inhibitor cysteine knot (ICK) structural motif. The amino acid sequences of these 110 predicted wild-type toxins were aligned around six conserved cysteine residues of the ICK motif. Three sequence elements, A, B, and C were delineated by the second and fifth of the six conserved cysteine residues in each predicted wild-type toxin sequence, resulting in 95 A, 104 B, and 106 C sequence elements (Table 3). Nucleotides were synthesized corresponding to these A, B, and C elements.
[172] Complementary nucleotide pairs for each unique element A, B, or C, were synthesized to produce nucleotide duplexes. These nucleotide duplexes were
phosphorylated using T4 Polynucleotide Kinase and annealed unidirectionally to produce polynucleotide components having an A-B-C sequence element pattern linked at cysteine residues. To achieve and monitor incorporation of the sequence elements, 104 separate reactions were performed to ligate the ABC inserts into the pAS62 phagemid vector in frame with phage particle coat protein pill, resulting in phagemids having the ABC inserts (see, e.g., PCT/US2008/013385). Each reaction contained one B nucleotide duplex, 95 A nucleotide duplexes, and 106 C nucleotide duplexes. Ligation mixtures were transformed in SS320 electrocompetent cells (Lucigen, Middleton, WI). To verify unbiased insert utilization, 416 plaques were sequenced. The processes yielded phage particles expressing the original 110 predicted wild-type toxins and approximately 1,047,170 novel peptides. Exemplary novel peptides are listed in Table 2A and FIG. 1. Exemplary A, B and C sequence elements are listed in Table 3.
B. Linkers and Dimerization
[173] Certain exemplary Hvl modulating agents were prepared by linking together two polypeptide components, each of which had an amino acid sequence comprising elements of wild-type toxin polypeptides as described above in Section A.
[174] For example, two monomers of the agent labeled as "C6" in Table 2A were joined together via a peptide linker. Several different peptide linkers were utilized. For example, each of a rigid linker of 10 amino acid residues, a flexible linker of 10 amino acid residues, or a long flexible linker of 38 amino acid residues was used. Table 4A lists amino acid sequences of exemplary polypeptides created through such linkage.
C. Signal Peptides
[175] In some embodiments, one or more signal peptides can be included in exemplary Hvl modulating agents (Table 4B). [176] For example, Hvl modulating agents with an N-terminal trypsin secretory signal sequence can be prepared.
D. Detectable Tags
[177] In some embodiments, an Hvl modulating agent may be modified with an epitope tag.
[178] For example, a c-Myc epitope tag can be added near the C-terminus of a polypeptide component in an Hvl modulating agent (Table 4C).
E. Tethering Moieties
[179] In some embodiments, an Hvl modulating agent may be modified with a tethering moiety that targets the Hvl modulating agent to a specific surface.
[180] For example, a hydrophobic sequence may be added to the C-terminus of an
Hvl modulating agent that targets the Hvl modulating agent for covalent tethering to glycosylphosphatidylinositol (GPI) anchors inserted in the extracellular leaflet of the plasma membrane (Table 4D).
[181] Annotated sequences of exemplary modified Hvl modulating agents are presented in FIG. 3.
F. Generating Hvl modulating agents with linkers and modifications
[182] Representative Hvl modulating agents having signal peptides, detectable tags, and tethering moieties were generated as follows. The sequence encoding mammalian Lynxl, a toxin-like nicotinic acetylcholine receptor modulator, was replaced by cDNA of the Hvl modulating agent C6, in-frame between the secretion signal and the Lynxl hydrophobic sequence for GPI attachment. A flexible linker containing a glycine- asparagine repeat was inserted between the C6 sequence and the hydrophobic sequence for GPI attachment, and a c-Myc epitope tag was introduced in the middle of the linker. Hvl modulating agents having these modifications are also called "T-toxins." Exemplary T- toxin sequences are depicted in FIGS. 3A-3E. The present disclosure appreciates that methods analogous to those described in Gui, J. et al, "A tarantula-venom peptide antagonizes the TRPA1 nociceptor ion channel by binding to the S 1-S4 gating domain," Curr Biol. 24(5):473-83 (2014) can be employed to generate GPI-tethered toxins as described herein.
Example 2: Characterization of Hvl Modulating Agents
[183] The present Example demonstrates a high-throughput assay for
characterization of Hvl modulating agents. Specifically, this assay characterizes whether Hvl modulating agents are capable of binding human Hvl (hHvl) protein.
[184] To characterize if an Hvl modulating agent can bind to hHvl channels, a phage display library expressing Hvl modulating agents was generated. Phage particles from Example 1A were used to infect Escherichia coli (E. coli) XLl-Blue cells for 15 min at room temperature. The infected cells were grown overnight at 37 °C in 150 mL 2xYT in the presence of 1010/mL M13K07 helper phage, 100 g/mL ampicillin, and 0.1 mM isopropyl β- D-l-thiogalactopyranoside (IPTG). Cultures were centrifuged and the supernatant was precipitated with PEG/NaCl solution. The phage pellet was collected by centrifugation and dissolved in TBS. Phage particle titer was determined by serial dilution in TBS and infection of E. coli XLl-Blue followed by plating on LB plates with antibiotic and determination of colony forming units (cfu).
[185] hHvl protein was biotinylated using sulfosuccinimidyl 2-(biotinamido)- ethyl-l,3-dithiopropionate (EZ-Link Sulfo-NHS-SS-Biotin, Thermo Scientific).
Biotinylation was verified by a pull-down assay using streptavidin MagneSphere beads (Promega). Biotinylated hHvl was adsorbed to 300 μΐ streptavidin MagneSphere paramagnetic particles, and free streptavidin-binding sites were blocked with biotin to prevent nonspecific binding.
[186] After manual washing of the magnetic beads, library phage particles (1011 cfu) were added in 300 TBSB (25 mM Tris-HCl, 140 mM NaCl, 3 mM KC1, 2 mM LPPG, 0.5% bovine serum albumin, pH 7.4) and incubated on a rocking shaker for 1 h. Poorly adherent phage particles were removed by washing 2-5 times with TBSTB (TBSB with 0.1% Tween 20). The captured phages on the magnetic beads were eluted with 100 mM DTT in 20 mM Tris, pH 8.0, for 10 min, and then used to infect E. coli XLl-Blue cells (Stratagene) for phage amplification. The phage particles captured in the first round were cycled through an additional five rounds of binding and selection using an automated magnetic bead manipulator (KingFisher, Thermo Scientific). Phage particles were quantified by titering before and after selective library sorting and genotyped by DNA sequencing after six rounds of panning. Phage enrichment was observed with immobilized hHvl as the target compared with the control target streptavidin. Exemplary Hvl modulating agents enriched by this method are listed in Table 2A. In some instances, repeats of Hvl modulating agent sequences after several rounds of panning can be observed, as demonstrated by agents labeled as A6 and G2, C2 and F2, C6 and D5, and D6 and E2. Without wishing to be bound by any particular theory, any repeat may be considered significant (since the library had more than 1 million peptides initially) and may demonstrate selection and functional convergence.
Example 3: Characterization of Hvl modulating agents by T-toxin assay
[187] The present example demonstrates characterization of the effects of Hvl modulating agents on hHvl using T-toxins. Specifically, the present example demonstrates inhibition of hHvl function as measured by tail current from Xenopus laevis oocytes expressing only hHvl or both hHvl and Hvl modulating agents tethered to the oocyte plasma membrane.
[188] T-toxin cDNAs were cloned into the pCS2+ plasmid vector for in vitro transcription of T-toxin cRNA. Capped cRNAs were prepared by restriction enzyme linearization, followed by in vitro transcription reaction with SP6 (for T-toxins) and T7 (for hHvl) RNA polymerase (mMessenger mMachine kit, Ambion). Concentrations of cRNAs were measured using NanoDrop 2000 (Thermo Scientific).
[189] cRNAs for T-toxins and hHvl were mixed at 1 : 1 ratio (w/w) and injected into the Xenopus laevis oocytes. Currents were measured by Two Electrode Voltage Clamp (TEVC). Recording solution was (in mM): 90 NaCl, 1 MgCl2, 2 CaCl2, 120 HEPES, pH 7.3. Recordings were performed with constant gravity flow of solution at 2ml/min yielding chamber exchange in ~ 5 s. Currents were recorded 2-3 days after cRNA injection using an oocyte clamp amplifier OC-725C (Warner Instruments, Hamden, CT), and electrodes filled with 3 M KC1 with resistance of 0.3 - 1 ΜΩ. Data were filtered at 1 kHz and digitized at 20 kHz using pClamp software and assessed with Clampfit v9.0 and Origin 6.0. Inhibition was studied by comparing tail current from oocytes expressing only hHvl and those with both hHvl and T-toxins. Inhibition was calculated as unblocked fractional current (FIG. 3F). Example 4: Characterization of Hvl modulating agents with a transmembrane link
[190] The present example demonstrates characterization of Hvl modulating agent effects on hHvl using Hvl modulating agents expressed from cells via a transmembrane link.
[191] The Hvl modulating agent C6 was tethered to cell surfaces using a transmembrane domain from the PDGF receptor, which links an internal mVenus fluorescent protein to an external C6 (FIG. 7). Unlike the tether in oocytes which attaches C6 to the outside of the cell (e.g. FIG. 3), this is a transmembrane link. To transiently express hHvl, 1 μg of hHvl tagged with teal fluorescence protein (hHvl-TFP) was transfected into HEK-293T cells using Lipofectamine 2000. Changes in the single exponential fit of fluorescence decay were indicative of FRET (FIG. 8). Changes in current density and shifts in the gn-^were indicative of blocking of hHvl.
Example 5: Hvl Modulating Agents Activate or Inhibit Hvl proton current
[192] The present Example documents assessing activity of the voltage-gated proton channel Hvl in response to Hvl modulating agents. Activity of Hvl was assessed by changes in proton currents.
[193] To transiently express hHvl, 1 μg of hHvl or hHvl tagged with teal fluorescence protein (hHvl-TFP) was transfected into HEK-293T cells using Lipofectamine 2000. In some instances, green fluorescent protein was used as a transfection marker.
Transfected cells were plated onto glass coverslips. Green or teal cells were selected for whole-cell patch clamp after 24 hours.
[194] Patch clamp recordings were performed with an external solution of lOOmM
HEPES, pH 7.5, 70mM NaCl, and 10 mM glucose. The pipette solution was lOOmM Bis Tris buffer, pH 6.5, 70 mM NaCl and 10 mM glucose. Hvl modulating agent was applied to these cells while pulsing to 40mV every 10 seconds and proton currents were measured using whole-cell patch clamp electrophysiology.
[195] FIG. 4 shows activation or inhibition of Hvl proton currents by Hvl modulating agent as compared to current without addition of modulating agent. Cells were incubated with either 500 nM C5 (FIG. 4A) or 250 nM C6 (FIG. 4B). Activation of Hvl channels by C5 increased proton current and slowed channel closing. Block of Hvl channels by C6 decreased proton currents.
Example 6: Hvl Modulating Agent Inhibits Effects of Progesterone on Sperm Capacitation
[196] The present example demonstrates effectiveness of certain Hvl modulating agents in suppressing maturation of the sperm response to progesterone. This example shows that activity of Hvl channels during capacitation is necessary for calcium rise and acrosomal reaction stimulation by physiological inducers required for fertilization.
[197] To test effects of Hvl modulating agents on sperm capacitation in a blind study, human sperm was exposed to capacitating conditions in the presence or absence of Hvl modulating agent C6 (Tx C) or a control peptide (Tx A) having the amino acid sequence GVEINVKCSGSPQCLKPCKDAGMDFGDCMNDKCHCTPK (SEQ ID NO: 810) (a mutant scorpion venom peptide; Takacs, Z., et al, "A designer ligand specific for Kvl.3 channels from a scorpion neurotoxin-based library," Proc Natl Acad. Sci. USA. 106(52): 22211-22216 (2009)). Sperm were incubated for 1 hour with the Tx C or Tx A (20 μΜ) in a medium that does not promote capacitation. Cells were transferred to a capacitating medium with Tx C or Tx A. After 4 hours of incubation, parameters related to capacitation were analyzed (FIG. 5). Known protocols for such analyses are described in Pocognoni, C.A., et al., "Perfringolysin O as a useful tool to study human sperm
physiology," Fertility and Sterility, 99(1): p. 99-106.e2 (2013).
[198] C6 did not affect the vitality (FIG. 5A), the protein tyrosine phosphorylation
(FIG. 5F and FIG. 5G), or the cholesterol content of the membranes (FIG. 5H). C6 did not significantly alter the mobility of sperm (FIGS. 5B-5E). C6 did affect the response of sperm to progesterone. The increase of cytosolic calcium triggered by progesterone is diminished in the presence of the peptide modulator and the acrosome reaction induced by the hormone is inhibited (FIGS. 5I-5K). Moreover, when C6 was added after capacitation, both intracellular calcium and acrosomal reaction, triggered by progesterone, did not show any changes. Example 7: Hvl Modulating Agents Inhibit Production of Reactive Oxygen Species in Human Blood Cells
[199] The present example demonstrates effectiveness of certain Hvl modulating agents in blocking ROS production by human blood cells.
[200] Whole blood was purchased in 10 mL tubes from Innovative Research, Inc, in accordance with FDA guidelines. Blood was used within 24-48 hours after being drawn. Upon arrival, blood cells were counted using a hemocytometer and diluted in Tyrode's solution to approximately 5 x 106 cells/mL. Twenty of the dilute blood cells were added to each well of a 96-well plate with a total volume of 100 in Tyrode's solution. Reactive oxygen species (ROS) were detected by fluorescence readout using 100 μΜ Amplex Red with 2 units/mL horseradish peroxidase added to each well.
[201] Blood was incubated with the following treatment conditions for 1 hour at 37
C: control; 100 μΜ zinc; 100 pM - 5 μΜ C6; and 10 μΜ MOKA toxin. Each treatment condition was added to wells in 5 repeats. After the incubation, 200 nM phorbol myristate acetate (PMA) was added to all wells except the control. PMA was used to stimulate ROS production. Fluorescence measurements were taken immediately after using excitation at 530 nM and emission at 590 nM. Measurements were repeated every 15 to 30 min for the next 2 hours. Relative fluorescence intensity was plotted versus time and used to calculate inhibition. FIG. 6 demonstrates that C6 blocks production of ROS in human blood cells in a dose-dependent manner. The known inhibitor of Hvl, zinc, blocks ROS production to background (control) levels. Two toxins that block potassium channels with nM affinity (Moka and KTX) had no effect.
Example 8: The Hvl modulating agent C6 targets an S3-S4 external loop region of hHvl [202] The present example demonstrates identification of regions in hHvl that can bind and/or respond to modulation by the Hvl modulating agent C6.
[203] The Hvl modulating agent C6 did not inhibit proton current of Ciona intestinalis (C. intestinalis) Hvl channels (CiHvl). Chimeric forms of ciHvl were generated in which amino acids from human Hvl (hHvl) corresponding to the S3-S4 external loop replaced the same region of CiHvl (hS3-S4-ciHvl). The resulting hS3-S4- ciHvl chimera comprised hHvl amino acids 1183 to L204: ILDIVLLFQEHQFEALGLLILL (SEQ ID NO: 111) and maintained characteristics of Hvl currents. C6 blocked current for hS3-S4-ciHvl (FIGS. 9A and 9B).
[204] Twelve residues in the S3-S4 external loop region of hHvl (F190 to L201) were individually mutated to Cysteine. Current with 1 μΜ C6 normalized to current without toxin (Itox/Ictr) was measured (FIG. 9C). Mutating hHvl E192C increased normalized current with C6 compared to WT hHvl . Mutating hHvl G199C or G199L increased inhibitory effects of C6 compared to WT hHvl .
Equivalents
[205] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. The scope of the present invention is not intended to be limited to the above Description, but rather is as set forth in the following claims:

Claims

Claims We claim:
1. An Hvl modulating agent that is or comprises an engineered polypeptide component having an inhibitor cysteine knot (ICK)-like structural motif.
2. The Hvl modulating agent of claim 1, wherein the polypeptide component is about 10 to about 100 amino acids in length.
3. The Hvl modulating agent of claim 1, wherein the polypeptide component has an amino acid sequence that is composed of one or more toxin sequence elements, each of which has a length within a range of about 5 to about 18 amino acids in length.
4. The Hvl modulating agent of claim 1, wherein the polypeptide component has 0, 1, 2, 3, 4, 5, or 6 conserved cysteine residues of an ICK structural motif.
5. The Hvl modulating agent of claim 1, wherein the polypeptide component has 0, 1, 2, or 3 disulfide bridges.
6. The Hvl modulating agent of claim 1, wherein the polypeptide component has 0, 1, 2, or 3 beta strands.
7. An Hvl modulating agent that is or comprises an engineered polypeptide component that includes one or more toxin sequence elements, each of which has an amino acid sequence that is substantially identical to, but differs from, that of a corresponding element found in a wild-type toxin.
8. The Hvl modulating agent of claim 7, wherein the polypeptide component is about 10 to about 100 amino acids in length.
9. The Hvl modulating agent of claim 7, wherein the polypeptide component has an amino acid sequence that is substantially identical to, but differs from, that of a wild- type toxin.
10. The Hvl modulating agent of claim 7, wherein each of the one or more toxin
sequence elements has a length within a range of about 5 to about 18 amino acids.
11. The Hvl modulating agent of claim 7, wherein two or more toxin sequence elements are assembled in a linear order such that the amino acid sequence shows overall correspondence to a full-length toxin.
12. The Hvl modulating agent of claim 7, wherein the one or more toxin sequence
elements has an amino acid sequence that comprises one or more insertions, deletions substitutions, rearrangements, or combinations thereof relative to a wild- type toxin sequence element and shows at least 40% sequence identity with the wild- type toxin.
13. The Hvl modulating agent of claim 7, wherein the one or more toxin sequence
elements has an amino acid sequence that differs at residues that undergo posttranslational modifications relative to a wild-type toxin sequence element.
14. The Hvl modulating agent of claim 7, wherein the polypeptide component has an amino acid sequence that includes one or more cysteine residues at positions corresponding to those at which a cysteine residue is found in a wild-type toxin sequence.
15. The Hvl modulating agent of claim 7, wherein the polypeptide component has an amino acid sequence that shares the same approximate relative position of cysteines with a wild-type toxin sequence.
16. The Hvl modulating agent of claim 7, wherein the wild-type toxin has an amino acid sequence delineated by six conserved cysteine residues that form disulfide bridges in an inhibitor cysteine knot (ICK) motif.
17. The Hvl modulating agent of claim 7, wherein the wild-type toxin is a venom toxin.
18. The Hvl modulating agent of claim 7, wherein the wild-type toxin has an amino acid sequence that aligns with a sequence in Table 1.
19. An Hvl modulating agent according to claims 1 or 7 that binds to the external
surface of human Hvl .
20. The Hvl modulating agent of claim 19 that binds to the S3-S4 external loop region of human Hvl.
21. The Hvl modulating agent of claim 19 that binds to or within a region of human Hvl having the amino acid sequence ILDIVLLFQEHQFEALGLLILL (SEQ ID NO: 111 )·
22. The Hvl modulating agent of claim 19 that binds to the closed state of human Hvl .
23. The Hvl modulating agent of claim 19 that binds to human Hvl monomers and dimers.
24. The Hvl modulating agent according to claims 1 or 7 that is or comprises a cyclic structure.
25. The Hvl modulating agent according to claims 1 or 7 that is or comprises a stapled polypeptide.
26. The Hvl modulating agent according to claims 1 or 7, wherein the polypeptide
component includes one or more pendant groups or other modifications selected from the group consisting of acetylation, amidation, glycosylation, lipidation, methylation, pegylation, phosphorylation, including combinations thereof.
27. The Hvl modulating agent according to claims 1 or 7, wherein the polypeptide
component has an amino acid sequence that comprises one or more tag elements, such as a detectable tag or a localizing tag.
28. The Hvl modulating agent according to claims 1 or 7, wherein the polypeptide
component is connected to a signal peptide or a coat protein of a phage.
29. An Hvl modulating agent that is or comprises a dimer or multimer of the Hvl
modulating agent of claims 1 or 7.
30. The Hvl modulating agent of claim 29, wherein the dimer or multimer is a
heterodimer or heteromultimer.
31. The Hvl modulating agent of claim 29, wherein the dimer or multimer is a
homodimer or homomultimer.
32. The Hvl modulating agent of claim 29, wherein the dimer or multimer is linked via a peptide linker.
33. A nucleic acid encoding all or part of an Hvl modulating agent of any of the above claims.
34. A vector including the nucleic acid of claim 33.
35. A cell including one or more of the Hvl modulating agents of any of the above claims, the nucleic acid of claim 33, or the vector of claim 34.
36. An Hvl modulating agent of any of the above claims that is incorporated into an antibody framework.
37. The Hvl modulating agent of claim 36, wherein the agent is fused to an antibody sequence or fragment thereof.
38. The Hvl modulating agent of claim 36, wherein the agent is attached or inserted into one or more of an immunoglobulin domain or fragment thereof.
39. An Hvl modulating agent of any of the above claims that inhibits human Hvl
function.
40. The Hvl modulating agent of claim 39, wherein the agent decreases or blocks proton current.
41. The Hvl modulating agent of claim 39, wherein the agent reduces the number or likelihood of Hvl channel opening.
42. The Hvl modulating agent of claim 39, wherein the agent increases the rate of Hvl channel closing.
43. The Hvl modulating agent of claim 39, wherein the agent causes Hvl channels to require stronger voltage to elicit proton current.
44. An Hvl modulating agent of any of the above claims that activates human Hvl function.
45. The Hvl modulating agent of claim 44, wherein the agent increases proton current.
46. The Hvl modulating agent of claim 44, wherein the agent increases the rate of Hvl channel opening.
47. The Hvl modulating agent of claim 44, wherein the agent slows the rate of Hvl channel closing.
48. An Hvl modulating agent of any of the above claims that changes transmembrane voltage of a cell.
49. The Hvl modulating agent of claim 48, wherein the agent hyperpolarizes membrane potential.
50. The Hvl modulating agent of claim 48, wherein the agent depolarizes membrane potential.
51. An Hvl modulating agent of any of the above claims that changes the
transmembrane pH gradient.
52. The Hvl modulating agent of claim 51, wherein the agent increases or decreases cytosolic pH.
53. The Hvl modulating agent of claim 51, wherein the agent increases or decreases extracellular or intraluminal pH.
54. An Hvl modulating agent of any of the above claims that increases or decreases the activity of NOX enzymes.
55. The Hvl modulating agent of claim 54 that increases or decreases ROS production.
56. An Hvl modulating agent of any of the above claims that inhibits sperm
capacitation.
57. An Hvl modulating agent of any of the above claims that decreases ROS production in white blood cells.
58. An Hvl modulating agent of any of the above claims that modulates the activity of one or more Hvl isoforms.
59. A polypeptide comprising one or more of an amino acid sequence element that is substantially identical with a sequence in Table 3A and is different from each sequence in Table 1.
60. The polypeptide of claim 59 having a length of about 10 to about 100 amino acids.
61. The polypeptide of claim 59, wherein the sequence element has a length within a range of about 5 to about 18, comprising a single sequence element corresponding to an A reference element, a single sequence element corresponding to a B reference element, and a single sequence element corresponding to a C reference element set forth in Table 3A.
62. The polypeptide of claim 61 having an amino acid sequence composed of a linear order of reference elements A-B-C.
63. The polypeptide of claim 62, wherein the A reference element has a sequence
according to SEQ ID NO: 809, the B element has a sequence according to SEQ ID NO: 273, and the C element has a sequence according to SEQ ID NO: 411.
64. The polypeptide of claim 62, wherein the A reference element has a sequence
according to SEQ ID NO: 255, the B element has a sequence according to SEQ ID NO: 273, and the C element has a sequence according to SEQ ID NO: 411.
65. The polypeptide of claim 59 whose amino acid sequence has an element that shares one or more cysteines with a sequence in Table 3A.
66. The polypeptide of claim 59 whose amino acid sequence has an element that shares the same approximate relative position of cysteines with a sequence in Table 3A.
67. A nucleic acid comprising one or more of a sequence element that is substantially identical with a sequence in Table 3B.
68. A polypeptide having an amino acid sequence that is substantially identical with a sequence in Table 2A and is different from each sequence in Table 1.
69. The polypeptide of claim 68 having a length within a range of about 10 to about 100 amino acids.
70. The polypeptide of claim 68 having an amino acid sequence that shares one or more cysteines with a sequence in Table 2 A.
71. The polypeptide of claim 68 having an amino acid sequence that shares the same approximate relative position of cysteines with a sequence in Table 2A.
72. The polypeptide of any of claims 68-71 that activates or inhibits human Hvl.
73. A polypeptide having an amino acid sequence that shares one or more cysteines with a sequence set forth in Table 1.
74. The polypeptide of claim 73 having a length within a range of about 10 to about 100 amino acids.
75. The polypeptide of claim 73 having an amino acid sequence that share the same approximate relative position of cysteines with a sequence in Table 1.
76. A polypeptide comprising an amino acid sequence
GCKWYLGDCADSDDCCETFHCKWVFFTSKFMCRRVWGKD.
77. A polypeptide comprising an amino acid sequence
SSTCIPSGQPCADSDDCCETFHCKWVFFTSKFMCRRVWGKD.
78. A nucleic acid comprising the sequence
GGCTGCAAATGGTATCTGGGCGATTGTGCGGATAGCGATGATTGCTGCG AAACCTTTCATTGCAAATGGGTGTTTTTTACCAGCAAATTTATGTGCCGC CGCGTGTGGGGCAAAGAT.
79. A nucleic acid comprising the sequence
AGCAGCACCTGCATTCCGAGCGGCCAGCCGTGTGCGGATAGCGATGATT GCTGCGAAACCTTTCATTGCAAATGGGTGTTTTTTACCAGCAAATTTATG TGCCGCCGCGTGTGGGGCAAAGAT.
80. A pharmaceutical composition comprising:
A polypeptide of any of the prior claims; and
A pharmaceutically acceptable carrier or excipient.
81. A method comprising the step of administering to a subject suffering from or
susceptible to an Hvl associated disease or condition a pharmaceutical composition of claim 80, such that the subject's Hvl associated disease or condition is treated or risk of developing an Hvl associated disease or condition is reduced.
82. The method of claim 81, wherein the Hvl associated disease or condition is selected from the group consisting of: inflammation, allergies, autoimmunity, cancer, asthma, brain damage from ischemic stroke, Alzheimer's disease, or infertility.
83. The method of claim 82 wherein the cancer is a leukemia or solid tumor.
84. The method of claim 83wherein the solid tumor is breast cancer.
85. A method comprising the steps of:
identifying a subject in need of modulating Hvl activity; and administering to the subject a pharmaceutical composition of claim 80.
86. The method of claim 85 wherein the subject is in need of blocking fertilization.
87. A method of making or manufacturing the pharmaceutical composition of claim 80, the method comprising a step of formulating the polypeptide with at least one pharmaceutically acceptable carrier or excipient to generate the pharmaceutical composition.
88. A method of making or manufacturing an Hvl modulating agent, the method
comprising steps of culturing a cell of claim 35 under conditions wherein the cell expresses the Hvl modulating agent.
89. A method of making or manufacturing an Hvl modulating agent the method
comprising steps of:
synthesizing nucleotide duplexes encoding the toxin sequence elements of claim 3;
annealing the duplexes; and
ligating the annealed duplexes into a vector for expression of the Hvl modulating agent.
90. A method of characterizing a composition having the structure of an Hvl modulating agent, said method comprising the steps of:
Contacting the composition with a system comprising a human Hvl channel; and
recording proton current in the system.
91. The method of claim 90 wherein the system is Xenopus laevis oocytes.
92. The method of claim 90 wherein the system is HEK-293T cells.
PCT/US2017/068896 2016-12-30 2017-12-29 Hv1 modulators and uses Ceased WO2018126111A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US16/474,906 US11274130B2 (en) 2016-12-30 2017-12-29 HV1 modulators and uses
US17/684,346 US12084481B2 (en) 2016-12-30 2022-03-01 HV1 modulators and uses
US18/815,668 US20250115647A1 (en) 2016-12-30 2024-08-26 Hv1 modulators and uses

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201662441097P 2016-12-30 2016-12-30
US62/441,097 2016-12-30
US201762447433P 2017-01-17 2017-01-17
US62/447,433 2017-01-17

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/474,906 A-371-Of-International US11274130B2 (en) 2016-12-30 2017-12-29 HV1 modulators and uses
US17/684,346 Continuation US12084481B2 (en) 2016-12-30 2022-03-01 HV1 modulators and uses

Publications (1)

Publication Number Publication Date
WO2018126111A1 true WO2018126111A1 (en) 2018-07-05

Family

ID=62709973

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/068896 Ceased WO2018126111A1 (en) 2016-12-30 2017-12-29 Hv1 modulators and uses

Country Status (2)

Country Link
US (3) US11274130B2 (en)
WO (1) WO2018126111A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110547257A (en) * 2019-10-12 2019-12-10 南开大学 Function and application of voltage-gated proton channel Hv1 in treating allergic asthma
WO2020260670A1 (en) * 2019-06-26 2020-12-30 Smartox Compounds for use in treating dravet syndrome and other disorders

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111471092B (en) * 2020-04-11 2022-10-28 湖南师范大学 A spider polypeptide toxin with Nav1.9 specific activation and its application
US12540163B2 (en) 2021-05-28 2026-02-03 The Regents Of The University Of California Compositions and methods for inhibiting an inflammatory response and treating inflammatory diseases
CN115960164A (en) * 2022-03-18 2023-04-14 中国人民解放军海军军医大学 Preparation method and application of scorpion toxin-derived cell-penetrating polypeptide

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7132505B1 (en) * 2001-05-10 2006-11-07 Centre National De La Recherche Scientifique - Cnrs Polypeptide inhibiting a proton-gated Na+ channel, a nucleic acid coding for such polypeptide and a method of manufacturing an ASIC1a channel blocker
US20120270236A1 (en) * 2006-02-15 2012-10-25 Children's Medical Center Corporation VOLTAGE-GATED PROTON CHANNEL, Hv1, AND USES THEREFOR
US20150087552A1 (en) * 2012-02-29 2015-03-26 D.E. Shaw Research, Llc Methods for screening voltage-gated proteins
US20150203812A1 (en) * 2014-01-20 2015-07-23 Francesco Tombola Inhibitors of Voltage Gated Ion Channels

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7132505B1 (en) * 2001-05-10 2006-11-07 Centre National De La Recherche Scientifique - Cnrs Polypeptide inhibiting a proton-gated Na+ channel, a nucleic acid coding for such polypeptide and a method of manufacturing an ASIC1a channel blocker
US20120270236A1 (en) * 2006-02-15 2012-10-25 Children's Medical Center Corporation VOLTAGE-GATED PROTON CHANNEL, Hv1, AND USES THEREFOR
US20150087552A1 (en) * 2012-02-29 2015-03-26 D.E. Shaw Research, Llc Methods for screening voltage-gated proteins
US20150203812A1 (en) * 2014-01-20 2015-07-23 Francesco Tombola Inhibitors of Voltage Gated Ion Channels

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
KENNEDY, KELLEIGH ET AL.: "(2042-Pos) A designer peptide toxin isolated by phage display that inhibits the human voltage-gated proton channel, hHvl", BIOPHYSICAL JOURNAL, vol. 112, no. 3, 3 February 2017 (2017-02-03), pages 415a, XP029909890 *
SOKOLOV, STANISLAV ET AL.: "Inhibition of sodium channel gating by trapping the domain II voltage sensor with protoxin II", MOLECULAR PHARMACOLOGY, vol. 73, no. 3, 2008, pages 1020 - 1028, XP055511416 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020260670A1 (en) * 2019-06-26 2020-12-30 Smartox Compounds for use in treating dravet syndrome and other disorders
CN110547257A (en) * 2019-10-12 2019-12-10 南开大学 Function and application of voltage-gated proton channel Hv1 in treating allergic asthma

Also Published As

Publication number Publication date
US11274130B2 (en) 2022-03-15
US20250115647A1 (en) 2025-04-10
US12084481B2 (en) 2024-09-10
US20190330285A1 (en) 2019-10-31
US20220289800A1 (en) 2022-09-15

Similar Documents

Publication Publication Date Title
US12084481B2 (en) HV1 modulators and uses
Ve et al. Adaptors in toll-like receptor signaling and their potential as therapeutic targets
CN107709355B (en) Single-chain CD40 receptor agonist proteins
EP2852397B1 (en) Huwentoxin-iv variants and methods of use
JP2008539735A (en) Glucagon-like peptide 1 (GLP-1) receptor antagonists and methods for their pharmacological use
EA009745B1 (en) Tissue protective cytokine receptor complex, assays for identifying tissue protective compounds and uses thereof
US9102751B2 (en) Huwentoxin-IV variants and methods of use
BR102016018074A2 (en) SIRP-ALFA VARIANT CONSTRUCTION, ITS METHOD OF PREPARATION AND USES, NUCLEIC ACID MOLECULE, VECTOR, HOST CELL, AND PHARMACEUTICAL COMPOSITION
SK15262002A3 (en) Thrombopoietin receptor modulating peptide
JPH07505774A (en) Peptides with GDP exchange factor activity, nucleic acid sequences encoding those peptides, methods of preparation, and uses
JP4494633B2 (en) Novel omega-conotoxins and peptides
WO2005059131A2 (en) Protein binding miniature proteins and uses thereof
US12247246B2 (en) Identification of inhibitors of TcpC and TIR NADase activity
US10414808B2 (en) Huwentoxin-IV variants and methods of use
US10946061B2 (en) Peptide inhibitors of twist
JP2002507892A (en) Cloning and characterization of human adenylate cyclase
US12540163B2 (en) Compositions and methods for inhibiting an inflammatory response and treating inflammatory diseases
US20240368271A1 (en) Targeting GPR65 for the Treatment of Cancer in Overweight and Obese Individuals
US20200353045A1 (en) Monomeric cxcl121 peptide and use thereof
JP2022536797A (en) Methods and compositions for treating inflammatory conditions
US9260486B2 (en) Peptidic activators of type I cGMP dependent protein kinases and uses thereof
US20090081227A1 (en) Human and mammalian stem cell-derived neuron survival factors
CA3227284A1 (en) A modified hla-b57 with increased expression levels
Gopalakrishnan et al. Potassium Channels: Overview of Molecular, Biophysical and Pharmacological Properties
Hirschi Structural and Functional Studies of Nucleoside Transporters

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17888229

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 17888229

Country of ref document: EP

Kind code of ref document: A1