WO2018102818A1 - Processive template independent dna polymerase variants - Google Patents

Processive template independent dna polymerase variants Download PDF

Info

Publication number
WO2018102818A1
WO2018102818A1 PCT/US2017/064517 US2017064517W WO2018102818A1 WO 2018102818 A1 WO2018102818 A1 WO 2018102818A1 US 2017064517 W US2017064517 W US 2017064517W WO 2018102818 A1 WO2018102818 A1 WO 2018102818A1
Authority
WO
WIPO (PCT)
Prior art keywords
template
independent polymerase
polymerase
independent
processivity factor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/064517
Other languages
French (fr)
Inventor
Kettner John Frederick GRISWOLD, Jr.
Brian M. TURCZYK
Daniel Jordan WIEGAND
George M. Church
Alexander GARRUSS
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Harvard University
Original Assignee
Harvard University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Harvard University filed Critical Harvard University
Priority to US16/465,816 priority Critical patent/US20190360013A1/en
Publication of WO2018102818A1 publication Critical patent/WO2018102818A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/26Preparation of nitrogen-containing carbohydrates
    • C12P19/28N-glycosides
    • C12P19/30Nucleotides
    • C12P19/34Polynucleotides, e.g. nucleic acids, oligoribonucleotides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1241Nucleotidyltransferases (2.7.7)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1241Nucleotidyltransferases (2.7.7)
    • C12N9/1264DNA nucleotidylexotransferase (2.7.7.31), i.e. terminal nucleotidyl transferase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y207/00Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/07Nucleotidyltransferases (2.7.7)
    • C12Y207/07031DNA nucleotidylexotransferase (2.7.7.31), i.e. terminal deoxynucleotidyl transferase
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/80Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor

Definitions

  • the present invention relates in general to methods of making polynucleotides using template independent DNA polymerase variants.
  • Template-independent polymerases have increasingly been used in polynucleotide synthesis methods. Yet, a need exists for methods of making polynucleotides using template independent DNA polymerase variants with improved functionality.
  • the present disclosure provides an enzymatic method of making a polynucleotide.
  • the method includes combining a selected nucleotide triphosphate, one or more cations, a template-independent polymerase, and an associated processivity factor in an aqueous reaction medium including a target substrate comprising an initiator sequence and having a 3' terminal nucleotide attached to a single stranded portion, such that the template-independent polymerase and the associated processivity factor interact with the target substrate under conditions which covalently add one or more of the selected nucleotide triphosphate to the 3' terminal nucleotide.
  • the method further includes repeatedly introducing a subsequent selected nucleotide triphosphate to the aqueous reaction medium under conditions which enzymatically add one or more of the subsequent selected nucleotide triphosphate to the target substrate until the polynucleotide is formed.
  • the processivity factor increases processivity of the template-independent polymerase.
  • the processivity factor comprises one or more binding units.
  • the processivity factor binds to and translocates across the target substrate.
  • the processivity factor binds to and reptates across the target substrate.
  • the processivity factor and the template-independent polymerase bind to the target substrate.
  • the processivity factor and the template-independent polymerase bind to the target substrate with an affinity greater than the template-independent polymerase alone or without the processivity factor.
  • the processivity factor and the template-independent polymerase comprise a fusion protein.
  • the processivity factor is attached to the template-independent polymerase at a location on the template-independent polymerase which facilitates processing of the target substrate by the template-independent polymerase.
  • the processivity factor is attached by a covalent or noncovalent bond to the template-independent polymerase at a location on the template-independent polymerase which facilitates processing of the target substrate by the template-independent polymerase.
  • the processivity factor is attached to the template-independent polymerase through a linker at a location on the template-independent polymerase which facilitates processing of the target substrate by the template-independent polymerase.
  • the processivity factor includes a polypeptide binding domain that binds to the template-independent polymerase.
  • the template-independent polymerase includes a polypeptide binding domain that binds to the processivity factor.
  • the template-independent polymerase and the processivity factor each include one member of a binding pair wherein the template-independent polymerase and the processivity factor are attached via the binding pair.
  • the template- independent polymerase and the processivity factor are crosslinked via a crosslinker. In exemplary embodiments, the template-independent polymerase and the processivity factor are crosslinked via sulfhydryl crosslinking. In some embodiments, the template-independent polymerase and the processivity factor are attached via protein conjugation. In other embodiments, the template-independent polymerase and the processivity factor are immobilized relative to one another in an orientation which facilitates processing of the substrate by the template-independent polymerase. In some embodiments, the template- independent polymerase and the processivity factor are immobilized relative to one another on a substrate in an orientation which facilitates processing of the substrate by the template- independent polymerase.
  • the template-independent polymerase and the processivity factor are co-localized on a substrate in an orientation which facilitates processing of the substrate by the template-independent polymerase.
  • the template- independent polymerase is a template-independent DNA or RNA polymerase.
  • the template-independent polymerase is a template-independent DNA polymerase.
  • the template-independent polymerase is a terminal deoxynucleotidyl transferase (TdT).
  • TdT terminal deoxynucleotidyl transferase
  • the template-independent polymerase is a TdT of the polX family of DNA polymerases.
  • the TdT is a mammalian TdT or TdT from other non-mammalian species.
  • the TdT is a member of the archaeo-eukaryotic primase (AEP) superfamily.
  • the TdT is a PolpTN2 or a C-terminal truncated PolpTN2, a PriS, a nonhomologous end joining archaeo-eukaryotic primase, a mammalian ⁇ , or a eukaryotic PrimPol.
  • the template-independent polymerase is a mutant where one or more cysteine residues are replaced by one or more non-cysteine residues.
  • the template-independent polymerase is a mutant where one or more or a plurality or all naturally occurring cysteine residues are replaced by one or more non-cysteine residues. In some embodiments, the template-independent polymerase is a mutant where one or more or a plurality or all naturally occurring cysteine residues are replaced by one or more non-cysteine residues and a surface accessible cysteine residue is provided. In other embodiments, the template-independent polymerase is a mutant where one or more non-cysteine residues are replaced by one or more cysteine residues. In some embodiments, the template-independent polymerase is a mutant having one or more surface accessible cysteine residues.
  • the template-independent polymerase is a mutant having at most one surface accessible cysteine residue.
  • the template-independent polymerase and the processivity factor each include a mutant surface accessible cysteine residue which connects the template-independent polymerase to the processivity factor.
  • the processivity factor comprises a prokaryotic or eukaryotic single stranded DNA binding protein.
  • the processivity factor comprises a prokaryotic single stranded DNA binding protein.
  • the processivity factor comprises an E. coli single stranded DNA binding protein.
  • the present disclosure provides mutant template- independent polymerases each having one or more mutations within the template-independent polymerase.
  • the mutant template-independent polymerase has one or more mutations from a cysteine residue to a non-cysteine residue.
  • the mutant template-independent polymerase has one or more mutations from a non-cysteine residue to a cysteine residue.
  • the mutant template-independent polymerase has one or more mutations from a non-cysteine residue to a surface accessible cysteine residue.
  • the mutant template-independent polymerase has a mutation from a non-cysteine residue to a surface accessible cysteine residue.
  • the mutant template-independent polymerase has a mutation from a non- cysteine residue to at most one surface accessible cysteine residue.
  • the present disclosure provides a macromolecule comprising a template-independent polymerase having a processivity factor attached thereto.
  • the template-independent polymerase is a template-independent DNA or RNA polymerase.
  • the template-independent polymerase is a template- independent DNA polymerase.
  • the template- independent polymerase is a terminal deoxynucleotidyl transferase (TdT).
  • the template-independent polymerase is a TdT of the polX family of DNA polymerases.
  • the TdT is a mammalian TdT.
  • the TdT is a member of the archaeo-eukaryotic primase (AEP) superfamily.
  • the TdT is a PolpTNZ or a C-terminal truncated PolpTN2, a PriS, a nonhomologous end joining archaeo-eukaryotic primase, a mammalian ⁇ , or a eukaryotic PrimPol.
  • the template-independent polymerase is a mutant where one or more cysteine residues is replaced by a non-cysteine residue.
  • the template-independent polymerase is a mutant where one or more non-cysteine residues is replaced by a cysteine residue. In some embodiments, the template-independent polymerase is a mutant having one or more surface accessible cysteine residues. In other embodiments, the template-independent polymerase is a mutant having at most one surface accessible cysteine residue. In some embodiments, the template-independent polymerase is attached to the processivity factor by a mutant surface accessible cysteine residue. In certain embodiments, the processivity factor comprises a prokaryotic or eukaryotic single stranded DNA binding protein. In other embodiments, the processivity factor comprises a prokaryotic single stranded DNA binding protein. In exemplary embodiments, the processivity factor comprises an E. coli single stranded DNA binding protein.
  • Embodiments of the present disclosure are directed to a system for making a polynucleotide including a selected nucleotide triphosphate, one or more cations, a template- independent polymerase, and an associated processivity factor in an aqueous reaction medium including a target substrate comprising an initiator sequence and having a 3' terminal nucleotide attached to a single stranded portion.
  • FIG. 1 depicts a schematic representation of an exemplary covalent attachment of a single stranded binding protein (SSB) to a template independent DNA polymerase.
  • SSB single stranded binding protein
  • FIGS. 2 A & 2B show results of purified TdT and its activity.
  • FIG. 2 A shows a molecular weight analysis of His-Tag mTdT purified from crude lysate with Tris-Gly gel electrophoresis under denaturing conditions. Lane 1 indicates the removal of unwanted protein from the crude lysate sample in Lane 2. Approximately 1000 ng of material was loaded on the gel.
  • FIG. 2B shows a TBE-Urea gel electrophoresis indicating initiator extension after 60 minutes from purified His-Tag mTdT in comparison to the commercially available Bovine TdT (New England Biolabs, Inc.) with an equalmolar mixture of dNTPs Approximately 100 ng of material was loaded on the gel.
  • FIGS. 3A & 3B show results of His-tag mTdT activity.
  • FIG. 3A shows the reaction efficiency for individual nucleotide (dATP, dGTP, dTTP, dCTP at 0.1 mM concentration) incorporation by His-tag mTDT was determined by calculating the total single stranded DNA (ssDNA) concentration from the average Relative Fluorescence Units (RFU) value of a nucleic acid stain over 80 minutes.
  • FIG. 3B shows the fold-increase in ssDNA concentration at 80 minutes for each nucleotide was then calculated using the initial concentration of ssDNA at 0 min for several ratios of extended polynucleotide to the initiator fragment.
  • FIG. 4 shows results of nucleotide incorporation activity of a mTdT compared to a non-cysteine mTdT variant.
  • the nucleotide incorporation activity of a mTDT 388 variant in which all 7 native cysteine residues were replaced with non-cysteine residues was compared to native mTDT 388's incorporation activity.
  • Reactions consisted of dNTPs at a concentration of 0.5 mM and a 20-nt initiation sequence. The average RFU was measured and plotted as a function of incubation time. Measurements were taken every 1 minute until reaction completion at 30 minutes.
  • FIG. 5A-E show the results of a kinetic analysis of purified wild-type and R454A human TdT with different divalent cations at increasing concentrations.
  • a poly-dT (18) initiator oligonucleotide was used at 10 pmol and dATP was supplemented into the reaction at 100 uM.
  • barplot (A) the overall rates of enzyme activity are plotted for the WT hTdT and the rates for hTdT R454A are plotted in barplot (B). These rates were derived from the RFU for ssDNA production measured in real time over 30 minutes as shown in scatterplots (C) for WT hTdT and (D) for hTdT R454A.
  • Embodiments of the present disclosure are directed to methods of making a polynucleotide. It has been discovered that template-independent polymerase variants with the associated processivity factor can process the repeated addition of nucleotide molecules to the 3' terminus of a single stranded target substrate oligonucleotide molecule under reaction conditions with improved processivity as compared to the template-independent polymerase alone or without the processivity factor.
  • the processivity factor is associated with the template- independent polymerase in a manner to facilitate improved binding of the template- independent polymerase to a single stranded substrate.
  • the processivity factor is attached to the template-independent polymerase via covalent or nonconvalent interactions.
  • linkers or binder pairs are included to join the processivity factor to the template- independent polymerase such that processing of the target substrate by the template- independent polymerase is improved.
  • the template-independent polymerase and the processivity factor are immobilized such as on a solid support in an orientation which facilitates processing of the substrate by the template-independent polymerase.
  • the template-independent polymerase variants include mutants where either one or more cysteine residues are replaced by one or more non-cysteine residues or vice versa.
  • the template-independent polymerase variants include mutants where residues central to enzyme functionality, such as those located in the catalytic pocket, are replaced with different residues to improve processivity or overall functionality.
  • the template-independent polymerase variants include mutants having one or more surface accessible cysteine residues.
  • the processivity factor comprises a prokaryotic or eukaryotic single stranded DNA binding protein such as an E. coli single stranded DNA binding protein.
  • Embodiments of the present disclosure are further directed to macromolecules including a template-independent polymerase having a processivity factor attached thereto.
  • automated characterization assays are used to determine the processivity of the macromolecules to identify candidates with enhanced processivity.
  • nucleic acid molecule As used herein, the terms “nucleic acid molecule,” “nucleic acid sequence,” “nucleic acid fragment” and “oligomer” are used interchangeably and are intended to include, but are not limited to, a polymeric form of nucleotides that may have various lengths, including either deoxyribonucleotides or ribonucleotides, or analogs thereof.
  • nucleic acid molecule In general, the terms “nucleic acid molecule,” “nucleic acid sequence,” “nucleic acid fragment,” “oligonucleotide” and “polynucleotide” are used interchangeably and are intended to include, but not limited to, a polymeric form of nucleotides that may have various lengths, either deoxyribonucleotides (DNA) or ribonucleotides (RNA), or analogs thereof.
  • DNA deoxyribonucleotides
  • RNA ribonucleotides
  • An oligonucleotide is typically composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); and thymine (T) (uracil (U) for thymine (T) when the polynucleotide is RNA).
  • deoxynucleotide triphosphates dNTPs, such as dATP, dCTP, dGTP, dTTP
  • rNTPs such as rATP, rCTP, rGTP, rUTP
  • ribonucleotide diphosphates may be used.
  • oligonucleotide sequence or simply "sequence is the alphabetical representation of a polynucleotide molecule; alternatively, the term may be applied to the polynucleotide molecule itself.
  • This alphabetical representation can be input into databases in a computer having a central processing unit and used for bioinformatics applications such as functional genomics and homology searching.
  • Oligonucleotides may optionally include one or more non-standard nucleotide(s), nucleotide analog(s) and/or modified nucleotides.
  • the present disclosure contemplates any deoxyribonucleotide or ribonucleotide and chemical variants thereof, such as methylated, hydroxymethylated or glycosylated forms of the bases, and the like.
  • natural nucleotides are used in the methods of making the nucleic acids. Natural nucleotides lack chain terminating moieties.
  • the methods of making the nucleic acids described herein do not use terminating nucleic acids or otherwise lack terminating nucleic acids, such as reversible terminators known to those of skill in the art. The methods are performed in the absence of chain terminating nucleic acids or wherein the nucleic acids are other than chain terminating nucleic acids.
  • modified nucleotides include, but are not limited to diaminopurine, S2T, 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4- acetylcytosine, 5-(carboxyhydroxylmethyl)uracil, 5-carboxymethylaminomethyl-2- thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyl adenine, 1 -methyl guanine, 1-methylinosine, 2,2-dimethylguanine, 2- methyladenine, 2-methylguanine, 3-methylcytosine, 5 -methyl cytosine, N6-adenine, 7- methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D- mannos
  • Nucleic acid molecules may also be modified at the base moiety (e.g., at one or more atoms that typically are available to form a hydrogen bond with a complementary nucleotide and/or at one or more atoms that are not typically capable of forming a hydrogen bond with a complementary nucleotide), sugar moiety or phosphate backbone.
  • Nucleic acid molecules may also contain amine-modified groups, such as aminoallyl-dUTP (aa-dUTP) and aminohexhylacrylamide-dCTP (aha-dCTP) to allow covalent attachment of amine reactive moieties, such as N-hydroxy succinimide esters (NHS).
  • Alternatives to standard DNA base pairs or RNA base pairs in the oligonucleotides of the present disclosure can provide higher density in bits per cubic mm, higher safety (resistant to accidental or purposeful synthesis of natural toxins), easier discrimination in photo- programmed polymerases, or lower secondary structure.
  • Such alternative base pairs compatible with natural and mutant polymerases for de novo and/or amplification synthesis are described in Betz K, Malyshev DA, Lavergne T, Welte W, Diederichs K, Dwyer TJ, Ordoukhanian P, Romesberg FE, Marx A (2012) KlenTaq polymerase replicates unnatural base pairs by inducing a Watson-Crick geometry, Nature Chem. Biol.
  • processive and “processivity” refer to an enzyme's ability to catalyze consecutive reactions without releasing a substrate molecule.
  • a DNA polymerase is processive if the polymerase makes multiple nucleotide incorporations, whether the same or different, before disassociation from a substrate such as a primer as those terms are known in the art of enzymatic synthesis.
  • polymerases are used to build nucleic acid molecules.
  • such nucleic acid molecules may represent information which is referred to herein as being recorded in the nucleic acid sequence or the nucleic acid is referred to herein as being storage media.
  • Polymerases are enzymes that produce a nucleic acid sequence, for example, using DNA or RNA as a template. Polymerases that produce RNA polymers are known as RNA polymerases, while polymerases that produce DNA polymers are known as DNA polymerases. Polymerases that incorporate errors are known in the art and are referred to herein as an "error-prone polymerases". Template independent polymerases may be error prone polymerases.
  • Error- prone polymerases will either accept a non-standard base, such as a reversible chain terminating base, or will incorporate a different nucleotide, such as a natural or unmodified nucleotide that is selectively provided during primer extension.
  • template-independent polymerases refer to polymerase enzymes which catalyze extension of polynucleotide substrate or primer strand with nucleotides in the absence of a polynucleotide template.
  • Template independent polymerases where the polynucleotide substrate or primer is DNA are known as template independent DNA polymerases.
  • Template independent polymerases where the polynucleotide substrate or primer is RNA are known as template independent RNA polymerases.
  • Template independent polymerases may accept a broad range of nucleotide polyphosphate substrates.
  • Template independent DNA polymerase are defined to include all enzymes with activity classified by the Enzyme commission number EC 2.7.7.31 (See, enzyme - ExPASy: SIB Bioinformatics Resource Portal, EC 2.7.7.31).
  • the template independent DNA polymerase is a terminal deoxynucleotidyl transferase (TdT) of the polX family of DNA polymerases.
  • TdT may also be referred to as DNA nucleotidylexotransferase, (DNTT) or simply terminal transferase.
  • DNTT DNA nucleotidylexotransferase
  • TdT is of mammalian origin, for example, from bovine or murine sources. Further description of TdT is provided in Biochim Biophys Acta., May 2010; 1804(5): 1151-1166, hereby incorporated by reference in its entirety.
  • TdT creates polynucleotide strands by catalyzing the addition of nucleotides to the 3' terminus of a DNA molecule in the absence of a template.
  • the preferred substrate of TdT is a 3'-overhang, but it can also add nucleotides to blunt or recessed 3' ends.
  • Cobalt is a cofactor, however the enzyme catalyzes reaction upon Mg 2+ , Zn 2+ , and Mn + administration in vitro.
  • Nucleic acid initiator fragments or sequences may be 4 or 5 nucleotides or longer and may be single stranded or double stranded.
  • Double stranded initiators may have a 3' overhang or they may be blunt ended or they may have a 3' recessed end.
  • Preferred nucleotides are dTTP, dATP, dGTP, dCTP. TdT can catalyze incorporation of many modified nucleotides.
  • the template independent DNA polymerase is a terminal deoxynucleotidyl transferase of the archaeo-eukaryotic primase (AEP) superfamily.
  • AEP archaeo-eukaryotic primase
  • Exemplary terminal transferases are described (Guilliam, T. A., Keen, B. A., Brissett, N. C, & Doherty, A. J, (2015), Primase-polymerases are a functionally diverse superfamily of replication and repair enzymes, Nucleic Acids Research, 43(14), 6651-64), which is hereby incorporated by reference in its entirety.
  • the terminal transferase is PolpTN2, a DNA primase-polymerase protein encoded by the pTN2 plasmid from Thermococcus nautilus.
  • a C-terminal truncation of PolpTN2 may be used, such as ⁇ 3 11-923. (Sukhvinder Gill et al., A highly divergent archaeo-eukaryotic primase from the Thermococcus nautilus plasmid, pTN2, Nucleic Acids Research, Volume 42, Issue 6, Pp. 3707-3719, http://doi.org/10.1093/nar/gktl385)
  • the terminal transferase is PriS, a primase S subunit from the kingdom Archea.
  • PriS a primase S subunit from the kingdom Archea.
  • DNA primase complex of p41-p46 or PriSL as described in the following:
  • Thermococcus kodakaraensis (Wiebke Chemnitz Galal et al., Characterization of DNA Primase Complex Isolated from the Archaeon, Thermococcus kodakaraensis, The Journal of Biological Chemistry 287, 16209-16219, 2012, doi: 10.1074/jbc.M111.338145), Sulfolobus solfataricus (Si-houy Lao-Sirieix, et al., The Heterodimeric Primase of the Hyperthermophilic Archaeon Sulfolobus solfataricus Possesses DNA and RNA Primase, Polymerase and 3 '-terminal Nucleotidyl Transferase Activities, Journal of Molecular Biology, Volume 344, Issue 5, 2004, Pages 1251-1263, http://dx.doi.org/10.1016/j jmb.2004.10.018),
  • the terminal transferase is an archeal nonhomologous end joining archaeo-eukaryotic primase.
  • the terminal transferase is a mammalian Pol ⁇ as described in Tatiana Kent, et al., Mechanism of microhomology-mediated end-joining promoted by human DNA polymerase ⁇ , Nature Structural & Molecular Biology, Vol. 22, 230-237, (2015), doi: 10.1038/nsmb.2961, hereby incorporated by reference in its entirety.
  • the terminal transferase is a Eukaryotic PrimPol
  • human primPol have been described as in Sara Garcia-Gomez, et al., PrimPol, an Archaic Primase/Polymerase Operating in Human Cells, Molecular Cell, Volume 52, Issue 4, 2013, Pages 541-553, http://dx.doi.Org/10.1016/j .molcel.2013.09.025, Thomas A. Guilliam, et al., Human PrimPol is a highly error-prone polymerase regulated by single-stranded DNA binding proteins, Nucl. Acids Res., (2015), 43 (2): 1056-1068, doi: 10.1093/nar/gkul321, which are hereby incorporated by reference in their entireties.
  • TdT may require divalent metal ions for catalysis.
  • TdT is unique in its ability to use a variety of divalent cations such as Co 2+ , Mn 2+ , Zn 2+ and Mg 2+ .
  • the extension rate of the primer p(dA)n (where n is the chain length from 4 through 50) with dATP in the presence of divalent metal ions is ranked in the following order: Mg 2+ > Zn 2+ > Co 2+ > Mn 2+ .
  • each metal ion has different effects on the kinetics of nucleotide incorporation.
  • Mg 2+ facilitates the preferential utilization of dGTP and dATP whereas Co 2+ increases the catalytic polymerization efficiency of the pyrimidines, dCTP and dTTP.
  • Zn 2+ behaves as a unique positive effector for TdT since reaction rates with Mg 2+ are stimulated by the addition of micromolar quantities of Zn 2+ . This enhancement may reflect the ability of Zn 2+ to induce conformational changes in TdT that yields higher catalytic efficiencies. Polymerization rates are lower in the presence of Mn 2+ compared to Mg 2+ , suggesting that Mn 2+ does not support the reaction as efficiently as Mg 2+ . Further description of TdT is provided in Biochim Biophys Acta., May 2010; 1804(5): 1151— 1166 hereby incorporated by reference in its entirety.
  • polymerase processivity factor and “processivity factor” are used interchangeably, and are defined to mean polypeptide domains and subdomains which confer sequence independent polynucleotide interactions, and are associated with a polymerase by covalent or noncovalent interactions.
  • Processivity factors are polypeptide domains or subdomains that confer enhanced processivity to an enzyme, such as a polymerase. In context of polymerases, they confer a lower dissociation constant between the polymerase and the polynucleotide substrate, allowing for more nucleotide incorporations on average before dissociation of the polymerase from the substrate or primer.
  • Polymerase processivity factors function by multiple sequence independent polynucleotide binding mechanisms and association to a polymerase. The primary mechanism is electrostatic interaction between the polynucleic acid phosphate backbone and the processivity factor. The second is steric interactions between the processivity factor with the minor groove structure of the duplex. The third mechanism, is topological restraint, where interactions with the polynucleotide are facilitated by clamp proteins that completely encircle the polynucleotide, with which they associate.
  • Exemplary sequence independent polynucleotide binding domains are known in the art, and are traditionally classified according to the preferred nucleic acid substrate, for example, DNA or RNA and strandedness, such as single stranded or double stranded.
  • One embodiment of the disclosure considers single stranded DNA binding domains/proteins as processivity enhancing factors.
  • polypeptide domains have been identified as polynucleotide binders. These polypeptide domains include four general structural topologies known to bind ssDNA: oligonucleotide-binding (OB) folds, K homology (KH) domains, RNA recognition motifs (RRMs), and whirly domains as described in Thayne H. Dickey et al., Single- Stranded DNA- Binding Proteins: Multiple Domains for Multiple Functions, Structure, Volume 21, Issue 7, 2 July 2013, Pages 1074-1084, http://dx.doi.Org/10.1016/j .str.2013.05.013, hereby incorporated by reference in its entirety.
  • Oligonucleotide binding domains are exemplary DNA binding domains structurally conserved in multiple DNA processing proteins. OBDs bind with ssDNA ligands from 3 to 11 nucleotides per OB fold and dissociation constants ranging from low-picomolar to high-micromolar levels. Affinities roughly correlate with the length of ssDNA bound. Some OBDs may confer sequence specific binding, while others are non-sequence specific. Exemplary OBD containing DNA-binding proteins specifically bind single- stranded DNA (ssDNA) are so called 'single stranded DNA binding proteins' (SSBs). SSB domains are well known to those of skill in the art, for example, as described in James L.
  • SSBs describe a family of evolved molecular chaperones of single stranded DNA. In vivo, SSBs serve multiple functions, for example stabilizing ssDNA at the replication fork, recombination and genome repair. SSBs may be composed of multiple subunits as pentameric, tetrameric, trimeric, dimeric or monomelic complexes.
  • SSBs are exemplary processivity enhancing factors for single stranded DNA substrates, because of the ability to translocate across single stranded DNA, and the relatively large potential barrier from unbinding from the single stranded DNA substrate, and a lack of sequence specific binding preference.
  • SSBs include, but are not limited to: Escherichia coli SSB (see Srinivasan Raghunathan et al., Nature Structural & Molecular Biology, Structure of the DNA binding domain of E. coli SSB bound to ssDNA, 7, 648 - 652 (2000), doi: 10.1038/77943), Deinococcus radiodurans SSB (see Lockhart JS, DeVeaux LC (2013) The Essential Role of the Deinococcus radiodurans ssb Gene in Cell Survival and Radiation Tolerance. PLoS ONE 8(8):e71651, doi: 10.1371/journal.
  • Escherichia coli SSB is a well-studied eubacterial SSB. Structural characterization of the EcSSB-ssDNA complex revealed that EcSSB is a homotetrameric protein, and binds single stranded DNA in a similar geometry to seams on a baseball (See, Srinivasan Raghunathan, et al., Structure of the DNA binding domain of E. coli SSB bound to ssDNA, Nature Structural & Molecular Biology, 7, 648 - 652, (2000), doi: 10.1038/77943, hereby incorporated by reference in its entirety).
  • EcSSB has DNA binding footprint of approximately 65 nucleotides, EcSSB has 12 tryptophan residues colocalized with OBDs that contact the DNA every 3 bases. Tryptophan-DNA interactions are stabilized by a general Pi stacking mechanism. Based on single molecule force spectrometry studies, EcSSB is understood to diffuse on ssDNA using a reptation mechanism, that involves the diffusion of 3bp defects through the complex as described in Ruobo Zhou, et al., SSB Functions as a Sliding Platform that Migrates on DNA via Reptation, Cell, 2011, Volume 146, Issue 3, p485, DOI: http://dx.doi.Org/10.1016/j .cell.2011.07.027, hereby incorporated by reference in its entirety.
  • Replication protein A is an exemplary homolog used in DNA replication, recombination and DNA repair in eukaryotes.
  • the RPA heterotrimer is comprised of RPA70, RPA32, RPA14 subunits as described in Carlos Iftode, et al., Replication Protein A (RPA): The Eukaryotic SSB, Critical Reviews in Biochemistry and Molecular Biology, 2008, Volume 34, 1999 - Issue 3, Pages 141-180, DOI: http://dx.doi.org/10.1080/10409239991209255, hereby incorporated by reference in its entirety.
  • attachment refers to both covalent interactions and noncovalent interactions.
  • a covalent interaction is a chemical linkage between two atoms or radicals formed by the sharing of a pair of electrons (i.e., a single bond), two pairs of electrons (i.e., a double bond) or three pairs of electrons (i.e., a triple bond).
  • Covalent interactions are also known in the art as electron pair interactions or electron pair bonds.
  • Noncovalent interactions include, but are not limited to, van der Waals interactions, hydrogen bonds, weak chemical bonds (i.e., via short-range noncovalent forces), hydrophobic interactions, ionic bonds and the like.
  • Suitable polymerase processivity factors will bind the polynucleotide substrate with affinities in excess of the template independent polymerase alone. Presupposing the processivity factor affinity is sufficiently large, the limit of polymerase processivity will be governed by affinity of the processivity factor to the polymerase.
  • the contemplated disclosure comprises of a number of methods for attachment of a processivity factor to a template Independent DNA polymerase.
  • the processivity factor and the template independent DNA polymerase are constructed as a protein fusion.
  • protein fusion and “peptide fusion” are used interchangeably and are defined as the concatenation of two peptide sequence of two or more polypeptide domain sequences.
  • the protein fusion may be comprised of an insertion of a polypeptide sequence of a polypeptide domain within the polypeptide sequence of another polypeptide domain, referred to herein as an interdomain fusion.
  • the term 'linker sequence' refers to a polypeptide sequence with certain properties. A linker sequence may be stiff or flexible, depending on the application.
  • a 'linker' polypeptide sequence may be introduced between two polypeptide sequence to provide extra distance and flexibility or rigidity between protein domains and subdomains.
  • Various compositions of linker sequences are known to those of skill in the art (See, e.g., Xiaoying Chen, et al., Fusion protein linkers: Property, design and functionality, Advanced Drug Delivery Reviews, 2013, Volume 65, Issue 10, Pages 1357-1369, DOI: http://dx.doi.Org/10.1016/j .addr.2012.09.039, hereby incorporated by reference in its entirety).
  • one or more of the polypeptide sequences are circular permuted prior to protein fusion.
  • Circular permutation is practiced by those of skill in the art (See, e.g., Ying Yu and Stefan Lutz, Circular permutation: a different way to engineer enzyme structure and function, Trends in Biotechnology, 2011, Volume 29, Issue 1, Pages 18-25, DOI: http://dx.doi.Org/10.1016/j .tibtech.2010.10.004, hereby incorporated by reference in its entirety).
  • Circular Permutation introduces novel positions on a protein for fusion to alternative domains or subdomains with respect to local tertiary structure.
  • the processivity factor and template independent polymerase domains are chemically crosslinked by a polyfunctional molecule containing a plurality of protein reactive moieties.
  • Protein crosslinking is known to those of skill in the art as a form of protein conjugation. A review of the art of protein conjugation is hereby incorporated by reference in its entirety (see Hermanson, G. T., (2013), Bioconjugate Techniques. Academic Press).
  • bifunctional cross linker may comprise of the homobifunctional moieties or heterobifunctional moieties, and other reactive groups compatible with polypeptide side chains suitable for monovalent functionalization.
  • Di Maleimides / di haloacetyl / di pyridyldi thiol / di vinylsulfone / di alkene with radical For example: 1,4-Bis[3- (2-pyridyldithio)propionamido]butane, BMOE (bis- maleimidoethane), BM(PEG)2 (1,8-bismaleimido- diethyleneglycol), BM(PEG)3 (1, 11-bismaleimido-
  • Sulfo- SMPB sulfosuccinimidyl 4-(N-maleimidophenyl)butyrate
  • Sulfo-SIAB sulfosuccinimidyl (4-iodoacetyl)aminobenzoate
  • Sulfo-MBS m- maleimidobenzoyl-N-hydroxysulfosuccinimide ester
  • Sulfo- LC-SPDP sulfosuccinimidyl 6-[3'-(2- pyridyldithio)propionamido]hexanoate
  • SM(PEG)24 PEGylated, long-chain SMCC crosslinker
  • SIAB N- succinimidyl (4-iodoacetyl)aminobenzoate
  • N-hydroxysuccinimide ester 3-(2-Pyridyldithio)propionic acid N-hydroxysuccinimide ester, and the like.
  • Carboxyl-to-amine Carbodiimide Isocyanate and (maleimide, haloacetyl, pyridyldi thiol,
  • the attachment of the processivity factor to the template independent polymerase is facilitated by a non-covalent interaction.
  • Non-covalent attachment may be facilitated by intrinsic binding affinity between the processivity factor and the template independent DNA polymerase.
  • contact in reference to weak non-covalent chemical interactions, such as van der Waal forces, hydrogen bonding, base-stacking interactions, ionic and hydrophobic interactions, and the like, dominate the interaction of the molecules.
  • Non-covalent attachment may also be facilitated by addition of a protein binding domain with high affinity to the complement domain, for example by protein fusion of a processivity factor binding domain to a template independent DNA polymerase, or by fusion of a template independent DNA polymerase binding domain to a processivity factor.
  • binding domain may comprise of the following classes of protein binders. Protein Scaffold
  • Alphabodies Triple helix coiled coil
  • Non-covalent attachment may also be facilitated by protein fusion of interacting protein binding domains with mutual affinity to the processivity factor, and template independent DNA polymerase.
  • a polymerase binding domain is attached to a processivity factor.
  • a processivity binding domain is attached to a polymerase.
  • binding domain may comprise of synthetic coiled-coil domains or classes of mutually interacting proteins.
  • Non-covalent attachment may also be facilitated by colocalized attachment of both a Templated independent DNA polymerase and a processivity factor to a common surface or support.
  • colocalized as used in reference to proteins, is defined to mean that two proteins are within a mutual radius of gyration from their respective surface attachment positions. In this embodiment, "colocalization” will mean the optimal spacing and orientation of processivity factor and polymerase to confer maximum stability of bound substrate by the polymerase.
  • the processivity factor may be comprised of more than 1 subunit, in which case, it is advantageous to construct a protein fusion comprised of the required subunits as a single multidomain protein.
  • Monomelic proteins greatly simplify purification and design of functional complexes in protein engineering, however they are not required to ensure the functionality of a system processivity factors and template independent DNA polymerases.
  • one or more oligonucleotide sequences such as substrates or primers as described herein may be immobilized on a support (e.g., a solid and/or semi-solid support).
  • a support e.g., a solid and/or semi-solid support.
  • polymerases and processivity factors as described herein may be attached to a support.
  • an oligonucleotide sequence can be attached to a support using one or more of the phosphoramidite linkers described herein.
  • Polypeptide sequences may also be bound to substrates using methods and linkers (cleavable or non cleavable) and chemistry known to those of skill in the art.
  • Suitable supports include, but are not limited to, slides, beads, chips, particles, strands, gels, sheets, tubing, spheres, containers, capillaries, pads, slices, films, plates and the like.
  • a solid support may be biological, nonbiological, organic, inorganic, or any combination thereof.
  • Supports of the present invention can be any shape, size, or geometry as desired.
  • the support may be square, rectangular, round, flat, planar, circular, tubular, spherical, and the like.
  • the support may be physically separated into regions, for example, with trenches, grooves, wells, or chemical barriers (e.g., hydrophobic coatings, etc.).
  • Supports may be made from glass (silicon dioxide), metal, ceramic, polymer or other materials known to those of skill in the art.
  • Supports may be a solid, semi-solid, elastomer or gel.
  • reagents and washes are delivered at a desired location for a desired period of time to, for example, covalently attached dNTP to an initiator sequence or an existing nucleotide attached at the desired location using a template-independent polymerase as is known in the art.
  • a selected nucleotide reagent liquid is deposited at the reaction site in the presence of a substrate as describe herein, one or more cations as described herein, a template-independent polymerase and a processivity factor as described herein where reaction takes place to add the dNTP to the substrate and then may be optionally followed by delivery of a buffer or wash that does not include the nucleotide.
  • Suitable delivery systems include fluidics systems, microfluidics systems, syringe systems, ink jet systems, pipette systems and other fluid delivery systems known to those of skill in the art.
  • Various flow cell embodiments or flow channel embodiments or microfluidic channel embodiments are envisioned which can deliver separate reagents or a mixture of reagents or washes using pumps or electrodes or other methods known to those of skill in the art of moving fluids through channels or microfluidic channels through one or more channels to a reaction region or vessel where the surface of the substrate is positioned so that the reagents can contact the desired location where a nucleotide is to be added.
  • a microfluidic device is provided with one or more reservoirs which include one or more reagents which are then transferred via microchannels to a reaction zone where the reagents are mixed and the reaction occurs.
  • Such microfluidic devices and the methods of moving fluid reagents through such microfluidic devices are known to those of skill in the art.
  • 'expression' or simply 'protein expression' refer to the generation of a recombinant protein product of interest in excess.
  • Methods of protein expression are well known in the art (See, e.g., Protein production and purification, Nat Methods., 2008, 5(2): 135— 146, doi: 10.1038/nmeth.f.202/, hereby incorporated by reference in its entirety).
  • a bacterial host is employed, such as Esherchia coli BL21(DE3 strains).
  • the host may be eukaryotic, for example, the yeasts Pichia pastoris described in (Mewes Boettner, et al., High-throughput screening for expression of heterologous proteins in the yeast Pichia pastoris, Journal of Biotechnology, 2002, Volume 99, Issue 1, Pages 51-62, DOI: http://dx.doi.org/10.1016/S0168-1656(02)00157-8, hereby incorporated by reference in its entirety) and Saccharomyces cerevisiae described in (Caterina Holz, et al., A micro-scale process for high-throughput expression of cDNAs in the yeast Saccharomyces cerevisiae, Protein Expression and Purification, 2002, Volume 25, Issue 3, Pages 372-378, DOI: http://dx.doi.org/10.1016/S1046-5928(02)00029-3, hereby incorporated by reference in its entirety), human cells (A.
  • protein purification when used herein in reference to polypeptides, attached polypeptides, or proteins is defined as a process separation of a subset of molecules from a mixture of molecules. Protein purification methods are well known in the art. See, e.g., R. K. Scopes, Protein Purification: Principles and Practice (Springer Advanced Texts in Chemistry), Springer, 1994, hereby incorporated by reference in its entirety. Exemplary processes of protein purification include affinity chromatography, size exclusion chromatography, ion exchange chromatography and the like. In purifications involving affinity chromatography, it is common to use a resin, comprising of functional moieties with selective affinity to a protein affinity tag.
  • 'protein affinity tag' or simply 'protein tag' are defined as a polypeptide sequences introduced at the terminal ends of a protein or internal to the protein sequence which confers additional affinity to a substrate.
  • Protein affinity tags and their use are known to those of skill in the art, see, e.g., Fujita-Yamaguchi Yoko, Affinity Chromatography of Native and Recombinant Proteins from Receptors for Insulin and IGF -I to Recombinant Single Chain Antibodies, Frontiers in Endocrinology, 2015, Vol. 6, pages 166, DOI: 10.3389/fendo.2015.00166, hereby incorporated by reference in its entirety.
  • Common exemplary protein affinity tags include His-tags, comprised of 5-10 histidines that bind nickel or cobalt chelate, or Glutathione-S-transferase (GST) tags, a protein which binds to immobilized glutathione.
  • GST Glutathione-S-transferase
  • affinity purification proteins containing affinity tags may be eluted from the resin by competitive binding of a ligand, for example imidazole for release of His-tagged proteins from Ni(II)-nitrilotriacetic acid (Ni-NTA) resins.
  • the protein may be cleaved from the resin by cleavage of a terminal protein tag.
  • a protease recognition sequence such as a TEV protease recognition sequence between the protein and a terminal affinity tag such as GST tag to enable protease cleavage of protein from the GST resin.
  • enzyme activity or "enzyme kinetics” are used herein to describe a protein' s ability to catalyze a chemical reaction and is defined by a standardized unit of measure which is based on the rate at which reaction products are formed or the rate in which a reaction is completed. This rate is commonly defined as a “rate unit”, which is further defined by the amount of protein needed to efficiently catalyze a reaction in order to accomplish its intended function over a period of time under a predefined set of reaction conditions (See, e.g., Berg, Jeremy M., John L. Tymoczko, and Lubert Stryer. Biochemistry. New York: W.H. Freeman, 2002, hereby incorporated by reference in its entirety).
  • the rate unit of template independent polymerases such as a TdT could be described by the amount of protein that is needed to catalyze the incorporation of a certain concentration of natural or non-natural nucleotides into a single-stranded polynucleotide sequence using an initiator strand that exists in-solution or bound to a surface.
  • the term "kinetic assay” and "activity screen” is used herein to describe an experimental procedure or set of procedures that has the ability to evaluate the enzymatic activity and enzyme kinetics of a protein.
  • multiplex and “high- throughput” are used to describe the parallelizable nature of a kinetic assay by having the ability to determine the individual enzymatic activity of less than, equal to or greater than 96 protein variants and/or reaction conditions in a single experiment.
  • the activity of multiple purified template independent DNA polymerase variants or complexes can be determined by the rate at which long single-stranded polynucleotide sequences are produced by measuring the fluorescent response in Relative Fluorescence Units (RFU) of a nucleic acid stain that is highly specific for single-stranded DNA.
  • ROU Relative Fluorescence Unit
  • the accuracy of the kinetic assay is characterized by a minimal observable fluorescent response if double stranded DNA contaminants are present in the reaction vessel or if single-stranded polynucleotide sequences form unintended secondary structures such as hairpins, stem-loop structures or G-quadraplexes and the like. Terminal deoxynucleotidyl transferase activity is only present if an observable increase in fluorescent signal occurs in comparison to a negative control consisting of only initiator strand, free nucleotides, cofactor and appropriate buffers.
  • a positive control consisting of commercially available terminal transferase, such as bovine terminal deoxynucleotidyl transferase (New England Biolabs, Inc.) may also be used to relatively gauge the activity of purified template independent DNA polymerase variants or complexes.
  • Terminal transferase such as bovine terminal deoxynucleotidyl transferase (New England Biolabs, Inc.)
  • bovine terminal deoxynucleotidyl transferase New England Biolabs, Inc.
  • Single stranded nucleic acid fluorescent stains suitable for kinetic assays are known to those of skill in the art and are described in (ThermoFisher Scientific Inc., The Molecular Probes Handbook, Nucleic Acid Detection and Analysis— Chapter 8, Nucleic Acid Stains— Section 8.1, hereby incorporated by reference in its entirety).
  • a concentration curve consisting of a single polynucleotide sequence greater than 10 nucleotides can be generated to yield a set of standardized fluorescent signals. Because the fluorescent response in the presence of TdT activity is directly correlated to the amount of single stranded polynucleotide present at a given reaction time interval, the exact amount of polynucleotide in terms of mass can be interpolated from the concentration versus RFU curve and tracked throughout the progression of the reaction. This produces a rate unit for a particular amount of protein in terms of "mass increase in single-stranded polynucleotide per minute".
  • the rate unit for this kinetic assay can be further quantitated given additional reaction parameters such as free nucleotide composition, cofactors, and initiator sequence composition as well as each component' s respective concentration.
  • This kinetic assay provides a highly accurate and standardized method to specifically determine the best- candidate TdT variants or complex in a cost-efficient and high-throughput activity screen.
  • a processivity factor can be functionally assessed for DNA binding activity by methods known to those of skill in the art.
  • DNAse footprinting individual purified processivity factors and their cognate ssDNA or dsDNA are incubated together at physiological conditions and subsequently processed by a nuclease, for example a DNA endonuclease and/or a DNA exonuclease.
  • Functional processivity factor DNA binding is indicated by an upward, higher molecular weight band shift of the DNA substrate incubated with processivity factor as compared to a control or reference sample under electrophoretic separation.
  • the negative control sample is a nuclease incubation of substrate DNA where no processivity factor is present.
  • DNAse footprinting a reference sample is where DNA substrate is used as is with processing. Further aspects of DNAse footprinting known in the art are described in Michael Brenowitz, et al., UNIT 12.4, DNase I Footprint Analysis of Protein-DNA Binding, Current Protocols in Molecular Biology, 2001, DOI: 10.1002/0471142727.mbl204s07, hereby incorporated by reference in its entirety.
  • Processivity Assays can assess the extent of processive ssDNA primer extension by processive template independent DNA polymerase variants or complexes.
  • template independent DNA polymerase processivity is determined on ssDNA substrate by allowing the polymerase to extend the ssDNA for an initial period followed by the addition of a greater than 100-fold excess of dideoxy ssDNA which sequesters the polymerase if it dissociates from the initial ssDNA during the reaction.
  • Alternative methods have been described in the art.
  • a template independent DNA polymerase derived from Mus Muluscus terminal deoxynucleotidyl transferase, (mTdT) is covalently attached to a monomeric single stranded binding protein, derived from Escherichia coli (mEcSSB).
  • This mTdT is mTdT 388 which is truncated and lacks the BRCTl domain common to many Family X polymerases and has been shown to be not critical to retaining terminal transferase activity. Additionally, the removal of this domain could additivity improve enzyme functionality and processivity with the attachment of the single stranded binding protein.
  • Template-independent DNA polymerases derived from other mammalian or non-mammalian species could be also acceptable for attachment to the single-stranded binding protein.
  • Template-independent DNA polymerases could also be the full-length wild-type enzyme.
  • EcSSB monomelic E coli SSB
  • the ssDNA binding footprint of mEcSSB is 65 nucleotides in length and has a measured Kd of less than 1 picomolar.
  • mEcSSB is an exemplary processivity domain for template independent extension of ssDNA because it permits active translocation of ssDNA about the SSB by a reptation mechanism, ensuring continuous contact with ssDNA product while tethered to an active DNA polymerase. Further, mEcSSB permits exceptionally high affinity to ssDNA such that dissociation of ssDNA from the template independent DNA polymerase is negligible, or nonexistent.
  • the method of attachment of the DNA polymerase to the SSB is by sulfhydryl crosslinking.
  • monovalent cysteine conjugation of the SSB and DNA polymerase is ensured by engineering each protein to contain at most one surface accessible cysteine each.
  • cysteine modified mEcSSB a solvent accessible 'GGSC sequence is introduced at the C-terminal tail.
  • an N-terminal Tev cleavable GST tag is added to the mEcSSB to support affinity purification.
  • the GST-tag mEcSSB is modified by the following mutations (C85S, C138S, C169S, C178S) to remove all cysteines.
  • cysteine modified mTdT all 7 native cysteine side chains in the short murine TdT (mTdT) 388 amino acid isoform (coordinates reference PDB ID:4I27) were replaced by non-cysteine residues.
  • the mTdT may contain an N- terminal His-tag for purification.
  • the following mutations can be selected for cysteine knockout mutagenesis (C155A, C188A, C216N, C302A, C378G, C404A, and C438A).
  • additional cysteine knockout mutations were proposed as suitable alternatives to the exemplary set of mutations.
  • the following mutations may be used in various combinations for each cysteine position (C155A, C155S, C188A, C188G, C216A, C216D, C216G, C216N, C302A, C302G, C302P, C378A, C378G, C404A, C404S, C438A, and C438V).
  • the mutant may contain one of the following exemplary combinations of mutations: (C155A, C188A, C216N, C302P, C378A, C400A, C434A), (C155A, C188A, C216N, C302L, C378G, C400A, C434A), (C155A, C188M, C216N, C302L, C378G, C400A, C434A), (C155A, C188A, C216N, C302P, C378G, C400A, C434A), (C155A, C188A, C216N, C302M, C378G, C400A, C434A), (C155A, C188M, C216N, C302P, C378G, C400A, C434A), (C155A, C188M, C216N, C302P, C378G, C400A, C434A).
  • cysteine engineered mTdT388 a single cysteine residue is reintroduced at a surface accessible region proximal to the primer binding site of the enzyme.
  • cysteines may be introduced at positions that are proximal to the primer binding site, which include but are not limited to the following positions: (265,268,284,287), or certain other residues in the range of 260-280.
  • EGIIEDGE S SEAK A VENDER YK SFKLF T S VF GVGLKT AEKWFRMGFRTLSKIQ SDK SL
  • the SSB is mEcSSB and the template independent DNA polymerase is mTdT.
  • the method of attachment involves covalent crosslinking of the template independent DNA polymerase and the SSB protein.
  • both proteins contain a unique purification tag, for example, His-tag and GST-tag respectively, and the proteins are purified by affinity purification prior to crosslinking.
  • the crosslinking reaction is prepared by mixing the purified SSB and template independent DNA polymerase in an equimolar ratio in the presence of excess crosslinking reagent.
  • the crosslinking agent is a bifunctional crosslinker, for example, a homobifunctional crosslinker, or a heterobifunctional crosslinker.
  • the bifunctional crosslinker is a homobifunctional maleimide crosslinker, for example, bismaleimidoethane, 1,4-bismaleimidobutane, bismaleimidohexane, 1,8- bismaleimido-diethyleneglycol, 1, 11-bismaleimido-triethyleneglycol, and the like.
  • maleimide crosslinking reaction a 2-3 fold molar excess of crosslinker to protein target is sufficient, although other molar ratios may be used.
  • concentration of protein in the reaction is preferably in the range of O. lmM, although other conditions are permissible.
  • the reaction proceeds for 2 hours at 4°C in a sulfhydryl-free buffering media, such as phosphate buffered saline at pH 6.5-7.5.
  • the crosslinker is quenched.
  • the quenching reagent can be cysteine, DTT, or other thiol-containing reducing agent, added at 100-500 fold molar excess at final concentration, for example, lOmM to 50mM.
  • the maleimide reaction quenching may proceed for 15 minutes at room temperature, however alternative conditions may be used.
  • the crosslinked S SB-template independent DNA polymerase product can be purified by several methods.
  • the method of purification occurs in two steps.
  • the quenched, crosslinked product is initially affinity purified by the SSB affinity tag, for example, on GST column if the SSB is GST tagged.
  • the SSB elution product is purified on an affinity column selective to the template independent DNA polymerase affinity Tag.
  • the template independent DNA polymerase contains a His-tag
  • concentrated GST tagged elution product may be purified on a His-tag selective Ni-NTA column.
  • the elution of the captured template independent DNA polymerase complex product from the affinity column can be dialyzed, which should be sufficiently pure for use.
  • affinity chromatography it may be advantageous to remove large affinity tags before or during protein purification.
  • a protease recognition sequence may be introduced between the protein and affinity tag.
  • a GST-TEV tag is removed from a template independent DNA binding protein, by on column protease cleavage as the first or second step of purification.
  • mTDT murine terminal nucleotidyl transferase
  • a vial containing 50 ⁇ . of chemically competent bacteria was transformed using approximately 50 ng of the fully assembled expression plasmid directly from the Gibson Assembly reaction tube following the protocol outlined by the manufacturer. Briefly, plasmid and chemically competent cells were incubated on ice for 30 minutes without mixing and then heat shocked at 42°C for 30 seconds. The cells were then placed on ice for another 5 minutes and 950 ⁇ . of SOC media was added to the vial before shaking at 200 RPM for 1 hour at 37°C. Transformed cells were selected for using LB-Kanamycin agar plates with an antibiotic concentration of 50 ⁇ g/mL.
  • the plates were incubated overnight at 37°C and the resulting colonies were picked for Sanger Sequencing in order to verify that the insert sequence for the His-tagged mutant mTDT was correct (Genewiz, Inc). Colonies that contained perfect copies of the insert sequences were used to inoculate 2 mL of LB-Kanamycin media and were incubated at 37°C overnight shaking at 200 RPM. The resulting cell suspension was diluted 1 :400 in flasks containing 30 mL of fresh LB-Kanamycin media and allowed to reach OD 0.6 (600 nm) while incubating at 37°C shaking at 200 RPM for approximately 2-3 hours.
  • TPTG Isopropyl ⁇ -D-l-thiogalactopyranoside
  • the His-tagged mutant mTDT produced by the induced bacterial cell suspension was purified with immobilized metal affinity chromatography using a Clontech HisTalon Gravity Column Kit as per manufacturer's instructions (Takara Bio USA). Briefly, cell suspensions were pelleted after spinning samples at 3000 x G for 30 minutes at 4°C. Pellets were then lysed using buffers provided by the HisTalon Kit and incubated with beads containing the metal affinity resin at 4°C in the presence of protease inhibitor. His-tagged mTDT was eluted from beads and elution fractions were concentrated using 3 OK MWCO centrifuge filter (EMD Millipore) spun at 5000 x G for 30 minutes.
  • EMD Millipore 3 OK MWCO centrifuge filter
  • the elution buffer was exchanged with lx Terminal Transferase storage buffer as per recommendation from NEB (50 mM ⁇ 0 4 , 100 mM NaCl, 1.43 ⁇ - ⁇ , 50% Glycerol, 0.1% Triton X-100, pH 7.3 at 25°C).
  • concentration of the resultant purified His-tagged mTDT protein was determined colorimetrically with a Reducing Agent Compatible micro BCA kit (Thermo Scientific) and the efficiency of the purification was accessed with denaturing Tris-Glycine gel electrophoresis visualized by Coomassie Orange Flour stain (Thermo Scientific).
  • the activity of the purified His-tagged mTDT protein was accessed by its ability to produce single stranded DNA (ssDNA) and extend an initiator 20-mer oligonucleotide in the presence of a single nucleotide or mixture of different nucleotides.
  • Extension reactions were supplemented with lx Terminal Transferase Buffer (50 mM Potassium Acetate, 20 mM Tris- Acetate, 10 mM Magnesium Acetate, pH 7.9 at 25°C), 0.25 mM CoCl 2 , and lx GelStar ssDNA SYBR Dye (Lonza), 5 pmol of Cy3-labeled initiator oligonucleotide and 5000 pmol of dNTPs. 100 ng of purified His-Tagged mTDT was then added to catalyze the extension reaction.
  • lx Terminal Transferase Buffer 50 mM Potassium Acetate, 20 mM Tris- Acetate, 10 mM Magnesium Acetate, pH 7.9 at 25°C
  • 0.25 mM CoCl 2 0.25 mM CoCl 2
  • lx GelStar ssDNA SYBR Dye Longza
  • Extension reactions were incubated at 37°C and monitored on a Biorad CFX96 Touch Real Time PCR Detection System scanning the relative fluorescence units in the SYBR Green channel every 1 minutes. Extension reactions reached completion after approximately 60 to 90 minutes after all nucleotides are depleted. ssDNA extension products were evaluated using denaturing TBE-Urea gel electrophoresis and further visualized on Typhoon FLA Biomolecular Imager (GE Heathcare) in the Cy3 channel.
  • Typhoon FLA Biomolecular Imager GE Heathcare
  • mutant TdT which exhibits enhanced or increased or improved or raised processivity as described herein.
  • a mutant human TdT is described where alanine is present at position 454 instead of arginine. Arginine is naturally present at position 454 in human TdT. Accordingly, mutant R454A hTdT is provided.
  • Site directed mutagenesis from arginine to alanine at position 454 was performed on a wild-type (WT) human TdT to determine if a mutation to a highly conserved amino acid residue within the catalytic pocket would produce a functional enzyme.
  • WT wild-type
  • one or more mutations are made within the catalytic pocket and the resulting mutant is a functional TdT enzyme.
  • the one or more mutations within the catalytic pocket enhance, increase or improve or raise the processivity of wild-type Terminal deoxynucleotidyl Transferases.
  • the one or more mutations includes R454A.
  • WT and R454A hTdT were screened for enzymatic activity with various divalent cations at different concentrations in order to determine the optimal reaction conditions.
  • Combinations of divalent cations such as Mn 2+ and Co 2+ , were at a 1 : 1 ratio for the indicated concentration (0.25 mM - 2 mM).
  • a poly-dT (18) initiator oligonucleotide was used at 10 pmol and dATP was supplemented into the reaction at 100 uM.
  • Fig. 5 A the overall rates of enzyme activity are plotted for the WT hTdT.
  • Fig. 5B the overall rates of enzyme activity are plotted for hTdT R454A.
  • the primary sequences of wild-type or mutant enzymes of interest such as mTdT 388 and WT hTdT were codon optimized for an E. coli expression system using a custom optimization algorithm and ordered as gBlocks® (Integrated DNA Technologies). Sequences were then inserted into the commercially available pET-28-c-(+) His-tag expression vector (EMD Millipore) using a Gibson Assembly master mix (New England Biolabs). A reaction containing 0.125 pmol of expression plasmid and 0.375 pmol of the gBlock® insert sequence was incubated at 50°C for 2 hours and then transformed into T7 Express Chemically Competent E. coli (New England Biolabs).
  • a vial containing 50 ⁇ _, of chemically competent bacteria was transformed using approximately 50 ng of the fully assembled expression plasmid directly from the Gibson Assembly reaction tube following the protocol outlined by the manufacturer. Briefly, plasmid and chemically competent cells were incubated on ice for 30 minutes without mixing and then heat shocked at 42°C for 30 seconds. The cells were then placed on ice for another 5 minutes and 950 ⁇ ⁇ of SOC media was added to the vial before shaking at 200 RPM for 1 hour at 37°C. Transformed cells were selected for using LB-Kanamycin agar plates with an antibiotic concentration of 50 ⁇ g/mL.
  • the plates were incubated overnight at 37°C and the resulting colonies were picked for Sanger Sequencing in order to verify that the insert sequence for the His-tag enzyme of interest was correct (Genewiz, Inc). Colonies that contained perfect copies of the insert sequences were used to inoculate 2 mL of LB-Kanamycin media and were incubated at 37°C overnight shaking at 200 RPM. The resulting cell suspension was diluted 1 :400 in flasks containing 30 mL of fresh LB-Kanamycin media and allowed to reach OD 0.6 (600 nm) while incubating at 37°C shaking at 200 RPM for approximately 2-3 hours.
  • His-tag enzyme of interest was induced by adding Isopropyl ⁇ -D-l-thiogalactopyranoside (TPTG) (Sigma) to the cell suspension at a concentration of 1 mM. Flasks were then incubated at 15°C while shaking at 200 RPM overnight.
  • TPTG Isopropyl ⁇ -D-l-thiogalactopyranoside
  • the His-tag enzyme of interest produced by the induced bacterial cell suspension was purified with immobilized metal affinity chromatography using a Clontech HisTalon Gravity Column Kit as per manufacturer's instructions (Takara Bio USA). Briefly, cell suspensions were pelleted after spinning samples at 3000 x G for 30 minutes at 4°C. Pellets were then lysed using buffers provided by the HisTalon Kit and incubated with beads containing the metal affinity resin at 4°C in the presence of protease inhibitor. His-tagged enzyme of interest was eluted from beads and elution fractions were concentrated using 3 OK MWCO centrifuge filter (EMD Millipore) spun at 5000 x G for 30 minutes.
  • EMD Millipore 3 OK MWCO centrifuge filter
  • Terminal deoxynucleotidyl Transferases such as mTdT 388 and WT hTdT
  • the elution buffer was exchanged with lx Terminal Transferase storage buffer as per recommendation from NEB (50 mM KPC , 100 mM NaCl, 1.43 ⁇ - ⁇ , 50% Glycerol, 0.1% Triton X-100, pH 7.3 at 25°C).
  • the concentration of the resultant purified His-tagged enzyme of interest was determined colorimetrically with a Reducing Agent Compatible micro BCA kit (Thermo Scientific) and the efficiency of the purification was accessed with denaturing Tris-Glycine gel electrophoresis visualized by Coomassie Orange Flour stain (Thermo Scientific).
  • Plasmids carrying the target protein were harvested and purified from a sequence verified liquid bacterial cultures grown overnight in LB-kanamycin media at 37C using a MiniPrep Kit (Qiagen). Oligonucleotide primers were ordered from IDT and were designed to PCR amplify the protein expression plasmid while simultaneously mutagenizing the plasmid at the predetermined location, yielding linearized DNA.
  • the protein expression plasmid was PCR amplified using the Q5 Hot Start High-Fidelity 2x Master Mix with the following thermocycling conditions: initial denature for 98°C for 30 seconds, denature at 98°C for 10 seconds, anneal at 68°C for 10 seconds, and extend at 72°C for 120 seconds for 25 cycles before a final extension of 2 minutes at 72°C. 1 uL of the resulting PCR amplification reaction was then treated with the kit' s enzyme reaction cocktail to re-circularize the protein expression plasmid while digesting away the unsubstituted plasmid sequences remaining in the reaction mixture. After bacterial transformation and sequence verification, colonies with perfect sequence matches were used to express the site-directed mutant protein.
  • Enzymatic Activity Assay (Terminal Transferase Kinetic Assay)
  • ssDNA single stranded DNA
  • Extension reactions were supplemented with lx Terminal Transferase Buffer (50 mM Potassium Acetate, 20 mM Tris-Acetate, 10 mM Magnesium Acetate, pH 7.9 at 25°C), 0.25 mM CoCb (or equivalent), and lx GelStar ssDNA SYBR Dye (Lonza), 10 pmol of Cy3-labeled initiator oligonucleotide and 100 uM of dNTPs. 1 uL of purified mTdT 388 or WT hTdT was then added to catalyze the extension reaction.
  • lx Terminal Transferase Buffer 50 mM Potassium Acetate, 20 mM Tris-Acetate, 10 mM Magnesium Acetate, pH 7.9 at 25°C), 0.25 mM CoCb (or equivalent), and lx GelStar ssDNA SYBR Dye (Lonza)

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Enzymes And Modification Thereof (AREA)

Abstract

An enzymatic method of making a polynucleotide is provided. The method includes combining a selected nucleotide triphosphate, one or more cations, a template-independent polymerase, and an associated processivity factor in an aqueous reaction medium including a target substrate comprising an initiator sequence and having a 3' terminal nucleotide attached to a single stranded portion, such that the template-independent polymerase and the associated processivity factor interact with the target substrate under conditions which covalently add one or more of the selected nucleotide triphosphate to the 3' terminal nucleotide. Also provided are mutant template-independent polymerases having a processivity factor attached thereto.

Description

Processive Template Independent DNA Polymerase Variants
RELATED APPLICATION DATA
This application claims priority to U.S. Provisional Application No. 62/429,344 filed on December 2, 2016, which is hereby incorporated herein by reference in its entirety for all purposes.
STATEMENT OF GOVERNMENT INTERESTS
This invention was made with government support under grant numbers
RM1HG008525 and R01MH103910 awarded by National Institutes of Health. The government has certain rights in the invention.
FIELD
The present invention relates in general to methods of making polynucleotides using template independent DNA polymerase variants.
BACKGROUND
Template-independent polymerases have increasingly been used in polynucleotide synthesis methods. Yet, a need exists for methods of making polynucleotides using template independent DNA polymerase variants with improved functionality.
SUMMARY
According to one aspect, the present disclosure provides an enzymatic method of making a polynucleotide. In one embodiment, the method includes combining a selected nucleotide triphosphate, one or more cations, a template-independent polymerase, and an associated processivity factor in an aqueous reaction medium including a target substrate comprising an initiator sequence and having a 3' terminal nucleotide attached to a single stranded portion, such that the template-independent polymerase and the associated processivity factor interact with the target substrate under conditions which covalently add one or more of the selected nucleotide triphosphate to the 3' terminal nucleotide. In another embodiment, the method further includes repeatedly introducing a subsequent selected nucleotide triphosphate to the aqueous reaction medium under conditions which enzymatically add one or more of the subsequent selected nucleotide triphosphate to the target substrate until the polynucleotide is formed. In one embodiment, the processivity factor increases processivity of the template-independent polymerase. In certain embodiments, the processivity factor comprises one or more binding units. In one embodiment, the processivity factor binds to and translocates across the target substrate. In another embodiment, the processivity factor binds to and reptates across the target substrate. In one embodiment, the processivity factor and the template-independent polymerase bind to the target substrate. In exemplary embodiments, the processivity factor and the template-independent polymerase bind to the target substrate with an affinity greater than the template-independent polymerase alone or without the processivity factor. In one embodiment, the processivity factor and the template-independent polymerase comprise a fusion protein. In some embodiments, the processivity factor is attached to the template-independent polymerase at a location on the template-independent polymerase which facilitates processing of the target substrate by the template-independent polymerase. In other embodiments, the processivity factor is attached by a covalent or noncovalent bond to the template-independent polymerase at a location on the template-independent polymerase which facilitates processing of the target substrate by the template-independent polymerase. In some embodiments, the processivity factor is attached to the template-independent polymerase through a linker at a location on the template-independent polymerase which facilitates processing of the target substrate by the template-independent polymerase. In other embodiments, the processivity factor includes a polypeptide binding domain that binds to the template-independent polymerase. In some embodiments, the template-independent polymerase includes a polypeptide binding domain that binds to the processivity factor. In other embodiments, the template-independent polymerase and the processivity factor each include one member of a binding pair wherein the template-independent polymerase and the processivity factor are attached via the binding pair. In certain embodiments, the template- independent polymerase and the processivity factor are crosslinked via a crosslinker. In exemplary embodiments, the template-independent polymerase and the processivity factor are crosslinked via sulfhydryl crosslinking. In some embodiments, the template-independent polymerase and the processivity factor are attached via protein conjugation. In other embodiments, the template-independent polymerase and the processivity factor are immobilized relative to one another in an orientation which facilitates processing of the substrate by the template-independent polymerase. In some embodiments, the template- independent polymerase and the processivity factor are immobilized relative to one another on a substrate in an orientation which facilitates processing of the substrate by the template- independent polymerase. In other embodiments, the template-independent polymerase and the processivity factor are co-localized on a substrate in an orientation which facilitates processing of the substrate by the template-independent polymerase. In some embodiments, the template- independent polymerase is a template-independent DNA or RNA polymerase. In one embodiment, the template-independent polymerase is a template-independent DNA polymerase. In another embodiment, the template-independent polymerase is a terminal deoxynucleotidyl transferase (TdT). In some embodiments, the template-independent polymerase is a TdT of the polX family of DNA polymerases. In other embodiments, the TdT is a mammalian TdT or TdT from other non-mammalian species. In some embodiments, the TdT is a member of the archaeo-eukaryotic primase (AEP) superfamily. In other embodiments, the TdT is a PolpTN2 or a C-terminal truncated PolpTN2, a PriS, a nonhomologous end joining archaeo-eukaryotic primase, a mammalian Ροΐθ, or a eukaryotic PrimPol. In some embodiments, the template-independent polymerase is a mutant where one or more cysteine residues are replaced by one or more non-cysteine residues. In other embodiments, the template-independent polymerase is a mutant where one or more or a plurality or all naturally occurring cysteine residues are replaced by one or more non-cysteine residues. In some embodiments, the template-independent polymerase is a mutant where one or more or a plurality or all naturally occurring cysteine residues are replaced by one or more non-cysteine residues and a surface accessible cysteine residue is provided. In other embodiments, the template-independent polymerase is a mutant where one or more non-cysteine residues are replaced by one or more cysteine residues. In some embodiments, the template-independent polymerase is a mutant having one or more surface accessible cysteine residues. In other embodiments, the template-independent polymerase is a mutant having at most one surface accessible cysteine residue. In some embodiments, the template-independent polymerase and the processivity factor each include a mutant surface accessible cysteine residue which connects the template-independent polymerase to the processivity factor. In other embodiments, the processivity factor comprises a prokaryotic or eukaryotic single stranded DNA binding protein. In some embodiments, the processivity factor comprises a prokaryotic single stranded DNA binding protein. In exemplary embodiments, the processivity factor comprises an E. coli single stranded DNA binding protein.
According to another aspect, the present disclosure provides mutant template- independent polymerases each having one or more mutations within the template-independent polymerase. In some embodiments, the mutant template-independent polymerase has one or more mutations from a cysteine residue to a non-cysteine residue. In other embodiments, the mutant template-independent polymerase has one or more mutations from a non-cysteine residue to a cysteine residue. In some embodiments, the mutant template-independent polymerase has one or more mutations from a non-cysteine residue to a surface accessible cysteine residue. In other embodiments, the mutant template-independent polymerase has a mutation from a non-cysteine residue to a surface accessible cysteine residue. In some embodiments, the mutant template-independent polymerase has a mutation from a non- cysteine residue to at most one surface accessible cysteine residue.
According to still another aspect, the present disclosure provides a macromolecule comprising a template-independent polymerase having a processivity factor attached thereto. In certain embodiments, the template-independent polymerase is a template-independent DNA or RNA polymerase. In one embodiment, the template-independent polymerase is a template- independent DNA polymerase. In an exemplary embodiment, wherein the template- independent polymerase is a terminal deoxynucleotidyl transferase (TdT). In some embodiments, the template-independent polymerase is a TdT of the polX family of DNA polymerases. In other embodiments, the TdT is a mammalian TdT. In some embodiments, the TdT is a member of the archaeo-eukaryotic primase (AEP) superfamily. In other embodiments, the TdT is a PolpTNZ or a C-terminal truncated PolpTN2, a PriS, a nonhomologous end joining archaeo-eukaryotic primase, a mammalian Ροΐθ, or a eukaryotic PrimPol. In some embodiments, the template-independent polymerase is a mutant where one or more cysteine residues is replaced by a non-cysteine residue. In other embodiments, the template-independent polymerase is a mutant where one or more non-cysteine residues is replaced by a cysteine residue. In some embodiments, the template-independent polymerase is a mutant having one or more surface accessible cysteine residues. In other embodiments, the template-independent polymerase is a mutant having at most one surface accessible cysteine residue. In some embodiments, the template-independent polymerase is attached to the processivity factor by a mutant surface accessible cysteine residue. In certain embodiments, the processivity factor comprises a prokaryotic or eukaryotic single stranded DNA binding protein. In other embodiments, the processivity factor comprises a prokaryotic single stranded DNA binding protein. In exemplary embodiments, the processivity factor comprises an E. coli single stranded DNA binding protein.
Embodiments of the present disclosure are directed to a system for making a polynucleotide including a selected nucleotide triphosphate, one or more cations, a template- independent polymerase, and an associated processivity factor in an aqueous reaction medium including a target substrate comprising an initiator sequence and having a 3' terminal nucleotide attached to a single stranded portion.
Further features and advantages of certain embodiments of the present invention will become more fully apparent in the following description of embodiments and drawings thereof, and from the claims.
BRIEF DESCRIPTION OF THE DRAWINGS
The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee. The foregoing and other features and advantages of the present embodiments will be more fully understood from the following detailed description of illustrative embodiments taken in conjunction with the accompanying drawings in which:
FIG. 1 depicts a schematic representation of an exemplary covalent attachment of a single stranded binding protein (SSB) to a template independent DNA polymerase.
FIGS. 2 A & 2B show results of purified TdT and its activity. FIG. 2 A shows a molecular weight analysis of His-Tag mTdT purified from crude lysate with Tris-Gly gel electrophoresis under denaturing conditions. Lane 1 indicates the removal of unwanted protein from the crude lysate sample in Lane 2. Approximately 1000 ng of material was loaded on the gel. FIG. 2B shows a TBE-Urea gel electrophoresis indicating initiator extension after 60 minutes from purified His-Tag mTdT in comparison to the commercially available Bovine TdT (New England Biolabs, Inc.) with an equalmolar mixture of dNTPs Approximately 100 ng of material was loaded on the gel.
FIGS. 3A & 3B show results of His-tag mTdT activity. FIG. 3A shows the reaction efficiency for individual nucleotide (dATP, dGTP, dTTP, dCTP at 0.1 mM concentration) incorporation by His-tag mTDT was determined by calculating the total single stranded DNA (ssDNA) concentration from the average Relative Fluorescence Units (RFU) value of a nucleic acid stain over 80 minutes. FIG. 3B shows the fold-increase in ssDNA concentration at 80 minutes for each nucleotide was then calculated using the initial concentration of ssDNA at 0 min for several ratios of extended polynucleotide to the initiator fragment.
FIG. 4 shows results of nucleotide incorporation activity of a mTdT compared to a non-cysteine mTdT variant. The nucleotide incorporation activity of a mTDT 388 variant in which all 7 native cysteine residues were replaced with non-cysteine residues was compared to native mTDT 388's incorporation activity. Reactions consisted of dNTPs at a concentration of 0.5 mM and a 20-nt initiation sequence. The average RFU was measured and plotted as a function of incubation time. Measurements were taken every 1 minute until reaction completion at 30 minutes.
FIG. 5A-E show the results of a kinetic analysis of purified wild-type and R454A human TdT with different divalent cations at increasing concentrations. A poly-dT (18) initiator oligonucleotide was used at 10 pmol and dATP was supplemented into the reaction at 100 uM. In the barplot (A), the overall rates of enzyme activity are plotted for the WT hTdT and the rates for hTdT R454A are plotted in barplot (B). These rates were derived from the RFU for ssDNA production measured in real time over 30 minutes as shown in scatterplots (C) for WT hTdT and (D) for hTdT R454A. In the boxplots (E), the average rate of ssDNA production for all divalent cation concentrations were compared for Mn2+, Mg2+, and Co2+ between the WT hTdT and hTDT454A.
DETAILED DESCRIPTION
Embodiments of the present disclosure are directed to methods of making a polynucleotide. It has been discovered that template-independent polymerase variants with the associated processivity factor can process the repeated addition of nucleotide molecules to the 3' terminus of a single stranded target substrate oligonucleotide molecule under reaction conditions with improved processivity as compared to the template-independent polymerase alone or without the processivity factor. The processivity factor is associated with the template- independent polymerase in a manner to facilitate improved binding of the template- independent polymerase to a single stranded substrate. The processivity factor is attached to the template-independent polymerase via covalent or nonconvalent interactions. In some embodiments, linkers or binder pairs are included to join the processivity factor to the template- independent polymerase such that processing of the target substrate by the template- independent polymerase is improved. In other embodiments, the template-independent polymerase and the processivity factor are immobilized such as on a solid support in an orientation which facilitates processing of the substrate by the template-independent polymerase. In some embodiments, the template-independent polymerase variants include mutants where either one or more cysteine residues are replaced by one or more non-cysteine residues or vice versa. In some other embodiments, the template-independent polymerase variants include mutants where residues central to enzyme functionality, such as those located in the catalytic pocket, are replaced with different residues to improve processivity or overall functionality. In other embodiments, the template-independent polymerase variants include mutants having one or more surface accessible cysteine residues. In some embodiments, the processivity factor comprises a prokaryotic or eukaryotic single stranded DNA binding protein such as an E. coli single stranded DNA binding protein.
Embodiments of the present disclosure are further directed to macromolecules including a template-independent polymerase having a processivity factor attached thereto. In certain embodiments, automated characterization assays are used to determine the processivity of the macromolecules to identify candidates with enhanced processivity.
Nucleic Acids and Nucleotides
As used herein, the terms "nucleic acid molecule," "nucleic acid sequence," "nucleic acid fragment" and "oligomer" are used interchangeably and are intended to include, but are not limited to, a polymeric form of nucleotides that may have various lengths, including either deoxyribonucleotides or ribonucleotides, or analogs thereof.
In general, the terms "nucleic acid molecule," "nucleic acid sequence," "nucleic acid fragment," "oligonucleotide" and "polynucleotide" are used interchangeably and are intended to include, but not limited to, a polymeric form of nucleotides that may have various lengths, either deoxyribonucleotides (DNA) or ribonucleotides (RNA), or analogs thereof. An oligonucleotide is typically composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); and thymine (T) (uracil (U) for thymine (T) when the polynucleotide is RNA). According to certain aspects, deoxynucleotide triphosphates (dNTPs, such as dATP, dCTP, dGTP, dTTP) may be used. According to certain aspects, ribonucleotide triphosphates (rNTPs, such as rATP, rCTP, rGTP, rUTP) may be used. According to certain aspects, ribonucleotide diphosphates (rNDPs) may be used. The term "oligonucleotide sequence" or simply "sequence is the alphabetical representation of a polynucleotide molecule; alternatively, the term may be applied to the polynucleotide molecule itself. This alphabetical representation can be input into databases in a computer having a central processing unit and used for bioinformatics applications such as functional genomics and homology searching. Oligonucleotides may optionally include one or more non-standard nucleotide(s), nucleotide analog(s) and/or modified nucleotides. The present disclosure contemplates any deoxyribonucleotide or ribonucleotide and chemical variants thereof, such as methylated, hydroxymethylated or glycosylated forms of the bases, and the like. According to certain aspects, natural nucleotides are used in the methods of making the nucleic acids. Natural nucleotides lack chain terminating moieties. According to another aspect, the methods of making the nucleic acids described herein do not use terminating nucleic acids or otherwise lack terminating nucleic acids, such as reversible terminators known to those of skill in the art. The methods are performed in the absence of chain terminating nucleic acids or wherein the nucleic acids are other than chain terminating nucleic acids.
Examples of modified nucleotides include, but are not limited to diaminopurine, S2T, 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4- acetylcytosine, 5-(carboxyhydroxylmethyl)uracil, 5-carboxymethylaminomethyl-2- thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyl adenine, 1 -methyl guanine, 1-methylinosine, 2,2-dimethylguanine, 2- methyladenine, 2-methylguanine, 3-methylcytosine, 5 -methyl cytosine, N6-adenine, 7- methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D- mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-D46- isopentenyladenine, uracil -5 -oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2- thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5- oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3- N-2-carboxypropyl) uracil, (acp3)w, 2,6-diaminopurine and the like. Nucleic acid molecules may also be modified at the base moiety (e.g., at one or more atoms that typically are available to form a hydrogen bond with a complementary nucleotide and/or at one or more atoms that are not typically capable of forming a hydrogen bond with a complementary nucleotide), sugar moiety or phosphate backbone. Nucleic acid molecules may also contain amine-modified groups, such as aminoallyl-dUTP (aa-dUTP) and aminohexhylacrylamide-dCTP (aha-dCTP) to allow covalent attachment of amine reactive moieties, such as N-hydroxy succinimide esters (NHS).
Modified nucleotide mono, di, tri phosphates and their synthesis methods have been described (Roy, B., Depaix, A., Perigaud, C, & Peyrottes, S, (2016), Recent Trends in Nucleotide Synthesis. Chemical Reviews, 116(14), 7854-7897), which is hereby incorporated by reference in its entirety.
Alternatives to standard DNA base pairs or RNA base pairs in the oligonucleotides of the present disclosure can provide higher density in bits per cubic mm, higher safety (resistant to accidental or purposeful synthesis of natural toxins), easier discrimination in photo- programmed polymerases, or lower secondary structure. Such alternative base pairs compatible with natural and mutant polymerases for de novo and/or amplification synthesis are described in Betz K, Malyshev DA, Lavergne T, Welte W, Diederichs K, Dwyer TJ, Ordoukhanian P, Romesberg FE, Marx A (2012) KlenTaq polymerase replicates unnatural base pairs by inducing a Watson-Crick geometry, Nature Chem. Biol. 8:612-614; See YJ, Malyshev DA, Lavergne T, Ordoukhanian P, Romesberg FE. J Am Chem Soc. 2011 Dec 14; 133(49): 19878-88, Site-specific labeling of DNA and RNA using an efficiently replicated and transcribed class of unnatural base pairs; Switzer CY, Moroney SE, Benner SA. (1993) Biochemistry. 32(39): 10489-96. Enzymatic recognition of the base pair between isocytidine and isoguanosine; Yamashige R, Kimoto M, Takezawa Y, Sato A, Mitsui T, Yokoyama S, Hirao I. Nucleic Acids Res. 2012 Mar;40(6):2793-806. Highly specific unnatural base pair systems as a third base pair for PCR amplification; and Yang Z, Chen F, Alvarado JB, Benner SA. J Am Chem Soc. 201 1 Sep 28; 133(38): 15105-12, Amplification, mutation, and sequencing of a six-letter synthetic genetic system. Other non-standard nucleotides may be used such as described in Malyshev, D.A., et al., Nature, vol. 509, pp. 385-388 (15 May 2014), which are hereby incorporated by reference in their entireties.
Polymerases
As used herein, the terms "processive" and "processivity" refer to an enzyme's ability to catalyze consecutive reactions without releasing a substrate molecule. For example, a DNA polymerase is processive if the polymerase makes multiple nucleotide incorporations, whether the same or different, before disassociation from a substrate such as a primer as those terms are known in the art of enzymatic synthesis.
According to an alternative embodiment of the present invention, polymerases are used to build nucleic acid molecules. According to one aspect, such nucleic acid molecules may represent information which is referred to herein as being recorded in the nucleic acid sequence or the nucleic acid is referred to herein as being storage media. Polymerases are enzymes that produce a nucleic acid sequence, for example, using DNA or RNA as a template. Polymerases that produce RNA polymers are known as RNA polymerases, while polymerases that produce DNA polymers are known as DNA polymerases. Polymerases that incorporate errors are known in the art and are referred to herein as an "error-prone polymerases". Template independent polymerases may be error prone polymerases. Using an error-prone polymerase allows the incorporation of specific bases at precise locations of the DNA molecule. Error- prone polymerases will either accept a non-standard base, such as a reversible chain terminating base, or will incorporate a different nucleotide, such as a natural or unmodified nucleotide that is selectively provided during primer extension.
Template independent polymerases
As used herein, template-independent polymerases, refer to polymerase enzymes which catalyze extension of polynucleotide substrate or primer strand with nucleotides in the absence of a polynucleotide template. Template independent polymerases where the polynucleotide substrate or primer is DNA are known as template independent DNA polymerases. Template independent polymerases where the polynucleotide substrate or primer is RNA are known as template independent RNA polymerases. Template independent polymerases may accept a broad range of nucleotide polyphosphate substrates. Template independent DNA polymerase are defined to include all enzymes with activity classified by the Enzyme commission number EC 2.7.7.31 (See, enzyme - ExPASy: SIB Bioinformatics Resource Portal, EC 2.7.7.31).
According to certain aspects of the invention the template independent DNA polymerase is a terminal deoxynucleotidyl transferase (TdT) of the polX family of DNA polymerases. TdT may also be referred to as DNA nucleotidylexotransferase, (DNTT) or simply terminal transferase. According to further aspects of the disclosure, TdT is of mammalian origin, for example, from bovine or murine sources. Further description of TdT is provided in Biochim Biophys Acta., May 2010; 1804(5): 1151-1166, hereby incorporated by reference in its entirety. TdT creates polynucleotide strands by catalyzing the addition of nucleotides to the 3' terminus of a DNA molecule in the absence of a template. The preferred substrate of TdT is a 3'-overhang, but it can also add nucleotides to blunt or recessed 3' ends. Cobalt is a cofactor, however the enzyme catalyzes reaction upon Mg2+, Zn2+, and Mn+ administration in vitro. Nucleic acid initiator fragments or sequences may be 4 or 5 nucleotides or longer and may be single stranded or double stranded. Double stranded initiators may have a 3' overhang or they may be blunt ended or they may have a 3' recessed end. Preferred nucleotides are dTTP, dATP, dGTP, dCTP. TdT can catalyze incorporation of many modified nucleotides.
According to certain aspects of the disclosure, the template independent DNA polymerase is a terminal deoxynucleotidyl transferase of the archaeo-eukaryotic primase (AEP) superfamily. Exemplary terminal transferases are described (Guilliam, T. A., Keen, B. A., Brissett, N. C, & Doherty, A. J, (2015), Primase-polymerases are a functionally diverse superfamily of replication and repair enzymes, Nucleic Acids Research, 43(14), 6651-64), which is hereby incorporated by reference in its entirety.
In further aspects of the disclosure, the terminal transferase is PolpTN2, a DNA primase-polymerase protein encoded by the pTN2 plasmid from Thermococcus nautilus. In further aspects of the contemplated disclosure a C-terminal truncation of PolpTN2 may be used, such as Δ311-923. (Sukhvinder Gill et al., A highly divergent archaeo-eukaryotic primase from the Thermococcus nautilus plasmid, pTN2, Nucleic Acids Research, Volume 42, Issue 6, Pp. 3707-3719, http://doi.org/10.1093/nar/gktl385)
In further aspects of the disclosure, the terminal transferase is PriS, a primase S subunit from the kingdom Archea. For example: DNA primase complex of p41-p46 or PriSL as described in the following:
Pyrococcus furiosus (Lidong Liu et al., The Archaeal DNA Primase Biochemical Characterization of the p41-p46 Complex from Pyrococcus Furiosus, The Journal of Biological Chemistry, 276, 45484-45490, 2001, doi: 10.1074/jbc.M106391200),
Thermococcus kodakaraensis (Wiebke Chemnitz Galal et al., Characterization of DNA Primase Complex Isolated from the Archaeon, Thermococcus kodakaraensis, The Journal of Biological Chemistry 287, 16209-16219, 2012, doi: 10.1074/jbc.M111.338145), Sulfolobus solfataricus (Si-houy Lao-Sirieix, et al., The Heterodimeric Primase of the Hyperthermophilic Archaeon Sulfolobus solfataricus Possesses DNA and RNA Primase, Polymerase and 3 '-terminal Nucleotidyl Transferase Activities, Journal of Molecular Biology, Volume 344, Issue 5, 2004, Pages 1251-1263, http://dx.doi.org/10.1016/j jmb.2004.10.018),
Pyrococcus horikoshii (Eriko Matsui et al., Distinct Domain Functions Regulating de Novo DNA Synthesis of Thermostable DNA Primase from Hyperthermophile Pyrococcus horikoshii, Biochemistry, 2003, 42 (50), pp 14968-14976, DOI: 10.1021/bi035556o), and
Archaeoglobus fulgidus (Stanislaw K. Jozwiakowski, et al., Archaeal replicative primases can perform translesion DNA synthesis, PNAS, 2015, vol. 112, no. 7, E633-E638, doi: 10.1073/pnas.1412982112), which are hereby incorporated by reference in their entireties.
In further aspects of the disclosure, the terminal transferase is an archeal nonhomologous end joining archaeo-eukaryotic primase.
In further aspects of the disclosure, the terminal transferase is a mammalian Pol Θ as described in Tatiana Kent, et al., Mechanism of microhomology-mediated end-joining promoted by human DNA polymerase Θ, Nature Structural & Molecular Biology, Vol. 22, 230-237, (2015), doi: 10.1038/nsmb.2961, hereby incorporated by reference in its entirety.
In further aspects of the disclosure, the terminal transferase is a Eukaryotic PrimPol, for example, human primPol have been described as in Sara Garcia-Gomez, et al., PrimPol, an Archaic Primase/Polymerase Operating in Human Cells, Molecular Cell, Volume 52, Issue 4, 2013, Pages 541-553, http://dx.doi.Org/10.1016/j .molcel.2013.09.025, Thomas A. Guilliam, et al., Human PrimPol is a highly error-prone polymerase regulated by single-stranded DNA binding proteins, Nucl. Acids Res., (2015), 43 (2): 1056-1068, doi: 10.1093/nar/gkul321, which are hereby incorporated by reference in their entireties.
As is known in the art of using a template-independent polymerase to build nucleic acid sequences, TdT or other DNA polymerases, may require divalent metal ions for catalysis. However, TdT is unique in its ability to use a variety of divalent cations such as Co2+, Mn2+, Zn2+ and Mg2+. In general, the extension rate of the primer p(dA)n (where n is the chain length from 4 through 50) with dATP in the presence of divalent metal ions is ranked in the following order: Mg2+ > Zn2+ > Co2+ > Mn2+. In addition, each metal ion has different effects on the kinetics of nucleotide incorporation. For example, Mg2+ facilitates the preferential utilization of dGTP and dATP whereas Co2+ increases the catalytic polymerization efficiency of the pyrimidines, dCTP and dTTP. Zn2+ behaves as a unique positive effector for TdT since reaction rates with Mg2+ are stimulated by the addition of micromolar quantities of Zn2+. This enhancement may reflect the ability of Zn2+ to induce conformational changes in TdT that yields higher catalytic efficiencies. Polymerization rates are lower in the presence of Mn2+ compared to Mg2+, suggesting that Mn2+ does not support the reaction as efficiently as Mg2+. Further description of TdT is provided in Biochim Biophys Acta., May 2010; 1804(5): 1151— 1166 hereby incorporated by reference in its entirety.
Polymerase Processivity Factors:
As used herein, "polymerase processivity factor" and "processivity factor" are used interchangeably, and are defined to mean polypeptide domains and subdomains which confer sequence independent polynucleotide interactions, and are associated with a polymerase by covalent or noncovalent interactions.
Processivity factors are polypeptide domains or subdomains that confer enhanced processivity to an enzyme, such as a polymerase. In context of polymerases, they confer a lower dissociation constant between the polymerase and the polynucleotide substrate, allowing for more nucleotide incorporations on average before dissociation of the polymerase from the substrate or primer. Polymerase processivity factors function by multiple sequence independent polynucleotide binding mechanisms and association to a polymerase. The primary mechanism is electrostatic interaction between the polynucleic acid phosphate backbone and the processivity factor. The second is steric interactions between the processivity factor with the minor groove structure of the duplex. The third mechanism, is topological restraint, where interactions with the polynucleotide are facilitated by clamp proteins that completely encircle the polynucleotide, with which they associate.
Exemplary sequence independent polynucleotide binding domains are known in the art, and are traditionally classified according to the preferred nucleic acid substrate, for example, DNA or RNA and strandedness, such as single stranded or double stranded. One embodiment of the disclosure considers single stranded DNA binding domains/proteins as processivity enhancing factors.
Various polypeptide domains have been identified as polynucleotide binders. These polypeptide domains include four general structural topologies known to bind ssDNA: oligonucleotide-binding (OB) folds, K homology (KH) domains, RNA recognition motifs (RRMs), and whirly domains as described in Thayne H. Dickey et al., Single- Stranded DNA- Binding Proteins: Multiple Domains for Multiple Functions, Structure, Volume 21, Issue 7, 2 July 2013, Pages 1074-1084, http://dx.doi.Org/10.1016/j .str.2013.05.013, hereby incorporated by reference in its entirety.
Oligonucleotide binding domains (OBDs) are exemplary DNA binding domains structurally conserved in multiple DNA processing proteins. OBDs bind with ssDNA ligands from 3 to 11 nucleotides per OB fold and dissociation constants ranging from low-picomolar to high-micromolar levels. Affinities roughly correlate with the length of ssDNA bound. Some OBDs may confer sequence specific binding, while others are non-sequence specific. Exemplary OBD containing DNA-binding proteins specifically bind single- stranded DNA (ssDNA) are so called 'single stranded DNA binding proteins' (SSBs). SSB domains are well known to those of skill in the art, for example, as described in James L. Keck (ed.), Single- Stranded DNA Binding Proteins: Methods and Protocols, Methods in Molecular Biology Volume 922, pp 37-54, Springer Science+Business Media, LLC 2012, DOI 10.1007/978-1- 62703-032-8 3 and Alexander G. Kozlov, et al., SSB Binding to ssDNA Using Isothermal Titration Calorimetry, Robert D. Shereda, et al., SSB as an Organizer/Mobilizer of Genome Maintenance Complexes, CRITICAL REVIEWS IN BIOCHEMISTRY AND MOLECULAR BIOLOGY, VOL. 43, ISS. 5, Pages 289-318, 2008, http://dx.doi.org/10.1080/10409230802341296, hereby incorporated by reference in their entireties. SSBs describe a family of evolved molecular chaperones of single stranded DNA. In vivo, SSBs serve multiple functions, for example stabilizing ssDNA at the replication fork, recombination and genome repair. SSBs may be composed of multiple subunits as pentameric, tetrameric, trimeric, dimeric or monomelic complexes. SSBs are exemplary processivity enhancing factors for single stranded DNA substrates, because of the ability to translocate across single stranded DNA, and the relatively large potential barrier from unbinding from the single stranded DNA substrate, and a lack of sequence specific binding preference.
Several exemplary prokaryotic SSBs have been characterized as known to those of skill in the art. These SSBs include, but are not limited to: Escherichia coli SSB (see Srinivasan Raghunathan et al., Nature Structural & Molecular Biology, Structure of the DNA binding domain of E. coli SSB bound to ssDNA, 7, 648 - 652 (2000), doi: 10.1038/77943), Deinococcus radiodurans SSB (see Lockhart JS, DeVeaux LC (2013) The Essential Role of the Deinococcus radiodurans ssb Gene in Cell Survival and Radiation Tolerance. PLoS ONE 8(8):e71651, doi: 10.1371/journal. pone.0071651), Sulfolobus solfataricus SSB (see Sonia Paytubi, et al., Displacement of the canonical single-stranded DNA-binding protein in the Thermoproteales, PNAS, 2012, vol. 109, no. 7, E398-E405, doi: 10.1073/pnas.1113277108), Tth SSB and Thermus aquaticus SSB (see Gregor Witte, et al., Biophysical Analysis of Thermus aquaticus Single-Stranded DNA Binding Protein, Biophysical Journal, Volume 94, Issue 6, 2008, Pages 2269-2279, http://dx.doi.org/10.1529/biophysj .107.121533), Deinococcus radiopugnans SSB (see Filipkowski, P., Koziatek, M. & Kur, J., A highly thermostable, homodimeric single- stranded DNA-binding protein from Deinococcus radiopugnans, Extremophiles, (2006), 10: 607, doi: 10.1007/s00792-006-0011-8), hereby incorporated by reference in their entireties.
Escherichia coli SSB (EcSSB) is a well-studied eubacterial SSB. Structural characterization of the EcSSB-ssDNA complex revealed that EcSSB is a homotetrameric protein, and binds single stranded DNA in a similar geometry to seams on a baseball (See, Srinivasan Raghunathan, et al., Structure of the DNA binding domain of E. coli SSB bound to ssDNA, Nature Structural & Molecular Biology, 7, 648 - 652, (2000), doi: 10.1038/77943, hereby incorporated by reference in its entirety). EcSSB has DNA binding footprint of approximately 65 nucleotides, EcSSB has 12 tryptophan residues colocalized with OBDs that contact the DNA every 3 bases. Tryptophan-DNA interactions are stabilized by a general Pi stacking mechanism. Based on single molecule force spectrometry studies, EcSSB is understood to diffuse on ssDNA using a reptation mechanism, that involves the diffusion of 3bp defects through the complex as described in Ruobo Zhou, et al., SSB Functions as a Sliding Platform that Migrates on DNA via Reptation, Cell, 2011, Volume 146, Issue 3, p485, DOI: http://dx.doi.Org/10.1016/j .cell.2011.07.027, hereby incorporated by reference in its entirety.
In non-eubacterial systems, functional eukaryotic homologs to the bacterial SSB protein family are known to those of skill in the art. Replication protein A (RPA) is an exemplary homolog used in DNA replication, recombination and DNA repair in eukaryotes. The RPA heterotrimer is comprised of RPA70, RPA32, RPA14 subunits as described in Cristina Iftode, et al., Replication Protein A (RPA): The Eukaryotic SSB, Critical Reviews in Biochemistry and Molecular Biology, 2008, Volume 34, 1999 - Issue 3, Pages 141-180, DOI: http://dx.doi.org/10.1080/10409239991209255, hereby incorporated by reference in its entirety.
Attachment of Polymerase Processivity Factors to Template Independent Polymerases
As used herein, the term "attach," or "attachment" refers to both covalent interactions and noncovalent interactions. A covalent interaction is a chemical linkage between two atoms or radicals formed by the sharing of a pair of electrons (i.e., a single bond), two pairs of electrons (i.e., a double bond) or three pairs of electrons (i.e., a triple bond). Covalent interactions are also known in the art as electron pair interactions or electron pair bonds. Noncovalent interactions include, but are not limited to, van der Waals interactions, hydrogen bonds, weak chemical bonds (i.e., via short-range noncovalent forces), hydrophobic interactions, ionic bonds and the like. A review of noncovalent interactions can be found in Alberts et al., in Molecular Biology of the Cell, 3d edition, Garland Publishing, 1994, hereby incorporated by reference in its entirety.
Suitable polymerase processivity factors will bind the polynucleotide substrate with affinities in excess of the template independent polymerase alone. Presupposing the processivity factor affinity is sufficiently large, the limit of polymerase processivity will be governed by affinity of the processivity factor to the polymerase. The contemplated disclosure comprises of a number of methods for attachment of a processivity factor to a template Independent DNA polymerase.
In certain exemplary embodiments of covalent attachment, the processivity factor and the template independent DNA polymerase are constructed as a protein fusion. The terms "protein fusion" and "peptide fusion" are used interchangeably and are defined as the concatenation of two peptide sequence of two or more polypeptide domain sequences. In certain embodiments, the protein fusion may be comprised of an insertion of a polypeptide sequence of a polypeptide domain within the polypeptide sequence of another polypeptide domain, referred to herein as an interdomain fusion. The term 'linker sequence', as used herein, refers to a polypeptide sequence with certain properties. A linker sequence may be stiff or flexible, depending on the application. In certain embodiments of protein fusions, a 'linker' polypeptide sequence may be introduced between two polypeptide sequence to provide extra distance and flexibility or rigidity between protein domains and subdomains. Various compositions of linker sequences are known to those of skill in the art (See, e.g., Xiaoying Chen, et al., Fusion protein linkers: Property, design and functionality, Advanced Drug Delivery Reviews, 2013, Volume 65, Issue 10, Pages 1357-1369, DOI: http://dx.doi.Org/10.1016/j .addr.2012.09.039, hereby incorporated by reference in its entirety).
In yet other embodiments of covalent attachment, one or more of the polypeptide sequences are circular permuted prior to protein fusion. Circular permutation is practiced by those of skill in the art (See, e.g., Ying Yu and Stefan Lutz, Circular permutation: a different way to engineer enzyme structure and function, Trends in Biotechnology, 2011, Volume 29, Issue 1, Pages 18-25, DOI: http://dx.doi.Org/10.1016/j .tibtech.2010.10.004, hereby incorporated by reference in its entirety). In the art of protein engineering, it is common to introduce a polypeptide linker sequence between the N and C terminus of the polypeptide, prior to circular permutation, which entails introducing new termini in a protein by cleavage of an existing peptide bond. Circular Permutation introduces novel positions on a protein for fusion to alternative domains or subdomains with respect to local tertiary structure.
In alternative embodiments of covalent attachment, the processivity factor and template independent polymerase domains are chemically crosslinked by a polyfunctional molecule containing a plurality of protein reactive moieties. Protein crosslinking is known to those of skill in the art as a form of protein conjugation. A review of the art of protein conjugation is hereby incorporated by reference in its entirety (see Hermanson, G. T., (2013), Bioconjugate Techniques. Academic Press). In one embodiment, bifunctional cross linker may comprise of the homobifunctional moieties or heterobifunctional moieties, and other reactive groups compatible with polypeptide side chains suitable for monovalent functionalization.
Monovalent Chemical Protein Conjugation
Figure imgf000024_0001
hydroxysuccinimide ester), Suberic acid bis(N- hydroxysuccinimide ester) , Suberic acid bis(3-sulfo-N- hydroxysuccinimide ester), and the like.
Di Maleimides / di haloacetyl / di pyridyldi thiol / di vinylsulfone / di alkene with radical. For example: 1,4-Bis[3- (2-pyridyldithio)propionamido]butane, BMOE (bis- maleimidoethane), BM(PEG)2 (1,8-bismaleimido- diethyleneglycol), BM(PEG)3 (1, 11-bismaleimido-
Sulfhydryl-to- triethyleneglycol), DTME (dithio-bis-maleimidoethane), and sulfhydryl the like.
(NHS ester, isocynanate, isothiocyanate, acid halid, or anhydride) and (maleimide, haloacetyl, pyridyldithiol, vinylsulfone, or alkene with radical) For Example: Sulfo- SMPB (sulfosuccinimidyl 4-(N-maleimidophenyl)butyrate), Sulfo-SIAB (sulfosuccinimidyl (4-iodoacetyl)aminobenzoate), Sulfo-N-succinimidyl 4-maleimidobutyrate , Sulfo-MBS (m- maleimidobenzoyl-N-hydroxysulfosuccinimide ester), Sulfo- LC-SPDP (sulfosuccinimidyl 6-[3'-(2- pyridyldithio)propionamido]hexanoate), Sulfo-KMUS (Ν-(κ- maleimidoundecanoyloxy) sulfosuccinimide ester), Sulfo- EMCS (N-(8-maleimidocaproyloxy) sulfosuccinimide ester), SMPT (4-succinimidyloxycarbonyl-alpha-methyl-alpha(2- pyridyldithio)toluene), SMPH (succinimidyl-6-((b-
Amine to sulfhydryl mal eimi dopropi onami do)hexanoate), SM(PEG)24 (PEGylated, long-chain SMCC crosslinker), SIAB (N- succinimidyl (4-iodoacetyl)aminobenzoate), SBAP
(succinimidyl 3-(bromoacetamido)propionate), PEG4-SPDP
(PEGylated, long-chain SPDP crosslinker), PEG12-SPDP
(PEGylated, long-chain SPDP crosslinker), 0-[N-(3-
Maleimidopropionyl)aminoethyl]-0'-[3-(TSr-succinimidyloxy)-
3 -oxopropyl]tri ethylene glycol, 0-[N-(3-
Maleimidopropionyl)aminoethyl]-0'-[3-(TSr-succinimidyloxy)-
3-oxopropyl]heptacosaethylene glycol, Maleimidoacetic acid
N-hydroxysuccinimide ester, Maleimide-PEG8-succinimidyl ester, Maleimide-PEG6-succinimidyl ester, Maleimide-PEG2- succinimidyl ester, Maleimide-PEG12-succinimidyl ester, LC-
SPDP (succinimidyl 6-[3(2- pyri dyl dithi o)propi onami do]hexanoate), LC- SMC C
(succinimidyl -4-(N-maleimidomethyl)cyclohexane- 1 - carboxy-(6-amidocaproate)), Iodoacetic acid N- hydroxysuccinimide ester, Bromoacetic acid N- hydroxysuccinimide ester, 6-Maleimidohexanoic acid N- hydroxysuccinimide ester, 4-Maleimidobutyric acid N- hydroxysuccinimide ester , 4-(4-Maleimidophenyl)butyric acid N-hydroxysuccinimide ester, 3-Maleimidopropionic acid
N-hydroxysuccinimide ester, 3-(2-Pyridyldithio)propionic acid N-hydroxysuccinimide ester, and the like.
Carboxyl-to-amine Carbodiimide Isocyanate and (maleimide, haloacetyl, pyridyldi thiol,
Hydroxyl-to-sulfhydryl vinylsulfone, or alkene with radical)
Figure imgf000027_0001
In alternative embodiments, the attachment of the processivity factor to the template independent polymerase is facilitated by a non-covalent interaction. Non-covalent attachment may be facilitated by intrinsic binding affinity between the processivity factor and the template independent DNA polymerase. As used herein, "contact" in reference to weak non-covalent chemical interactions, such as van der Waal forces, hydrogen bonding, base-stacking interactions, ionic and hydrophobic interactions, and the like, dominate the interaction of the molecules.
Non-covalent attachment may also be facilitated by addition of a protein binding domain with high affinity to the complement domain, for example by protein fusion of a processivity factor binding domain to a template independent DNA polymerase, or by fusion of a template independent DNA polymerase binding domain to a processivity factor. As used herein, "binding domain" may comprise of the following classes of protein binders. Protein Scaffold
Binder
Antibody Fv Domain from IgG
Single-chain Fv Domain from IgG
variable fragment
Single Variable domain from IgG of the Camelid Family, Variable Domain Antibody domain from IgG Heavy chain in Carteleginic Fish
Affibodies Z domain of Protein A
Affilins Gamma-B crystalline, Ubiquitin
Affimers Cystatin
Affitins Sac7d (from Sulfolobus acidocaldarius)
Alphabodies Triple helix coiled coil
Anticalins Lipocalins
Avimers A domains of various membrane receptors
DARPins Ankyrin repeat motif
Fynomers SH3 domain of Fyn
Monobodies 10th type III domain of fibronectin
Non-covalent attachment may also be facilitated by protein fusion of interacting protein binding domains with mutual affinity to the processivity factor, and template independent DNA polymerase. In an additional aspect, a polymerase binding domain is attached to a processivity factor. In an additional aspect, a processivity binding domain is attached to a polymerase. As used herein, "binding domain" may comprise of synthetic coiled-coil domains or classes of mutually interacting proteins.
Non-covalent attachment may also be facilitated by colocalized attachment of both a Templated independent DNA polymerase and a processivity factor to a common surface or support. The term "colocalized" as used in reference to proteins, is defined to mean that two proteins are within a mutual radius of gyration from their respective surface attachment positions. In this embodiment, "colocalization" will mean the optimal spacing and orientation of processivity factor and polymerase to confer maximum stability of bound substrate by the polymerase.
The processivity factor may be comprised of more than 1 subunit, in which case, it is advantageous to construct a protein fusion comprised of the required subunits as a single multidomain protein. Monomelic proteins greatly simplify purification and design of functional complexes in protein engineering, however they are not required to ensure the functionality of a system processivity factors and template independent DNA polymerases.
Supports and Attachment
In certain exemplary embodiments, one or more oligonucleotide sequences, such as substrates or primers as described herein may be immobilized on a support (e.g., a solid and/or semi-solid support). Alternatively, polymerases and processivity factors as described herein may be attached to a support. In certain aspects, an oligonucleotide sequence can be attached to a support using one or more of the phosphoramidite linkers described herein. Polypeptide sequences may also be bound to substrates using methods and linkers (cleavable or non cleavable) and chemistry known to those of skill in the art. Suitable supports include, but are not limited to, slides, beads, chips, particles, strands, gels, sheets, tubing, spheres, containers, capillaries, pads, slices, films, plates and the like. In various embodiments, a solid support may be biological, nonbiological, organic, inorganic, or any combination thereof. Supports of the present invention can be any shape, size, or geometry as desired. For example, the support may be square, rectangular, round, flat, planar, circular, tubular, spherical, and the like. When using a support that is substantially planar, the support may be physically separated into regions, for example, with trenches, grooves, wells, or chemical barriers (e.g., hydrophobic coatings, etc.). Supports may be made from glass (silicon dioxide), metal, ceramic, polymer or other materials known to those of skill in the art. Supports may be a solid, semi-solid, elastomer or gel.
Reagent Delivery Systems
According to certain aspects, reagents and washes are delivered at a desired location for a desired period of time to, for example, covalently attached dNTP to an initiator sequence or an existing nucleotide attached at the desired location using a template-independent polymerase as is known in the art. A selected nucleotide reagent liquid is deposited at the reaction site in the presence of a substrate as describe herein, one or more cations as described herein, a template-independent polymerase and a processivity factor as described herein where reaction takes place to add the dNTP to the substrate and then may be optionally followed by delivery of a buffer or wash that does not include the nucleotide. Suitable delivery systems include fluidics systems, microfluidics systems, syringe systems, ink jet systems, pipette systems and other fluid delivery systems known to those of skill in the art. Various flow cell embodiments or flow channel embodiments or microfluidic channel embodiments are envisioned which can deliver separate reagents or a mixture of reagents or washes using pumps or electrodes or other methods known to those of skill in the art of moving fluids through channels or microfluidic channels through one or more channels to a reaction region or vessel where the surface of the substrate is positioned so that the reagents can contact the desired location where a nucleotide is to be added.
According to another embodiment, a microfluidic device is provided with one or more reservoirs which include one or more reagents which are then transferred via microchannels to a reaction zone where the reagents are mixed and the reaction occurs. Such microfluidic devices and the methods of moving fluid reagents through such microfluidic devices are known to those of skill in the art.
Protein Expression
The terms 'expression' or simply 'protein expression', refer to the generation of a recombinant protein product of interest in excess. Methods of protein expression are well known in the art (See, e.g., Protein production and purification, Nat Methods., 2008, 5(2): 135— 146, doi: 10.1038/nmeth.f.202/, hereby incorporated by reference in its entirety). Commonly, a bacterial host is employed, such as Esherchia coli BL21(DE3 strains). Alternatively the host may be eukaryotic, for example, the yeasts Pichia pastoris described in (Mewes Boettner, et al., High-throughput screening for expression of heterologous proteins in the yeast Pichia pastoris, Journal of Biotechnology, 2002, Volume 99, Issue 1, Pages 51-62, DOI: http://dx.doi.org/10.1016/S0168-1656(02)00157-8, hereby incorporated by reference in its entirety) and Saccharomyces cerevisiae described in (Caterina Holz, et al., A micro-scale process for high-throughput expression of cDNAs in the yeast Saccharomyces cerevisiae, Protein Expression and Purification, 2002, Volume 25, Issue 3, Pages 372-378, DOI: http://dx.doi.org/10.1016/S1046-5928(02)00029-3, hereby incorporated by reference in its entirety), human cells (A. R. Aricescu, W. Lu and E. Y. Jones, A time- and cost-efficient system for high-level protein production in mammalian cells, Acta Cryst, (2006), D62, 1243-1250, DOI: https://doi.org/10.1107/S0907444906029799, hereby incorporated by reference in its entirety), or cell-free systems using prokaryotic (Corinna Tuckey, et al., UNIT 16.31 Protein Synthesis Using a Reconstituted Cell-Free System, Current Protocols in Molecular Biology, 2014, DOI: 10.1002/0471142727.mbl631sl08, hereby incorporated by reference in its entirety) or eukaryotic extracts.
Protein Purification
The terms "protein purification", when used herein in reference to polypeptides, attached polypeptides, or proteins is defined as a process separation of a subset of molecules from a mixture of molecules. Protein purification methods are well known in the art. See, e.g., R. K. Scopes, Protein Purification: Principles and Practice (Springer Advanced Texts in Chemistry), Springer, 1994, hereby incorporated by reference in its entirety. Exemplary processes of protein purification include affinity chromatography, size exclusion chromatography, ion exchange chromatography and the like. In purifications involving affinity chromatography, it is common to use a resin, comprising of functional moieties with selective affinity to a protein affinity tag.
As used herein, the terms 'protein affinity tag', or simply 'protein tag' are defined as a polypeptide sequences introduced at the terminal ends of a protein or internal to the protein sequence which confers additional affinity to a substrate. Protein affinity tags and their use are known to those of skill in the art, see, e.g., Fujita-Yamaguchi Yoko, Affinity Chromatography of Native and Recombinant Proteins from Receptors for Insulin and IGF -I to Recombinant Single Chain Antibodies, Frontiers in Endocrinology, 2015, Vol. 6, pages 166, DOI: 10.3389/fendo.2015.00166, hereby incorporated by reference in its entirety. Common exemplary protein affinity tags include His-tags, comprised of 5-10 histidines that bind nickel or cobalt chelate, or Glutathione-S-transferase (GST) tags, a protein which binds to immobilized glutathione. In certain application of affinity purification proteins containing affinity tags may be eluted from the resin by competitive binding of a ligand, for example imidazole for release of His-tagged proteins from Ni(II)-nitrilotriacetic acid (Ni-NTA) resins. In other applications of protein purification, the protein may be cleaved from the resin by cleavage of a terminal protein tag. For example, it is common to introduce a protease recognition sequence such as a TEV protease recognition sequence between the protein and a terminal affinity tag such as GST tag to enable protease cleavage of protein from the GST resin.
Template Independent DNA Polymerase Functional Assay
The terms "enzymatic activity" or "enzyme kinetics" are used herein to describe a protein' s ability to catalyze a chemical reaction and is defined by a standardized unit of measure which is based on the rate at which reaction products are formed or the rate in which a reaction is completed. This rate is commonly defined as a "rate unit", which is further defined by the amount of protein needed to efficiently catalyze a reaction in order to accomplish its intended function over a period of time under a predefined set of reaction conditions (See, e.g., Berg, Jeremy M., John L. Tymoczko, and Lubert Stryer. Biochemistry. New York: W.H. Freeman, 2002, hereby incorporated by reference in its entirety). For example, the rate unit of template independent polymerases such as a TdT could be described by the amount of protein that is needed to catalyze the incorporation of a certain concentration of natural or non-natural nucleotides into a single-stranded polynucleotide sequence using an initiator strand that exists in-solution or bound to a surface. The term "kinetic assay" and "activity screen" is used herein to describe an experimental procedure or set of procedures that has the ability to evaluate the enzymatic activity and enzyme kinetics of a protein. The terms "multiplex" and "high- throughput" are used to describe the parallelizable nature of a kinetic assay by having the ability to determine the individual enzymatic activity of less than, equal to or greater than 96 protein variants and/or reaction conditions in a single experiment. In an exemplary multiplex kinetic assay, the activity of multiple purified template independent DNA polymerase variants or complexes can be determined by the rate at which long single-stranded polynucleotide sequences are produced by measuring the fluorescent response in Relative Fluorescence Units (RFU) of a nucleic acid stain that is highly specific for single-stranded DNA. The accuracy of the kinetic assay is characterized by a minimal observable fluorescent response if double stranded DNA contaminants are present in the reaction vessel or if single-stranded polynucleotide sequences form unintended secondary structures such as hairpins, stem-loop structures or G-quadraplexes and the like. Terminal deoxynucleotidyl transferase activity is only present if an observable increase in fluorescent signal occurs in comparison to a negative control consisting of only initiator strand, free nucleotides, cofactor and appropriate buffers. In addition, a positive control consisting of commercially available terminal transferase, such as bovine terminal deoxynucleotidyl transferase (New England Biolabs, Inc.) may also be used to relatively gauge the activity of purified template independent DNA polymerase variants or complexes. Single stranded nucleic acid fluorescent stains suitable for kinetic assays are known to those of skill in the art and are described in (ThermoFisher Scientific Inc., The Molecular Probes Handbook, Nucleic Acid Detection and Analysis— Chapter 8, Nucleic Acid Stains— Section 8.1, hereby incorporated by reference in its entirety).
To further quantitate the rate unit of each individual purified template independent DNA polymerase variants, a concentration curve consisting of a single polynucleotide sequence greater than 10 nucleotides can be generated to yield a set of standardized fluorescent signals. Because the fluorescent response in the presence of TdT activity is directly correlated to the amount of single stranded polynucleotide present at a given reaction time interval, the exact amount of polynucleotide in terms of mass can be interpolated from the concentration versus RFU curve and tracked throughout the progression of the reaction. This produces a rate unit for a particular amount of protein in terms of "mass increase in single-stranded polynucleotide per minute". The rate unit for this kinetic assay can be further quantitated given additional reaction parameters such as free nucleotide composition, cofactors, and initiator sequence composition as well as each component' s respective concentration. This kinetic assay provides a highly accurate and standardized method to specifically determine the best- candidate TdT variants or complex in a cost-efficient and high-throughput activity screen.
Processivity Factor Functional Assay
A processivity factor can be functionally assessed for DNA binding activity by methods known to those of skill in the art. In an exemplary assay, termed DNAse footprinting, individual purified processivity factors and their cognate ssDNA or dsDNA are incubated together at physiological conditions and subsequently processed by a nuclease, for example a DNA endonuclease and/or a DNA exonuclease. Functional processivity factor DNA binding is indicated by an upward, higher molecular weight band shift of the DNA substrate incubated with processivity factor as compared to a control or reference sample under electrophoretic separation. In certain aspects of DNAse footprinting, the negative control sample is a nuclease incubation of substrate DNA where no processivity factor is present. In other aspects of DNAse footprinting, a reference sample is where DNA substrate is used as is with processing. Further aspects of DNAse footprinting known in the art are described in Michael Brenowitz, et al., UNIT 12.4, DNase I Footprint Analysis of Protein-DNA Binding, Current Protocols in Molecular Biology, 2001, DOI: 10.1002/0471142727.mbl204s07, hereby incorporated by reference in its entirety.
Processivity Assay Methods for determining processivity of DNA polymerases are also known in the art. Processivity assays can assess the extent of processive ssDNA primer extension by processive template independent DNA polymerase variants or complexes. In an exemplary method, template independent DNA polymerase processivity is determined on ssDNA substrate by allowing the polymerase to extend the ssDNA for an initial period followed by the addition of a greater than 100-fold excess of dideoxy ssDNA which sequesters the polymerase if it dissociates from the initial ssDNA during the reaction. Alternative methods have been described in the art. See Tatiana Kent, et al., Polymerase Θ is a robust terminal transferase that oscillates between three different mechanisms during end-joining, eLife 2016;5:el3740, DOI: http://dx.doi.org/10.7554/eLife.13740, hereby incorporated by reference in its entirety.
The following examples are set forth as being representative of the present disclosure. These examples are not to be construed as limiting the scope of the present disclosure as these and other equivalent embodiments will be apparent in view of the present disclosure, figures and accompanying claims.
EXAMPLE I
A template independent DNA polymerase derived from Mus Muluscus terminal deoxynucleotidyl transferase, (mTdT) is covalently attached to a monomeric single stranded binding protein, derived from Escherichia coli (mEcSSB). This mTdT is mTdT 388 which is truncated and lacks the BRCTl domain common to many Family X polymerases and has been shown to be not critical to retaining terminal transferase activity. Additionally, the removal of this domain could additivity improve enzyme functionality and processivity with the attachment of the single stranded binding protein. Template-independent DNA polymerases derived from other mammalian or non-mammalian species could be also acceptable for attachment to the single-stranded binding protein. Template-independent DNA polymerases could also be the full-length wild-type enzyme.
A monomelic E coli SSB (mEcSSB) was previously generated and characterized for functional studies in vivo and in vitro (See, Edwin Antony, et al., Multiple C-Terminal Tails within a Single E. coli SSB Homotetramer Coordinate DNA Replication and Repair, Journal of Molecular Biology, 2013, Volume 425, Issue 23, Pages 4802-4819, DOI: http://dx.doi.org/10.1016/j jmb.2013.08.021, hereby incorporated by reference in its entirety).
At ion concentrations optimal for catalytic activity of mTdT and other template independent DNA polymerases, the ssDNA binding footprint of mEcSSB is 65 nucleotides in length and has a measured Kd of less than 1 picomolar. mEcSSB is an exemplary processivity domain for template independent extension of ssDNA because it permits active translocation of ssDNA about the SSB by a reptation mechanism, ensuring continuous contact with ssDNA product while tethered to an active DNA polymerase. Further, mEcSSB permits exceptionally high affinity to ssDNA such that dissociation of ssDNA from the template independent DNA polymerase is negligible, or nonexistent.
In one embodiment, the method of attachment of the DNA polymerase to the SSB is by sulfhydryl crosslinking. In another embodiment, monovalent cysteine conjugation of the SSB and DNA polymerase is ensured by engineering each protein to contain at most one surface accessible cysteine each.
In an exemplary cysteine modified mEcSSB, a solvent accessible 'GGSC sequence is introduced at the C-terminal tail. In further embodiments, an N-terminal Tev cleavable GST tag is added to the mEcSSB to support affinity purification. In additional exemplary embodiments, the GST-tag mEcSSB is modified by the following mutations (C85S, C138S, C169S, C178S) to remove all cysteines. In an exemplary cysteine modified mTdT, all 7 native cysteine side chains in the short murine TdT (mTdT) 388 amino acid isoform (coordinates reference PDB ID:4I27) were replaced by non-cysteine residues. In further embodiments, the mTdT may contain an N- terminal His-tag for purification. In further embodiments of the mutant mTdT, the following mutations can be selected for cysteine knockout mutagenesis (C155A, C188A, C216N, C302A, C378G, C404A, and C438A). In other embodiments of mTdT388 cysteine knockout, additional cysteine knockout mutations were proposed as suitable alternatives to the exemplary set of mutations. In further embodiments, the following mutations may be used in various combinations for each cysteine position (C155A, C155S, C188A, C188G, C216A, C216D, C216G, C216N, C302A, C302G, C302P, C378A, C378G, C404A, C404S, C438A, and C438V). In further embodiments of mTdT388 cysteine knockout, the mutant may contain one of the following exemplary combinations of mutations: (C155A, C188A, C216N, C302P, C378A, C400A, C434A), (C155A, C188A, C216N, C302L, C378G, C400A, C434A), (C155A, C188M, C216N, C302L, C378G, C400A, C434A), (C155A, C188A, C216N, C302P, C378G, C400A, C434A), (C155A, C188A, C216N, C302M, C378G, C400A, C434A), (C155A, C188M, C216N, C302P, C378G, C400A, C434A).
In other aspects of cysteine engineered mTdT388, a single cysteine residue is reintroduced at a surface accessible region proximal to the primer binding site of the enzyme. In further aspects, cysteines may be introduced at positions that are proximal to the primer binding site, which include but are not limited to the following positions: (265,268,284,287), or certain other residues in the range of 260-280.
An exemplary mEcSSB sequence:
GST-TEV-mECSSB-MonoCys (SEQ ID NO. 1)
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPY YIDGDVKLTQSMAIIRYIADKHNMLGGSPKERAEISMLEGAVLDIRYGVSRIAYSKDF ETLKVDFLSKLPEMLKMFEDRLSHKTYLNGDHVTHPDFMLYDALDVVLYMDPMSL
DAFPKLVSFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPE
FPGRLERPHRDGGGSE LYFQGSGGASRGV KVILVG LGQDPEVRYMPNGGAVA
NITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTR
KWTDQSGQDRYTTEVVVNVGGTMQMLQLGTQPELIQDAGGGVRMSGAGTASRGV KVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLF
GKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLASH
MASRGVNKVILVG LGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEW
HRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEWVNVGGTM
QMLQLGTQPELIQDAGGGVRMSGAGTASRGV KVILVGNLGQDPEVRYMPNGGAV
ANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRT
RKWTDQSGQDRYTTEVVVNVGGTMQMLGGSC*
An exemplary mTdT sequence without cysteine:
6xHis-mTdT388 NoCys (SEQ ID NO. 2)
MGS SHHHHHHS SGLVPRGSHMSPSPVPGSQNVPAP AVKKISQ YAAQRRTTLNNYNQ
LFTDALDILAENDELRENEGSALAFMRASSVLKSLPFPITSMKDTEGIPNLGDKVKSII
EGIIEDGE S SEAK A VENDER YK SFKLF T S VF GVGLKT AEKWFRMGFRTLSKIQ SDK SL
RFTQMQKAGFLYYEDLVSAVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGK
MTGHDVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYGDILESTFEKFKQPSRKV
DALDHFQKAFLILKLDHGRVHSEKSGQQEGKGWKAIRVDLVMAPYDRRAFALLGW
TGSRQFERDLRRYATHERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWE
RNA*
Production of Template Independent DNA Polymerase-SSB Complex This disclosure provides supporting methods for production of processive template independent DNA Polymerase variants, macromolecules or complexes. In an exemplary embodiment, the SSB is mEcSSB and the template independent DNA polymerase is mTdT.
In an exemplary attachment and purification procedure, the method of attachment involves covalent crosslinking of the template independent DNA polymerase and the SSB protein. In an exemplary production process, both proteins contain a unique purification tag, for example, His-tag and GST-tag respectively, and the proteins are purified by affinity purification prior to crosslinking.
In an exemplary process, the crosslinking reaction is prepared by mixing the purified SSB and template independent DNA polymerase in an equimolar ratio in the presence of excess crosslinking reagent. In an exemplary embodiment, the crosslinking agent is a bifunctional crosslinker, for example, a homobifunctional crosslinker, or a heterobifunctional crosslinker. Preferably, the bifunctional crosslinker is a homobifunctional maleimide crosslinker, for example, bismaleimidoethane, 1,4-bismaleimidobutane, bismaleimidohexane, 1,8- bismaleimido-diethyleneglycol, 1, 11-bismaleimido-triethyleneglycol, and the like. Methods for covalent chemical conjugation to proteins are known to those of skill in the art (See, e.g., Hermanson, G. T. (2013). Bioconjugate Techniques. Academic Press, hereby incorporated by reference in its entirety). In an exemplary maleimide crosslinking reaction, a 2-3 fold molar excess of crosslinker to protein target is sufficient, although other molar ratios may be used. In other aspects of maleimide crosslinking, the concentration of protein in the reaction is preferably in the range of O. lmM, although other conditions are permissible. In other embodiments of maleimide crosslinking, the reaction proceeds for 2 hours at 4°C in a sulfhydryl-free buffering media, such as phosphate buffered saline at pH 6.5-7.5.
After the crosslinking reaction is completed, the crosslinker is quenched. In an exemplary process of maleimide crosslinking, the quenching reagent can be cysteine, DTT, or other thiol-containing reducing agent, added at 100-500 fold molar excess at final concentration, for example, lOmM to 50mM. In other embodiments, the maleimide reaction quenching may proceed for 15 minutes at room temperature, however alternative conditions may be used.
After a crosslinking reaction is quenched, the crosslinked S SB-template independent DNA polymerase product can be purified by several methods. In an exemplary purification process, the method of purification occurs in two steps. In the first step of an exemplary purification process, the quenched, crosslinked product is initially affinity purified by the SSB affinity tag, for example, on GST column if the SSB is GST tagged. In the second step of an exemplary purification process, the SSB elution product is purified on an affinity column selective to the template independent DNA polymerase affinity Tag. For example, if the template independent DNA polymerase contains a His-tag, then concentrated GST tagged elution product may be purified on a His-tag selective Ni-NTA column. In further exemplary embodiments of a purification process, the elution of the captured template independent DNA polymerase complex product from the affinity column can be dialyzed, which should be sufficiently pure for use.
In certain embodiments of affinity chromatography, it may be advantageous to remove large affinity tags before or during protein purification. For example, it can be advantageous to remove GST tags from proteins of interest, prior to use. In such cases, a protease recognition sequence may be introduced between the protein and affinity tag. In an exemplary process, a GST-TEV tag is removed from a template independent DNA binding protein, by on column protease cleavage as the first or second step of purification.
Alternatively, other purification processes may be suitable to purify the quenched crosslinked protein complexes products. In an exemplary process, provided that there is a large molecular difference between the sum of the proteins of the complex, and the individual proteins, size exclusion membranes or columns can be used.
Material and Methods
Protein Expression
Gene blocks comprising the His-tagged mutant murine terminal nucleotidyl transferase (mTDT) gene sequences were ordered and shipped from Integrated DNA Technologies, Inc. Sequences were then inserted into the commercially available pET28b bacterial expression plasmid using a Gibson Assembly master mix (New England Biolabs). A reaction containing 0.125 pmol of expression plasmid and 0.375 pmol of mTDT insert sequence was incubated at 50°C for 2 hours and then placed on ice for subsequent transformation into T7 Express Chemically Competent E. coli (New England Biolabs).
A vial containing 50 μΐ. of chemically competent bacteria was transformed using approximately 50 ng of the fully assembled expression plasmid directly from the Gibson Assembly reaction tube following the protocol outlined by the manufacturer. Briefly, plasmid and chemically competent cells were incubated on ice for 30 minutes without mixing and then heat shocked at 42°C for 30 seconds. The cells were then placed on ice for another 5 minutes and 950 μΐ. of SOC media was added to the vial before shaking at 200 RPM for 1 hour at 37°C. Transformed cells were selected for using LB-Kanamycin agar plates with an antibiotic concentration of 50 μg/mL.
The plates were incubated overnight at 37°C and the resulting colonies were picked for Sanger Sequencing in order to verify that the insert sequence for the His-tagged mutant mTDT was correct (Genewiz, Inc). Colonies that contained perfect copies of the insert sequences were used to inoculate 2 mL of LB-Kanamycin media and were incubated at 37°C overnight shaking at 200 RPM. The resulting cell suspension was diluted 1 :400 in flasks containing 30 mL of fresh LB-Kanamycin media and allowed to reach OD 0.6 (600 nm) while incubating at 37°C shaking at 200 RPM for approximately 2-3 hours. Expression of the His-tagged mTDT protein was induced by adding Isopropyl β-D-l-thiogalactopyranoside (TPTG) (Sigma) to the cell suspension at a concentration of 1 mM. Flasks were then incubated at 15°C while shaking at 200 RPM overnight.
Protein Purification
The His-tagged mutant mTDT produced by the induced bacterial cell suspension was purified with immobilized metal affinity chromatography using a Clontech HisTalon Gravity Column Kit as per manufacturer's instructions (Takara Bio USA). Briefly, cell suspensions were pelleted after spinning samples at 3000 x G for 30 minutes at 4°C. Pellets were then lysed using buffers provided by the HisTalon Kit and incubated with beads containing the metal affinity resin at 4°C in the presence of protease inhibitor. His-tagged mTDT was eluted from beads and elution fractions were concentrated using 3 OK MWCO centrifuge filter (EMD Millipore) spun at 5000 x G for 30 minutes. The elution buffer was exchanged with lx Terminal Transferase storage buffer as per recommendation from NEB (50 mM ΚΡ04, 100 mM NaCl, 1.43 β-ΜΕ, 50% Glycerol, 0.1% Triton X-100, pH 7.3 at 25°C). The concentration of the resultant purified His-tagged mTDT protein was determined colorimetrically with a Reducing Agent Compatible micro BCA kit (Thermo Scientific) and the efficiency of the purification was accessed with denaturing Tris-Glycine gel electrophoresis visualized by Coomassie Orange Flour stain (Thermo Scientific).
Enzymatic Activity Assay
The activity of the purified His-tagged mTDT protein was accessed by its ability to produce single stranded DNA (ssDNA) and extend an initiator 20-mer oligonucleotide in the presence of a single nucleotide or mixture of different nucleotides. Extension reactions were supplemented with lx Terminal Transferase Buffer (50 mM Potassium Acetate, 20 mM Tris- Acetate, 10 mM Magnesium Acetate, pH 7.9 at 25°C), 0.25 mM CoCl2, and lx GelStar ssDNA SYBR Dye (Lonza), 5 pmol of Cy3-labeled initiator oligonucleotide and 5000 pmol of dNTPs. 100 ng of purified His-Tagged mTDT was then added to catalyze the extension reaction.
Extension reactions were incubated at 37°C and monitored on a Biorad CFX96 Touch Real Time PCR Detection System scanning the relative fluorescence units in the SYBR Green channel every 1 minutes. Extension reactions reached completion after approximately 60 to 90 minutes after all nucleotides are depleted. ssDNA extension products were evaluated using denaturing TBE-Urea gel electrophoresis and further visualized on Typhoon FLA Biomolecular Imager (GE Heathcare) in the Cy3 channel.
EXAMPLE II
Aspects of the present disclosure are directed to mutant TdT which exhibits enhanced or increased or improved or raised processivity as described herein. According to one aspect a mutant human TdT is described where alanine is present at position 454 instead of arginine. Arginine is naturally present at position 454 in human TdT. Accordingly, mutant R454A hTdT is provided.
Site directed mutagenesis from arginine to alanine at position 454 (R454A) was performed on a wild-type (WT) human TdT to determine if a mutation to a highly conserved amino acid residue within the catalytic pocket would produce a functional enzyme. According to one aspect, one or more mutations are made within the catalytic pocket and the resulting mutant is a functional TdT enzyme. According to one aspect, the one or more mutations within the catalytic pocket enhance, increase or improve or raise the processivity of wild-type Terminal deoxynucleotidyl Transferases. According to one aspect, the one or more mutations includes R454A. After His-tag purification, WT and R454A hTdT were screened for enzymatic activity with various divalent cations at different concentrations in order to determine the optimal reaction conditions. Combinations of divalent cations such as Mn2+ and Co2+, were at a 1 : 1 ratio for the indicated concentration (0.25 mM - 2 mM). A poly-dT (18) initiator oligonucleotide was used at 10 pmol and dATP was supplemented into the reaction at 100 uM. As shown in Fig. 5 A, the overall rates of enzyme activity are plotted for the WT hTdT. As shown in Fig. 5B, the overall rates of enzyme activity are plotted for hTdT R454A. These rates were dervived from the RFU for ssDNA production measured in real time over 30 minutes as shown in Fig. 5C for WT hTdT and Fig. 5D hTdT R454A (Note: only Mn2+, Mg2+, and Co2+ are shown for simplicity). As shown in Fig. 5E, the average rate of ssDNA production for all divalent cation concentrations were compared for Mn2+, Mg2+, and Co2+ between the WT hTdT and hTDT454A.
EXAMPLE III
Material and Methods
General Protein Expression
The primary sequences of wild-type or mutant enzymes of interest such as mTdT 388 and WT hTdT were codon optimized for an E. coli expression system using a custom optimization algorithm and ordered as gBlocks® (Integrated DNA Technologies). Sequences were then inserted into the commercially available pET-28-c-(+) His-tag expression vector (EMD Millipore) using a Gibson Assembly master mix (New England Biolabs). A reaction containing 0.125 pmol of expression plasmid and 0.375 pmol of the gBlock® insert sequence was incubated at 50°C for 2 hours and then transformed into T7 Express Chemically Competent E. coli (New England Biolabs). A vial containing 50 μΙ_, of chemically competent bacteria was transformed using approximately 50 ng of the fully assembled expression plasmid directly from the Gibson Assembly reaction tube following the protocol outlined by the manufacturer. Briefly, plasmid and chemically competent cells were incubated on ice for 30 minutes without mixing and then heat shocked at 42°C for 30 seconds. The cells were then placed on ice for another 5 minutes and 950 μΐ^ of SOC media was added to the vial before shaking at 200 RPM for 1 hour at 37°C. Transformed cells were selected for using LB-Kanamycin agar plates with an antibiotic concentration of 50 μg/mL.
The plates were incubated overnight at 37°C and the resulting colonies were picked for Sanger Sequencing in order to verify that the insert sequence for the His-tag enzyme of interest was correct (Genewiz, Inc). Colonies that contained perfect copies of the insert sequences were used to inoculate 2 mL of LB-Kanamycin media and were incubated at 37°C overnight shaking at 200 RPM. The resulting cell suspension was diluted 1 :400 in flasks containing 30 mL of fresh LB-Kanamycin media and allowed to reach OD 0.6 (600 nm) while incubating at 37°C shaking at 200 RPM for approximately 2-3 hours. Expression of the His-tag enzyme of interest was induced by adding Isopropyl β-D-l-thiogalactopyranoside (TPTG) (Sigma) to the cell suspension at a concentration of 1 mM. Flasks were then incubated at 15°C while shaking at 200 RPM overnight.
General Protein Purification
The His-tag enzyme of interest produced by the induced bacterial cell suspension was purified with immobilized metal affinity chromatography using a Clontech HisTalon Gravity Column Kit as per manufacturer's instructions (Takara Bio USA). Briefly, cell suspensions were pelleted after spinning samples at 3000 x G for 30 minutes at 4°C. Pellets were then lysed using buffers provided by the HisTalon Kit and incubated with beads containing the metal affinity resin at 4°C in the presence of protease inhibitor. His-tagged enzyme of interest was eluted from beads and elution fractions were concentrated using 3 OK MWCO centrifuge filter (EMD Millipore) spun at 5000 x G for 30 minutes. For Terminal deoxynucleotidyl Transferases, such as mTdT 388 and WT hTdT, the elution buffer was exchanged with lx Terminal Transferase storage buffer as per recommendation from NEB (50 mM KPC , 100 mM NaCl, 1.43 β-ΜΕ, 50% Glycerol, 0.1% Triton X-100, pH 7.3 at 25°C). The concentration of the resultant purified His-tagged enzyme of interest was determined colorimetrically with a Reducing Agent Compatible micro BCA kit (Thermo Scientific) and the efficiency of the purification was accessed with denaturing Tris-Glycine gel electrophoresis visualized by Coomassie Orange Flour stain (Thermo Scientific).
General Site Directed Mutagenesis
Plasmids carrying the target protein were harvested and purified from a sequence verified liquid bacterial cultures grown overnight in LB-kanamycin media at 37C using a MiniPrep Kit (Qiagen). Oligonucleotide primers were ordered from IDT and were designed to PCR amplify the protein expression plasmid while simultaneously mutagenizing the plasmid at the predetermined location, yielding linearized DNA. Using the reagents from the Q5 Site- Directed Mutagenesis Kit (NEB), the protein expression plasmid was PCR amplified using the Q5 Hot Start High-Fidelity 2x Master Mix with the following thermocycling conditions: initial denature for 98°C for 30 seconds, denature at 98°C for 10 seconds, anneal at 68°C for 10 seconds, and extend at 72°C for 120 seconds for 25 cycles before a final extension of 2 minutes at 72°C. 1 uL of the resulting PCR amplification reaction was then treated with the kit' s enzyme reaction cocktail to re-circularize the protein expression plasmid while digesting away the unsubstituted plasmid sequences remaining in the reaction mixture. After bacterial transformation and sequence verification, colonies with perfect sequence matches were used to express the site-directed mutant protein. Enzymatic Activity Assay (Terminal Transferase Kinetic Assay)
The enzymatic activity of purified mTdT 388 and WT hTdT was accessed by their ability to produce single stranded DNA (ssDNA) and extend an initiator 18-mer oligonucleotide in the presence of a single nucleotide or mixture of different nucleotides. Extension reactions were supplemented with lx Terminal Transferase Buffer (50 mM Potassium Acetate, 20 mM Tris-Acetate, 10 mM Magnesium Acetate, pH 7.9 at 25°C), 0.25 mM CoCb (or equivalent), and lx GelStar ssDNA SYBR Dye (Lonza), 10 pmol of Cy3-labeled initiator oligonucleotide and 100 uM of dNTPs. 1 uL of purified mTdT 388 or WT hTdT was then added to catalyze the extension reaction. Extension reactions were incubated at 37°C and monitored on a Biorad CFX96 Touch Real Time PCR Detection System scanning the relative fluorescence units in the SYBR Green channel every 1 minutes for 30 minutes. The ssDNA extension products from these reactions were evaluated using denaturing 15% TBE-Urea gel electrophoresis and visualized on Typhoon FLA Biomolecular Imager (GE Heathcare) in the Cy3 channel.

Claims

Claims:
1. An enzymatic method of making a polynucleotide comprising
combining a selected nucleotide triphosphate, one or more cations, a template- independent polymerase, and an associated processivity factor in an aqueous reaction medium including a target substrate comprising an initiator sequence and having a 3' terminal nucleotide attached to a single stranded portion, such that the template-independent polymerase and the associated processivity factor interact with the target substrate under conditions which covalently add one or more of the selected nucleotide triphosphate to the 3 ' terminal nucleotide.
2. The method of claim 1 further including
repeatedly introducing a subsequent selected nucleotide triphosphate to the aqueous reaction medium under conditions which enzymatically add one or more of the subsequent selected nucleotide triphosphate to the target substrate until the polynucleotide is formed.
3. The method of claim 1 wherein the processivity factor increases processivity of the template-independent polymerase.
4. The method of claim 1 wherein the processivity factor comprises one or more binding units.
5. The method of claim 1 wherein the processivity factor binds to and translocates across the target substrate.
6. The method of claim 1 wherein the processivity factor binds to and reptates across the target substrate.
7. The method of claim 1 wherein the processivity factor and the template- independent polymerase bind to the target substrate.
8. The method of claim 1 wherein the processivity factor and the template- independent polymerase bind to the target substrate with an affinity greater than the template- independent polymerase alone.
9. The method of claim 1 wherein the processivity factor and the template- independent polymerase comprise a fusion protein.
10. The method of claim 1 wherein the processivity factor is attached to the template-independent polymerase at a location on the template-independent polymerase which facilitates processing of the target substrate by the template-independent polymerase.
11. The method of claim 1 wherein the processivity factor is attached by a covalent or noncovalent bond to the template-independent polymerase at a location on the template- independent polymerase which facilitates processing of the target substrate by the template- independent polymerase.
12. The method of claim 1 wherein the processivity factor is attached to the template-independent polymerase through a linker at a location on the template-independent polymerase which facilitates processing of the target substrate by the template-independent polymerase.
13. The method of claim 1 wherein the processivity factor includes a polypeptide binding domain that binds to the template-independent polymerase.
14. The method of claim 1 wherein the template-independent polymerase includes a polypeptide binding domain that binds to the processivity factor.
15. The method of claim 1 wherein the template-independent polymerase and the processivity factor each include one member of a binding pair wherein the template- independent polymerase and the processivity factor are attached via the binding pair.
16. The method of claim 1 wherein the template-independent polymerase and the processivity factor are crosslinked via a crosslinker.
17. The method of claim 1 wherein the template-independent polymerase and the processivity factor are crosslinked via sulfhydryl crosslinking.
18. The method of claim 1 wherein the template-independent polymerase and the processivity factor are attached via protein conjugation.
19. The method of claim 1 wherein the template-independent polymerase and the processivity factor are immobilized relative to one another in an orientation which facilitates processing of the substrate by the template-independent polymerase.
20. The method of claim 1 wherein the template-independent polymerase and the processivity factor are immobilized relative to one another on a substrate in an orientation which facilitates processing of the substrate by the template-independent polymerase.
21. The method of claim 1 wherein the template-independent polymerase and the processivity factor are co-localized on a substrate in an orientation which facilitates processing of the substrate by the template-independent polymerase.
22. The method of claim 1 wherein the template-independent polymerase is a template-independent DNA or RNA polymerase.
23. The method of claim 1 wherein the template-independent polymerase is a template-independent DNA polymerase.
24. The method of claim 1 wherein the template-independent polymerase is a terminal deoxynucleotidyl transferase (TdT).
25. The method of claim 1 wherein the template-independent polymerase is a TdT of the polX family of DNA polymerases.
26. The method of claim 24 wherein the TdT a mammalian TdT.
27. The method of claim 24 wherein the TdT is a member of the archaeo- eukaryotic primase (AEP) superfamily.
28. The method of claim 24 wherein the TdT is a PolpTN2 or a C-terminal truncated PolpTN2, a PriS, a nonhomologous end joining archaeo-eukaryotic primase, a mammalian Ροΐθ, or a eukaryotic PrimPol.
29. The method of claim 1 wherein the template-independent polymerase is a mutant where one or more cysteine residues are replaced by one or more non-cysteine residues.
30. The method of claim 1 wherein the template-independent polymerase is a mutant where all naturally occurring cysteine residues are replaced by one or more non- cysteine residues.
31. The method of claim 1 wherein the template-independent polymerase is a mutant where all naturally occurring cysteine residues are replaced by one or more non- cysteine residues and a surface accessible cysteine residue is provided.
32. The method of claim 1 wherein the template-independent polymerase is a mutant where one or more non-cysteine residues are replaced by one or more cysteine residues.
33. The method of claim 1 wherein the template-independent polymerase is a mutant having one or more one surface accessible cysteine residues.
34. The method of claim 1 wherein the template-independent polymerase is a mutant having at most one surface accessible cysteine residue.
35. The method of claim 1 wherein the template-independent polymerase and the processivity factor each include a mutant surface accessible cysteine residue which connect the template-independent polymerase to the processivity factor.
36. The method of claim 1 wherein the processivity factor comprises a prokaryotic or eukaryotic single stranded DNA binding protein.
37. The method of claim 1 wherein the processivity factor comprises a prokaryotic single stranded DNA binding protein.
38. The method of claim 1 wherein the processivity factor comprises an E. coli single stranded DNA binding protein.
39. A mutant template-independent polymerase having one or more mutations from a cysteine residue to a non-cysteine residue.
40. A mutant template-independent polymerase having one or more mutations from a non-cysteine residue to a cysteine residue.
41. A mutant template-independent polymerase having one or more mutations from a non-cysteine residue to a surface accessible cysteine residue.
42. A mutant template-independent polymerase having a mutation from a non- cysteine residue to a surface accessible cysteine residue.
43. A mutant template-independent polymerase having a mutation from a non- cysteine residue to at most one surface accessible cysteine residue.
44. A macromolecule comprising a template-independent polymerase having a processivity factor attached thereto.
45. The macromolecule of claim 44 wherein the template-independent polymerase is a template-independent DNA or RNA polymerase.
46. The macromolecule of claim 44 wherein the template-independent polymerase is a template-independent DNA polymerase.
47. The macromolecule of claim 44 wherein the template-independent polymerase is a terminal deoxynucleotidyl transferase (TdT).
48. The macromolecule of claim 46 wherein the template-independent polymerase is a TdT of the polX family of DNA polymerases.
49. The macromolecule of claim 46 wherein the TdT a mammalian TdT.
50. The macromolecule of claim 46 wherein the TdT is a member of the archaeo- eukaryotic primase (AEP) superfamily.
51. The macromolecule of claim 46 wherein the TdT is a PolpTN2 or a C-terminal truncated PolpTN2, a PriS, a nonhomologous end joining archaeo-eukaryotic primase, a mammalian Ροΐθ, or a eukaryotic PrimPol.
52. The macromolecule of claim 44 wherein the template-independent polymerase is a mutant where one or more cysteine residues is replaced by a non-cysteine residue.
53. The macromolecule of claim 44 wherein the template-independent polymerase is a mutant where one or more non-cysteine residues is replaced by a cysteine residue.
54. The macromolecule of claim 44 wherein the template-independent polymerase is a mutant having one or more one surface accessible cysteine residues.
55. The macromolecule of claim 44 wherein the template-independent polymerase is a mutant having at most one surface accessible cysteine residue.
56. The macromolecule of claim 44 wherein the template-independent polymerase is attached to the processivity factor by a mutant surface accessible cysteine residue.
57. The macromolecule of claim 44 wherein the processivity factor comprises a prokaryotic or eukaryotic single stranded DNA binding protein.
58. The macromolecule of claim 44 wherein the processivity factor comprises a prokaryotic single stranded DNA binding protein.
59. The macromolecule of claim 44 wherein the processivity factor comprises an E. coli single stranded DNA binding protein.
60. The macromolecule of claim 44 wherein the template-independent polymerase and the processivity factor comprise a fusion protein.
61. The macromolecule of claim 60 wherein fusion protein comprises SEQ ID NO. 1 and SEQ ID NO. 2.
62. A system for making a polynucleotide comprising
a selected nucleotide triphosphate, one or more cations, a template-independent polymerase, and an associated processivity factor in an aqueous reaction medium including a target substrate comprising an initiator sequence and having a 3' terminal nucleotide attached to a single stranded portion.
PCT/US2017/064517 2016-12-02 2017-12-04 Processive template independent dna polymerase variants Ceased WO2018102818A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/465,816 US20190360013A1 (en) 2016-12-02 2017-12-04 Processive Template Independent DNA Polymerase Variants

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662429344P 2016-12-02 2016-12-02
US62/429,344 2016-12-02

Publications (1)

Publication Number Publication Date
WO2018102818A1 true WO2018102818A1 (en) 2018-06-07

Family

ID=62242724

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/064517 Ceased WO2018102818A1 (en) 2016-12-02 2017-12-04 Processive template independent dna polymerase variants

Country Status (2)

Country Link
US (1) US20190360013A1 (en)
WO (1) WO2018102818A1 (en)

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019135007A1 (en) * 2018-01-08 2019-07-11 Dna Script Variants of terminal deoxynucleotidyl transferase and uses thereof
WO2020072715A1 (en) * 2018-10-04 2020-04-09 President And Fellows Of Harvard College Compositions and methods comprising mutants of terminal deoxynucleotidyl transferase
WO2020081985A1 (en) * 2018-10-19 2020-04-23 Molecular Assemblies, Inc. Modified template-independent enzymes for polydeoxynucleotide synthesis
US10760063B2 (en) 2014-10-20 2020-09-01 Molecular Assemblies, Inc. Modified template-independent enzymes for polydeoxynucleotide synthesis
EP3744854A1 (en) * 2019-05-28 2020-12-02 DNA Script Variants of terminal deoxynucleotidyl transferase and uses thereof
WO2020239737A1 (en) * 2019-05-28 2020-12-03 Dna Script Variants of terminal deoxynucleotidyl transferase and uses thereof.
US20220081714A1 (en) * 2019-01-04 2022-03-17 Northwestern University Storing temporal data into dna
WO2022063835A1 (en) * 2020-09-22 2022-03-31 Dna Script Stabilized n-terminally truncated terminal deoxynucleotidyl transferase variants and uses thereof
US11390858B2 (en) 2014-10-20 2022-07-19 Molecular Assemblies, Inc. Modified template-independent enzymes for polydeoxynucleotide synthesis
WO2023111180A1 (en) * 2021-12-15 2023-06-22 Quantoom Biosciences France Sas Variants of thermostable dna primases and uses thereof
CN118256467A (en) * 2024-03-22 2024-06-28 上海交通大学 Terminal deoxynucleotidyl transferase variants, nucleic acids and applications
US12071638B2 (en) 2018-01-08 2024-08-27 Dna Script Variants of terminal deoxynucleotidyl transferase and uses thereof

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11773422B2 (en) 2019-08-16 2023-10-03 Microsoft Technology Licensing, Llc Regulation of polymerase using cofactor oxidation states
US11795450B2 (en) 2019-09-06 2023-10-24 Microsoft Technology Licensing, Llc Array-based enzymatic oligonucleotide synthesis
US11702683B2 (en) * 2020-05-28 2023-07-18 Microsoft Technology Licensing, Llc De novo polynucleotide synthesis with substrate-bound polymerase
US20230235373A1 (en) * 2020-06-12 2023-07-27 Synhelix Controlled template-independent synthesis of nucleic acids using thermostable enzymes
CN116249782A (en) * 2020-06-12 2023-06-09 辛希克斯 De novo template-independent nucleic acid synthesis using thermostable enzymes
US12344876B2 (en) 2020-10-30 2025-07-01 Microsoft Technology Licensing, Llc Spatially addressable control of polymerase activity
US12391970B2 (en) 2020-11-11 2025-08-19 Microsoft Technology Licensing, Llc Spatial control of polynucleotide synthesis by strand capping
CN114196714B (en) * 2021-11-04 2023-09-29 华南理工大学 Template-free synthesis of oligonucleotide chains containing non-natural bases using terminal deoxyribonucleotidyl transferase and its application
CN117904069B (en) * 2024-01-04 2025-07-15 华中农业大学 VirEN protein-mediated DNA splicing and gene editing method
WO2025221936A1 (en) * 2024-04-16 2025-10-23 Codexis, Inc. Engineered terminal nucleotidyl transferase variants

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040121411A1 (en) * 2000-04-03 2004-06-24 Roberts Susan B. Isolation of functionally active gamma-secretase protein complex and methods for detection of activity and inhibitors thereof
US20140010843A1 (en) * 2003-03-13 2014-01-09 Ralph Biemans Method of detoxification
US20160108382A1 (en) * 2014-10-20 2016-04-21 Molecular Assemblies, Inc. Modified template-independent enzymes for polydeoxynucleotide synthesis
US20160265044A1 (en) * 2009-03-27 2016-09-15 Life Technologies Corporation Conjugates of biomolecules to nanoparticles

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040121411A1 (en) * 2000-04-03 2004-06-24 Roberts Susan B. Isolation of functionally active gamma-secretase protein complex and methods for detection of activity and inhibitors thereof
US20140010843A1 (en) * 2003-03-13 2014-01-09 Ralph Biemans Method of detoxification
US20160265044A1 (en) * 2009-03-27 2016-09-15 Life Technologies Corporation Conjugates of biomolecules to nanoparticles
US20160108382A1 (en) * 2014-10-20 2016-04-21 Molecular Assemblies, Inc. Modified template-independent enzymes for polydeoxynucleotide synthesis

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
MOTEA, EA ET AL.: "Terminal Deoxynucleotidyl Transferase: The Story of a Misguided DNA Polymerase", BIOCHIMICA ET BIOPHYSICA ACTA, vol. 1804, no. 5, May 2010 (2010-05-01), pages 1151 - 1166, XP026981990 *
PITCHER, RS ET AL.: "Structure and Function of Mycobacterial NHEJ DNA Repair Polymerase", JOURNAL MOLECULAR BIOLOGY, vol. 366, no. 2, 16 February 2007 (2007-02-16), pages 391 - 404, XP005854062 *
RANDELL, JC ET AL.: "Linear Diffusion on DNA Despite High-Affinity Binding by a DNA Polymerase Processivity Factor", MOLECULAR CELL, vol. 8, no. 4, October 2001 (2001-10-01), pages 911 - 920, XP055490807 *
ROMAIN, F ET AL.: "Conferring a template-dependent polymerase activity to terminal deoxynucleotidyltransferase by mutation in the Loop1 region", NUCLEIC ACIDS RESEARCH, vol. 37, no. 14, August 2009 (2009-08-01), pages 4642 - 4656, XP002615643 *
WILLIAMS, JGK ET AL.: "An artificial processivity clamp made with streptavidin facilitates oriented attachment of polymerase-DNA complexes to surfaces", NUCLEIC ACIDS RESEARCH, vol. 36, no. 18, October 2008 (2008-10-01), pages e121, XP055490817 *

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11390858B2 (en) 2014-10-20 2022-07-19 Molecular Assemblies, Inc. Modified template-independent enzymes for polydeoxynucleotide synthesis
US10760063B2 (en) 2014-10-20 2020-09-01 Molecular Assemblies, Inc. Modified template-independent enzymes for polydeoxynucleotide synthesis
US10774316B2 (en) 2014-10-20 2020-09-15 Molecular Assemblies, Inc. Modified template-independent enzymes for polydeoxynucleotide synthesis
US12286652B2 (en) 2018-01-08 2025-04-29 Dna Script Variants of terminal deoxynucleotidyl transferase and uses thereof
US12071638B2 (en) 2018-01-08 2024-08-27 Dna Script Variants of terminal deoxynucleotidyl transferase and uses thereof
CN112105725A (en) * 2018-01-08 2020-12-18 Dna斯克瑞普特公司 Variants of terminal deoxynucleotidyl transferase and uses thereof
WO2019135007A1 (en) * 2018-01-08 2019-07-11 Dna Script Variants of terminal deoxynucleotidyl transferase and uses thereof
WO2020072715A1 (en) * 2018-10-04 2020-04-09 President And Fellows Of Harvard College Compositions and methods comprising mutants of terminal deoxynucleotidyl transferase
WO2020081985A1 (en) * 2018-10-19 2020-04-23 Molecular Assemblies, Inc. Modified template-independent enzymes for polydeoxynucleotide synthesis
US20220081714A1 (en) * 2019-01-04 2022-03-17 Northwestern University Storing temporal data into dna
CN114207140A (en) * 2019-05-28 2022-03-18 Dna斯克瑞普特公司 Terminal deoxynucleotidyl transferase variants and uses thereof
AU2020281709B2 (en) * 2019-05-28 2024-08-08 Centre National De La Recherche Scientifique Variants of terminal deoxynucleotidyl transferase and uses thereof.
WO2020239737A1 (en) * 2019-05-28 2020-12-03 Dna Script Variants of terminal deoxynucleotidyl transferase and uses thereof.
EP4407026A3 (en) * 2019-05-28 2025-01-15 DNA Script Variants of terminal deoxynucleotidyl transferase and uses thereof
EP3744854A1 (en) * 2019-05-28 2020-12-02 DNA Script Variants of terminal deoxynucleotidyl transferase and uses thereof
WO2022063835A1 (en) * 2020-09-22 2022-03-31 Dna Script Stabilized n-terminally truncated terminal deoxynucleotidyl transferase variants and uses thereof
WO2023111180A1 (en) * 2021-12-15 2023-06-22 Quantoom Biosciences France Sas Variants of thermostable dna primases and uses thereof
CN118256467A (en) * 2024-03-22 2024-06-28 上海交通大学 Terminal deoxynucleotidyl transferase variants, nucleic acids and applications

Also Published As

Publication number Publication date
US20190360013A1 (en) 2019-11-28

Similar Documents

Publication Publication Date Title
US20190360013A1 (en) Processive Template Independent DNA Polymerase Variants
US20250115895A1 (en) Dpo4 polymerase variants
Hottin et al. Structural insights into the processing of nucleobase-modified nucleotides by DNA polymerases
KR102709829B1 (en) Methods for processing nucleic acid samples
Nikoomanzar et al. Engineering polymerases for applications in synthetic biology
US12473538B2 (en) DP04 polymerase variants
US11530392B2 (en) DPO4 polymerase variants with improved accuracy
Houlihan et al. Exploring the chemistry of genetic information storage and propagation through polymerase engineering
CN103097547B (en) Modified albumen and its preparation and application
ES2274901T3 (en) DIRECTED EVOLUTION PROCEDURE.
US20070048748A1 (en) Mutant polymerases for sequencing and genotyping
Li et al. Synthesis and polymerase recognition of threose nucleic acid triphosphates equipped with diverse chemical functionalities
US20170292156A1 (en) Modified proteins and methods of making and using same
US20240344051A1 (en) Compositions and methods for ordered and continuous complementary DNA (cDNA) synthesis across non-continuous templates
Schultz et al. Taq DNA polymerase mutants and 2′-modified sugar recognition
CN111788485A (en) Modified biotin-binding proteins for immobilization
JP2012523233A (en) Modified DNase composition and method of use thereof
WO2020072715A1 (en) Compositions and methods comprising mutants of terminal deoxynucleotidyl transferase
EP4097242A1 (en) Macromolecules engineered fornanoelectronic measurement
US20230313157A1 (en) Dp04 polymerase variants with improved accuracy
Yanagihara et al. The dnaE173 mutator mutation confers on the α subunit of Escherichia coli DNA polymerase III a capacity for highly processive DNA synthesis and stable binding to primer/template DNA
Reha-Krantz Recent patents of gene sequences relative to DNA polymerases
Figazzolo Synthesis and biochemical characterization of novel moieties to be incorporated in aptamers

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17877208

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 17877208

Country of ref document: EP

Kind code of ref document: A1