WO2018076008A1 - Compositions and methods comprising permuted protein tags for facilitating overexpression, solubility, and purification of target proteins - Google Patents

Compositions and methods comprising permuted protein tags for facilitating overexpression, solubility, and purification of target proteins Download PDF

Info

Publication number
WO2018076008A1
WO2018076008A1 PCT/US2017/057881 US2017057881W WO2018076008A1 WO 2018076008 A1 WO2018076008 A1 WO 2018076008A1 US 2017057881 W US2017057881 W US 2017057881W WO 2018076008 A1 WO2018076008 A1 WO 2018076008A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
segment
rbp
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/057881
Other languages
French (fr)
Inventor
Stewart N. LOH
Jeung-Hoi HA
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Research Foundation of the State University of New York
Original Assignee
Research Foundation of the State University of New York
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Research Foundation of the State University of New York filed Critical Research Foundation of the State University of New York
Priority to US16/342,459 priority Critical patent/US11401520B2/en
Publication of WO2018076008A1 publication Critical patent/WO2018076008A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P21/00Preparation of peptides or proteins
    • C12P21/02Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4746Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used p53
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/521Chemokines
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1025Acyltransferases (2.3)
    • C12N9/104Aminoacyltransferases (2.3.2)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/24Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a MBP (maltose binding protein)-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site

Definitions

  • the present disclosure provides improved compositions and methods for expressing proteins.
  • the disclosure provides expression vectors that are suitable for expressing target proteins that are present in fusion proteins between separate segments of Ribose Binding Protein (RBP) or Maltose Binding Protein (MBP). Kits comprising the expression vectors and cells comprising the expression vectors are included. Methods of making fusion proteins, methods of separating fusion proteins and/or the target proteins they include are also included, as are the fusion proteins themselves.
  • the disclosure provides an expression vector encoding a polypeptide, the polypeptide comprising sequentially in an N to C terminal direction:
  • the second segment is located N-terminal to the first segment relative to an intact wild type amino acid sequence of an RBP comprising the sequence of SEQ ID NO: 1, and the sequence is permuted as further described herein, but the disclosure includes non-permuted configurations as well, and thus includes permuted and linear version of the fusion proteins.
  • the expression vector optionally further encodes at the C-terminus of the polypeptide a second Histidine sequence that can function with the first Histidine sequence in the functional Histidine tag, wherein the functional His tag may have improved metal binding relative to either of the first or second His tags alone.
  • Proteins described herein can comprise a non-covalently bound ribose, which can be present in cells that make the proteins, and which may persist during separation of the protein from the cells if such separation is performed.
  • the amino acid sequence of the first segment and the amino acid sequence of the second segment together comprise an amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that is at least 251 amino acids in length, and the amino acid sequences of the first and second segments do not overlap with each other.
  • This degree of identity includes amino acid sequences that have, for example, insertions and/or deletions (gaps), or amino acid substitutions/mutations.
  • the first and second segments can together have at least 90% identity with a segment of SEQ ID NO: 1 that comprises amino acids number 4 and 254 of SEQ ID NO: 1.
  • the configuration is such that the first linker and the second linker, and the first protease cleavage site if present, and the second protease cleavage site if present, together comprise at least thirty amino acids. If present cleavage sites can be the same or different from each other.
  • the fusion proteins can comprises sequences such that they are susceptible to non-enzymatic cleavage, which can be used in conjunction with or as an alternative to protease recognition sites.
  • the segment of SEQ ID NO: l is amino acids 4-254 of SEQ NO: 1.
  • the second segment comprises a contiguous amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that begins with amino acid number 1, 2, 3, or 4 of SEQ ID NO: 1 and ends with amino acid number 33, 59, 69, 84, 96, 124, 135, 185, or 209 of SEQ ID NO: l
  • the first segment comprises a contiguous amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that is amino acids 34-254 of SEQ ID NO: 1, 60-254 of SEQ ID NO: 1, 70-254 of SEQ ID NO: l, 85-254 of SEQ ID NO: 1, 97-254 of SEQ ID NO: 1, 125-254 of SEQ ID NO: 1, 136- 254 of SEQ ID NO: 1, 186-254 of SEQ ID NO: l, or 210-254 of SEQ ID NO: 1, thereby having
  • the second segment comprises a contiguous amino acid sequence of SEQ ID NO: 1 that begins with amino acid number 1, 2, 3, or 4 of SEQ ID NO: 1 and ends with amino acid number 33, 59, 69, 84, 96, 124, 135, 185, or 209 of SEQ ID NO: l .
  • the second segment ends at amino acid 96 or amino acid 124 of SEQ ID NO l .
  • the expression vector has at least one restriction
  • the expression vector further encodes at least one protease cleavage site located between the at least one restriction endonuclease digestion site and the first or the second linker sequence; and/or iii) the first and/or the second linker is at least 15 amino acids in length.
  • at least one restriction endonuclease digestion site is present in the multiple cloning site and the first and/or the second linker is at least 15 amino acids in length.
  • the disclosure comprises methods.
  • the method comprises allowing expression of any expression vector described herein such that a fusion protein is expressed, with the proviso that a polynucleotide sequence encoding a target protein is inserted into the multiple cloning site, and wherein the expressed fusion protein optionally comprises the first and second Histidine sequences, the first and second segments of the Ribose Binding Protein, the first and second linker sequences, and the at least one protease cleavage site if the protease cleavage site is encoded by the expression vector.
  • the protein comprises one or both of the Histidine sequences
  • the method further comprises exposing the fusion protein to a metal such that the first and second Histidine sequences form a functional Histidine tag that forms a non-covalent association with the metal.
  • the method can further comprise separating the fusion protein from the metal.
  • the fusion protein comprises at least one protease cleavage site and optionally comprises a second protease cleavage site such that the first and second protease cleavage sites flank the target protein.
  • the method further comprising cleaving the fusion protein at the first or the first and the second protease cleavage sites, and optionally purifying a protein cleavage product that comprises the target protein.
  • the disclosure includes expressing the fusion proteins in prokaryotic or eukaryotic cells, and includes such cells and cell cultures, and cell culture media.
  • kits comprising the expression vectors are provided.
  • Figure 1 provides a schematic comparisons of embodiments of this disclosure (Figure 1, panel B) with linear tags, such as are described in PCT/US 16/56832.
  • Figure 1, panel A The endonuclease site (ERS) is intact before the sequence encoding Target protein is inserted into the expression vector.
  • the ERS can be present in a multi-cloning site in an expression vector that contains a plurality of endonuclease recognition sites (i.e., restriction sites).
  • Figure 2 provides a schematic of representative fusion proteins.
  • Panel A linear tag, similar to Figure 1, Panel A.
  • Figure 2 Panel B, split His tag with linear permutated Ribose Binding Protein (RBP).
  • Panel C linear RBP tag with a target protein inserted in between positions 96 and 97 of RBP flanked by linker sequences (circular RBP tag).
  • Fig. 2C accordingly shows that in contrast to the split, circularly-permuted tag of this disclosure (using RBP as a representative solubility tag), the target protein gene can be inserted internally into the RBP gene, and thus can be used to produce a fusion protein encoded by the gene with the same protein orientation.
  • panels A, B and C provide schematic comparisons of different first and second segments of RBP in illustrative split, circularly permutated fusion proteins of this disclosure.
  • Figure 4 provides comparison of purification chromatogram of si 25 -clover with one N-terminal His tag (H1S3), with that of sl25-clover with both N- (H1S3) and C-terminal (H1S3) His tags.
  • His3-sl25-clover does not bind to cobalt-NTA (nitrilotriacetic acid) resin in 20 mM imidazole while His3-S 125-clover-His3 binds to the resin and is released at higher concentration of imidazole.
  • NTA nitrilotriacetic acid
  • Figure 5 provides comparison of purification chromatogram of s97-clover with one N-terminal His tag (His6) with that of s97-clover with both N- (His6) and C-terminal (Hiss) His tags. Both proteins bind to nickel-NTA resin in 10 mM imidazole, but His6-s97-clover is released at lower concentration of imidazole than His6-s97-clover-His5 protein.
  • Figure 6 provides a photographic representation of a SDS-polyacrylamide (SDS- PAGE) gel stained with Coomassie dye demonstrating that His6-LECT2 (14 kDa) does not express to detectable levels. Similarly, His6-wtRBP-LECT2 expresses poorly; the major species present is the truncated species His6-wtRBP. By contrast, His6-s97-LECT2 L is expressed at high levels, with the full-length protein being the major species present.
  • SDS- PAGE SDS-polyacrylamide
  • Figure 7 provides a photographic representation of a SDS-PAGE gel stained with Coomassie dye demonstrating that His6-wtRBP MDM2 does not express to detectable levels (left panel). By contrast, His6-s97-MDM2 is expressed at high levels (right panel).
  • Figure 8 provides a photographic representation of a SDS-PAGE gel stained with Coomassie dye demonstrating that His3-s97-P53-His3 is expressed at high levels (left panel).
  • the fusion protein is digested with HRV3C protease on Nickel-NTA resin and eluted with one other contaminant (right panel).
  • Figure 9A provides the amino acid and DNA sequences of a split tteRBP protein (s97) with a multiple cloning site for inserting a target gene (with N-terminal Met) and two linker sequences.
  • tteRBP is Thermoanaerobacter tengcongensis (tte) RBP.
  • Figure 9B provides the amino acid sequence of a split, circularly permuted RBP- MDM2 fusion protein, the sequence of a split tteRBP protein (si 25) with a multiple cloning site for inserting a target gene, and a split, circularly permuted RBP-clove fusion.
  • Figure 9B also provides the amino acid sequence of a split, circularly permuted RBP-MDM2 fusion protein, the sequence of a split tteRBP protein with a multiple cloning site for inserting a target gene, and a split, circularly permuted RBP-clove fusion.
  • Figure 10 provides the amino acid sequence of tteRBP with permutation sites signified by asterisks.
  • Figure 11 provides the amino acid sequence of Pyrococcus furiosus (pfu) MPB, and the amino acid and DNA sequences of a split pfu MBP protein with a multiple cloning site for inserting a target gene.
  • Pfu is extremophilic species of Archaea.
  • Figure 12 provides a photographic representation of SDS-PAGE gel stained with Coomassie dye demonstrating that human hRAS is purified using just Nickel-NTA resin.
  • Soluble fraction containing His3-s97-hRAS-His3 protein was loaded on the column and hRAS was eluted after on-column protease digestion.
  • Figure 13 provides a photographic representation of SDS-PAGE gel stained with Coomassie dye demonstrating high expression of yeast actin using split si 25 tteRBP system.
  • Figure 14 provides a photographic representation of SDS-PAGE gel stained with
  • GAP is GTPase-activating protein.
  • Every numerical range given throughout this specification includes its upper and lower values, as well as every narrower numerical range that falls within it, as if such narrower numerical ranges were all expressly written herein.
  • Every DNA sequence disclosed herein includes its complementary DNA sequence, and also includes the RNA equivalents thereof.
  • Every DNA and RNA sequence encoding the polypeptides disclosed herein is encompassed by this disclosure, including but not limited to all fusion proteins, and all of the Ribose Binding Protein (RBP) segment of fusion proteins and all of the Maltose Binding Protein (MBP) segment of fusion proteins, including but not limited to those comprising N- terminal and/or C-terminal truncations of the RBP segment or the MBP segment.
  • RBP Ribose Binding Protein
  • MBP Maltose Binding Protein
  • the disclosure includes permuted and non-permuted protein configurations of proteins, which can be present in fusion proteins.
  • Permuted and “permutation” and “permuting” and “permute” and “permutants” as used herein means that, relative to a wild type amino reference sequence, proteins of this disclosure have first and second segments of an RBP or MBP, wherein the second segment is located N-terminal to the first segment when compared to an intact wild type amino acid sequence of the RBP of the MBP.
  • a hypothetical contiguous reference protein has a series of segments of NH2-AA1 AA2, AA3, AA4, AA5, AA6, AA7, AA8, AA9, AA10, AA11, AA12, AA13, AA14, AA15, AA16, AA18, AA19, AA20- COOH.
  • the reference protein therefore has amino acids 1- 20 in the N to C orientation.
  • a non-limiting example of a permutation of this protein is: NH2-. . . AA9, AA10, AA11, AA12, AA13, AA14. . . AA2, AA3, AA4, AA5, AAe, AA7, AAs. .. - COOH, wherein the ellipses represent other amino acids that may or may not be part of a fusion protein that contains such permutated segments.
  • Such fusion proteins are described further below.
  • N- terminal and C-terminal when referring to amino acids within a polypeptide is used herein as a convenience to describe orientation, but does not necessarily mandate that the particular amino acid be at the N- or C- terminal amino end of the polypeptide itself.
  • the disclosure comprises segments of an RBP protein, wherein the segments comprise an amino acid sequence that is 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% or completely identical to the sequence (the tteRBP, described further below): KEGKTIGLVISTLN PFFVTLKNGAEEKAKELGYKIIVEDSQ DSSKELSNVEDLIQQK VDVLLI PVDSDAVVTAIKEANSKNIPVITIDRSANGGDVVSHIASDNVKGGEMAAEF IAKALKGKGNVVELEGIPGASAARDRGKGFDEAIAKYPDIKIVAKQAADFDRSKGLS VMENILQAQPKIDAVFAQ DEMALGAIKAIEAANRQGIIVVGFDGTEDALKAIKEGK MAATIAQQPALMGSLGVEMADKYLKGEKIP FIPAELKLITKENVQ (SEQ ID NO: 1).
  • the tteRBP sequence that includes and counts the terminal Met in amino acid numbering is SEQ ID NO:2.
  • variants of the RBP and MBP or target protein bearing one or several amino acid substitutions or deletions are also included in this disclosure.
  • the variants comprise mutations, including but not necessarily limited to conservative amino acid substitutions, and mutations that enhance one or more properties of the RBP or the MBP.
  • a sequence having at least 90% similarity to any sequence described herein can be shorter or longer than the described sequence. The skilled artisan can easily assess whether such variants are appropriate for a method of this disclosure.
  • permutation site The location of the N- terminal and C-terminal amino acid(s) where an RBP or MBP according to this disclosure can be separated into segments is referred to as a permutation site, and may be referred to as a circular permutation site. All individual permutation sites, all combinations of permutation sites, and all protein segments delineated by each single and every combination of permutation sites is encompassed by this disclosure.
  • the disclosure includes a fusion protein comprising first and second segments of the RBP wherein the second segment is located N-terminal to the first segment relative to an intact wild type amino acid sequence of an RBP.
  • the fusion protein comprises the amino acid sequence of the first segment and the amino acid sequence of the second segment together comprise an amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that is at least 251 amino acids in length, and wherein the amino acid sequences of the first and second segments do not overlap with each other.
  • the first segment has as its first amino acid position 34, 60, 70, 85, 97, 125, 136, 186 or 210 of SEQ ID NO: 1.
  • the first segment can optionally extended by any number of amino acids up to amino acid number 277 of SEQ ID NO: 1.
  • the first segment ends at amino acid 277 of SEQ ID NO: 1.
  • the first segment has at least 90% identity with a segment of SEQ ID NO: 1 that is amino acids 34-254 of SEQ ID NO: l, 60-254 of SEQ ID NO: l, 70-254 of SEQ ID NO: l, 85-254 of SEQ ID NO: 1, 97-254 of SEQ ID NO: 1, 125-254 of SEQ ID NO: 1, 136-254 of SEQ ID NO: 1, 186-254 of SEQ ID NO: l, or 210-254 of SEQ ID NO: l .
  • the first segment has at least 90% identity with a segment of SEQ ID NO: 1 that begins with one of amino acids 34 of SEQ ID NO: 1, 60 of SEQ ID NO: 1, 70 of SEQ ID NO: 1, 85 of SEQ ID NO: 1, 97 of SEQ ID NO: l, 125 of SEQ ID NO: 1, 136 of SEQ ID NO: 1, 186 of SEQ ID NO: 1, or 210 of SEQ ID NO: 1 and ends with an amino acid from 254 of SEQ ID NO: 1 to 277 of SEQ ID NO l .
  • the second segment comprises a contiguous amino acid sequence of SEQ ID NO: 1 that begins with amino acid number 1, 2, 3, or 4 of SEQ ID NO: 1 and ends with amino acid number 33, 59, 69, 84, 96, 124, 135, 185, or 209 of SEQ ID NO: 1.
  • the second segment ends at amino acid 96 or amino acid 124 of SEQ ID NO: l .
  • the second segment has at least 90% identity with a segment of SEQ ID NO: 1 that begins with amino acid number 1, 2, 3, or 4 of SEQ ID NO: 1 and ends with amino acid number 33, 59, 69, 84, 96, 124, 135, 185, or 209 of SEQ ID NO: 1.
  • fusion and "fuse” as used herein mean a protein that contains amino acid segments from distinct sources, wherein the proteins are made using recombinant molecular biology approaches that adapt standard approaches that are known in the art. It is not intended to mean chemical formation of polypeptides, such as by non-protein translation approaches, such as solid or solution phase based peptide synthesis approaches. Likewise, the fusion proteins are not made by chemical conjugation of pre-existing peptides in the absence of translation.
  • a segment from a C-terminal region of the wild type protein is moved to a position that is N-terminal to said wild type C-terminal region, and vice versa.
  • the wild type orientation can be maintained, provided first and second segments are included and are separated from one another, as described further herein.
  • a fusion protein described herein does not contain only one RBP or MBP segment, i.e., the fusion proteins comprises more than one RBP or MBP segment which are separated from each other by intervening amino acids that are not RBP or MBP amino acids, such as linkers and target proteins described further below.
  • this disclosure comprises improvements in increasing protein expression and/or solubility that are distinct from certain other approaches, such as those described in PCT/US 16/56832, published as WO 2017/066441.
  • the present disclosure presents a novel approach to incorporating an expression tag into a fusion protein.
  • the disclosure provides a circular permutant.
  • circular permutants are used in a novel purification system which utilizes split Histidine (His) tags fused to each of the N- and C-termini of the fusion protein, which is referred to in some embodiments as a split His tag.
  • the present system is applicable to any expression tag, including but not limited to RBP and MBP.
  • fusion proteins produced according to the methods of this disclosure have improved and/or different characteristics that relate at least in part to the discontinuous inclusion of two segments of the RBP or the MBP in the fusion protein.
  • improvements can be detected by comparison to a suitable reference (i.e., a control or control value).
  • the reference is a value based on one or more properties of a fusion protein that comprises only one segment of the RBP or the MBP and a target protein.
  • the reference can include a standardized value or curve(s), and/or experimentally designed controls such as a known or determined expression value for a protein, such as a target protein, wherein the expression is measured for the target protein without it being in a fusion protein that contains two discontinuous segments of the RBP or the MBP.
  • a reference value may also be depicted as an area on a graph, or a value obtained from an elution profile, or a solubility value, or a protein degradation value, and/or the total amount of protein that is expressed and/or recovered from an expression system, such values being determined based on any suitable parameter, such as the mass, moles, etc. of the protein that is produced and/or separated from the expression system.
  • fusion proteins can be evaluated using any suitable approaches, which include but are not limited to Western blotting, spectroscopy (such as circular dichroism, fluorescence, absorbance, MR,), circular dichroism, mass spectrometry, Gel electrophoresis under denaturing conditions, gel electrophoresis under non-denaturing conditions, 2D gel electrophoresis, chromatography, including but not limited to cation-exchange
  • the fusion proteins can be evaluated based on actual or predicted ability to bind to sugar, i.e., ribose for RBP and maltose for MBP.
  • the disclosure relates to fusion proteins that comprise RBP segments or derivatives thereof such that they retain sufficient homology to WT RBP (such as RBP expressed by Thermoanaerobacter tengcongensis (tteRBP, described further below) that when they fold together (i.e., a tertiary structure is formed) a functional ribose binding pocket is preserved.
  • WT RBP such as RBP expressed by Thermoanaerobacter tengcongensis (tteRBP, described further below) that when they fold together (i.e., a tertiary structure is formed) a functional ribose binding pocket is preserved.
  • teRBP Thermoanaerobacter tengcongensis
  • a fusion protein of this disclosure binds more ribose relative to a fusion protein that comprises only one RBP segment.
  • a fusion protein of this disclosure that is, for example, bound to a metal due to the inclusion of one or more His tags is in a non-covalent association with one or more ribose molecules.
  • a fusion protein that is separated from a binding partner such as a suitable metal is in a non- covalent association with one or more ribose molecules.
  • a fusion protein of this disclosure that is in a non-covalent complex with ribose molecules is more stable and/or is more soluble than a fusion protein that contains only one RBP segment.
  • ribose is added to, for example, a cell lysate prior to or during a fusion protein
  • ribose is added to a cell culture medium in which a fusion protein of this disclosure is being expressed.
  • an fusion protein comprising two RBP segments includes one or more of E. coli RBP amino acids S9, N13, F 15, F16, N64, D89, S103, 1132, F 164, N190, F214, D215 and Q235, or the T. tengcongensis RBP amino acids that are the equivalents thereof.
  • an RBP segment of this disclosure binds specifically to D-ribose.
  • the amino acid sequence of an RBP protein of this disclosure comprises or consists of SEQ ID NO: l, which is RBP produced by T.
  • the amino acid residues of this amino acid sequence can be compared by those skilled in the art to the RBP sequence of RBP produced by E. coli, which is known in the art and can be found, for example, under GenBank accession number SMH27141.1, the amino acid sequence from which is incorporated herein by reference as of the filing date of this application or patent.
  • the ribose binding residues of RBP produced by E. coli that are involved in the ribose binding pocket comprise S9, N13, F15, F 16, N64, D89, S 103, 1132, F164, N190, F214, D215 and Q235, and the homologous amino acids in tteRBP can be readily recognized by comparison to the E. coli sequence.
  • amino acids 17 and 18 and 217 and 218 of SEQ ID NO: l and a number of amino acids between 18 and 217 are considered to be necessary for RBP to bind to ribose.
  • the two segments in the present invention together include the amino acids of SEQ ID NO: 1 numbered 4 to 254, which includes the aforementioned amino acid residues (in contrast to the linear RBP in described in WO 2017/066441) and because the two segments are capable of interacting with each other and adopting a suitable tertiary structure for ribose binding (unlike the segments described in the published PCT application WO 2013/101915), absent certain modifications to the sequence of the two segments, the RBP formed when the two segments fold together will be capable of binding ribose.
  • ribose binding is not required for the two segments of RBP to fold together properly.
  • the disclosure includes such mutated proteins.
  • the disclosure includes a mutation that is a Cys to Ser alteration relative to a native sequence RBP sequence, such as a Cys to Ser alteration at position 101 in SEQ ID NO: l (position 102 in SEQ ID NO:2).
  • Figure 1 compares one embodiment of this disclosure ( Figure 1, panel B) with a linear tag, such as that described in PCT/US16/56832 published as WO 2017/066441.
  • Figure 1, panel A In the linear tag, the target protein gene is appended to either the 3 '-end of the RBP gene (shown as top linear RBP tag in Figure 1A) or the 5 '-end of the RBP gene (shown as bottom linear RBP tag in Figure 1 A).
  • the RBP gene encodes for full-length RBP (amino acids [AA] 1-277, in normal, sequential order, or at a minimum, encodes the RBP amino acids 34 [Gly] to 210 [Gin]).
  • RBP and the target protein are separated by a peptide linker (labeled 'link' in Fig. 1) and a protease cleavage site (labeled 'cleave' in Fig. 1), to enable recovery of the untagged target protein.
  • a nucleotide sequence encoding for a full histidine tag (typically 6-8 His residues) is placed at the beginning or end of the gene to facilitate purification.
  • the target protein gene is inserted internally into the RBP gene ( Figure IB), and thus can be used to produce a fusion protein encoded by the gene with the same protein orientation.
  • the RBP gene can be rearranged such that it encodes for an RBP protein that is permuted.
  • the disclosure includes variations of amino acid positions that are expressly described herein, so long as the fusion protein includes properties that are improved relative to a reference.
  • the RBP gene is rearranged such that it encodes for an RBP protein that is circularly permuted at amino acid position 97.
  • the amino acid sequence of permuted RBP in certain embodiments begins with amino acid 97 (numbered according to the wild-type RBP sequence), continues through amino acid 277, through a linker sequence of variable composition (the target protein can be inserted here), to amino acid number 1, and ends with amino acid 96.
  • the target protein gene is flanked by two nucleotide sequences that each encode for peptide linkers and a protease cleavage site, to facilitate recovery of the untagged target protein.
  • a sequence encoding a split-His tag can be placed at each end (i.e., C- and N-termini) of the final gene.
  • the design and rationale for an embodiment of the split- His tag is described below.
  • Representative fusion proteins expressed by the genes in Figure 1 are shown schematically in Figure 2.
  • the 97-277 segment can be C- terminal to the RBP 1-96 segment.
  • An optional linker can be inserted between the split-His tag and the adjacent segment of RBP.
  • a methionine will generally be added to the N- terminus of the fusion protein.
  • the methionine precedes the first split His tag or, if a split His tag is not in use, the first segment of RBP or MBP.
  • the N-terminal methionine is not counted in the amino acid numbering of the protein (SEQ ID NO: 1 does not include the first Met).
  • the target protein is inserted internally into RBP ( Figures IB and 2B), whereas the linear system of the 832 PCT application published as WO 2017066441 places the two proteins end-to-end (Figs. 1 A and 2A).
  • the RBP folds by docking of the 1-96 and 97-277 fragments, which extend from both termini of the target protein. This effectively yields a closed, topologically circular protein in which the target protein is protected from exoprotease attack at both its N- and C- termini by the presence of the extremely stable RBP protein ( Figure 3A).
  • RBP tag is circularly permuted at AA 125
  • RBP folds by docking of the 1-124 and 125-277 fragments, which extend from both termini of the target protein. Circular permutation vs. normal amino acid sequence of RBP
  • the same benefits of internal fusion could be achieved by inserting the target protein into position 97 of the normal RBP sequence, i.e. (RBP 1 -96)-(target protein)-(RBP 97-277) ( Figure 2C), instead of the permuted RBP sequence, i.e. (RBP 97-277)-(target protein)-(RBP l-96)(or into position 125 of the normal RBP sequence).
  • the target protein is still protected from exoprotease degradation by the RBP protein at both its N- and C-termini.
  • the circular permutation is employed in order to make a unique, high-affinity binding site (split-His tag) that will allow us to specifically purify the full-length protein, and reject those that are truncated either by protease cleavage or by incomplete translation.
  • split-His tag high-affinity binding site
  • one segment of a fusion protein comprises amino acids 34- 96 of the RBP, while another segment comprises amino acids 97-211.
  • one segment of a fusion protein of this comprises amino acids 34-124 of the RBP, while another segment comprises amino acids 125-211.
  • RBP split permuted RBP
  • the "RBP (97-277)” segment is engineered to comprise or consist of RBP amino acids 97-211, and/or wherein the "RBP (1-96)” is engineered to comprise or consist of RBP amino acids 34-96, or wherein the "RBP (125- 277)” segment is engineered to comprise or consist of RBP amino acids 125-21 1, and/or wherein the "RBP (1-124)” is engineered to comprise or consist of RBP amino acids 34-124.
  • One of the two segments may be engineered to begin with any amino acids between 1 and 33 inclusive and end at the permutation site, and the other of the two segments may be engineered to start after the permutation site and end at any AA between 210 and 277 inclusive.
  • MBP e.g., pfu MBP
  • GST can be circularly permuted for the purposes of protein expression, including for enabling the effective use of split His tags.
  • MBP gene is rearranged such that it encodes for an MBP protein that is circularly permuted at amino acid position 126 ( Figure 3C).
  • the amino acid sequence of permuted MBP in certain embodiments begins with amino acid 126 (numbered according to the wild-type MBP sequence), continues through amino acid 379, through a linker sequence of variable composition (the target protein can be inserted here), to amino acid number 1, and ends with amino acid 125.
  • the target protein gene is flanked by two nucleotide sequences that each encode for peptide linkers and a protease cleavage site, to facilitate recovery of the untagged target protein.
  • a split-His tag is placed at each end (i.e., C- and N-termini) of the final gene.
  • the N-terminus of the 1-125 segment of the MBP is truncated by one or more amino acids, such as, for example by 1, 2, 3, 4, etc. up to about 34 AAs
  • the C-terminus of the 126-379 segment of the MBP is truncated by one or more amino acids, such as, for example by 1, 2, 3, 4, etc. up to about 60 AAs.
  • Circular permutes of many proteins are less stable than the non-permuted protein. Circular permutes of some proteins from thermophilic organisms, however, such as tte-RBP (from Thermoanaerobacter tengcongensis) and PfuMBV (from Pyrococcus furiosus), are very stable.
  • a "Split-His tag” means a His-tag that is divided between the N- and C- termini of the fusion protein.
  • each of the two portions of the split His-tag comprises an adequate length of Histidines such that when the two portions are adjacent to one another recovery of the fusion protein is greater than a suitable control.
  • each split-His tag comprises a length of Histidines that is too short for stable binding to nickel ions that have been attached to beads.
  • a His-tag is a linear sequence of n histidine residues where n is typically 6-8. His-tags achieve purification by binding specifically to nickel or cobalt ions that have been attached to beads. In all His-tag purification systems described to date, the His-tag placed at the N-terminus of the protein, at the C-terminus of the protein, or occasionally in the middle.
  • the current system employs two split-His that are arrayed in close proximity and in approximately parallel orientation, by virtue of the structure of circularly permuted RBP.
  • split-His tag The distinction between split-His tag and conventional His-tag is that the two split-His tags must be very close to each other, such that the two tags can cooperatively bind the same, or nearby (on a molecular scale), nickel ion(s). Because the two split-His tags cooperatively bind, they act almost as a single His tag with a number of His equal to the sum of the number of His in the two split-His tags. For example, if each split His tag contains three His residues, their cooperative binding strength is close to or equal to that of a single His tag with six residues. To our knowledge, no expression system exists that has this feature.
  • the full-length protein binds more tightly to nickel beads (or other appropriate stationary phase) than truncated proteins (which will contain only one or neither of the split-His tags).
  • the full-length protein can then be selectively purified from fragments by a gradient of eluent (e.g. imidazole), represented in Figures 4 and 5.
  • split His tags of equal length tend to work optimally for purification because both split His tags have an equal affinity to the nickel substrate of the column and as a result will release from the substrate under the same conditions and at the same time.
  • each split-His tag contains two, three, four, five, six, seven or eight His residues. In one embodiment, each split-His tag contains 2 to 20 His residues. The present disclosure, however, does not preclude split His tags of unequal length, such as one split-His tag containing two residues and the other containing three residues, or one split-His tag containing three His residues and the other split-His tag containing five, etc., as performed for Figure 5.
  • An optional linker can be inserted between the split-His tag and the
  • Native proteins that are expressed by the cell being used for protein production may be rich in His and may therefore bind naturally to the nickel (or other suitable metal, such as cobalt) substrate.
  • the disclosure includes use of split His tags that contain a total of more than six His residues.
  • the disclosure includes use two six or two eight residue split His tag, one on each end of the fusion protein.
  • a higher concentration of, for example, imidazole can be used to elute the native, His-rich proteins that have bound opportunistically to the nickel column than can be used when split His tags with fewer His residues are used.
  • split-His tag circularly permuted RBP -target fusion protein production system One advantage of the split-His tag circularly permuted RBP -target fusion protein production system is that single column purification is possible. (See, for example, representative and non-limiting embodiments described below under "One column purification of the target protein" and data shown represented by Figure 12). Truncated fusion proteins will only have a single split His tag and will therefore only bind loosely to the nickel column's beads. These truncated fusion proteins and any His-rich native proteins can be eluted away using an eluent gradient.
  • an appropriate protease can be run through the column to cleave the target protein from the RBP tags and release it from the column and into the mobile phase (e.g., buffer). If the protease contains a His tag of an appropriate length (e.g., six), it will bind to the column, either on the first pass or on a subsequent pass of the mobile phase through the column, thereby separating it from the released target protein.
  • the target protein may be nicked by proteases in the cell used for expressing the fusion protein. In that case there may be full-length target protein mixed with fragments of the target protein.
  • the heparin resin can be used to purify P53 further.
  • Ion exchange, size exclusion, or affinity chromatography can also be used for purification, depending on the protein one wants to purify. The foregoing is applicable to a split-His tag circularly permuted RBP-target fusion protein production system.
  • affinity chromatography using heparin resin to purify P53 and the size exclusion chromatography to purify MDM2 and Lect2 protein.
  • a circular permutant can be created by permuting the amino acid sequence at any position, although it is preferable to permutate surface loops to avoid perturbing protein structure.
  • RBP has many surface loops (15) from which to choose when making a circular permutant.
  • positions 97 and 124 are considered to be preferable sites to permute RBP due to their ability to yield a combination of stability, solubility, and foldability in the permutated proteins.
  • position 97 is a favorable position to break the RBP sequence. It is possible to create similar constructs as that shown in Fig.
  • permutation sites on RBP include 34 (i.e., between AAs 33 and 34), 60, 125, 137, 186, and 210.
  • the permutation can be within several AAs to either side of the aforementioned sites, as long as it is within the surface loops that comprise those sites (e.g., it can be at AA 121, 122, 123, 124, 126, 127, 128, 129, or 130 instead of at 125 in RBP).
  • the target protein and flanking nucleotides are inserted into the RBP at the
  • MBP permuted at any of its loops, such as at 55, 82, 126, and 204.
  • Split His tags are to be employed with a circularly permuted tag, is the proximity and relative orientation of the N-terminus of the leading segment (e.g., the 125-277 segment of RBP) and the C-terminus of the trailing segment (e.g., the 1-124 segment of RBP) after the two segments fold together. If the N- and C-termini are oriented roughly parallel and are adjacent to each other, the split His tags will be roughly parallel and adjacent to each other and will generally work well. If the N- and C-termini are neither, the split His tags may not function optimally or at all. Thus, the disclosure provides modifying properties of the proteins using suitable length linkers, as described elsewhere herein.
  • the disclosure includes fusion proteins that are designed to be monomeric to achieve the benefits of split-His tag technology.
  • the linkers and cleavage site are flexible enough and long enough to allow the two, separated and permuted sections of RBP become adjacent each other and fold to form a permuted and non-permuted RBP.
  • the linkers that flank the RBP, including both peptide linkers and protease cleavage (or the nucleotides coding therefore) are greater than the longest amino-to-carboxy dimension within the target protein.
  • the linkers that flank the RBP, including both peptide linkers and protease cleavage (or the nucleotides coding therefore) can be 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more amino acids in length.
  • the linkers that can be used with embodiments of this disclosure, it is preferable for the linkers to be flexible.
  • appropriate linkers are rich in small or polar amino acids such as Gly and Ser to provide suitable flexibility.
  • the amino acid composition of the linkers is not particularly limited.
  • Certain exemplary linker sequences are provided in the amino acid sequences and figures of this disclosure, which are not intended to limit the amino acid composition of the linkers.
  • approaches to design of flexible linkers are known in the art. (See, for example, Klein, et al. "Design and Characterization of Structured Protein Linkers with Differing Flexibilities.” Protein Engineering, Design and Selection 27.10 (2014): 325-330, the disclosure of which is incorporated herein by reference).
  • the combination of the two linkers collectively include at least 30 amino acids, and thus are substantially longer than previous linkers that have been described with fusion proteins that include segments of RBP.
  • the disclosure relates to configurations of a fusion protein wherein the two discontinuous RBP segments are be able to fold together (i.e., adopt a suitable tertiary structure such that the ribose binding pocket remains functional).
  • linker sequences can comprise protease recognitions sites as described elsewhere herein.
  • the total number of amino acids in the linkers is approximately 30 amino acids in total when the end of the segment of RBP corresponding to the C terminus segment (such as of SEQ IN NO: 1) is spatially proximal to amino acid 277 of SEQ ID NO: l .
  • the 30 amino acids can be distributed between the linkers in any way, with the first and second linkers (plus protease sites if included) being between 0 and 30 amino acids long, again provided that the total is at least about 30 amino acids.
  • the linkers and any protease sites if present together are about 20 amino acids longer than 30 if the segment of RBP corresponding to the C terminus segment of SEQ IN NO: 1 ends at or near amino acid 254 (about 20 amino acids longer). This is because, and again without intending to be constricted by theory, in a folded protein of SEQ ID NO: 1 beginning at amino acid number 4 and ending at amino acid number 254, the N and C termini are farther away from each other than in a folded protein of SEQ ID NO: 1 that begins at amino acid number 4 and ends at amino acid number 277.
  • the length of the linkers can be adapted to account for the length of the RBP or MBP protein segments that are included in the fusion protein/encoded by the expression vectors.
  • the first and second RBP segments collectively include 277 RBP amino acids, such as those depicted in SEQ ID NO: 1, it is considered that total 30 amino acids of linker length is considered adequate. If for example, RBP amino acids are not included, such as by omitting the last 23 amino acids (i.e., 255 to 277), then the linker can be extended to substitute for those amino acids.
  • a linker can be extended by an additional 23 amino acids. Similar linker length modifications can be made if other RBP amino acids are omitted. The same approach applies to MBP as well.
  • the disclosure includes a recombinant DNA molecule, such as an expression vector, encoding a fusion protein, comprising operatively-linked at least one nucleotide sequence coding for a target polypeptide at least one nucleotide sequence coding for the RBP segments as described herein.
  • a recombinant DNA molecule such as an expression vector, encoding a fusion protein, comprising operatively-linked at least one nucleotide sequence coding for a target polypeptide at least one nucleotide sequence coding for the RBP segments as described herein.
  • Polynucleotide sequences are operatively-linked when they are placed into a functional relationship with another polynucleotide sequence.
  • a promoter is operatively-linked to a coding sequence if the promoter affects transcription or expression of the coding sequence.
  • operatively-linked means that the linked sequences are contiguous and, where necessary to join two protein coding regions, both contiguous and in reading frame.
  • certain genetic elements such as enhancers, may be operatively-linked even at a distance, i.e., even if not contiguous. Promoters of the present disclosure may be endogenous or heterologous to the host, and may be constitutive or inducible.
  • the appropriate promoter and other necessary vector sequences are selected so as to be functional in the host.
  • Examples of workable combinations of cell lines and expression vectors include but are not limited to those described Sambrook, J., et al., in “Molecular Cloning: A Laboratory Manual” (1989, 4th edition: 2012)-, Eds. J. Sambrook, E. F. Fritsch and T. Maniatis, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, or Ausubel, F., et al., in "Current Protocols in Molecular Biology” (1987 and periodic updates), Eds. F. Ausubel, R. Brent and K. R.
  • any other suitable promoters can be used in the expression vectors of this disclosure, some examples of which include but are not limited to promoters that are provided with commercially available expression vectors, such as the Pm/xylS promoter from Vectron Biosolutions. Other specific examples are known and are described in, for example, "A comparative analysis of the properties of regulated promoter systems commonly used for recombinant gene expression in Escherichia coif Microbial Cell Factories, 201312:26, from which the disclosure of promoters is incorporate herein by reference.
  • the promoters used in embodiments or the disclosure may be constitutive promoters, or they may be inducible.
  • the expression systems are not limited to prokaryotic systems, and thus may be configured for expression in eukaryotic systems, such as yeast, animal systems such as baculovirus-insect cell systems, mammalian cell expression systems, and cell free expression systems that are known in the art and that, when given the benefit of the present disclosure, can also be used.
  • eukaryotic systems such as yeast
  • animal systems such as baculovirus-insect cell systems
  • mammalian cell expression systems such as baculovirus-insect cell systems
  • cell free expression systems that are known in the art and that, when given the benefit of the present disclosure, can also be used.
  • Suitable expression vectors are known in the art and can be adapted for use in methods of this disclosure.
  • Expression of the proteins can be also be scaled to produce any desired amount of the proteins, such as by batch scaling, and can be used to produce milligram, gram, or kilogram quantities of the proteins. Such quantities can refer to production of the fusion protein, or of the target protein if the target protein is separated from the fusion protein.
  • DNA constructs prepared for introduction into a host typically comprise a replication system recognized by the host, including the intended DNA fragment encoding the desired target fusion peptide, and will can also include transcription and translational initiation regulatory sequences operatively-linked to the polypeptide encoding segment.
  • Expression systems may include, for example, an origin of replication or autonomously replicating sequence (ARS) and expression control sequences, a promoter, an enhancer and necessary processing information sites, such as ribosome-binding sites, RNA splice sites, polyadenylation sites, transcriptional terminator sequences, and mRNA stabilizing sequences.
  • ARS autonomously replicating sequence
  • expression control sequences such as ribosome-binding sites, RNA splice sites, polyadenylation sites, transcriptional terminator sequences, and mRNA stabilizing sequences.
  • Expression and cloning vectors can contain a selectable marker, a gene encoding a protein necessary for the survival or growth of a host cell transformed with the vector, although such a marker gene may be carried on another polynucleotide sequence co- introduced into the host cell. Only those host cells expressing the marker gene will survive and/or grow under selective conditions.
  • Typical selection genes include but are not limited to those encoding proteins that (a) confer resistance to antibiotics or other toxic substances, e.g., ampicillin, tetracycline, etc.; (b) complement auxotrophic deficiencies; or (c) supply critical nutrients not available from complex media. The choice of the proper selectable marker will depend on the host cell, and appropriate markers for different hosts are known in the art.
  • the expression vectors containing the polynucleotides of interest can be introduced into the host cell by any method known in the art. These methods vary depending upon the type of cellular host, including but not limited to transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, other substances, and infection by viruses. Large quantities of the polynucleotides and polypeptides may be prepared by expressing the polynucleotides in compatible host cells.
  • the most commonly used prokaryotic hosts are strains of Escherichia coli, although other prokaryotes, such as Bacillus subtilis may also be used.
  • Construction of a vector according to the present disclosure employs conventional ligation techniques. Isolated plasmids or DNA fragments are cleaved, tailored, and religated in the form desired to generate the plasmids required. If desired, analysis to confirm correct sequences in the constructed plasmids is performed in a known fashion. Suitable methods for constructions expression vectors, preparing in vitro transcripts, introducing DNA into host cells, and performing analyses for assessing expression and function are known to those skilled in the art.
  • the DNA construct comprise linker peptides as illustrated herein. As described above, the linkers and cleavage site are flexible enough and long enough to allow the two, separated and permuted sections of RBP become adjacent each other and fold to form a permuted RBP.
  • the linker peptide(s) can be constructed to comprise a proteolytic cleavage site.
  • a recombinant DNA molecule such as an expression vector, encoding a fusion protein comprising at least one polynucleotide sequence coding for a target polypeptide, a polynucleotide sequence coding for the RBP- solubility tags as described herein, and additionally comprising a nucleic acid sequence coding for a peptidic linker comprising a proteolytic cleavage site, represents a non-limiting embodiment of this invention.
  • the expression vector comprises codons optimized for expression in the host cell.
  • fusion proteins of this disclosure may or may not contain protease recognition sites. If a protease recognition site is included it can be comprised within a linker sequence. Suitable protease recognition sites are known in the art and can be adapted with embodiments of this disclosure. In embodiments, the protease recognition site can comprise a site that is recognized by any of plant, viral, bacterial and/or animal proteases. Animal proteases include acid proteases secreted into the stomach (such as pepsin) and serine proteases present in duodenum (trypsin and chymotrypsin). Proteases present in blood serum (thrombin, plasmin, Hageman factor, etc.) recognize sites that can also be used.
  • animal proteases include acid proteases secreted into the stomach (such as pepsin) and serine proteases present in duodenum (trypsin and chymotrypsin). Proteases present in blood serum (thrombin, plasmin, Hage
  • proteases are present in leukocytes (elastase, cathepsin G), and some venoms also contain proteases, such as pit viper haemotoxin; sites that are recognized by such proteases are included in the disclosure. It will also be recognized that amino acid sequences recognized by proteases expressed by bacteria in the gut of various animals, including humans, or by the animals themselves in various parts of their anatomy, such as their gut, digestive system or circulatory system, can also be incorporated into the fusion proteins. In such cases, the separation of the target protein from the fusion protein can occur in that part of the animal's anatomy.
  • a target protein of this disclosure can comprise a protein- based pro-drug (or other biologically active protein) which is activated via liberation from the fusion protein only once it is administered to an animal that expresses the cognate protease.
  • Protease recognition sites that can be used in this invention are known in the art. For example, see the table of protease recognition sites available at www.proteinsandproteomics.org/content/free/tables_l/tablel l .pdf, the disclosure of which is incorporated herein by reference.
  • protease cleavage sites that can be used in embodiments of this disclosure include Tobacco etch virus (ENLYFQ/G; SEQ ID NO: 16, Enterokinase site (DDDDK/ SEQ ID NO: 13), Factor Xa site IEGR/ (SEQ ID NO: 14) and Thrombin (LVPR/GS SEQ ID NO: 15).
  • Tobacco etch virus ENLYFQ/G; SEQ ID NO: 16, Enterokinase site (DDDDK/ SEQ ID NO: 13), Factor Xa site IEGR/ (SEQ ID NO: 14) and Thrombin (LVPR/GS SEQ ID NO: 15).
  • Protease sequences (or other cleavage sites) that are not included in the target protein can be designed and included by analysis of the amino acid sequence of the target protein, thus avoiding or minimizing cleavage of the target protein.
  • publicly available tools for protease sites can be used to determine protease cleavage sites, such as PeptideCutter (available at web.expasy.org/peptide_cutter/).
  • the fusion proteins can comprise amino acid sequences that can be cleaved to, for example, liberate the target protein, but not necessarily by a protease, and thus may be cleaved non-enzymatically.
  • sequences can be included in the linkers.
  • such sequence can be, for example, particularly susceptible to acid hydrolysis, or by exposure to other chemicals, or by heat treatment.
  • the fusion proteins comprise sequences that are designed to be exclusively or preferentially cleaved by cyanogen bromide, which cleaves peptide bonds after a methionine.
  • the fusion proteins may be designed to be exclusively or preferentially cleaved at tryptophanyl, aspartyl, cysteinyl, and/or asparaginyl peptide bonds. Acids such as trifluoroacetic acid and formic acid may also be used for such non-enzymatic proteolysis. Approaches such as these can be adapted to alter conditions in which a fusion protein of this disclosure is treated, such as by modifying pH, temperature, salt concentrations and the like so that preferential cleavage of the target protein can be achieved.
  • Combinations of these cleavage mechanisms or approaches can be used in a single fusion protein, including incorporating different cleavage mechanisms between the target protein and each of the RBP segments or incorporating more than one cleavage mechanism between the target protein and one or both of the RBP segments.
  • the invention is demonstrated using several target proteins as described in the Examples. These include Leukocyte Cell Derived Chemotaxin 2 (LECT2), Human mouse double minute 2 homolog (MDM2) also known as E3 ubiquitin-protein ligase Mdm2, p53, hRAS, actin and GTPase-activating protein (GAP).
  • LECT2 Leukocyte Cell Derived Chemotaxin 2
  • MDM2 Human mouse double minute 2 homolog
  • GAP GTPase-activating protein
  • the disclosure demonstrates embodiments with proteins of vastly different amino acids compositions, sizes and function. Accordingly, it is expected that the target protein that is included in the fusion proteins of this disclosure may be any polypeptide of interest.
  • a target polypeptide according to the present disclosure may be any polypeptide required or desired in larger amounts and therefore may be difficult to isolate or purify from other sources.
  • Non-limiting examples of target proteins that can produced by the present methods include mammalian gene products, such as enzymes, cytokines, growth factors, hormones, vaccines, antibodies and the like.
  • overexpressed gene products of the present disclosure include gene products such as p53, erythropoietin, insulin, somatotropin, growth hormone releasing factor, platelet derived growth factor, epidermal growth factor, transforming growth factor a, transforming growth factor 13, epidermal growth factor, fibroblast growth factor, nerve growth factor, insulin-like growth factor I, insulin-like growth factor II, clotting Factor VIII, superoxide dismutase, a-interferon, ⁇ -interferon, interleukin-1, interleukin-2, interleukin-3, interleukin-4, interleukin-5, interleukin-6, granulocyte colony stimulating factor, multi- lineage colony stimulating activity, granulocyte-macrophage stimulating factor, macrophage colony stimulating factor, T cell growth
  • overexpressed gene products are human gene products.
  • the present methods can readily be adapted to enhance secretion of any overexpressed gene product which can be used as a vaccine.
  • Overexpressed gene products which can be used as vaccines include any structural, membrane-associated, membrane-bound or secreted gene product of a mammalian pathogen.
  • Mammalian pathogens include viruses, bacteria, single-celled or multi-celled parasites which can infect or attack a mammal.
  • viral vaccines can include vaccines against viruses such as human immunodeficiency virus (HIV), vaccinia, poliovirus, adenovirus, influenza, hepatitis A, hepatitis B, dengue virus, Japanese B encephalitis, Varicella zoster, cytomegalovirus, hepatitis A, rotavirus, as well as vaccines against viral diseases like measles, yellow fever, mumps, rabies, herpes, influenza, parainfluenza and the like.
  • viruses such as human immunodeficiency virus (HIV), vaccinia, poliovirus, adenovirus, influenza, hepatitis A, hepatitis B, dengue virus, Japanese B encephalitis, Varicella zoster, cytomegalovirus, hepatitis A, rotavirus, as well as vaccines against viral diseases like measles, yellow fever, mumps, rabies, herpes, influenza, parainfluenza
  • Bacterial vaccines can include vaccines against bacteria such as Vibrio cholerae, Salmonella typhi, Bordetella pertussis, Streptococcus pneumoniae, Hemophilus influenza, Clostridium tetani, Corynebacterium diphtheriae, Mycobacterium leprae, R. rickettsii, Shigella, Neisseria gonorrhoeae, Neisseria meningitidis, Coccidioides immitis, Borellia burgdorferi, and the like.
  • a target polypeptide may also comprise sequences; e.g., diagnostically relevant epitopes, from several different proteins constructed to be expressed as a single recombinant polypeptide.
  • the target protein can comprise a protein that can be suitable for use as a nutraceutical, a dietary or other food supplement, a food additive, a filler, a binder, or for any purpose related to human and non-human animal nutrition.
  • the target protein is intended for human consumption, or for veterinary purposes, including but not limited to the purposes of providing a feed, feedstock, a dietary supplement, or other food component to, for example, animals that are used in an agricultural industry, or for companion animals.
  • the non-human animals are bovine animals, poultry, porcine animals, felines, canines, equine animals, or fish.
  • the protein can be comprised within intact cells, such as in a cell culture, or in can be provided as a cell lysate.
  • cells that produce the protein can be used as a probiotic agent, which could be for instance fed to a recipient, and/or could be used as an inoculant so that that the cells could colonize for example some or all of the gastrointestinal tract of the animal (or elsewhere) and provide an ongoing supply of the target protein, whether or not it remains as a component of the fusion protein.
  • the protein comprises a high proportion of essential amino acids, i.e., an abundance of any one or combination of phenylalanine, valine, threonine, tryptophan, methionine, leucine, isoleucine, lysine, and histidine.
  • the protein comprises an enzyme that is beneficial to a person who may produce an inadequate amount of the enzyme.
  • the recombinant proteins of the inventions can be recovered by conventional methods.
  • the host cell is bacterial, such as E. coli it may be lysed physically, chemically or enzymatically and the protein product isolated from the resulting lysate. It is then purified using conventional techniques, including but not necessarily limited to conventional protein isolation techniques such as selective precipitation, adsorption chromatography, and affinity chromatography, including but not limited to a monoclonal antibody affinity column.
  • Proteins of the present invention that are expressed with a histidine tail (HIS tag) as described above can easily be purified by affinity chromatography using an ion metal affinity chromatography column (IMAC) column.
  • IMAC ion metal affinity chromatography column
  • the fusion protein will bind to any ribose in the cells expressing it. In some cases, the amount of fusion protein will exceed the supply of ribose in the cell. To increase that supply and ensure that each fusion protein is bound to a ribose, ribose can be added to the media in which the cells expressing the fusion protein are growing. Alternatively, the ribose can be added after the cells are lysed. In either case, the additional ribose will ensure that all of the fusion protein is bound to a ribose.
  • the disclosure When used as part of an expression construct designed for the expression of the coded protein in an appropriate host the disclosure produces a novel fusion protein, from which the protein of interest can be readily purified, in certain embodiments at substantially higher levels than can be achieved using only the sequence for the protein of interest alone, or using a linear configuration as described above.
  • Fusion polypeptides can be purified to high levels (greater than 80%, or greater than 90% pure, as visualized by SDS-PAGE) by undergoing further purification steps. Additional purification steps can be carried out and may be performed either before or after the IMAC column to yield highly purified protein. They present a major single band when analyzed by SDS PAGE under reducing conditions, and western blot analysis show less than 5% host cell protein contamination.
  • the present disclosure relates to a method of producing a fusion protein.
  • the method comprises the steps of culturing a host cell transformed with an expression vector as described above, expression of that fusion protein in the respective host cell and separating the protein from the cell culture.
  • the expression system is demonstrated to function with several distinct proteins as described herein, but it is expected it will function with a wide variety of distinct polypeptides with different structural and functional properties.
  • compositions comprising fusion proteins, or proteins liberated from the fusion proteins of this disclosure are also provided.
  • Such compositions include but are not necessarily limited to compositions that comprise a pharmaceutically acceptable excipient and thus are suitable for human and veterinary prophylactic and/or therapeutic approaches.
  • kits for producing fusion proteins according to this disclosure are provided.
  • the kits can provide one or more expression vectors described herein, as well as printed instructions for using the vectors, and/or for recovering the overexpressed protein.
  • the fusion protein may domain swap in the cell, particularly if it is expressed at extremely high concentrations. If domain swapping occurs, the present invention will protect against proteolytic attack by blocking both termini of the target protein and allow for purification and recovery of the target protein.
  • Permuting/splitting RBP at positions other than 97 is covered in this invention and is discussed in the next section.
  • His3 tags to both termini of sl25-clover (His3-sl25- clover-His3). To mimic the products of proteolytic cleavage or incomplete
  • LECT2 is the protein that causes the 4 th most common form of systemic amyloidosis in the United States. Lect2 has three disulfide bonds. When Lect2 was previously expressed in E.coli, it did not fold properly because the disulfide bonds became scrambled. Lect2 expressed as S97 fusion protein was not only soluble but also has all three disulfide bonds correctly formed according to Mass Spec. We made three LECT2 constructs. For the first we inserted LECT2 into position 97 of split-RBP (as shown in Figure 3A) to create His6-s97- LECT2.
  • His6-s97-LECT2 is expressed at high levels, with the full-length protein being the major species present. Importantly, truncation products (e.g. the s97 fragments of 1 1 kDa and 20 kDa) are not detected. These results indicate that: (1) the s97 tag greatly enhances expression of LECT2, and (2) the closed, topologically circular topology created by the s97-LECT2 fusion seems to protect the full-length protein from degradation, compared to the linear wtRBP-LECT2 fusion.
  • MDM2 human double-minute protein 2
  • MDM2 is a high-value target for protein expression because it is the major negative regulator for the p53 tumor suppressor. Disrupting the MDM2-p53 interaction is a major target for developing anti-cancer drugs, but these efforts have been hindered by the inability to express full-length MDM2 in sufficient quantity.
  • the MDM2 gene was appended to or inserted in the RBP gene as shown in Fig. 3A, with appropriate linkers (see Fig. 9b for gene and protein sequences). E. coli cultures were grown, induced, harvested, and lysed under identical conditions.
  • Figure 7 shows the eluents from the nickel column. Five times as many cells were lysed for the linear RBP data.
  • the linear RBP system prep (left) shows a faint, barely detectable band of full-length
  • RBP-MDM2 eluting from the nickel column.
  • the free RBP band is very intense.
  • the example of the current disclosure (right) indicates an intense band of full-length RBP- MDM2 (again, generated from 1/5 as many cells as the linear control) with less
  • FIG. 8 (left gel) indicates that full-length His3- s97-p53-His3 is overexpressed to a high level in E. coli lysates, with the majority of the protein found in the soluble fraction. P53 alone, without being fused to s97 or wtRBP, does not express to detectable levels (not shown).
  • Figure 8 (right gel) demonstrates that the split- His tag enables purification of the full-length protein to homogeneity, and that subsequent cleavage with prescission protease yields the correct, native p53 protein. This protein was determined to be fully functional by DNA binding assays (not shown).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Biomedical Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Enzymes And Modification Thereof (AREA)

Abstract

Provided are compositions and methods for used in solubilizing, stabilizing and expressing proteins. The proteins are fusion proteins that contain a protein of interest. The fusion proteins contain segments of Ribose Binding Protein (RBP) or Maltose Binding Protein (MBP). The fusion proteins can have the RBP or MBP segments flanking the target protein, and the RBP or MBP segments can be in the fusion protein in the same orientation as they normally occur (except for being interrupted by the target protein) or the segments can be permuted. Novel segments of the RBP and MBP are provided and result in improved expression and/or solubility of the proteins. Some examples include one or a combination of two complete or partial Histidine tags. Some examples allow for the target protein to be separated from all or a part of the fusion protein such as by enzymatic or non-enzymatic cleavage.

Description

COMPOSITIONS AND METHODS COMPRISING PERMUTED PROTEIN TAGS FOR FACILITATING OVEREXPRESSION, SOLUBILITY, AND PURIFICATION
OF TARGET PROTEINS CROSS REFERENCE TO RELATED APPLICATIONS
This application claims priority to U. S. provisional patent application no. 62/411,295, filed October 21, 2016, and to U.S. provisional patent application no. 62/518,207, filed June 12, 2017, the disclosures of each of which are incorporated herein by reference. GOVERNMENT SUPPORT CLAUSE
This invention was made with government support under grant no. GM069755 and GM1 15762 awarded by the National Institutes of Health. The government has certain rights in the invention. BACKGROUND
There is an ongoing and unmet need for compositions and methods that improve expression, solubility and/or purification of proteins. The present disclosure pertains to these needs.
SUMMARY
The present disclosure provides improved compositions and methods for expressing proteins. In embodiments the disclosure provides expression vectors that are suitable for expressing target proteins that are present in fusion proteins between separate segments of Ribose Binding Protein (RBP) or Maltose Binding Protein (MBP). Kits comprising the expression vectors and cells comprising the expression vectors are included. Methods of making fusion proteins, methods of separating fusion proteins and/or the target proteins they include are also included, as are the fusion proteins themselves.
In particular embodiments the disclosure provides an expression vector encoding a polypeptide, the polypeptide comprising sequentially in an N to C terminal direction:
a) optionally, at the N-terminus of the polypeptide a first Histidine sequence that can function as a component of a functional Histidine tag with a second Histidine sequence located at the C-terminus of the polypeptide;
b) a first segment of a Ribose Binding Protein (RBP);
c) a first linker sequence;
d) at least one restriction endonuclease digestion site; e) a second linker sequence;
f) a second segment of the RBP.
In one embodiment the second segment is located N-terminal to the first segment relative to an intact wild type amino acid sequence of an RBP comprising the sequence of SEQ ID NO: 1, and the sequence is permuted as further described herein, but the disclosure includes non-permuted configurations as well, and thus includes permuted and linear version of the fusion proteins. The expression vector optionally further encodes at the C-terminus of the polypeptide a second Histidine sequence that can function with the first Histidine sequence in the functional Histidine tag, wherein the functional His tag may have improved metal binding relative to either of the first or second His tags alone.
Proteins described herein can comprise a non-covalently bound ribose, which can be present in cells that make the proteins, and which may persist during separation of the protein from the cells if such separation is performed.
In a configuration of the first and second segments, the amino acid sequence of the first segment and the amino acid sequence of the second segment together comprise an amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that is at least 251 amino acids in length, and the amino acid sequences of the first and second segments do not overlap with each other. This degree of identity includes amino acid sequences that have, for example, insertions and/or deletions (gaps), or amino acid substitutions/mutations. In one implementation the first and second segments can together have at least 90% identity with a segment of SEQ ID NO: 1 that comprises amino acids number 4 and 254 of SEQ ID NO: 1.
In an embodiment the configuration is such that the first linker and the second linker, and the first protease cleavage site if present, and the second protease cleavage site if present, together comprise at least thirty amino acids. If present cleavage sites can be the same or different from each other. In embodiments, the fusion proteins can comprises sequences such that they are susceptible to non-enzymatic cleavage, which can be used in conjunction with or as an alternative to protease recognition sites.
In certain embodiments the segment of SEQ ID NO: l is amino acids 4-254 of SEQ NO: 1. In embodiments, the second segment comprises a contiguous amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that begins with amino acid number 1, 2, 3, or 4 of SEQ ID NO: 1 and ends with amino acid number 33, 59, 69, 84, 96, 124, 135, 185, or 209 of SEQ ID NO: l In embodiments, the first segment comprises a contiguous amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that is amino acids 34-254 of SEQ ID NO: 1, 60-254 of SEQ ID NO: 1, 70-254 of SEQ ID NO: l, 85-254 of SEQ ID NO: 1, 97-254 of SEQ ID NO: 1, 125-254 of SEQ ID NO: 1, 136- 254 of SEQ ID NO: 1, 186-254 of SEQ ID NO: l, or 210-254 of SEQ ID NO: 1, thereby having the first amino acid of the first segment as amino acid 34, 60, 70, 85, 97, 125, 136, 186 or 210 of SEQ ID NO: 1, and wherein the first segment is optionally extended by any number of amino acids up to amino acid number 277 of SEQ ID NO: 1. In one embodiment the first segment ends at amino acid 277 of SEQ ID NO: 1.
In certain embodiments the second segment comprises a contiguous amino acid sequence of SEQ ID NO: 1 that begins with amino acid number 1, 2, 3, or 4 of SEQ ID NO: 1 and ends with amino acid number 33, 59, 69, 84, 96, 124, 135, 185, or 209 of SEQ ID NO: l . In one embodiment, the second segment ends at amino acid 96 or amino acid 124 of SEQ ID NO l .
In certain embodiments, the expression vector has at least one restriction
endonuclease digestion present in a multiple cloning site; and/or ii) the expression vector further encodes at least one protease cleavage site located between the at least one restriction endonuclease digestion site and the first or the second linker sequence; and/or iii) the first and/or the second linker is at least 15 amino acids in length. In one approach at least one restriction endonuclease digestion site is present in the multiple cloning site and the first and/or the second linker is at least 15 amino acids in length.
In another aspect the disclosure comprises methods. In one approach the method comprises allowing expression of any expression vector described herein such that a fusion protein is expressed, with the proviso that a polynucleotide sequence encoding a target protein is inserted into the multiple cloning site, and wherein the expressed fusion protein optionally comprises the first and second Histidine sequences, the first and second segments of the Ribose Binding Protein, the first and second linker sequences, and the at least one protease cleavage site if the protease cleavage site is encoded by the expression vector. In embodiments, the protein comprises one or both of the Histidine sequences, and the method further comprises exposing the fusion protein to a metal such that the first and second Histidine sequences form a functional Histidine tag that forms a non-covalent association with the metal. The method can further comprise separating the fusion protein from the metal. In certain approaches the fusion protein comprises at least one protease cleavage site and optionally comprises a second protease cleavage site such that the first and second protease cleavage sites flank the target protein. In an embodiment the method further comprising cleaving the fusion protein at the first or the first and the second protease cleavage sites, and optionally purifying a protein cleavage product that comprises the target protein. In certain aspects the disclosure includes expressing the fusion proteins in prokaryotic or eukaryotic cells, and includes such cells and cell cultures, and cell culture media. In embodiments, kits comprising the expression vectors are provided.
BRIEF DESCRIPTION OF THE FIGURES
Figure 1 provides a schematic comparisons of embodiments of this disclosure (Figure 1, panel B) with linear tags, such as are described in PCT/US 16/56832. (Figure 1, panel A). The endonuclease site (ERS) is intact before the sequence encoding Target protein is inserted into the expression vector. The ERS can be present in a multi-cloning site in an expression vector that contains a plurality of endonuclease recognition sites (i.e., restriction sites).
Figure 2 provides a schematic of representative fusion proteins. Panel A, linear tag, similar to Figure 1, Panel A. Figure 2 Panel B, split His tag with linear permutated Ribose Binding Protein (RBP). Panel C, linear RBP tag with a target protein inserted in between positions 96 and 97 of RBP flanked by linker sequences (circular RBP tag). Fig. 2C accordingly shows that in contrast to the split, circularly-permuted tag of this disclosure (using RBP as a representative solubility tag), the target protein gene can be inserted internally into the RBP gene, and thus can be used to produce a fusion protein encoded by the gene with the same protein orientation.
Figure 3, panels A, B and C provide schematic comparisons of different first and second segments of RBP in illustrative split, circularly permutated fusion proteins of this disclosure.
Figure 4 provides comparison of purification chromatogram of si 25 -clover with one N-terminal His tag (H1S3), with that of sl25-clover with both N- (H1S3) and C-terminal (H1S3) His tags. His3-sl25-clover does not bind to cobalt-NTA (nitrilotriacetic acid) resin in 20 mM imidazole while His3-S 125-clover-His3 binds to the resin and is released at higher concentration of imidazole.
Figure 5 provides comparison of purification chromatogram of s97-clover with one N-terminal His tag (His6) with that of s97-clover with both N- (His6) and C-terminal (Hiss) His tags. Both proteins bind to nickel-NTA resin in 10 mM imidazole, but His6-s97-clover is released at lower concentration of imidazole than His6-s97-clover-His5 protein.
Figure 6 provides a photographic representation of a SDS-polyacrylamide (SDS- PAGE) gel stained with Coomassie dye demonstrating that His6-LECT2 (14 kDa) does not express to detectable levels. Similarly, His6-wtRBP-LECT2 expresses poorly; the major species present is the truncated species His6-wtRBP. By contrast, His6-s97-LECT2 L is expressed at high levels, with the full-length protein being the major species present.
Figure 7 provides a photographic representation of a SDS-PAGE gel stained with Coomassie dye demonstrating that His6-wtRBP MDM2 does not express to detectable levels (left panel). By contrast, His6-s97-MDM2 is expressed at high levels (right panel).
Figure 8 provides a photographic representation of a SDS-PAGE gel stained with Coomassie dye demonstrating that His3-s97-P53-His3 is expressed at high levels (left panel). The fusion protein is digested with HRV3C protease on Nickel-NTA resin and eluted with one other contaminant (right panel).
Figure 9A provides the amino acid and DNA sequences of a split tteRBP protein (s97) with a multiple cloning site for inserting a target gene (with N-terminal Met) and two linker sequences. tteRBP is Thermoanaerobacter tengcongensis (tte) RBP.
Figure 9B provides the amino acid sequence of a split, circularly permuted RBP- MDM2 fusion protein, the sequence of a split tteRBP protein (si 25) with a multiple cloning site for inserting a target gene, and a split, circularly permuted RBP-clove fusion. Figure 9B also provides the amino acid sequence of a split, circularly permuted RBP-MDM2 fusion protein, the sequence of a split tteRBP protein with a multiple cloning site for inserting a target gene, and a split, circularly permuted RBP-clove fusion.
Figure 10 provides the amino acid sequence of tteRBP with permutation sites signified by asterisks.
Figure 11 provides the amino acid sequence of Pyrococcus furiosus (pfu) MPB, and the amino acid and DNA sequences of a split pfu MBP protein with a multiple cloning site for inserting a target gene. Pfu is extremophilic species of Archaea.
Figure 12 provides a photographic representation of SDS-PAGE gel stained with Coomassie dye demonstrating that human hRAS is purified using just Nickel-NTA resin.
Soluble fraction containing His3-s97-hRAS-His3 protein was loaded on the column and hRAS was eluted after on-column protease digestion.
Figure 13 provides a photographic representation of SDS-PAGE gel stained with Coomassie dye demonstrating high expression of yeast actin using split si 25 tteRBP system.
Figure 14 provides a photographic representation of SDS-PAGE gel stained with
Coomassie dye demonstrating high expression of human GAP344 using split s97 tteRBP system and subsequent purification on Nickel-NTA resin. GAP is GTPase-activating protein.
DETAILED DESCRIPTION Unless defined otherwise herein, all technical and scientific terms used in this disclosure have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains.
Every numerical range given throughout this specification includes its upper and lower values, as well as every narrower numerical range that falls within it, as if such narrower numerical ranges were all expressly written herein. Every DNA sequence disclosed herein includes its complementary DNA sequence, and also includes the RNA equivalents thereof. Every DNA and RNA sequence encoding the polypeptides disclosed herein is encompassed by this disclosure, including but not limited to all fusion proteins, and all of the Ribose Binding Protein (RBP) segment of fusion proteins and all of the Maltose Binding Protein (MBP) segment of fusion proteins, including but not limited to those comprising N- terminal and/or C-terminal truncations of the RBP segment or the MBP segment.
The disclosure includes permuted and non-permuted protein configurations of proteins, which can be present in fusion proteins. "Permuted" and "permutation" and "permuting" and "permute" and "permutants" as used herein means that, relative to a wild type amino reference sequence, proteins of this disclosure have first and second segments of an RBP or MBP, wherein the second segment is located N-terminal to the first segment when compared to an intact wild type amino acid sequence of the RBP of the MBP. To illustrate in a non-limiting fashion, a hypothetical contiguous reference protein has a series of segments of NH2-AA1 AA2, AA3, AA4, AA5, AA6, AA7, AA8, AA9, AA10, AA11, AA12, AA13, AA14, AA15, AA16, AA18, AA19, AA20- COOH. The reference protein therefore has amino acids 1- 20 in the N to C orientation. A non-limiting example of a permutation of this protein is: NH2-. . . AA9, AA10, AA11, AA12, AA13, AA14. . . AA2, AA3, AA4, AA5, AAe, AA7, AAs. .. - COOH, wherein the ellipses represent other amino acids that may or may not be part of a fusion protein that contains such permutated segments. Such fusion proteins are described further below.
Reference to N- terminal and C-terminal when referring to amino acids within a polypeptide is used herein as a convenience to describe orientation, but does not necessarily mandate that the particular amino acid be at the N- or C- terminal amino end of the polypeptide itself.
In embodiments the disclosure comprises segments of an RBP protein, wherein the segments comprise an amino acid sequence that is 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% or completely identical to the sequence (the tteRBP, described further below): KEGKTIGLVISTLN PFFVTLKNGAEEKAKELGYKIIVEDSQ DSSKELSNVEDLIQQK VDVLLI PVDSDAVVTAIKEANSKNIPVITIDRSANGGDVVSHIASDNVKGGEMAAEF IAKALKGKGNVVELEGIPGASAARDRGKGFDEAIAKYPDIKIVAKQAADFDRSKGLS VMENILQAQPKIDAVFAQ DEMALGAIKAIEAANRQGIIVVGFDGTEDALKAIKEGK MAATIAQQPALMGSLGVEMADKYLKGEKIP FIPAELKLITKENVQ (SEQ ID NO: 1).
The tteRBP sequence that includes and counts the terminal Met in amino acid numbering is SEQ ID NO:2. Variants of the RBP and MBP or target protein bearing one or several amino acid substitutions or deletions are also included in this disclosure. In embodiments, the variants comprise mutations, including but not necessarily limited to conservative amino acid substitutions, and mutations that enhance one or more properties of the RBP or the MBP. In embodiments, a sequence having at least 90% similarity to any sequence described herein can be shorter or longer than the described sequence. The skilled artisan can easily assess whether such variants are appropriate for a method of this disclosure.
The location of the N- terminal and C-terminal amino acid(s) where an RBP or MBP according to this disclosure can be separated into segments is referred to as a permutation site, and may be referred to as a circular permutation site. All individual permutation sites, all combinations of permutation sites, and all protein segments delineated by each single and every combination of permutation sites is encompassed by this disclosure.
In embodiments, the disclosure includes a fusion protein comprising first and second segments of the RBP wherein the second segment is located N-terminal to the first segment relative to an intact wild type amino acid sequence of an RBP. In embodiments, the fusion protein comprises the amino acid sequence of the first segment and the amino acid sequence of the second segment together comprise an amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that is at least 251 amino acids in length, and wherein the amino acid sequences of the first and second segments do not overlap with each other. In embodiments, the first segment has as its first amino acid position 34, 60, 70, 85, 97, 125, 136, 186 or 210 of SEQ ID NO: 1. The first segment can optionally extended by any number of amino acids up to amino acid number 277 of SEQ ID NO: 1. Thus, in one embodiment, the first segment ends at amino acid 277 of SEQ ID NO: 1. In embodiments, the first segment has at least 90% identity with a segment of SEQ ID NO: 1 that is amino acids 34-254 of SEQ ID NO: l, 60-254 of SEQ ID NO: l, 70-254 of SEQ ID NO: l, 85-254 of SEQ ID NO: 1, 97-254 of SEQ ID NO: 1, 125-254 of SEQ ID NO: 1, 136-254 of SEQ ID NO: 1, 186-254 of SEQ ID NO: l, or 210-254 of SEQ ID NO: l . In embodiments, the first segment has at least 90% identity with a segment of SEQ ID NO: 1 that begins with one of amino acids 34 of SEQ ID NO: 1, 60 of SEQ ID NO: 1, 70 of SEQ ID NO: 1, 85 of SEQ ID NO: 1, 97 of SEQ ID NO: l, 125 of SEQ ID NO: 1, 136 of SEQ ID NO: 1, 186 of SEQ ID NO: 1, or 210 of SEQ ID NO: 1 and ends with an amino acid from 254 of SEQ ID NO: 1 to 277 of SEQ ID NO l .
In embodiments, the second segment comprises a contiguous amino acid sequence of SEQ ID NO: 1 that begins with amino acid number 1, 2, 3, or 4 of SEQ ID NO: 1 and ends with amino acid number 33, 59, 69, 84, 96, 124, 135, 185, or 209 of SEQ ID NO: 1. In embodiments, the second segment ends at amino acid 96 or amino acid 124 of SEQ ID NO: l . In embodiments, the second segment has at least 90% identity with a segment of SEQ ID NO: 1 that begins with amino acid number 1, 2, 3, or 4 of SEQ ID NO: 1 and ends with amino acid number 33, 59, 69, 84, 96, 124, 135, 185, or 209 of SEQ ID NO: 1.
The term "fusion" and "fuse" as used herein mean a protein that contains amino acid segments from distinct sources, wherein the proteins are made using recombinant molecular biology approaches that adapt standard approaches that are known in the art. It is not intended to mean chemical formation of polypeptides, such as by non-protein translation approaches, such as solid or solution phase based peptide synthesis approaches. Likewise, the fusion proteins are not made by chemical conjugation of pre-existing peptides in the absence of translation.
As described above, in certain approaches a segment from a C-terminal region of the wild type protein is moved to a position that is N-terminal to said wild type C-terminal region, and vice versa. But in alternative embodiments the wild type orientation can be maintained, provided first and second segments are included and are separated from one another, as described further herein. In embodiments, a fusion protein described herein does not contain only one RBP or MBP segment, i.e., the fusion proteins comprises more than one RBP or MBP segment which are separated from each other by intervening amino acids that are not RBP or MBP amino acids, such as linkers and target proteins described further below. Without intending to be bound by any particular feature, it is consider that this disclosure comprises improvements in increasing protein expression and/or solubility that are distinct from certain other approaches, such as those described in PCT/US 16/56832, published as WO 2017/066441. In more detail, in one non-limiting and representative approach, the present disclosure presents a novel approach to incorporating an expression tag into a fusion protein. In one approach the disclosure provides a circular permutant. In embodiments circular permutants are used in a novel purification system which utilizes split Histidine (His) tags fused to each of the N- and C-termini of the fusion protein, which is referred to in some embodiments as a split His tag. The present system is applicable to any expression tag, including but not limited to RBP and MBP.
In certain embodiments, fusion proteins produced according to the methods of this disclosure have improved and/or different characteristics that relate at least in part to the discontinuous inclusion of two segments of the RBP or the MBP in the fusion protein. In non-limiting examples, such improvements can be detected by comparison to a suitable reference (i.e., a control or control value). In embodiments, the reference is a value based on one or more properties of a fusion protein that comprises only one segment of the RBP or the MBP and a target protein. In embodiments, the reference can include a standardized value or curve(s), and/or experimentally designed controls such as a known or determined expression value for a protein, such as a target protein, wherein the expression is measured for the target protein without it being in a fusion protein that contains two discontinuous segments of the RBP or the MBP. A reference value may also be depicted as an area on a graph, or a value obtained from an elution profile, or a solubility value, or a protein degradation value, and/or the total amount of protein that is expressed and/or recovered from an expression system, such values being determined based on any suitable parameter, such as the mass, moles, etc. of the protein that is produced and/or separated from the expression system. In non-limiting embodiments fusion proteins can be evaluated using any suitable approaches, which include but are not limited to Western blotting, spectroscopy (such as circular dichroism, fluorescence, absorbance, MR,), circular dichroism, mass spectrometry, Gel electrophoresis under denaturing conditions, gel electrophoresis under non-denaturing conditions, 2D gel electrophoresis, chromatography, including but not limited to cation-exchange
chromatography, high-performance liquid chromatography (HPLC), chromatography-mass spectroscopy (LC/MS), immunological methods, and analysis of resistance to degradation using a variety of approaches known to those skilled in the art. In embodiments, the fusion proteins can be evaluated based on actual or predicted ability to bind to sugar, i.e., ribose for RBP and maltose for MBP.
In embodiments, the disclosure relates to fusion proteins that comprise RBP segments or derivatives thereof such that they retain sufficient homology to WT RBP (such as RBP expressed by Thermoanaerobacter tengcongensis (tteRBP, described further below) that when they fold together (i.e., a tertiary structure is formed) a functional ribose binding pocket is preserved. The structure of RBP, and its residues that contribute to ribose binding, are known in the art. (See, for example, "The backbone structure of the thermophilic
Thermoanaerobacter tengcongensis ribose binding protein is essentially identical to its mesophilic E.coli homolog." BMC Structural Biology (2008) 8:20; and Analysis of ligand binding to a ribose biosensor using site-directed mutagenesis and fluorescence spectroscopy. Protein Science (2007) 16, 362-368, the descriptions of each of which are incorporated herein by reference). In embodiments, a fusion protein of this disclosure binds more ribose relative to a fusion protein that comprises only one RBP segment. In embodiments, a fusion protein of this disclosure that is, for example, bound to a metal due to the inclusion of one or more His tags is in a non-covalent association with one or more ribose molecules. In embodiments, a fusion protein that is separated from a binding partner such as a suitable metal is in a non- covalent association with one or more ribose molecules. In embodiments, a fusion protein of this disclosure that is in a non-covalent complex with ribose molecules is more stable and/or is more soluble than a fusion protein that contains only one RBP segment. In an embodiment ribose is added to, for example, a cell lysate prior to or during a fusion protein
separation/isolation process. In embodiments, ribose is added to a cell culture medium in which a fusion protein of this disclosure is being expressed. In certain embodiments, an fusion protein comprising two RBP segments includes one or more of E. coli RBP amino acids S9, N13, F 15, F16, N64, D89, S103, 1132, F 164, N190, F214, D215 and Q235, or the T. tengcongensis RBP amino acids that are the equivalents thereof. In embodiments, an RBP segment of this disclosure binds specifically to D-ribose. In embodiments, the amino acid sequence of an RBP protein of this disclosure comprises or consists of SEQ ID NO: l, which is RBP produced by T. tengcongensis. The amino acid residues of this amino acid sequence can be compared by those skilled in the art to the RBP sequence of RBP produced by E. coli, which is known in the art and can be found, for example, under GenBank accession number SMH27141.1, the amino acid sequence from which is incorporated herein by reference as of the filing date of this application or patent. In this regard, the ribose binding residues of RBP produced by E. coli that are involved in the ribose binding pocket comprise S9, N13, F15, F 16, N64, D89, S 103, 1132, F164, N190, F214, D215 and Q235, and the homologous amino acids in tteRBP can be readily recognized by comparison to the E. coli sequence.
With respect to ribose binding, in a specific and non-limiting example, amino acids 17 and 18 and 217 and 218 of SEQ ID NO: l and a number of amino acids between 18 and 217 are considered to be necessary for RBP to bind to ribose. Because the two segments in the present invention together include the amino acids of SEQ ID NO: 1 numbered 4 to 254, which includes the aforementioned amino acid residues (in contrast to the linear RBP in described in WO 2017/066441) and because the two segments are capable of interacting with each other and adopting a suitable tertiary structure for ribose binding (unlike the segments described in the published PCT application WO 2013/101915), absent certain modifications to the sequence of the two segments, the RBP formed when the two segments fold together will be capable of binding ribose. However, it should be understood that ribose binding is not required for the two segments of RBP to fold together properly. In this regard, it has been demonstrated by the inventors that the residues 17+18, and residues 217+218 can be been modified in RBP creating mutants which cannot bind ribose but are still folded and remain stable. It is expected that this approach will apply to the folding of two segments wherein one or more of the residues 17, 18, 217 and 218 have been similarly mutated (i.e., they will still be able to fold together properly and be stable). Thus, the disclosure includes such mutated proteins. In one embodiment, the disclosure includes a mutation that is a Cys to Ser alteration relative to a native sequence RBP sequence, such as a Cys to Ser alteration at position 101 in SEQ ID NO: l (position 102 in SEQ ID NO:2).
Gene and protein structures
Figure 1 compares one embodiment of this disclosure (Figure 1, panel B) with a linear tag, such as that described in PCT/US16/56832 published as WO 2017/066441. (Figure 1, panel A). In the linear tag, the target protein gene is appended to either the 3 '-end of the RBP gene (shown as top linear RBP tag in Figure 1A) or the 5 '-end of the RBP gene (shown as bottom linear RBP tag in Figure 1 A). The RBP gene encodes for full-length RBP (amino acids [AA] 1-277, in normal, sequential order, or at a minimum, encodes the RBP amino acids 34 [Gly] to 210 [Gin]). RBP and the target protein are separated by a peptide linker (labeled 'link' in Fig. 1) and a protease cleavage site (labeled 'cleave' in Fig. 1), to enable recovery of the untagged target protein. A nucleotide sequence encoding for a full histidine tag (typically 6-8 His residues) is placed at the beginning or end of the gene to facilitate purification.
In contrast, in the split, circularly-permuted tag of this disclosure (using RBP as a representative solubility tag), the target protein gene is inserted internally into the RBP gene (Figure IB), and thus can be used to produce a fusion protein encoded by the gene with the same protein orientation. In addition, the RBP gene can be rearranged such that it encodes for an RBP protein that is permuted.
The disclosure includes variations of amino acid positions that are expressly described herein, so long as the fusion protein includes properties that are improved relative to a reference.
In one embodiment the RBP gene is rearranged such that it encodes for an RBP protein that is circularly permuted at amino acid position 97. The amino acid sequence of permuted RBP in certain embodiments begins with amino acid 97 (numbered according to the wild-type RBP sequence), continues through amino acid 277, through a linker sequence of variable composition (the target protein can be inserted here), to amino acid number 1, and ends with amino acid 96. The target protein gene is flanked by two nucleotide sequences that each encode for peptide linkers and a protease cleavage site, to facilitate recovery of the untagged target protein. A sequence encoding a split-His tag can be placed at each end (i.e., C- and N-termini) of the final gene. The design and rationale for an embodiment of the split- His tag is described below. Representative fusion proteins expressed by the genes in Figure 1 are shown schematically in Figure 2. In an embodiment, the 97-277 segment can be C- terminal to the RBP 1-96 segment. An optional linker can be inserted between the split-His tag and the adjacent segment of RBP.
For E. coli protein expression systems, a methionine will generally be added to the N- terminus of the fusion protein. In the split, circularly permuted tags described here, the methionine precedes the first split His tag or, if a split His tag is not in use, the first segment of RBP or MBP. In some embodiments, the N-terminal methionine is not counted in the amino acid numbering of the protein (SEQ ID NO: 1 does not include the first Met). Some of the DNA sequences given herein for expression of proteins include a stop codon at the 3 ' end. A plasmid containing the DNA sequence does not need to include that stop codon.
Internal fusion vs. end-to-end fusion
In the disclosure, the target protein is inserted internally into RBP (Figures IB and 2B), whereas the linear system of the 832 PCT application published as WO 2017066441 places the two proteins end-to-end (Figs. 1 A and 2A). In the current system, and without intending to be constrained by any particular theory, it is considered that the RBP folds by docking of the 1-96 and 97-277 fragments, which extend from both termini of the target protein. This effectively yields a closed, topologically circular protein in which the target protein is protected from exoprotease attack at both its N- and C- termini by the presence of the extremely stable RBP protein (Figure 3A). Likewise if the RBP tag is circularly permuted at AA 125, the RBP folds by docking of the 1-124 and 125-277 fragments, which extend from both termini of the target protein. Circular permutation vs. normal amino acid sequence of RBP
The same benefits of internal fusion could be achieved by inserting the target protein into position 97 of the normal RBP sequence, i.e. (RBP 1 -96)-(target protein)-(RBP 97-277) (Figure 2C), instead of the permuted RBP sequence, i.e. (RBP 97-277)-(target protein)-(RBP l-96)(or into position 125 of the normal RBP sequence). In the former, the target protein is still protected from exoprotease degradation by the RBP protein at both its N- and C-termini. The circular permutation is employed in order to make a unique, high-affinity binding site (split-His tag) that will allow us to specifically purify the full-length protein, and reject those that are truncated either by protease cleavage or by incomplete translation. Although embodiments excluding amino acids 1-33 and/or amino acids 21 1-277 will dock properly, they will be unable to bind ribose, and as a result will likely be less stable than embodiments containing both these segments
In various embodiments, one segment of a fusion protein comprises amino acids 34- 96 of the RBP, while another segment comprises amino acids 97-211. In various
embodiments, one segment of a fusion protein of this comprises amino acids 34-124 of the RBP, while another segment comprises amino acids 125-211. These variations can be made in the context of the split permuted RBP: wherein the "RBP (97-277)" segment is engineered to comprise or consist of RBP amino acids 97-211, and/or wherein the "RBP (1-96)" is engineered to comprise or consist of RBP amino acids 34-96, or wherein the "RBP (125- 277)" segment is engineered to comprise or consist of RBP amino acids 125-21 1, and/or wherein the "RBP (1-124)" is engineered to comprise or consist of RBP amino acids 34-124. One of the two segments may be engineered to begin with any amino acids between 1 and 33 inclusive and end at the permutation site, and the other of the two segments may be engineered to start after the permutation site and end at any AA between 210 and 277 inclusive.
Other expression tags, such as MBP (e.g., pfu MBP) and GST, can be circularly permuted for the purposes of protein expression, including for enabling the effective use of split His tags. In one embodiment the MBP gene is rearranged such that it encodes for an MBP protein that is circularly permuted at amino acid position 126 (Figure 3C). The amino acid sequence of permuted MBP in certain embodiments begins with amino acid 126 (numbered according to the wild-type MBP sequence), continues through amino acid 379, through a linker sequence of variable composition (the target protein can be inserted here), to amino acid number 1, and ends with amino acid 125. The target protein gene is flanked by two nucleotide sequences that each encode for peptide linkers and a protease cleavage site, to facilitate recovery of the untagged target protein. A split-His tag is placed at each end (i.e., C- and N-termini) of the final gene. In an embodiment, the N-terminus of the 1-125 segment of the MBP is truncated by one or more amino acids, such as, for example by 1, 2, 3, 4, etc. up to about 34 AAs, while the C-terminus of the 126-379 segment of the MBP is truncated by one or more amino acids, such as, for example by 1, 2, 3, 4, etc. up to about 60 AAs. These variations can be made in the context of the split permuted MBP.
Circular permutes of many proteins are less stable than the non-permuted protein. Circular permutes of some proteins from thermophilic organisms, however, such as tte-RBP (from Thermoanaerobacter tengcongensis) and PfuMBV (from Pyrococcus furiosus), are very stable.
Split His-tag vs. His-tag
In embodiments of this disclosure, a "Split-His tag" means a His-tag that is divided between the N- and C- termini of the fusion protein. In certain embodiments, each of the two portions of the split His-tag comprises an adequate length of Histidines such that when the two portions are adjacent to one another recovery of the fusion protein is greater than a suitable control. In an embodiment, each split-His tag comprises a length of Histidines that is too short for stable binding to nickel ions that have been attached to beads.
In more detail, a His-tag is a linear sequence of n histidine residues where n is typically 6-8. His-tags achieve purification by binding specifically to nickel or cobalt ions that have been attached to beads. In all His-tag purification systems described to date, the His-tag placed at the N-terminus of the protein, at the C-terminus of the protein, or occasionally in the middle. The current system employs two split-His that are arrayed in close proximity and in approximately parallel orientation, by virtue of the structure of circularly permuted RBP. The distinction between split-His tag and conventional His-tag is that the two split-His tags must be very close to each other, such that the two tags can cooperatively bind the same, or nearby (on a molecular scale), nickel ion(s). Because the two split-His tags cooperatively bind, they act almost as a single His tag with a number of His equal to the sum of the number of His in the two split-His tags. For example, if each split His tag contains three His residues, their cooperative binding strength is close to or equal to that of a single His tag with six residues. To our knowledge, no expression system exists that has this feature. Further, engineering a split His tag into any recombinant protein, regardless of whether or not the other elements of the fusion proteins of this disclosure are included in the protein, is encompassed by this invention. Note that if one His-tag is placed at each terminus of the linear RBP-target protein fusion (Fig. 2), the two His-tags will not by physically close to each other and will therefore not bind cooperatively.
When a protein is circularly permuted, two sequential amino acids of the parent protein (typically in a surface loop) become the new amino and carboxy termini of the permuted protein. Therefore, the termini of a permuted protein are always close in space. If one attaches a split-His tag to each terminus, these tags are expected to project outward in roughly parallel orientation and be very close to each other (Fig. 2B). This tandem
arrangement of 2 x split-His binds nickel more tightly than a single His tag of the same number of His residues as each split His tag. What this means is that the full-length protein binds more tightly to nickel beads (or other appropriate stationary phase) than truncated proteins (which will contain only one or neither of the split-His tags). The full-length protein can then be selectively purified from fragments by a gradient of eluent (e.g. imidazole), represented in Figures 4 and 5.
Split His tags of equal length tend to work optimally for purification because both split His tags have an equal affinity to the nickel substrate of the column and as a result will release from the substrate under the same conditions and at the same time. In one
embodiment, each split-His tag contains two, three, four, five, six, seven or eight His residues. In one embodiment, each split-His tag contains 2 to 20 His residues. The present disclosure, however, does not preclude split His tags of unequal length, such as one split-His tag containing two residues and the other containing three residues, or one split-His tag containing three His residues and the other split-His tag containing five, etc., as performed for Figure 5. An optional linker can be inserted between the split-His tag and the
adjacent segment of RBP.
Native proteins that are expressed by the cell being used for protein production may be rich in His and may therefore bind naturally to the nickel (or other suitable metal, such as cobalt) substrate. In order to make it easier to separate these proteins from the fusion protein, the disclosure includes use of split His tags that contain a total of more than six His residues. For example, the disclosure includes use two six or two eight residue split His tag, one on each end of the fusion protein. In such embodiments, a higher concentration of, for example, imidazole can be used to elute the native, His-rich proteins that have bound opportunistically to the nickel column than can be used when split His tags with fewer His residues are used.
One advantage of the split-His tag circularly permuted RBP -target fusion protein production system is that single column purification is possible. (See, for example, representative and non-limiting embodiments described below under "One column purification of the target protein" and data shown represented by Figure 12). Truncated fusion proteins will only have a single split His tag and will therefore only bind loosely to the nickel column's beads. These truncated fusion proteins and any His-rich native proteins can be eluted away using an eluent gradient. After eluting away the undesired fusion protein fragments, an appropriate protease can be run through the column to cleave the target protein from the RBP tags and release it from the column and into the mobile phase (e.g., buffer). If the protease contains a His tag of an appropriate length (e.g., six), it will bind to the column, either on the first pass or on a subsequent pass of the mobile phase through the column, thereby separating it from the released target protein. In some cases, the target protein may be nicked by proteases in the cell used for expressing the fusion protein. In that case there may be full-length target protein mixed with fragments of the target protein. Additional steps, using any of the techniques known to those skilled in chromatography and/or filtration, may be necessary to separate the fragments from the full-length target protein. For Instance, the heparin resin can be used to purify P53 further. Ion exchange, size exclusion, or affinity chromatography can also be used for purification, depending on the protein one wants to purify. The foregoing is applicable to a split-His tag circularly permuted RBP-target fusion protein production system. In certain embodiments of the disclosure as illustrated by the Figures, we used affinity chromatography using heparin resin to purify P53 and the size exclusion chromatography to purify MDM2 and Lect2 protein.
Circular permutation at other positions (Figure 10)
A circular permutant can be created by permuting the amino acid sequence at any position, although it is preferable to permutate surface loops to avoid perturbing protein structure. RBP has many surface loops (15) from which to choose when making a circular permutant. An aspect of this disclosure is our discovery that positions 97 and 124 are considered to be preferable sites to permute RBP due to their ability to yield a combination of stability, solubility, and foldability in the permutated proteins. Using a screening method that we developed [Ha et al. (2015), Chemistry & Biology 22, 1384] we discovered that position 97 is a favorable position to break the RBP sequence. It is possible to create similar constructs as that shown in Fig. 1 by permuting RBP at the other sites described in the above study, and this invention covers those designs as well. Other permutation sites on RBP include 34 (i.e., between AAs 33 and 34), 60, 125, 137, 186, and 210. The permutation can be within several AAs to either side of the aforementioned sites, as long as it is within the surface loops that comprise those sites (e.g., it can be at AA 121, 122, 123, 124, 126, 127, 128, 129, or 130 instead of at 125 in RBP). In embodiments where there is no permutation of RBP, the target protein and flanking nucleotides are inserted into the RBP at the
aforementioned sites, or at another suitable site within the RBP. The same applies to MBP, which can be permuted at any of its loops, such as at 55, 82, 126, and 204.
Split His tags are to be employed with a circularly permuted tag, is the proximity and relative orientation of the N-terminus of the leading segment (e.g., the 125-277 segment of RBP) and the C-terminus of the trailing segment (e.g., the 1-124 segment of RBP) after the two segments fold together. If the N- and C-termini are oriented roughly parallel and are adjacent to each other, the split His tags will be roughly parallel and adjacent to each other and will generally work well. If the N- and C-termini are neither, the split His tags may not function optimally or at all. Thus, the disclosure provides modifying properties of the proteins using suitable length linkers, as described elsewhere herein.
Monomer vs. domain-swapped oligomer
In certain examples in which we inserted "lever" proteins into surface loops of
"assembler" proteins (including RBP) we developed a technology by which such insertions would cause RBP to form domain-swapped dimers and oligomers (described in US patent application no. 14/369,408; "the 408 application" published as WO/2013/101915). A purpose of this technology was to create self-assembling, domain-swapped biomaterials. This employed very short linkers (0-3 amino acids in length) to fuse lever proteins (with unusually long amino-to-carboxy terminal distances) into internal positions of assembler proteins. The lever protein then tears the assembler protein in two and holds the pieces so far apart that they cannot refold with each other within the same molecule. They are forced to refold with other molecules (domain swap).
In contrast to the '408 application, in the present invention, longer linkers are used
(i.e., 15-30 amino acids, or longer, which can include the protease cleavage site if present) to join the target protein to the RBP segments. This allows RBP to accommodate target proteins with even the longest amino-to-carboxy distances without domain swapping (Fig. 2). In this regard, and without intending to be bound by any particular theory, the disclosure includes fusion proteins that are designed to be monomeric to achieve the benefits of split-His tag technology. In particular, the linkers and cleavage site are flexible enough and long enough to allow the two, separated and permuted sections of RBP become adjacent each other and fold to form a permuted and non-permuted RBP. In an embodiment, the linkers that flank the RBP, including both peptide linkers and protease cleavage (or the nucleotides coding therefore), are greater than the longest amino-to-carboxy dimension within the target protein. In an embodiment, the linkers that flank the RBP, including both peptide linkers and protease cleavage (or the nucleotides coding therefore), can be 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more amino acids in length.
In more detail, with respect to the linkers that can be used with embodiments of this disclosure, it is preferable for the linkers to be flexible. In certain approaches, appropriate linkers are rich in small or polar amino acids such as Gly and Ser to provide suitable flexibility. Thus, the amino acid composition of the linkers is not particularly limited. Certain exemplary linker sequences are provided in the amino acid sequences and figures of this disclosure, which are not intended to limit the amino acid composition of the linkers. Further, approaches to design of flexible linkers are known in the art. (See, for example, Klein, et al. "Design and Characterization of Structured Protein Linkers with Differing Flexibilities." Protein Engineering, Design and Selection 27.10 (2014): 325-330, the disclosure of which is incorporated herein by reference).
In embodiments, the combination of the two linkers collectively include at least 30 amino acids, and thus are substantially longer than previous linkers that have been described with fusion proteins that include segments of RBP. In certain embodiments, the disclosure relates to configurations of a fusion protein wherein the two discontinuous RBP segments are be able to fold together (i.e., adopt a suitable tertiary structure such that the ribose binding pocket remains functional). In embodiments, linker sequences can comprise protease recognitions sites as described elsewhere herein. Without intending to be constrained to any particular theory, it is considered that the total number of amino acids in the linkers (and any protease sites if included) is approximately 30 amino acids in total when the end of the segment of RBP corresponding to the C terminus segment (such as of SEQ IN NO: 1) is spatially proximal to amino acid 277 of SEQ ID NO: l . The 30 amino acids can be distributed between the linkers in any way, with the first and second linkers (plus protease sites if included) being between 0 and 30 amino acids long, again provided that the total is at least about 30 amino acids. In certain approaches it is preferable that there be at least a short (about 3, 4, 5, 10) linker between each termini of the target protein. In embodiments, the linkers and any protease sites if present together are about 20 amino acids longer than 30 if the segment of RBP corresponding to the C terminus segment of SEQ IN NO: 1 ends at or near amino acid 254 (about 20 amino acids longer). This is because, and again without intending to be constricted by theory, in a folded protein of SEQ ID NO: 1 beginning at amino acid number 4 and ending at amino acid number 254, the N and C termini are farther away from each other than in a folded protein of SEQ ID NO: 1 that begins at amino acid number 4 and ends at amino acid number 277.
In particular, the length of the linkers can be adapted to account for the length of the RBP or MBP protein segments that are included in the fusion protein/encoded by the expression vectors. As a non-limiting example, if in certain embodiments, the first and second RBP segments collectively include 277 RBP amino acids, such as those depicted in SEQ ID NO: 1, it is considered that total 30 amino acids of linker length is considered adequate. If for example, RBP amino acids are not included, such as by omitting the last 23 amino acids (i.e., 255 to 277), then the linker can be extended to substitute for those amino acids. In a non-limiting approach if the final RBP amino acid in a segment of the fusion protein is 254, a linker can be extended by an additional 23 amino acids. Similar linker length modifications can be made if other RBP amino acids are omitted. The same approach applies to MBP as well.
In a further embodiment, the disclosure includes a recombinant DNA molecule, such as an expression vector, encoding a fusion protein, comprising operatively-linked at least one nucleotide sequence coding for a target polypeptide at least one nucleotide sequence coding for the RBP segments as described herein.
Polynucleotide sequences are operatively-linked when they are placed into a functional relationship with another polynucleotide sequence. For instance, a promoter is operatively-linked to a coding sequence if the promoter affects transcription or expression of the coding sequence. Generally, operatively-linked means that the linked sequences are contiguous and, where necessary to join two protein coding regions, both contiguous and in reading frame. However, it is well known that certain genetic elements, such as enhancers, may be operatively-linked even at a distance, i.e., even if not contiguous. Promoters of the present disclosure may be endogenous or heterologous to the host, and may be constitutive or inducible. The appropriate promoter and other necessary vector sequences are selected so as to be functional in the host. Examples of workable combinations of cell lines and expression vectors include but are not limited to those described Sambrook, J., et al., in "Molecular Cloning: A Laboratory Manual" (1989, 4th edition: 2012)-, Eds. J. Sambrook, E. F. Fritsch and T. Maniatis, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, or Ausubel, F., et al., in "Current Protocols in Molecular Biology" (1987 and periodic updates), Eds. F. Ausubel, R. Brent and K. R. E., Wiley & Sons Verlag, New York; and Metzger, D., et al., Nature 334 (1988) 31-6. Many useful vectors for expression in bacteria, yeast, mammalian, insect, plant or other cells are known in the art and may be obtained from vendors including, but not limited to, Stratagene, New England Biolabs, Promega Biotech, and others. In addition, the construct may be joined to an amplifiable gene so that multiple copies of the gene may be obtained. Thus, and without intending to be constrained by any particular theory, it is considered that one of the advantages of using highly soluble proteins such as RBP and MBP as overexpression tags as described herein is that they are so soluble that a stronger expression promoter, such as the T7 promoter (T7P in Figure 1), can be used to drive protein production to very high levels. We have discovered that the presently described approaches facilitate expression of so much of the RBP fusion protein (Figure IB) that any native E. coli proteins that are present are at very small concentrations, making purification easier. However, any other suitable promoters (ranging from strong to weak promoters) can be used in the expression vectors of this disclosure, some examples of which include but are not limited to promoters that are provided with commercially available expression vectors, such as the Pm/xylS promoter from Vectron Biosolutions. Other specific examples are known and are described in, for example, "A comparative analysis of the properties of regulated promoter systems commonly used for recombinant gene expression in Escherichia coif Microbial Cell Factories, 201312:26, from which the disclosure of promoters is incorporate herein by reference. The promoters used in embodiments or the disclosure may be constitutive promoters, or they may be inducible.
Furthermore, the expression systems are not limited to prokaryotic systems, and thus may be configured for expression in eukaryotic systems, such as yeast, animal systems such as baculovirus-insect cell systems, mammalian cell expression systems, and cell free expression systems that are known in the art and that, when given the benefit of the present disclosure, can also be used. Suitable expression vectors are known in the art and can be adapted for use in methods of this disclosure.
Expression of the proteins can be also be scaled to produce any desired amount of the proteins, such as by batch scaling, and can be used to produce milligram, gram, or kilogram quantities of the proteins. Such quantities can refer to production of the fusion protein, or of the target protein if the target protein is separated from the fusion protein. In more detail with respect to expression systems, DNA constructs prepared for introduction into a host typically comprise a replication system recognized by the host, including the intended DNA fragment encoding the desired target fusion peptide, and will can also include transcription and translational initiation regulatory sequences operatively-linked to the polypeptide encoding segment. Expression systems (expression vectors) may include, for example, an origin of replication or autonomously replicating sequence (ARS) and expression control sequences, a promoter, an enhancer and necessary processing information sites, such as ribosome-binding sites, RNA splice sites, polyadenylation sites, transcriptional terminator sequences, and mRNA stabilizing sequences.
Expression and cloning vectors can contain a selectable marker, a gene encoding a protein necessary for the survival or growth of a host cell transformed with the vector, although such a marker gene may be carried on another polynucleotide sequence co- introduced into the host cell. Only those host cells expressing the marker gene will survive and/or grow under selective conditions. Typical selection genes include but are not limited to those encoding proteins that (a) confer resistance to antibiotics or other toxic substances, e.g., ampicillin, tetracycline, etc.; (b) complement auxotrophic deficiencies; or (c) supply critical nutrients not available from complex media. The choice of the proper selectable marker will depend on the host cell, and appropriate markers for different hosts are known in the art.
The expression vectors containing the polynucleotides of interest can be introduced into the host cell by any method known in the art. These methods vary depending upon the type of cellular host, including but not limited to transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, other substances, and infection by viruses. Large quantities of the polynucleotides and polypeptides may be prepared by expressing the polynucleotides in compatible host cells. The most commonly used prokaryotic hosts are strains of Escherichia coli, although other prokaryotes, such as Bacillus subtilis may also be used.
Construction of a vector according to the present disclosure employs conventional ligation techniques. Isolated plasmids or DNA fragments are cleaved, tailored, and religated in the form desired to generate the plasmids required. If desired, analysis to confirm correct sequences in the constructed plasmids is performed in a known fashion. Suitable methods for constructions expression vectors, preparing in vitro transcripts, introducing DNA into host cells, and performing analyses for assessing expression and function are known to those skilled in the art. The DNA construct comprise linker peptides as illustrated herein. As described above, the linkers and cleavage site are flexible enough and long enough to allow the two, separated and permuted sections of RBP become adjacent each other and fold to form a permuted RBP.
In cases where it is desired to release one or all of the solubility and expression tags out of a fusion protein, the linker peptide(s) can be constructed to comprise a proteolytic cleavage site. Thus, a recombinant DNA molecule, such as an expression vector, encoding a fusion protein comprising at least one polynucleotide sequence coding for a target polypeptide, a polynucleotide sequence coding for the RBP- solubility tags as described herein, and additionally comprising a nucleic acid sequence coding for a peptidic linker comprising a proteolytic cleavage site, represents a non-limiting embodiment of this invention. In certain embodiments, the expression vector comprises codons optimized for expression in the host cell.
As discussed above, fusion proteins of this disclosure may or may not contain protease recognition sites. If a protease recognition site is included it can be comprised within a linker sequence. Suitable protease recognition sites are known in the art and can be adapted with embodiments of this disclosure. In embodiments, the protease recognition site can comprise a site that is recognized by any of plant, viral, bacterial and/or animal proteases. Animal proteases include acid proteases secreted into the stomach (such as pepsin) and serine proteases present in duodenum (trypsin and chymotrypsin). Proteases present in blood serum (thrombin, plasmin, Hageman factor, etc.) recognize sites that can also be used. Other proteases are present in leukocytes (elastase, cathepsin G), and some venoms also contain proteases, such as pit viper haemotoxin; sites that are recognized by such proteases are included in the disclosure. It will also be recognized that amino acid sequences recognized by proteases expressed by bacteria in the gut of various animals, including humans, or by the animals themselves in various parts of their anatomy, such as their gut, digestive system or circulatory system, can also be incorporated into the fusion proteins. In such cases, the separation of the target protein from the fusion protein can occur in that part of the animal's anatomy. Thus, in embodiments, a target protein of this disclosure can comprise a protein- based pro-drug (or other biologically active protein) which is activated via liberation from the fusion protein only once it is administered to an animal that expresses the cognate protease. Protease recognition sites that can be used in this invention are known in the art. For example, see the table of protease recognition sites available at www.proteinsandproteomics.org/content/free/tables_l/tablel l .pdf, the disclosure of which is incorporated herein by reference.
In specific but non-limiting embodiments, protease cleavage sites that can be used in embodiments of this disclosure include Tobacco etch virus (ENLYFQ/G; SEQ ID NO: 16, Enterokinase site (DDDDK/ SEQ ID NO: 13), Factor Xa site IEGR/ (SEQ ID NO: 14) and Thrombin (LVPR/GS SEQ ID NO: 15).
Protease sequences (or other cleavage sites) that are not included in the target protein can be designed and included by analysis of the amino acid sequence of the target protein, thus avoiding or minimizing cleavage of the target protein. In embodiments, publicly available tools for protease sites can be used to determine protease cleavage sites, such as PeptideCutter (available at web.expasy.org/peptide_cutter/).
In other embodiments, the fusion proteins can comprise amino acid sequences that can be cleaved to, for example, liberate the target protein, but not necessarily by a protease, and thus may be cleaved non-enzymatically. Such sequences can be included in the linkers. In certain embodiments, such sequence can be, for example, particularly susceptible to acid hydrolysis, or by exposure to other chemicals, or by heat treatment. In certain approaches the fusion proteins comprise sequences that are designed to be exclusively or preferentially cleaved by cyanogen bromide, which cleaves peptide bonds after a methionine. Likewise, the fusion proteins may be designed to be exclusively or preferentially cleaved at tryptophanyl, aspartyl, cysteinyl, and/or asparaginyl peptide bonds. Acids such as trifluoroacetic acid and formic acid may also be used for such non-enzymatic proteolysis. Approaches such as these can be adapted to alter conditions in which a fusion protein of this disclosure is treated, such as by modifying pH, temperature, salt concentrations and the like so that preferential cleavage of the target protein can be achieved. Combinations of these cleavage mechanisms or approaches can be used in a single fusion protein, including incorporating different cleavage mechanisms between the target protein and each of the RBP segments or incorporating more than one cleavage mechanism between the target protein and one or both of the RBP segments.
The invention is demonstrated using several target proteins as described in the Examples. These include Leukocyte Cell Derived Chemotaxin 2 (LECT2), Human mouse double minute 2 homolog (MDM2) also known as E3 ubiquitin-protein ligase Mdm2, p53, hRAS, actin and GTPase-activating protein (GAP). Thus, the disclosure demonstrates embodiments with proteins of vastly different amino acids compositions, sizes and function. Accordingly, it is expected that the target protein that is included in the fusion proteins of this disclosure may be any polypeptide of interest. In embodiments, a target polypeptide according to the present disclosure may be any polypeptide required or desired in larger amounts and therefore may be difficult to isolate or purify from other sources. Non-limiting examples of target proteins that can produced by the present methods include mammalian gene products, such as enzymes, cytokines, growth factors, hormones, vaccines, antibodies and the like. In embodiments, overexpressed gene products of the present disclosure include gene products such as p53, erythropoietin, insulin, somatotropin, growth hormone releasing factor, platelet derived growth factor, epidermal growth factor, transforming growth factor a, transforming growth factor 13, epidermal growth factor, fibroblast growth factor, nerve growth factor, insulin-like growth factor I, insulin-like growth factor II, clotting Factor VIII, superoxide dismutase, a-interferon, γ-interferon, interleukin-1, interleukin-2, interleukin-3, interleukin-4, interleukin-5, interleukin-6, granulocyte colony stimulating factor, multi- lineage colony stimulating activity, granulocyte-macrophage stimulating factor, macrophage colony stimulating factor, T cell growth factor, lymphotoxin and the like. In embodiments overexpressed gene products are human gene products. The present methods can readily be adapted to enhance secretion of any overexpressed gene product which can be used as a vaccine. Overexpressed gene products which can be used as vaccines include any structural, membrane-associated, membrane-bound or secreted gene product of a mammalian pathogen. Mammalian pathogens include viruses, bacteria, single-celled or multi-celled parasites which can infect or attack a mammal. For example, viral vaccines can include vaccines against viruses such as human immunodeficiency virus (HIV), vaccinia, poliovirus, adenovirus, influenza, hepatitis A, hepatitis B, dengue virus, Japanese B encephalitis, Varicella zoster, cytomegalovirus, hepatitis A, rotavirus, as well as vaccines against viral diseases like measles, yellow fever, mumps, rabies, herpes, influenza, parainfluenza and the like. Bacterial vaccines can include vaccines against bacteria such as Vibrio cholerae, Salmonella typhi, Bordetella pertussis, Streptococcus pneumoniae, Hemophilus influenza, Clostridium tetani, Corynebacterium diphtheriae, Mycobacterium leprae, R. rickettsii, Shigella, Neisseria gonorrhoeae, Neisseria meningitidis, Coccidioides immitis, Borellia burgdorferi, and the like. A target polypeptide may also comprise sequences; e.g., diagnostically relevant epitopes, from several different proteins constructed to be expressed as a single recombinant polypeptide.
In embodiments, the target protein can comprise a protein that can be suitable for use as a nutraceutical, a dietary or other food supplement, a food additive, a filler, a binder, or for any purpose related to human and non-human animal nutrition. In an embodiment, the target protein is intended for human consumption, or for veterinary purposes, including but not limited to the purposes of providing a feed, feedstock, a dietary supplement, or other food component to, for example, animals that are used in an agricultural industry, or for companion animals. In embodiments, the non-human animals are bovine animals, poultry, porcine animals, felines, canines, equine animals, or fish. In embodiments, the protein can be comprised within intact cells, such as in a cell culture, or in can be provided as a cell lysate. In embodiments, cells that produce the protein can be used as a probiotic agent, which could be for instance fed to a recipient, and/or could be used as an inoculant so that that the cells could colonize for example some or all of the gastrointestinal tract of the animal (or elsewhere) and provide an ongoing supply of the target protein, whether or not it remains as a component of the fusion protein. In embodiments, the protein comprises a high proportion of essential amino acids, i.e., an abundance of any one or combination of phenylalanine, valine, threonine, tryptophan, methionine, leucine, isoleucine, lysine, and histidine. In embodiments, the protein comprises an enzyme that is beneficial to a person who may produce an inadequate amount of the enzyme.
The recombinant proteins of the inventions can be recovered by conventional methods. Thus, where the host cell is bacterial, such as E. coli it may be lysed physically, chemically or enzymatically and the protein product isolated from the resulting lysate. It is then purified using conventional techniques, including but not necessarily limited to conventional protein isolation techniques such as selective precipitation, adsorption chromatography, and affinity chromatography, including but not limited to a monoclonal antibody affinity column.
Proteins of the present invention that are expressed with a histidine tail (HIS tag) as described above can easily be purified by affinity chromatography using an ion metal affinity chromatography column (IMAC) column. In embodiments where the permute or non- permute RBP formed when the two segments of the fusion protein fold together is capable of binding ribose, the fusion protein will bind to any ribose in the cells expressing it. In some cases, the amount of fusion protein will exceed the supply of ribose in the cell. To increase that supply and ensure that each fusion protein is bound to a ribose, ribose can be added to the media in which the cells expressing the fusion protein are growing. Alternatively, the ribose can be added after the cells are lysed. In either case, the additional ribose will ensure that all of the fusion protein is bound to a ribose.
When used as part of an expression construct designed for the expression of the coded protein in an appropriate host the disclosure produces a novel fusion protein, from which the protein of interest can be readily purified, in certain embodiments at substantially higher levels than can be achieved using only the sequence for the protein of interest alone, or using a linear configuration as described above.
Fusion polypeptides can be purified to high levels (greater than 80%, or greater than 90% pure, as visualized by SDS-PAGE) by undergoing further purification steps. Additional purification steps can be carried out and may be performed either before or after the IMAC column to yield highly purified protein. They present a major single band when analyzed by SDS PAGE under reducing conditions, and western blot analysis show less than 5% host cell protein contamination.
In one aspect, the present disclosure relates to a method of producing a fusion protein. The method comprises the steps of culturing a host cell transformed with an expression vector as described above, expression of that fusion protein in the respective host cell and separating the protein from the cell culture. The expression system is demonstrated to function with several distinct proteins as described herein, but it is expected it will function with a wide variety of distinct polypeptides with different structural and functional properties.
Compositions comprising fusion proteins, or proteins liberated from the fusion proteins of this disclosure are also provided. Such compositions include but are not necessarily limited to compositions that comprise a pharmaceutically acceptable excipient and thus are suitable for human and veterinary prophylactic and/or therapeutic approaches.
In another embodiment, kits for producing fusion proteins according to this disclosure are provided. The kits can provide one or more expression vectors described herein, as well as printed instructions for using the vectors, and/or for recovering the overexpressed protein.
Although we have expressly designed the fusion protein to remain monomelic, it is plausible that it may domain swap in the cell, particularly if it is expressed at extremely high concentrations. If domain swapping occurs, the present invention will protect against proteolytic attack by blocking both termini of the target protein and allow for purification and recovery of the target protein.
The following Examples are intended to illustrate, but not limit the invention.
Example: GFP
To demonstrate the effectiveness of the split-His tag design, we inserted a target protein (clover, a green fluorescent protein variant) into position 97 of RBP (Figure 3 A), and in a second construct, into position 125 of RBP to generate the construct (split-Hi s)-(RBP 125-277)-(linker/cleavage site)-(clover)-(cleavage site/linker)-(RBP l-124)-(split-His) (Figure 3B). We designate these constructs as s97-clover and sl25-clover, respectively (s97 means a target protein bracketed by linkers and cleavage sites was inserted into position 97 of the RBP). Permuting/splitting RBP at positions other than 97 is covered in this invention and is discussed in the next section. We chose to permute/split at position 125 because inspection of the X-ray structure of WT RBP suggested that the split-His tags would be oriented in a more parallel orientation than they would be when RBP is permuted at position 97. Thus, we reasoned that the metal binding affinity of the split-His tags in sl25 constructs would be higher than in s97 constructs. We added His3 tags to both termini of sl25-clover (His3-sl25- clover-His3). To mimic the products of proteolytic cleavage or incomplete
transcription/translation, we created a second construct in which only a single His3 tag was added to the N-terminus (His3-sl25-clover). We expressed the proteins in E. coli and loaded them on a Co2+-agarose purification column. As expected, the single His3 tag was too short to facilitate binding of His3-sl25-clover to the column; nearly all of the protein flowed through in the wash and only a tiny peak eluted in the 0.15 M imidazole elution step (Figure 4). In marked contrast, most of the His3-sl25-clover-His3 protein bound to the column, with a large, sharp peak coming off with the 0.15 M imidazole elution. Figure 4 demonstrates that the full- length fusion protein, which contains both halves of the split-His3 tag, can be efficiently separated from degraded and or incompletely transcribed/translated species that only contain a single His3 tag.
As an additional demonstration of the ability of split-His tag to selectively purify full- length proteins, we performed a similar experiment with His6-s97-clover-His5 (and His6-s97- clover as the single-His tag control). To more closely replicate real-world purification, we pre-mixed the two proteins before loading them onto a Ni2+ column. Figure 5 shows that His6-s97-clover elutes earlier in the imidazole step gradient compared to His6-s97-clover- His5, again demonstrating that the split-His tag can resolve full-length from truncated products.
Example: LECT2 protein overexpression via split-RBP vs. linear RBP vs. tagless
Here we demonstrate that the split, circularly permuted RBP expression tag is superior to both the linear RBP and tagless systems for overexpressing the protein LECT2. LECT2 is the protein that causes the 4th most common form of systemic amyloidosis in the United States. Lect2 has three disulfide bonds. When Lect2 was previously expressed in E.coli, it did not fold properly because the disulfide bonds became scrambled. Lect2 expressed as S97 fusion protein was not only soluble but also has all three disulfide bonds correctly formed according to Mass Spec. We made three LECT2 constructs. For the first we inserted LECT2 into position 97 of split-RBP (as shown in Figure 3A) to create His6-s97- LECT2. For the second we fused wild-type, non-permuted RBP to the N-terminus of LECT2 to create His6-wtRBP-LECT2. For the third we simply added a His6-tag to the N-terminus of LECT2 to generate His6-LECT2. We then expressed the proteins under identical conditions in E. coli, lysed the cells, and ran the insoluble and soluble fractions on an SDS- polyacrylamide gel. Figure 6 shows that H1S6-LECT2 (14 kDa) does not express to detectable levels. Similarly, His6-wtRBP-LECT2 expresses poorly; the major species present is the truncated species His6-wtRBP. By contrast, His6-s97-LECT2 is expressed at high levels, with the full-length protein being the major species present. Importantly, truncation products (e.g. the s97 fragments of 1 1 kDa and 20 kDa) are not detected. These results indicate that: (1) the s97 tag greatly enhances expression of LECT2, and (2) the closed, topologically circular topology created by the s97-LECT2 fusion seems to protect the full-length protein from degradation, compared to the linear wtRBP-LECT2 fusion. Example: expression of human double-minute protein 2 (MDM2)
MDM2 is a high-value target for protein expression because it is the major negative regulator for the p53 tumor suppressor. Disrupting the MDM2-p53 interaction is a major target for developing anti-cancer drugs, but these efforts have been hindered by the inability to express full-length MDM2 in sufficient quantity. We directly compared MDM2 expression using the split, circularly permuted RBP system of the present invention versus a linear RBP embodiment. The MDM2 gene was appended to or inserted in the RBP gene as shown in Fig. 3A, with appropriate linkers (see Fig. 9b for gene and protein sequences). E. coli cultures were grown, induced, harvested, and lysed under identical conditions. Figure 7 shows the eluents from the nickel column. Five times as many cells were lysed for the linear RBP data.
The linear RBP system prep (left) shows a faint, barely detectable band of full-length
RBP-MDM2 eluting from the nickel column. By contrast, the free RBP band is very intense. The example of the current disclosure (right) indicates an intense band of full-length RBP- MDM2 (again, generated from 1/5 as many cells as the linear control) with less
contamination with RBP fragments.
We digested the solutions with protease to release free MDM2. In the linear RBP system prep, we then passed the solution over nickel beads to remove the free RBP contaminant. No MDM2 band was observed in the gel. In contrast, for the permuted circular tag, we digested with protease but did not pass the solution over nickel beads. We observe nearly complete cleavage of full-length RBP-MDM2 to yield an intense band of free MDM2. Thus, the present disclosure provides a significant improvement in protein production/purification relevant to a control.
Example: expression of p53
We inserted human p53 into position 97 of split, circularly permuted RBP (as shown in Figure 3A) to create His3-s97-p53-His3. Figure 8 (left gel) indicates that full-length His3- s97-p53-His3 is overexpressed to a high level in E. coli lysates, with the majority of the protein found in the soluble fraction. P53 alone, without being fused to s97 or wtRBP, does not express to detectable levels (not shown). Figure 8 (right gel) demonstrates that the split- His tag enables purification of the full-length protein to homogeneity, and that subsequent cleavage with prescission protease yields the correct, native p53 protein. This protein was determined to be fully functional by DNA binding assays (not shown).
The following is a non-limiting protocol by which an embodiment of this disclosure can be performed.
One column purification of the target protein
1. Transform BL21(DE3) cells (or one of its derivatives) with an appropriate plasmid (e.g. pET41 sRBP-mdm2) as described herein.
2. Inoculate one colony in 1 liter of LB and grow at 30 °C until Οϋόοο ~ 0.6.
3. Induce the protein expression with Isopropyl β-D-galactopyranoside (0.1 to 0.4 mM) at 18 °C and further incubate the media for 16 to 19 hours with vigorous shaking at 18 °C.
4. Spin down cells and freeze on dry ice.
5. Lyse cells in 10 mM Tris, pH 8.0, 0.3 to 0.5 M NaCl, 10 mM Imidazole (Buffer A).
6. Remove insoluble material by centrifugation and load the soluble fraction onto - 15 ml of Ni-NTA (or Co-NTA) resin which is pre-equilibrated in Buffer A.
7. Wash the resin with Buffer A until the absorbance at 260 and 280 reaches the buffer level.
8. Add HisTag-RBP-HRV3C Protease (1 to 2% (w/w) of the target protein) to the resin and gently mix at 4 °C overnight.
9. Collect the flow through and further wash the resin with Buffer A till OD280 ~ 0. • If the target protein has free thiols, β-mercaptoethanol or a reagent with a similar function should be present.
• In some cases, it is preferable to elute target protein fused to split RBP from the resin and then mix HRV3C protease (or any other protease) to the fusion protein.
While the disclosure has been particularly shown and described with reference to specific embodiments, it should be understood by those having skill in the art that various changes in form and detail may be made therein without departing from the spirit and scope of the present disclosure as disclosed herein.

Claims

What is claimed is:
1. An expression vector encoding a polypeptide, the polypeptide comprising sequentially in an N to C terminal direction:
a) optionally at the N-terminus of the polypeptide a first Histidine sequence that can function as a component of a functional Histidine tag with a second Histidine sequence located at the C-terminus of the polypeptide;
b) a first segment of a Ribose Binding Protein (RBP);
c) a first linker sequence;
d) at least one restriction endonuclease digestion site;
e) a second linker sequence;
f) a second segment of the RBP,
wherein the second segment is located N-terminal to the first segment relative to an intact wild type amino acid sequence of an RBP comprising the sequence of SEQ ID NO: 1; and
g) optionally at the C-terminus of the polypeptide a second Histidine sequence that can function with the first Histidine sequence in the functional Histidine tag, wherein optionally the functional His tag if present has improved metal binding relative to either of the first or second His tags alone,
wherein the amino acid sequence of the first segment and the amino acid sequence of the second segment together comprise an amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that is at least 251 amino acids in length, and wherein the amino acid sequences of the first and second segments do not overlap with each other,
and wherein the first linker and the second linker, and the first protease cleavage site if present, and the second protease cleavage site if present, together comprise at least thirty amino acids.
2. The expression vector of claim 1, wherein the segment of SEQ ID NO: 1 is amino acids 4-254 of SEQ NO: l .
3. The expression vector of claim 1, wherein the first segment comprises a contiguous amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that is amino acids 34-254 of SEQ ID NO: 1, 60-254 of SEQ ID NO: 1, 70-254 of SEQ ID NO: 1, 85- 254 of SEQ ID NO: 1, 97-254 of SEQ ID NO: 1, 125-254 of SEQ ID NO: 1, 136-254 of SEQ ID NO: 1, 186-254 of SEQ ID NO: 1, or 210-254 of SEQ ID NO: 1, thereby having the first amino acid of the first segment as amino acid 34, 60, 70, 85, 97, 125, 136, 186 or 210 of SEQ ID NO: 1, and wherein the first segment is optionally extended by any number of amino acids up to amino acid number 277 of SEQ ID NO: 1.
4. The expression vector of claim 1, wherein the second segment comprises a contiguous amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that begins with amino acid number 1, 2, 3, or 4 of SEQ ID NO: 1 and ends with amino acid number 33, 59, 69, 84, 96, 124, 135, 185, or 209 of SEQ ID NO: 1.
5. The expression vector of claim 1, wherein the second segment comprises a contiguous amino acid sequence of SEQ ID NO: l that begins with amino acid number 1, 2, 3, or 4 of SEQ ID NO: l and ends with amino acid number 33, 59, 69, 84, 96, 124, 135, 185, or 209 of SEQ ID NO: l .
6. The expression vector of claim 5, wherein the second segment ends at amino acid 96 or amino acid 124 of SEQ ID NO: 1.
7. The expression vector of any one of claims 1-6, wherein: i) the at least one restriction endonuclease digestion site is present in a multiple cloning site; and/or ii) the expression vector further encodes at least one protease cleavage site located between the at least one restriction endonuclease digestion site and the first or the second linker sequence; and/or iii) the first and/or the second linker is at least 15 amino acids in length.
8. The expression vector of claim 7, wherein the at least one restriction endonuclease digestion site is present in the multiple cloning site and the first and/or the second linker is at least 15 amino acids in length.
9. A method comprising allowing expression of the expression vector of claim 7 such that a fusion protein is expressed, with the proviso that a polynucleotide sequence encoding a target protein is inserted into the multiple cloning site, and wherein the expressed fusion protein comprises the first and second Histidine sequences, the first and second segments of the Ribose Binding Protein, the first and second linker sequences, and the at least one protease cleavage site if the protease cleavage site is encoded by the expression vector.
10. The method of claim 9, wherein first and the second linker are at least 15 amino acids in length.
1 1. The method of claim 10, further comprising exposing the fusion protein to a metal such that the first and second Histidine sequences form a functional Histidine tag that forms a non-covalent association with the metal.
12. The method of claim 1 1 , further comprising separating the fusion protein from the metal.
13. The method of claim 10, wherein the fusion protein comprises the at least one protease cleavage site and optionally comprises a second protease cleavage site such that the first and second protease cleavage sites flank the target protein, the method further comprising cleaving the fusion protein at the first or the first and the second protease cleavage sites, and optionally purifying a protein cleavage product that comprises the target protein.
14. The method of claim 9, wherein the expression of the vector is in prokaryotic cells.
15. A population of cells comprising an expression vector of claim 7.
16. The population of cells of claim 15, wherein the cells are prokaryotic cells.
17. A population of prokaryotic cells comprising an expression vector of claim 8.
18. A fusion protein produced by the method of claim 9.
19. A kit comprising an expression vector of claim 7.
20. The kit of claim 19, further comprising printed instructions for using the expression vector to produce the fusion protein.
21. An expression vector encoding a polypeptide, the polypeptide comprising sequentially in an N to C terminal direction:
a) a first segment of a Ribose Binding Protein (RBP);
b) a first linker sequence;
c) optionally a first protease cleavage site;
d) at least one restriction endonuclease digestion site;
e) optionally a second protease cleavage site
f) a second linker sequence;
g) a second segment of the RBP;
wherein the expression vector optionally comprises a first Histidine sequence located at the N-terminus of the polypeptide and/or C-terminus of the polypeptide;
wherein the amino acid sequence of the first segment and the amino acid sequence of the second segment together comprise an amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that is at least 251 amino acids in length, and wherein the amino acid sequences of the first and second segments do not overlap with each other; and wherein the first linker and the second linker, and the first protease cleavage site if present, and the second protease cleavage site if present, together comprise at least thirty amino acids.
22. The expression vector of claim 21, wherein the first segment comprises a contiguous amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that is amino acids 34-254 of SEQ ID NO: 1, 60-254 of SEQ ID NO: 1, 70-254 of SEQ ID NO: 1, 85- 254 of SEQ ID NO: 1, 97-254 of SEQ ID NO: 1, 125-254 of SEQ ID NO: 1, 136-254 of SEQ ID NO: 1, 186-254 of SEQ ID NO: 1, or 210-254 of SEQ ID NO: 1, thereby having the first amino acid of the first segment as amino acid 34, 60, 70, 85, 97, 125, 136, 186 or 210 of SEQ ID NO: 1, and wherein the first segment is optionally extended by any number of amino acids up to amino acid number 277 of SEQ ID NO: 1.
23. The expression vector of claim 21, wherein the first segment ends at amino acid 277 of SEQ ID NO: 1
24. The expression vector of any one of claims 21-23, wherein: i) the at least one restriction endonuclease digestion site is present in a multiple cloning site; and/or ii) the expression vector further encodes at least one protease cleavage site located between the at least one restriction endonuclease digestion site and the first or the second linker sequence; and/or iii) the first and/or the second linker is at least 20 amino acids in length, and wherein the second segment comprises a contiguous amino acid sequence that has at least 90% identity with a segment of SEQ ID NO: 1 that begins with amino acid number 1, 2, 3, or 4 of SEQ ID NO: l and ends with amino acid number 33, 59, 69, 84, 96, 124, 135, 185, or 209 of SEQ ID NO: 1.
25. A method comprising allowing expression of the expression vector of claim 21 such that a fusion protein is expressed, with the proviso that a polynucleotide sequence encoding a target protein is inserted into the multiple cloning site, and wherein the expressed fusion protein comprises the first and second Histidine sequences, the first and second segments of the RBP, the first and second linker sequences, and the at least one protease cleavage site if the protease cleavage site is encoded by the expression vector.
26. A cell comprising an expression vector of claim 21 or 22.
27. A fusion protein produced by the method of claim 25.
28. A kit comprising an expression vector of claim 22.
PCT/US2017/057881 2016-10-21 2017-10-23 Compositions and methods comprising permuted protein tags for facilitating overexpression, solubility, and purification of target proteins Ceased WO2018076008A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/342,459 US11401520B2 (en) 2016-10-21 2017-10-23 Compositions and methods comprising permuted protein tags for facilitating overexpression, solubility, and purification of target proteins

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201662411295P 2016-10-21 2016-10-21
US62/411,295 2016-10-21
US201762518207P 2017-06-12 2017-06-12
US62/518,207 2017-06-12

Publications (1)

Publication Number Publication Date
WO2018076008A1 true WO2018076008A1 (en) 2018-04-26

Family

ID=62019706

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/057881 Ceased WO2018076008A1 (en) 2016-10-21 2017-10-23 Compositions and methods comprising permuted protein tags for facilitating overexpression, solubility, and purification of target proteins

Country Status (2)

Country Link
US (1) US11401520B2 (en)
WO (1) WO2018076008A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018165328A1 (en) * 2017-03-07 2018-09-13 Recombipure, Inc. Compositions, methods, and systems for affinity-based protein identification and purification
WO2024149995A1 (en) 2023-01-10 2024-07-18 Nuclera Ltd Protein aggregation assays

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6303128B1 (en) * 1994-12-20 2001-10-16 Csl Limited Method for protein expression
US6410220B1 (en) * 1997-02-28 2002-06-25 Nature Technology Corp Self-assembling genes, vectors and uses thereof
US20050130269A1 (en) * 2002-01-10 2005-06-16 Isa Gokce Fusion proteins
US20140302078A1 (en) * 2005-03-30 2014-10-09 Novartis Vaccines And Diagnostics Srl Haemophilus influenzae type b
WO2017066441A1 (en) * 2015-10-13 2017-04-20 The Research Foundation For The State University Of New York Cleavable fusion tag for protein overexpression and purification

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6303128B1 (en) * 1994-12-20 2001-10-16 Csl Limited Method for protein expression
US6410220B1 (en) * 1997-02-28 2002-06-25 Nature Technology Corp Self-assembling genes, vectors and uses thereof
US20050130269A1 (en) * 2002-01-10 2005-06-16 Isa Gokce Fusion proteins
US20140302078A1 (en) * 2005-03-30 2014-10-09 Novartis Vaccines And Diagnostics Srl Haemophilus influenzae type b
WO2017066441A1 (en) * 2015-10-13 2017-04-20 The Research Foundation For The State University Of New York Cleavable fusion tag for protein overexpression and purification

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018165328A1 (en) * 2017-03-07 2018-09-13 Recombipure, Inc. Compositions, methods, and systems for affinity-based protein identification and purification
US11414454B2 (en) 2017-03-07 2022-08-16 Auctus Biologies, Inc. Compositions, methods, and systems for affinity-based protein identification and purification
WO2024149995A1 (en) 2023-01-10 2024-07-18 Nuclera Ltd Protein aggregation assays
WO2024149996A1 (en) 2023-01-10 2024-07-18 Nuclera Ltd Protein expression systems

Also Published As

Publication number Publication date
US11401520B2 (en) 2022-08-02
US20190270998A1 (en) 2019-09-05

Similar Documents

Publication Publication Date Title
US10662231B2 (en) Fusion proteins of superfolder green fluorescent protein and use thereof
Costa et al. Fusion tags for protein solubility, purification and immunogenicity in Escherichia coli: the novel Fh8 system
Murby et al. Upstream strategies to minimize proteolytic degradation upon recombinant production inEscherichia coli
Sahdev et al. Production of active eukaryotic proteins through bacterial expression systems: a review of the existing biotechnology strategies
JP6817939B2 (en) Fusion partner for peptide production
US20080286834A1 (en) Leader Sequences For Directing Secretion of Polypeptides and Methods For Production Thereof
SG193852A1 (en) Novel immunoglobulin-binding proteins with improved specificity
US11345722B2 (en) High pH protein refolding methods
JPH09504166A (en) Expression of a fusion polypeptide exported extracellularly without a leader sequence
US11053278B2 (en) Tangential flow filtration based protein refolding methods
JP2016515396A (en) Methods for expression of peptides and proteins
WO2006069403B1 (en) Methods for producing soluble multi-membrane-spanning proteins
Dyr et al. Separation used for purification of recombinant proteins
KR20140135959A (en) On-column enzymatic cleavage
US11401520B2 (en) Compositions and methods comprising permuted protein tags for facilitating overexpression, solubility, and purification of target proteins
TW201829774A (en) Expression construct and method for producing proteins of interest
US20090239262A1 (en) Affinity Polypeptide for Purification of Recombinant Proteins
AU2007329171A1 (en) Protein particles
CN113061598B (en) Trypsin mutant, preparation method and application thereof
Murby et al. Differential degradation of a recombinant albumin‐binding receptor in Escherichia coli
US7829687B2 (en) Artificial disulfide isomerases and uses thereof
WO2004044007A1 (en) Production of ubiquitin fusion proteins
KR20260022903A (en) Method for enhancing the folding and subsequent solubilization of disulfide-containing proteins in E.coli system
WO2025163019A1 (en) Tags for enhanced expression of recombinant proteins
US20170226489A1 (en) Solubility and Affinity Tag for Recombinant Protein Expression and Purification

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17862997

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 17862997

Country of ref document: EP

Kind code of ref document: A1