WO2018073216A1 - Means and methods to treat inflammation - Google Patents

Means and methods to treat inflammation Download PDF

Info

Publication number
WO2018073216A1
WO2018073216A1 PCT/EP2017/076427 EP2017076427W WO2018073216A1 WO 2018073216 A1 WO2018073216 A1 WO 2018073216A1 EP 2017076427 W EP2017076427 W EP 2017076427W WO 2018073216 A1 WO2018073216 A1 WO 2018073216A1
Authority
WO
WIPO (PCT)
Prior art keywords
antigen binding
seq
mmp8
binding polypeptide
sequence depicted
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2017/076427
Other languages
French (fr)
Inventor
Claude Libert
Roosmarijn Vandenbroucke
Sophie STEELAND
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Universiteit Gent
Vlaams Instituut voor Biotechnologie VIB
Original Assignee
Universiteit Gent
Vlaams Instituut voor Biotechnologie VIB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universiteit Gent, Vlaams Instituut voor Biotechnologie VIB filed Critical Universiteit Gent
Publication of WO2018073216A1 publication Critical patent/WO2018073216A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to a composition comprising MMP8 and TNFRl inactivating antigen binding polypeptides, preferably antigen binding polypeptides comprising antibodies; it relates further to the use of such composition to treat inflammation, such as but not limited to systemic inflammatory response syndrome, sepsis, LPS induced inflammation, renal ischemia/reperfusion injury, ventilation induced lung injury, periodontal inflammation, rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis, ankylosing spondylitis, Lyme arthritis and osteoarthritis.
  • inflammation such as but not limited to systemic inflammatory response syndrome, sepsis, LPS induced inflammation, renal ischemia/reperfusion injury, ventilation induced lung injury, periodontal inflammation, rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis, ankylosing spondylitis, Lyme arthritis and osteoarthritis.
  • Severe sepsis and septic shock are important causes of morbidity and mortality in intensive care units (Angus & van der Poll, New Engl J Med 2013; Gotts & Matthay, BMJ (Clinical research ed), 2016; Fleischmann et al., Current estimates and limitations. Am J Respir Crit Care Med, 2016).
  • Current treatment of sepsis patients is limited and focuses mainly on supportive measures (Schuerholz et al. Minerva anestesiologica, 2008;74:181-195). Although many therapeutics have been clinically evaluated, no specific treatment is currently approved to treat the heterogeneous population of sepsis patients (Heming et al., Expert opinion on emerging drugs, 2016; van der Poll, Crit Care, 2016).
  • TNF cytokine tumor necrosis factor
  • TNF signals through two receptors pro-inflammatory signaling is believed to happen via TNFRl
  • TNFR2 signaling is believed to be involved in immune regulation and maintaining homeostasis. Since anti-TNF treatment is associated with side-effects that might be due to blockage of TNFRl as well as TNFR2 signals, we believe that selective TNFRl inhibition might be a better and safer approach than inhibition of TNF itself (Van Hauwermeiren et al., Cytokine & growth factor reviews, 2011).
  • TNFRl deficiency protects against death after injection of moderate LPS doses (Vandenbroucke et al., EMBO Mol Med, 2013), but not against very high doses (Rothe et al., Circ Shock, 1994).
  • Matrix metalloproteinase 8 is a Zn 2+ -dependent endopeptidase belonging to a structurally related group of MM Ps that are considered important modulators of immunity and involved in several inflammatory diseases (Vandenbroucke & Libert, Nature Rev Drug Discovery, 2014).
  • MM P8 was proposed as a potential drug target for treatment of sepsis and multiple studies with sepsis patients reported correlations between increased MM P8 levels, higher mortality rates, increased organ failure and high plasma C-reactive protein (CRP) levels (Martin et al, Scientific Rep, 2014). In mouse models of sepsis, it was also shown that genetic and pharmacological inhibition of MMP8 improved survival.
  • MM P8 was upregulated after LPS-induced endotoxemia and involved in the LPS-induced disruption of the blood-CSF barrier (Vandenbroucke et al., J Neurosci, 2012).
  • FIGURE 1 A-E sTN FRl and MMP8 levels are increased in human sepsis patients and the levels were correlated with disease severity. Blood was withdrawn daily of sepsis patients after meeting the inclusion criteria and after admission in the intensive care unit (ICU) during 7 consecutive days.
  • A-B M MP8 and sTN FRl levels were determined daily in plasma of sepsis patients with Luminex technology and ELISA, respectively and compared with the levels in healthy controls.
  • FIGURE 2 A-B MMP8 and TN FRl deficiencies leads to elevated expression of Tnfrsfla and Mmp8, respectively, eight hours after LPS injection.
  • Wild type (WT), TN FRl-/- and M MP8-/- mice were injected with 10 mg/kg LPS (LD100) or PBS (untreated) and organs were analyzed after 8 h.
  • LPS LPS
  • PBS untreated
  • organs were analyzed after 8 h.
  • A Fold change of Tnfrsfla gene expression in WT and M M P8-/- mice compared to untreated mice determined in ileum, choroid plexus and lung.
  • B Fold change of Mmp8 gene expression in WT and TN FRl-/- mice compared to untreated mice determined in ileum, choroid plexus and lung.
  • FIGURE 3 A-D Dual deficiency of M MP8 and TN FRl synergistically protects against endotoxemia.
  • FIGURE 4 A-l Dual MMP8/TN FR1 inhibition preserves the intestinal and blood-cerebrospinal fluid barrier and reduces local and systemic inflammation after endotoxemia.
  • Wild type (WT), MMP8-/-, TN FRl-/- and DKO mice were injected intraperitoneally with LD100 of LPS or with PBS (untreated). Mice were euthanized 8 h after LPS injection.
  • A Permeability of the intestinal barrier was assessed by measuring leakage of fluorescently labeled dextran from the intestines into the blood circulation.
  • B-C Fold change in mRNA gene expression of 116 and Mmpl3 was determined in ileum.
  • E-F Fold change in mRNA gene expression of 116 and Nos2 was determined in the choroid plexus (CP).
  • FIGURE 5 A-D Dual ablation of MMP8 and TN FRl synergistically protects against sepsis induced by cecal ligation and puncture (CLP).
  • Male wild type (WT, - ⁇ ), MM P8-/- ( -O- ), TN FRl-/-( - ⁇ -) and DKO ( -D- ) mice were subjected to CLP surgery and treated with broad-spectrum antibiotics 9 and 24 h after CLP, and mortality was monitored. Sham-treated mice underwent the same surgical procedure but without ligation and puncture. Serum and plasma were collected and analyzed 6 h after CLP. Survival (A) and rectal body temperature (B) were monitored for 10 days.
  • FIGURE 6 A-H Dual ablation of MMP8 and TN FR1 leads to moderate neutrophil efflux from blood to the peritoneum with maintenance of bacterial clearance in peritoneum and blood.
  • mice were subjected to CLP. Sham-treated mice underwent the same surgical procedure but without ligation and puncture. Six or 24 h after CLP, blood and peritoneal lavage fluid (PLF) were collected for analysis.
  • A-D The absolute number of white blood cells (WBC) and neutrophils in circulation (A-B) and in PLF (C-D) 6 h after CLP, determined with Hemavet hematology analyzer.
  • E-F Blood and PLF were collected 6 and 24 h after CLP and total bacterial counts were determined and expressed as colony-forming units (CFU) per peritoneal cavity.
  • G-H Chemokines
  • PLF peritoneal lavage fluid
  • CFU colony forming units
  • FIGURE 7 A-F In endotoxemia, simultaneous therapeutic inhibition of TNFR1 and MMP8 with biologicals is significantly more protective against lethality than single inhibition.
  • Survival (C) and body temperature (D) were monitored in M MP8-/- mice that were injected i.p.
  • mice LD100 in MMP8-/- mice
  • 400 ⁇ g anti- TN FRl ( - ⁇ ) or PBS ( -0- ) (n 5-6 mice/group).
  • Survival (E) and body temperature (F) were monitored in WT mice treated with anti-MM P8 N b and/or anti-TN FRl Ab ( ⁇ * ⁇ ) or PBS ( "v " ) and injected with LPS (LD75 in WT mice). After 24 h, mice received a second injection of both treatments. Mice treated only with anti-MMP8 N b or anti-TN FRl Ab received an additional PBS injection after 24 h.
  • Body temperatures represent mean ⁇ SEM (B, D, H) or mean only (F). Survival curves were analyzed with the Wilcoxon test. * for 0.01 ⁇ p ⁇ 0.05; ** for 0.001 ⁇ p ⁇ 0.01.
  • FIGURE 8 A-B Structure and gene construct of Nb 70-alb-14.
  • A Construction of Nb 70-alb-14. At the N- terminal end of the construct, the C-terminal end of Nb 70 is linked to the N-terminal end of Nb Alb via a [G4S]3 linker. The C-terminal end of Nb Alb is then linked to the N-terminal end of Nb 14 and this Nb is linked to the His6-tag at the C-terminus.
  • B Nucleotide sequence of Nb 70-Alb-14. The Nb sequences are shown in bold, the sequence of the [G4S]3 linker is underlined and the His6-tag is shown in italic.
  • FIGURE 9 a-d Binding Nb 70-alb-14 to hTNFRl, albumin, mMMP8_CD and mMMP8_FL.
  • Nb 70-Alb-14 binding affinity of Nb 70-Alb-14 to hTNFRl (a), albumin (b), the catalytic domain of mouse MMP8 (mMMP8_CD) (c) and the full length MMP8 (mMMP8_FL) (d)
  • the respective ELISAs were performed.
  • binding affinity of Nb 70-Alb-14 was compared with the relevant monovalent Nb: Nb 70 for hTNFRl binding, Nb 14 for MMP8 binding and Nb Alb for albumin binding.
  • FIGURE 10 a-c Surface plasmon resonance affinity measurement on immobilized hTNFRl, mMMP8_CD and mMMP8_FL.
  • Surface plasmon resonance sensorgram of Nb 70-alb-14 on immobilized hTNFRl (a), mouse MMP8 catalytic domain (mMMP8_CD) (b), mouse MMP8 full length (mMMP8_FL) (c).
  • the adjusted sensorgram overlays show binding of Nb 70-alb-14 applied in a dilution series ranging from 500 nM to 2.01 nM or 250 nM to 0.97 nM to immobilized hTNFRl or MMP8. Dotted lines show global fitting of the binding data to a two-state binding model. Surface plasmon resonance analyses were performed in duplicate.
  • FIGURE 11 a-c Inhibition of TNF/TNFR1 and MMP8 activity by Nb70-alb-14.
  • mMMP8_CD mouse catalytic domain of MMP8
  • FIGURE 12 a-d Serum half life of Nb 70-alb-14 and in vivo efficacy of Nb 70-alb-14 in endotoxemia and CLP.
  • FIGURE 13 A-l sTNFRl, MMP8 and IL6 plasma levels are increased in human sepsis patients and the levels were correlated with each other and with disease severity
  • A-C MMP8, sTNFRl and IL6 levels were determined daily in plasma of sepsis patients with Luminex technology (MMP8) and ELISA and were compared with the levels in healthy controls.
  • D-H Scatterplots of sTNFRl (D,F,H) and log(MMP8) (E,G,H) plasma levels versus SOFA score (F,G) and log(IL6) plasma levels (D,E), and sTNFRl versus log(MMP8) plasma (H) determined in sepsis patients.
  • I Fold induction of MMP8 and TNFRSF1A in whole blood-derived RNA determined in sepsis patients and compared to expression levels determined in healthy controls preference set to 1).
  • FIGURE 14 A-D Mmp8 and Tnfrsfla expression is upregulated after endotoxemia and cecal ligation and puncture (CLP) in different organs
  • qPCR data were normalized to stable housekeeping genes determined by GeNorm. Data represent min- to-max box and whiskers. Statistics between untreated/sham and treated mice were calculated with a two-tailed Mann-Whitney test. * for 0.01 ⁇ p ⁇ 0.05; ** for 0.001 ⁇ p ⁇ 0.01; * ** for 0.001 ⁇ p 0.0001, and **** for p ⁇ 0.0001.
  • FIGURE 15 A-C Therapeutic simultaneous abrogation of TNFR1 and MMP8 in cecal ligation and puncture (CLP).
  • mice hTNFRl Tg mice were subjected to cecal ligation and puncture (CLP) under sublethal conditions (50% ligation and 1 puncture with 21G needle). Mice were treated as in A.
  • CLP cecal ligation and puncture
  • Body temperatures represent mean ⁇ SEM (B). Survival curves were analyzed with the Wilcoxon test. * for 0.01 ⁇ p ⁇ 0.05.
  • Figure 16 Dual ablation of MMP8 and TNFR1 reduces systemic chemokine levels after endotoxemia.
  • an “antigen binding polypeptide” typically refers to a polypeptide, which has affinity and specificity comparable to an immunoglobulin, such as an antibody.
  • MMP8 refers to Matrix metalloproteinase-8, also known as collagenase-2 or neutrophil collagenase and was originally believed to be expressed only by neutrophils. More recently, it has become clear that MMP8 can be expressed in a wide range of cells, such as epithelial cells, fibroblasts and macrophages, mainly during inflammatory conditions (Van Lint and Libert, 2006). Inactive MMP8 is stored in the intracellular granules of neutrophils and is released upon activation to ensure rapid availability of MMP8 at inflammatory sites. The effect of MMP8 expression on cancer progression and its association with several inflammatory disorders has been described (Van Lint and Libert, 2006).
  • MMP8 inactivating antigen binding polypeptide means that the antigen binding polypeptide significantly reduces the MMP8 activity as measured in an EnzCheck ® fluorescein- labeled DQ gelatin conjugate test (Invitrogen). The skilled practitioner knows methods to investigate the ability of an antigen binding polypeptide to reduce the MMP8 activity.
  • Said antigen binding polypeptide can be any antigen binding polypeptide known to the person skilled in the art, such as but not limited to proteins, antibodies, heavy chain antibodies (hcAb), single domain antibodies (sdAb), variable domain of camelid heavy chain antibody (VHH) variable domain of the new antigen receptor (VNA ), engineered CH2 domains (nanoantibodies; Dimitrov, 2009), minibodies (Tramontano et al., 1994), and alphabodies (WO 2010066740).
  • MMP8 inactivating antigen binding polypeptides can be found in WO2012059513. All of these MMP8 inactivating polypeptides can be applied in the aspects and embodiments of this invention.
  • TNFR1 refers to Tumor necrosis factor receptor 1. Most of the biological activities of TNF are initiated by binding to TNFR1. For further explanations on TNFR1 regulation the reader is referred to Van Hauwermeiren, F. et al., Cytokine & growth factor reviews, 2014.
  • TNFR1 inactivating antigen binding polypeptide means that the antigen binding polypeptide significantly reduces the TNFR1 activity as measured in an HEK-2 blue assay (Invitrogen). Methods to investigate the ability of an antigen binding polypeptide to reduce the TNFR1 activity are well-known to the skilled practitioner.
  • Said antigen binding polypeptide can be any antigen binding polypeptide known to the person skilled in the art, such as but not limited to proteins, antibodies, heavy chain antibodies (hcAb), single domain antibodies (sdAb), variable domain of camelid heavy chain antibody (VHH) variable domain of the new antigen receptor (VNAR), engineered CH2 domains (nanoantibodies; Dimitrov, 2009), minibodies (Tramontano et al., 1994), and alphabodiesTM (WO 2010066740).
  • TNFR1 inactivating antigen binding polypeptides the reader is referred to WO2008149148, WO2008113515 and Steeland S et al., J Biol Chem. 2015. All of these TNF 1 inactivating polypeptides can be applied in the aspects and embodiments of this invention.
  • the term "specificity" refers to the ability of a polypeptide to bind preferentially to one antigenic target versus a different antigenic target and does not necessarily imply high affinity.
  • affinity refers to the degree to which a polypeptide binds to an antigen in such a way that the equilibrium of antigen and polypeptide shifts toward the presence of a complex formed by their binding.
  • an antigen and a polypeptide are combined in relatively equal concentration, a polypeptide of high affinity will bind to the available antigen in such a way that the equilibrium shifts toward high concentration of the resulting complex.
  • potency is a measure of the biological activity of a polypeptide. Potency of an agent can be determined by any suitable method known in the art. Cell culture based potency assays are often the preferred format for determining biological activity since they measure the physiological response elicited by the agent and can generate results within a relatively short period of time.
  • cell based assays based on the mechanism of action of the product, can be used, including but not limited to proliferation assays, cytotoxicity assays, reporter gene assays, cell surface receptor binding assays and assays to measure induction/inhibition of functionally essential protein or other signal molecule (such as phosphorylated proteins, enzymes, cytokines, cA P and the like), all well-known in the art.
  • Results from cell based potency assays can be expressed as "relative potency" as determined by comparison of the polypeptides of the invention to the response obtained for the corresponding reference polypeptides, optionally further comprising an irrelevant polypeptide, such as Nb Alb-Ctrl-Ctrl (cf. examples section).
  • antibody refers to an immunoglobulin molecule which specifically binds with an antigen.
  • Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. Such an antibody is commonly composed of 4 chains, 2 heavy- and 2 light chains, and is thus tetrameric. An exception thereto are camel antibodies that are composed of heavy chain dimers and are devoid of light chains, but nevertheless have an extensive antigen- binding repertoire.
  • Antibodies of the present invention can thus exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, Fv, Fab and F(ab)2, as well as single chain antibodies and humanized antibodies (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, NY; Worn and Pluckthun, 2001; Koerber et al., 2015.).
  • a "VHH” according to the invention refers to a variable domain of a heavy chain camelid antibody. Camelid antibodies, and the VHH derived sequences are known to the person skilled in the art. Camelid antibodies have been described, amongst others in WO9404678 and in WO2007118670.
  • variable regions are mostly responsible for determining the specificity of the antibody and will comprise complementarity determining regions (CDRs).
  • CDRs complementarity determining regions
  • CDR complementarity determining region
  • variable loop within the variable regions of either heavy or light chains and contains the amino acid sequences capable of specifically binding to antigenic targets.
  • CDR regions account for the basic specificity of the antibody for a particular antigenic determinant structure. Such regions are also referred to as “hypervariable regions.”
  • the CDRs represent non-contiguous stretches of amino acids within the variable regions but, regardless of species, the positional locations of these critical amino acid sequences within the variable heavy and light chain regions have been found to have similar locations within the amino acid sequences of the variable chains.
  • the variable regions of the heavy and light chains of all canonical antibodies each have 3 CDR regions, each non- contiguous with the others for the respective light and heavy chains. The accepted CDR regions have been described by Kabat et al. (1991).
  • the MMP8 inactivating antigen binding protein and the TNFR1 inactivating antigen binding protein are present in one molecule.
  • "Present in one molecule” according to the invention refers to attachment of the MMP8 inactivating antigen binding protein and the TNFR1 inactivating antigen binding protein. Attachment can be achieved in several ways as known in the art. For example, the MMP8 inactivating antigen binding protein and the TNFR1 inactivating antigen binding protein can be covalently bound to each other. As an alternative approach, the MMP8 inactivating antigen binding protein and the TNFR1 inactivating antigen binding protein are present in one molecule and are coupled by a linker. Optionally, a linker sequence can be used.
  • a further antigen binding protein can also be used as linker sequence to combine the MMP8 inactivating antigen binding protein and the TNFR1 inactivating antigen binding protein are present in one molecule; one such example is described further herein.
  • nucleic acid refers to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. This term refers only to the primary structure of the molecule. Thus, this term includes double- and single-stranded DNA, and RNA. It also includes known types of modifications, for example, methylation, "caps" substitution of one or more of the naturally occurring nucleotides with an analog.
  • vector includes any vector known to the skilled person, including plasmid vectors, cosmid vectors, phage vectors, such as lambda phage, viral vectors, such as adenoviral, AAV or baculoviral vectors, or artificial chromosome vectors such as bacterial artificial chromosomes (BAC), yeast artificial chromosomes (YAC), or PI artificial chromosomes (PAC).
  • plasmid vectors such as lambda phage
  • viral vectors such as adenoviral, AAV or baculoviral vectors
  • artificial chromosome vectors such as bacterial artificial chromosomes (BAC), yeast artificial chromosomes (YAC), or PI artificial chromosomes (PAC).
  • Said vectors include expression as well as cloning vectors.
  • Expression vectors comprise plasmids as well as viral vectors and generally contain a desired coding sequence and appropriate DNA sequences necessary for the expression of the operably linked coding sequence in a particular host organism (e.g., bacteria, yeast, plant, insect, or mammal) or in in vitro expression systems.
  • Cloning vectors are generally used to engineer and amplify a certain desired DNA fragment and may lack functional sequences needed for expression of the desired DNA fragments.
  • a "host cell” refers to a cell which is suitable for transformation with a vector comprising a nucleic acid of the disclosure.
  • Said host cell can be any host cell known to the person skilled in the art and includes, but is not limited to bacterial cells, fungal cells including yeast cells, insect cells and mammalian cells. Particularly host cells, which can be used for the production of MMP8 and/or TNFR1 inactivating antigen binding polypeptides are envisaged herein.
  • inflammatory disease is known to the person skilled in the art.
  • the list of inflammatory diseases includes, but is not limited to systemic inflammatory response syndrome, sepsis, LPS induced inflammation, renal ischemia/reperfusion injury, ventilation induced lung injury, periodontal inflammation, rheumatoid arthritis, multiple sclerosis, ankylosing spondylitis, Lyme arthritis and osteoarthritis.
  • a “pharmaceutical composition” refers to a composition comprising the MMP8 and TNFR1 inactivating antigen binding polypeptides, nucleic acids and vectors as referred to herein in a pharmaceutically effective amount and a pharmaceutically acceptable carrier.
  • a pharmaceutically acceptable carrier is preferably a carrier that is relatively non-toxic and innocuous to a patient at concentrations consistent with effective activity of the active ingredient so that any side effects ascribable to the carrier do not vitiate the beneficial effects of the active ingredient. It is likely that the MMP8 and TNFRl inactivating antigen binding polypeptides, nucleic acids and vectors according to the invention are administered as a combination therapy in combination with at least one further anti-inflammatory agent.
  • Explicitly within the scope of the present application is the combined administration of the MMP8 and TNFRl inactivating antigen binding polypeptides, nucleic acids and vectors as disclosed herein with anti-infectious agents.
  • these anti-infectious reagents are antibiotics.
  • Such a pharmaceutical composition can be utilized to achieve the desired pharmacological effect by administration to a patient in need thereof.
  • a patient for the purpose of this invention, is a mammal, particularly a human, in need of treatment for the particular condition or disease.
  • veterinary applications are also within the scope of the present invention.
  • MMP8 Matrix Metallo-Proteinase 8
  • TNFRl Tumor necrosis factor receptor 1
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a Tumor necrosis factor receptor 1 (TNFRl) inactivating antigen binding polypeptide.
  • MMP8 Matrix Metallo- Proteinase 8
  • TNFRl Tumor necrosis factor receptor 1
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody.
  • MMP8 Matrix Metallo-Proteinase 8
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • SEQ ID Nos 1 to 3 refer to the sequence of the CDRs of the MMP8 inactivating antigen binding polypeptide:
  • SEQ ID NO: 1 GFTLDYYNIG
  • SEQ ID NO: 2 CISSSGGRTNYADSVKG
  • SEQ ID NO: 3 CMATTEGYEYDY
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl,
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide
  • MMP8 Matrix Metallo-Proteinase 8
  • said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • SEQ ID NOs 4 to 6 refer to the sequence of the CDRs of the TNFRl inactivating antigen binding polypeptide:
  • SEQ ID NO: 5 AISWSGGSTYYADSVKG
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo- Proteinase 8
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide
  • said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs
  • said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule.
  • MMP8 Matrix Metallo- Proteinase 8
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody.
  • MMP8 Matrix Metallo-Proteinase 8
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
  • MMP8 Matrix Metallo- Proteinase 8
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide is provided, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicte
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicte
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ
  • the invention relates to an isolated polypeptide comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, and to compositions, such as pharmaceutical compositions, comprising such isolated polypeptide.
  • MMP8 Matrix Metallo- Proteinase 8
  • such isolated polypeptide may be comprising a MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • such isolated polypeptide may be comprising a TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID Nos.
  • such isolated polypeptide may be comprising a MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID Nos; and may be comprising a TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID Nos.
  • Such isolated polypeptide is one comprising the amino acid sequence depicted in SEQ ID NO: 7 (except for 6xHis-tag this is the amino acid sequence encoded by the nucleotide sequence of Figure 8B).
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity.
  • MMP8 Matrix Metallo- Proteinase 8
  • SEQ ID NO: 7 depicts a tri-specific nanobody construct with the structure anti-TNFRl- anti-Albumine- anti-MMP8.
  • the different building blocks of this construct are linked by a (G4S)3- linker.
  • a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody .
  • MMP8 Matrix Metallo-Proteinase 8
  • TNFRl inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity
  • a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
  • MMP8 Matrix Metallo- Proteinase 8
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided wherein said MMP8 inactivating antigen binding polypeptide comprises a CDR1 sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDR1, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDR1 sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDR1, CDR2 and/or
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDR1 sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDR1 sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein C
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depict
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicte
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteina
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO:
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a C
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 in
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity.
  • MMP8 Matrix Metallo-Proteinase 8
  • a nucleic acid encoding at least one antigen binding polypeptide of composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody.
  • MMP8 Matrix Metallo-Proteinase 8
  • An exemplary nucleotide sequence is the one defined by SEQ ID NO: 28.
  • a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
  • MMP8 Matrix Metallo-Proteinase 8
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide is provided wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide is provided wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO:
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a C
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said MMP8 inactivating anti
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity.
  • MMP8 Matrix Metallo-Proteinase 8
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNF 1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody.
  • MMP8 Matrix Metallo-Proteinase 8
  • a vector comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
  • MMP8 Matrix Metallo-Proteinase 8
  • compositions, nucleic acid and vector according to the invention as described above are provided for use as a medicament.
  • composition, nucleic acid and vector according to the invention as described above are provided for use to treat an inflammatory disease.
  • composition, nucleic acid and vector according to the invention as described above are provided for use to treat an inflammatory disease, wherein said inflammatory disease is selected from the list of diseases consisting of systemic inflammatory response syndrome, sepsis, LPS induced inflammation, renal ischemia/reperfusion injury, ventilation induced lung injury, periodontal inflammation, rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis, ankylosing spondylitis, Lyme arthritis and osteoarthritis.
  • diseases consisting of systemic inflammatory response syndrome, sepsis, LPS induced inflammation, renal ischemia/reperfusion injury, ventilation induced lung injury, periodontal inflammation, rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis, ankylosing spondylitis, Lyme arthritis and osteoarthritis.
  • composition, nucleic acid and vector according to the invention as described above are provided for use to treat an inflammatory disease, wherein said inflammatory disease is sepsis.
  • composition, nucleic acid and vector according to the invention as described above are provided for use to treat an inflammatory disease, wherein said inflammatory disease is LPS induced inflammation.
  • a pharmaceutical composition comprising the composition, nucleic acid and vector according to the invention as described above and a pharmaceutically acceptable carrier.
  • a kit is provided comprising the composition, nucleic acid and vector according to the invention as described above.
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide is provided wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a C
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depict
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteinase 8
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO:
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4,
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 inactivating antigen binding polypeptide comprises
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
  • MMP8 Matrix Metallo-Proteina
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective S
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNF 1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity.
  • MMP8 Matrix Metallo-Proteinase 8
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody.
  • MMP8 Matrix Metallo-Proteinase 8
  • a host cell comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
  • MMP8 Matrix Metallo-Proteinase 8
  • said antigen binding protein is derived from a camelid antibody, preferably from a heavy chain camelid antibody, devoid of light chains, such as a variable domain of a heavy chain camelid antibody (VHH).
  • VHH variable domain of a heavy chain camelid antibody
  • said VHH comprises a sequence selected from the group consisting of SEQ ID N° 1 - SEQ ID N°6.
  • a composition comprising a MMP8 inactivating antigen binding polypeptide, a TNFR1 inactivating antigen binding polypeptide and at least one antigen binding polypeptide directed against a third target.
  • the present invention also relates to a trispecific or multispecific polypeptide, comprising or essentially consisting of at least three binding moieties, such as three immunoglobulin single variable domains (ISVs), wherein at least one of said at least three binding moieties is directed against a first target, at least one of said at least three binding moieties is directed against a second target and at least a third binding moiety increasing half-life, such as e.g. an Albumin binder.
  • ISVs immunoglobulin single variable domains
  • polypeptides of the invention can be used as "building blocks" to form polypeptides of the invention, e.g., by suitably combining ISVs with other groups, residues, moieties or binding units, in order to form compounds or constructs as described herein (such as, without limitations, bi-/tri-/tetra-/ multivalent polypeptides and bi-/tri-/tetra- /multispecific polypeptides of the invention described herein) which combine within one molecule one or more desired properties or biological functions.
  • polypeptides of the invention can be adapted and examples of such polypeptides with adapted valence and specificity will be clear to the skilled person based on the disclosure herein; and such bi-/tri- /tetra-/ multivalent polypeptides and bi-/tri-/tetra-/multispecific polypeptides form a further aspect of the invention.
  • the process of designing/selecting and/or preparing the composition comprising a MMP8 inactivating antigen binding polypeptide and a TNF 1 inactivating antigen binding polypeptide of the invention, starting from an amino acid sequence of the invention, is also referred to herein as "formatting" said amino acid sequence of the invention; and an amino acid of the invention that is made part of a compound or polypeptide of the invention is said to be “formatted” or to be “in the format of said compound or polypeptide of the invention". Examples of ways in which an amino acid sequence of the invention can be formatted and examples of such formats will be clear to the skilled person based on the disclosure herein; and such formatted polypeptides form a further aspect of the invention.
  • antigen binding affinity of polypeptides of the invention can be adapted and examples of such polypeptides with adapted antigen binding affinities will be clear to the skilled person based on the disclosure herein; and such polypeptides with adapted antigen binding affinities form a further aspect of the invention.
  • non-limiting examples of MMP8 inactivating antigen binding polypeptides can be found in WO2012059513.
  • TNFR1 inactivating antigen binding polypeptides the reader is referred to WO2008149148, WO2008113515 and Steeland S et al., J Biol Chem. 2015.
  • the polypeptides of the invention have an increased half-life in serum (as further described herein). More specifically, the half-life of ISVs according to the invention is increased when compared to the immunoglobulin single variable domain from which they have been derived.
  • an immunoglobulin single variable domain of the invention may be linked (chemically or otherwise) to one or more groups or moieties that extend the half-life (such as PEG), so as to provide a derivative of an amino acid sequence of the invention with increased half-life.
  • polypeptides of the invention are known to the skilled person and are further explained based on the disclosure herein, and for example comprise polypeptides of the invention that have been chemically modified to increase the half-life thereof (for example, by means of pegylation); polypeptides of the invention that comprise at least one additional binding site for binding to a serum protein (such as serum albumin); or polypeptides of the invention which comprise at least one amino acid sequence of the invention that is linked to at least one moiety (and in particular at least one amino acid sequence) which increases the half-life of the amino acid sequence of the invention.
  • polypeptides of the invention that have been chemically modified to increase the half-life thereof (for example, by means of pegylation); polypeptides of the invention that comprise at least one additional binding site for binding to a serum protein (such as serum albumin); or polypeptides of the invention which comprise at least one amino acid sequence of the invention that is linked to at least one moiety (and in particular at least one amino acid sequence) which increases the half-life of the
  • polypeptides of the invention which comprise such half-life extending moieties or immunoglobulin single variable domains for example include, without limitation, polypeptides in which the one or more immunoglobulin single variable domains of the invention are suitably linked to one or more serum proteins or fragments thereof (such as (human) serum albumin or suitable fragments thereof) or to one or more binding units that can bind to serum proteins (such as, for example, domain antibodies, immunoglobulin single variable domains that are suitable for use as a domain antibody, single domain antibodies, immunoglobulin single variable domains that are suitable for use as a single domain antibody, "dAb"'s, immunoglobulin single variable domains that are suitable for use as a dAb, or Nanobodies that can bind to serum proteins such as serum albumin (such as human serum albumin), serum immunoglobulins such as IgG, or transferrin; reference is made to the further description and references mentioned herein); polypeptides in which an amino acid sequence of the invention is linked to an Fc portion (
  • the polypeptides of the invention with increased half-life preferably have a half-life that is at least 1.5 times, preferably at least 2 times, such as at least 5 times, for example at least 10 times or more than 20 times, greater than the half-life of the corresponding amino acid sequence of the invention per se.
  • the polypeptides of the invention with increased half-life may have a half-life e.g., in humans that is increased with more than 1 hours, preferably more than 2 hours, more preferably more than 6 hours, such as more than 12 hours, or even more than 24, 48 or 72 hours, compared to the corresponding amino acid sequence of the invention per se.
  • such polypeptides of the invention have a serum half-life e.g. in humans that is increased with more than 1 hours, preferably more than 2 hours, more preferably more than 6 hours, such as more than 12 hours, or even more than 24, 48 or 72 hours, compared to the corresponding amino acid sequence of the invention per se.
  • such polypeptides of the invention exhibit a serum half-life in human of at least about 12 hours, preferably at least 24 hours, more preferably at least 48 hours, even more preferably at least 72 hours or more.
  • a polypeptide of the invention will be a linear polypeptide.
  • the invention in its broadest sense is not limited thereto.
  • a linker with three or more "arms", which each "arm” being linked to a building block, ISV or Nanobody, so as to provide a "star-shaped" construct.
  • polypeptides are linked to one or more serum proteins or fragments thereof in such a way that linkage leads to an increased half-life of the polypeptides.
  • the effect of different shapes of the construct can be tested during routine experimentation and non-limiting examples of ways in which the polypeptides can be linked are illustrated in the present disclosure; such linked polypeptides with an increased half-life form a further aspect of the invention.
  • the compounds or polypeptides of the invention can generally be prepared by a method which comprises at least one step of suitably linking the one or more immunoglobulin single variable domains of the invention to the one or more further groups, residues, moieties or binding units, optionally via the one or more suitable linkers, so as to provide the compound or polypeptide of the invention.
  • Polypeptides of the invention can also be prepared by a method which generally comprises at least the steps of providing a nucleic acid that encodes a polypeptide of the invention, expressing said nucleic acid in a suitable manner, and recovering the expressed polypeptide of the invention. Such methods can be performed in a manner known per se, which will be clear to the skilled person, for example on the basis of the methods and techniques further described herein.
  • compounds or constructs which comprise or essentially consist of one or more derivatives as described herein, and optionally further comprise one or more other groups, residues, moieties or binding units, optionally linked via one or more linkers.
  • said one or more other groups, residues, moieties or binding units are immunoglobulin single variable domains.
  • the one or more polypeptides of the invention and the one or more groups, residues, moieties or binding units may be linked directly to each other and/or via one or more suitable linkers or spacers.
  • the linkers may also be immunoglobulin single variable domains, so that the resulting compound or construct is a fusion protein or fusion polypeptide.
  • the two or more building blocks, ISVs or Nanobodies and the optionally one or more polypeptides and one or more other groups, drugs, agents, residues, moieties or binding units may be directly linked to each other (as for example described in WO 99/23221) and/or may be linked to each other via one or more suitable spacers or linkers, or any combination thereof.
  • suitable spacers or linkers for use in multivalent and multispecif ic polypeptides will be clear to the skilled person, and may generally be any linker or spacer used in the art to link amino acid sequences.
  • said linker or spacer is suitable for use in constructing polypeptides that are intended for pharmaceutical use.
  • Some particularly preferred spacers include the spacers and linkers that are used in the art to link antibody fragments or antibody domains. These include the linkers mentioned in the general background art cited above, as well as for example linkers that are used in the art to construct diabodies or ScFv fragments (in this respect, however, it should be noted that, whereas in diabodies and in ScFv fragments, the linker sequence used should have a length, a degree of flexibility and other properties that allow the pertinent VH and VL domains to come together to form the complete antigen-binding site, there is no particular limitation on the length or the flexibility of the linker used in the polypeptide of the invention, since each nanobody by itself forms a complete antigen-binding site).
  • a linker may be a suitable amino acid sequence, and in particular amino acid sequences of between 1 and 50, preferably between 1 and 30 amino acid residues.
  • amino acid sequences include gly-ser linkers, for example of the type (glyxsery)z, such as (for example (gly ser)3 or (gly3ser2)3, as described in WO 99/42077 and the (G4S)3, GS30, GS15, GS9 and GS7 linkers described in the applications by Ablynx mentioned herein (see for example WO 06/040153 and WO 06/122825), as well as hinge-like regions, such as the hinge regions of naturally occurring heavy chain antibodies or similar sequences (such as described in WO 94/04678).
  • gly-ser linkers for example of the type (glyxsery)z, such as (for example (gly ser)3 or (gly3ser2)3, as described in WO 99/42077 and the (G4S)3, GS30, GS
  • the preferred linker is (G4S)3.
  • Some other linkers are poly-alanine (such as AAA), as well as the linkers GS30 (SEQ ID NO: 85 in WO 06/122825) and GS9 (SEQ ID NO: 84 in WO 06/122825).
  • Other suitable linkers generally comprise organic compounds or polymers, in particular those suitable for use in polypeptides for pharmaceutical use. For instance, poly(ethyleneglycol) moieties have been used to link antibody domains, see for example WO 04/081026.
  • the length, the degree of flexibility and/or other properties of the linker(s) used may have some influence on the properties of the final polypeptide of the invention, including but not limited to the affinity, specificity or avidity for a chemokine, or for one or more of the other antigens. Based on the disclosure herein, the skilled person will be able to determine the optimal linker(s) for use in a specific polypeptide of the invention, optionally after some limited routine experiments.
  • the length and flexibility of the linker are preferably such that it allows each building block, ISV or Nanobody of the invention present in the polypeptide to bind to its cognate target, e.g. the antigenic determinant on each of the targets.
  • the skilled person will be able to determine the optimal linker(s) for use in a specific polypeptide of the invention, optionally after some limited routine experiments.
  • linker(s) used confer one or more other favourable properties or functionality to the polypeptides of the invention, and/or provide one or more sites for the formation of derivatives and/or for the attachment of functional groups (e.g. as described herein for the derivatives of the Nanobodies of the invention).
  • linkers containing one or more charged amino acid residues can provide improved hydrophilic properties
  • linkers that form or contain small epitopes or tags can be used for the purposes of detection, identification and/or purification.
  • linkers when two or more linkers are used in the polypeptides of the invention, these linkers may be the same or different. Again, based on the disclosure herein, the skilled person will be able to determine the optimal linkers for use in a specific polypeptide of the invention, optionally after some limited routine experiments.
  • first building block and the second building block on the polypeptide can be chosen according to the needs of the person skilled in the art, as well as the relative affinities which may depend on the location of these building blocks in the polypeptide, and whether the polypeptide comprises a linker, is a matter of design choice. However, some orientations, with or without linkers, may provide preferred binding characteristics in comparison to other orientations.
  • the order of the first and the second building block in the polypeptide of the invention can be (from N-terminus to C-terminus): (i) first building block (e.g. a first ISV such as a first Nanobody) - [linker] -second building block (e.g.
  • second building block e.g. a second ISV such as a second Nanobody
  • first building block e.g. a first ISV such as a first Nanobody
  • linker is optional
  • a further embodiment of the invention is a nucleic acid encoding a MMP8 inactivating antigen binding and/or a TNFRl inactivating antigen binding polypeptide according to the invention.
  • said nucleic acid is operably linked to a promoter, thereby allowing expression of the MMP8 and/or TNFRl inactivating polypeptide in a selected host.
  • "Operably linked” refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manner.
  • a promoter sequence "operably linked” to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the promoter sequence.
  • Promoter sequence refers to a functional DNA sequence unit that, when operably linked to a coding sequence and possibly placed in the appropriate inducing conditions, is sufficient to promote transcription of said coding sequence.
  • a host cell transformed with a vector comprising a nucleic acid according to the invention is provided.
  • Said host cell can be any host cell known to the person skilled in the art and includes, but is not limited to bacterial cells, fungal cells including yeast cells, insect cells and mammalian cells.
  • Preferably said host cell is a bacterial cell or a yeast cell.
  • Still another aspect of the invention is the use of a host cell according to the invention, for the production of a MMP8 and/or TNFRl inactivating antigen binding polypeptide.
  • Said production will normally comprise (a) the cultivation of the host cell (b) creating conditions allowing the expression of the nucleic acid encoding the MMP8 and/or TNF 1 inactivating antigen binding polypeptides - either in parallel with the cultivation or at the end of the cultivation (c) isolating the MMP8 and/or TNFR1 inactivating antigen binding polypeptide.
  • the MMP8 and/or TNFR1 inactivating antigen binding polypeptide can be secreted in the medium, or it may remain intracellular, requiring disruption of the host cell for the isolation of the MMP8 and/or TNFR1 inactivating antigen binding polypeptide.
  • a pharmaceutical composition comprising the polypeptides, nucleic acids and vectors according to the invention and a pharmaceutically acceptable carrier.
  • a pharmaceutical composition can be utilized to achieve the desired pharmacological effect by administration to a patient in need thereof.
  • a patient for the purpose of this invention, is a mammal, particularly a human, in need of treatment for the particular condition or disease.
  • treatment or “treating” or “treat” can be used interchangeably and are defined by a therapeutic intervention that slows, interrupts, arrests, controls, stops, reduces, or reverts the progression or severity of a sign, symptom, disorder, condition, or disease, but does not necessarily involve a total elimination of all disease-related signs, symptoms, conditions, or disorders. However, it will be understood that the aforementioned terms do not imply that symptoms are present.
  • the present invention includes pharmaceutical compositions that are comprised of a pharmaceutically acceptable carrier and a pharmaceutically effective amount of polypeptides, nucleic acids and vectors of the invention and a pharmaceutically acceptable carrier.
  • a pharmaceutically acceptable carrier is preferably a carrier that is relatively non-toxic and innocuous to a patient at concentrations consistent with effective activity of the active ingredient so that any side effects ascribable to the carrier do not vitiate the beneficial effects of the active ingredient.
  • a pharmaceutically effective amount of polypeptides, nucleic acids and vectors of the invention and a pharmaceutically acceptable carrier is preferably that amount which produces a result or exerts an influence on the particular condition being treated.
  • polypeptides, nucleic acids and vectors of the invention and a pharmaceutically acceptable carrier can be administered with pharmaceutically acceptable carriers well known in the art using any effective conventional dosage form, including immediate, slow and timed release preparations, and can be administered by any suitable route such as any of those commonly known to those of ordinary skill in the art.
  • the pharmaceutical composition of the invention can be administered to any patient in accordance with standard techniques.
  • the administration can be by any appropriate mode, including orally, parenterally, topically, nasally, ophthalmically, intrathecal ⁇ , intracerebroventricularly, sublingually, rectally, vaginally, and the like. Still other techniques of formulation as nanotechnology and aerosol and inhalant are also within the scope of this invention.
  • the dosage and frequency of administration will depend on the age, sex and condition of the patient, concurrent administration of other drugs, counter-indications and other parameters to be taken into account by the clinician.
  • the pharmaceutical composition of this invention can be lyophilized for storage and reconstituted in a suitable carrier prior to use.
  • physiologically acceptable carrier, excipient, stabilizer need to be added into the pharmaceutical composition of the invention (Remington's Pharmaceutical Sciences 22th edition, Ed. Allen, Loyd V, Jr. (2012).
  • the dosage and concentration of the carrier, excipient and stabilizer should be safe to the subject (human, mice and other mammals), including buffers such as phosphate, citrate, and other organic acid; antioxidant such as vitamin C, small polypeptide, protein such as serum albumin, gelatin or immunoglobulin; hydrophilic polymer such as PVP, amino acid such as amino acetate, glutamate, asparagine, arginine, lysine; glycose, disaccharide, and other carbohydrate such as glucose, mannose or dextrin, chelate agent such as EDTA, sugar alcohols such as mannitol, sorbitol; counterions such as Na+, and /or surfactant such as as TWEENTM, PLURONICSTM or PEG and the like.
  • the preparation containing pharmaceutical composition of this invention should be sterilized before injection. This procedure can be done using sterile filtration membranes before or after lyophilization and reconstitution.
  • the pharmaceutical composition is usually filled in a container with sterile access port, such as an i.v. solution bottle with a cork.
  • a container with sterile access port such as an i.v. solution bottle with a cork.
  • the cork can be penetrated by hypodermic needle.
  • the polypeptides, nucleic acids and vectors according to the invention are provided for use as a medicament.
  • Said medicament is needed in a therapeutically effective amount.
  • an "effective amount" can vary for the polypeptides, nucleic acids and vectors of the present invention.
  • One skilled in the art can readily assess the potency of the polypeptides, nucleic acids and vectors according to the invention.
  • the dosage and concentration can be adjusted according to the actual situation as the effective amount needed will depend upon the severity of the disease and the general state of the patient's health.
  • One skilled in the art knows how to choose proper dosage and injection means according to the actual situation.
  • mice and human can be seen in Mordenti, J. and Chappell, W. "The use of interspecies scaling in toxicokinetics” in Toxicokinetics and New Drug Development, Yacobi et al.; Pergamon Press, New York 1989, pp.42-96.
  • Treatment performed using the compositions described herein is considered “effective” if one or more symptoms are reduced, relative to such symptoms present before treatment, or relative to such symptoms in an individual (human or model animal) not treated with such composition or other suitable control.
  • Symptoms will obviously vary depending upon the disease or disorder targeted, but can be measured by an ordinarily skilled clinician or technician. Such symptoms can be measured, for example, by monitoring the level of one or more biochemical indicators of the disease or disorder (e.g., levels of an enzyme or metabolite correlated with the disease, affected cell numbers, etc.), by monitoring physical manifestations (e.g., inflammation, etc.), or by an accepted clinical assessment scale.
  • a sustained (e.g., one day or more, preferably longer) reduction in disease or disorder symptoms by one or more points on a given clinical scale is indicative of "effective” treatment.
  • prophylaxis performed using a composition as described herein is "effective” if the onset or severity of one or more symptoms is delayed, reduced or abolished relative to such symptoms in a similar individual (human or animal model) not treated with the composition.
  • Example 1 MMP8 and sTNFRl plasma levels are elevated in human severe sepsis and septic shock.
  • TNFR1 and MMP8 plasma levels were positively correlated with IL6 (r 0.53 and 0.59, Figures 13D and E, Table 2) and CRP levels (r 0.39 and 0.53), and also with the sequential organ failure assessment (SOFA) score (r 0.58 and 0.51), an objective score that describes the incidence and severity of organ dysfunction in critically ill patients (Vincent et al., 1996, Intensive Care Med 22:707-710) ( Figures 13F and G, Table 2).
  • SOFA sequential organ failure assessment
  • MMP8 and sTNFRl levels were also correlated with each other (r 0.66, Figure 13H).
  • TNFRSFIA mRNA expression in whole blood-derived RNA of sepsis patients was significantly increased and MMP8 mRNA expression tended to be increased from the first day after ICU admission compared to healthy control patients (Table 2).
  • Table 2 Pearson correlation coefficients for inflammatory markers and disease score in sepsis patients
  • Example 2 Increased Tnfrsfla and Mmp8 expression during endotoxemia compensate for the loss of MMP8 and TNFRl in deficient mice.
  • DKO mice double knockout mice by crossing MMP8 7" and TNFRl 7" mice and analyzed their susceptibility to endotoxemia. Initially, all mice were injected with a dose of LPS which is LDioo for WT mice, and both MMP8 7" and TNFRl 7" mice showed partial but significant protection (survival rate of 57% and 83%, respectively). DKO mice, however, were completely protected ( Figure 3A-B). To further investigate the magnitude of protection, all mice were injected with 6 x LDioo of WT mice.
  • DKO mice were highly resistant (survival rate of 81,5%) to hypothermia and death induced by this LPS dose, which is in sharp contrast to the WT and single deficient mice, all of which died 24 to 30 h after challenge.
  • Eight hours after LPS extremely high systemic levels of pro-inflammatory cytokines, such as IL6 and IL17A, were found in serum of WT mice ( Figure 16 A-B).
  • IL6 levels in single KO mice were not significantly lower compared to WT mice but they were completely reduced in the DKO mice. Levels of IL17a were already lower in the single KO mice, and the same trend was seen in the DKO mice.
  • Example 4 Both MMP8 and TNFR1 are involved in the increased permeability of intestinal and blood- cerebrospinal fluid barriers during endotoxemia.
  • Example 5 MMP8/TNFR1 double deficiency blunts local and systemic inflammation during endotoxemia.
  • Example 6 Combined deficiency of MMP8 and TNFR1 leads to superior protection against CLP and is accompanied by reduced systemic inflammation and liver damage.
  • TNFRl 7- mice displayed reduced hypothermia for a period of 72 h after initiation of CLP compared to WT mice, they eventually died at a similar rate as WT mice.
  • the protection in the DKO mice is accompanied by lower systemic IL6 levels and also in the peritoneal lavage fluid chemokine levels like KC were significantly lower in DKO mice than in WT or single KO mice ( Figure 5 C-D).
  • TNFRl 7- and MMP8 7- mice did not have lower levels of neutrophil chemokines KC and MIP2 in PFL than WT mice ( Figure 6G-H), pointing to an inefficient chemokine response in those mice as the reduced number of neutrophils in DKO mice could be explained by a reduction in PFL chemokines.
  • Figure 6G-H pointing to an inefficient chemokine response in those mice as the reduced number of neutrophils in DKO mice could be explained by a reduction in PFL chemokines.
  • Example 8 Blocking TNFR1 and MMP8 simultaneously with antibodies provides stronger protection than single treatments and reproduces the DKO phenotvpe after endotoxemia.
  • TNFR1 7" mice were injected with the anti-MMP8 Nb and LPS (LD 75 in TNFR1 7" mice). This treatment completely protected against hypothermia and death ( Figure 7 A-B).
  • MMP8 7" mice were injected with anti-TNFRl Ab and a lethal dose of LPS.
  • mice C57BL/6J wildtype (WT), C57BL/6J TNFR1 (TNFR1-/-) and C57BL/6J MMP8 deficient (MMP8-/-) and C57BL/6J TNFR1-/-MMP8-/- mice (DKO) mice were used.
  • TNFR1-/- and MMP8-/- mice are described by M. Rothe ( Rothe J et al., Nature 1993;364:798-802) and Balbin (Balbin M et al., Nature genetics 2003;35:252-257), respectively.
  • DKO mice were generated by intercrossing TNFR1-/- and MMP8-/- mice. All mice were housed in SPF conditions with 12-12 h light and dark cycles and free access to food and water. We used age- (8-12 weeks) and gender-matched mice. All experiments were approved by the animal ethics committee of Ghent University.
  • Endotoxemia model Mice were injected intraperitoneal ⁇ (i.p.) with lipopolysaccharide (LPS) from Salmonella enterica serotype abortus equi (Sigma). The doses corresponded to LD100 (10 mg/kg) or 6 x LD100 for WT mice (60 mg/kg) or the lethal dose for TNFR1 7" and MMP8 7" mice (20 mg/kg). Control mice were injected with PBS. Rectal body temperature was followed after challenge. Body temperature of dead mice is set to 24°C as long as the remaining living mice form the same group are monitored. Organs and blood were isolated 8 h after injection of 10 mg/kg LPS for further analysis.
  • LPS lipopolysaccharide
  • mice were subjected to CLP for induction of polymicrobial, peritoneal sepsis according to Wichterman & Chaudry 1980 (J Surgic Res 29:189-201). Sepsis was induced in isoflurane-anesthetized mice by 75% ligation of the cecum, followed by a single through-and-through puncture with a 21-Gauge needle, extruding a small amount of cecal contents as described previously (Vandenbroucke RE et al. 2012, J Neurosci 32:9805-9816). During lethality studies, mice were injected i.p.
  • mice underwent the same procedure but without ligation and puncture.
  • the cecum of mice subjected to sublethal CLP was 50% ligated and punctured only once. Rectal body temperature was followed after challenge during several days. Body temperature of dead mice is set to 24°C as long as the remaining living mice from the same group are monitored. After 6 h or 24 h, blood and organs were collected and peritoneal lavage was performed with 4 ml of ice-cold PBS.
  • MMP8-/- and TNFR1-/- mice were injected i.p. with 10 mg/kg Armenian hamster anti-TNFRl antibody (R&D) or 25 mg/kg trivalent anti-MMP8 Nanobody (Demeestere D et al., Molecular therapy : the journal of the American Society of Gene Therapy 2016), respectively, and an LD100 injection of LPS.
  • Control mice were treated with control Nb (Steeland S, The Journal of biological chemistry 2014) or PBS.
  • LPS-injected WT mice were treated with 10 mg/kg anti-TNFRl antibody, 25 mg/kg anti-MMP8 Nanobody, a combination of both, or with vehicle.
  • RNALater RNALater
  • Choroid plexus was snap-frozen.
  • RNA concentration was measured using the Nanodrop 1000 (Thermo Scientific) and cDNA was synthesized by the iScript cDNA Synthesis Kit (Bio-Rad).
  • qPCR was performed with the Light Cycler 480 system (Roche) using Sensifast Bioline Mix (Bio-Line).
  • Expression levels were normalized to the expression of the two most stable housekeeping genes, which were determined for each organ using geNorm (Vandesompele et al. 2002, Genome Biol 3:research0034): liver, hypoxanthine-guanine phosphoribosyltransferase (Hprt) and ribosomal protein (Rpl); ileum, ribosomal protein (Rpl) and Gapdh; lung: Rpl and Hprt; brain: Hprt and Ubc; and choroid plexus (CP): Gapdh and Rpl.
  • housekeeping genes were 60S acidic ribosomal protein P0 (RPLP0) and 60S ribosomal protein L13a (RPL13A).
  • Mmp8 forward 5'-ATTCCCAAGGAGTGTCCAAGC-3' (SEQ ID NO:8); reverse 5'- TG ATTGTC ATATCTCC AG C ACTG G -3' (SEQ ID NO:9);
  • Tnfrsfla forward 5'-CCGGGAGAAGAGGGATAGCTT-3' (SEQ ID NO:10); reverse 5'- TCGGACAGTCACTCACCAAGT-3' (SEQ ID NO:ll);
  • MMP8 forward 5'-TTTTGATGCCGAAGAAACATGGA-3' (SEQ ID NO:12), reverse 5'- GTGAGCGAGCCCCAAAGAA-3' (SEQ ID NO:13);
  • TNFRSF1A forward 5'-CCTCAGGGGTTATTGGACTGG-3' (SEQ ID NO:14), reverse 5'- G G G G AC AC AC ACT ATCTCTCT-3' (SEQ ID NO:15);
  • Gapdh forward 5'-TGAAGCAGGCATCTGAGGG-3' (SEQ ID NO: 16), reverse 5'- CGAAGGTGGAAGAGTGGGAG-3' (SEQ ID NO:17);
  • Ubc forward 5'-AGGTCAAACAGGAAGACAGAC GTA-3' (SEQ ID NO:18), reverse 5'- TCACACCCAAGAACAAGCACA-3' (SEQ ID NO:19);
  • Hprt forward 5'-AGTGTTGGATACAGG CCAGAC-3' (SEQ ID NO:20), reverse 5'- CGTGATTCAAATCCCTGAAGT-3' (SEQ ID NO:21);
  • Rpl forward 5' -CCTG CTG CTCTC AAG GTT-3' (SEQ ID NO:22), reverse 5' -TG GTTGTC ACTG CCTCGTACTT-3' (SEQ ID NO:23);
  • RPLP0 forward 5'-CATGCTCAACATCTCCCCCTTCTCC-3' (SEQ ID NO:24), reverse 5'- GGGAAGGTGTAATCCGTCTCCACAG-3' (SEQ ID NO:25);
  • RPL13A forward 5'-CCTGGAGGAGAAGAGGAAAGAGA-3' (SEQ ID NO:26), reverse 5'- TTGAGGACCTCTGTGTATTTGTCAA-3' (SEQ ID NO:27).
  • Plasma cytokine, chemokine and MMP8 determination Levels of cytokines and chemokines were measured in plasma and peritoneal lavage fluid using a multiplex method (Bio-Plex Pro-assay Bio-Rad). MMP8 levels in human heparin plasma were detected with the Luminex Fluorokine Map Multiplex Human MMP Assay (R&D Systems). All techniques were performed according to the manufacturer's guidelines.
  • Soluble human TNFR1 and IL6 levels were determined in human heparin plasma with the human TNFRSFIA ELISA Pair set (Sino Biological Inc.), the human IL6 ready-set-go kit (eBioscience) according to the manufacturer's guidelines.
  • the following examples focus on the design and use of a trispecific construct capable of inhibition of both TNFR1 and MMP8.
  • Nb 70-alb-14 binding affinity of Nb 70-alb-14 to human TNFR1, mouse MMP8 and albumin with ELISA and surface plasmon resonance (SPR).
  • SPR surface plasmon resonance
  • Nb 70-alb-14 1.482 nM and Nb 14 0.66 nM
  • the affinity of Nb 70-alb-14 for mouse albumin was lower than that of Nb Alb-Ctrl-Ctrl and of Nb Alb (25.89 nM, 3.55 nM and 0.8249 nM, respectively).
  • Nb 70-alb-14 has fast kinetics of association to immobilized hTNFRl (Kai 7.523E4 1/Ms) with an overall equilibrium affinity of 75.4 nM ( Figure 10a) but to MMP8_CD and MMP8_FL the association kinetics are a little bit slower (K a i 5.074E4 1/Ms and K a i 3.140E4 1/Ms, respectively) ( Figure lOb-c).
  • K D Equilibrium constant (K D ) of Nb 70-alb-14, Nb 14 and Nb 70 determined by surface plasmon resonance (SPR) 1 and K d by ELISA to immobilized mouse catalytic domain MMP8 (mMMP8_CD), mouse full length domain (mMMP8_FL), human TNFR1 (hTNFRl) and albumin.
  • SPR surface plasmon resonance
  • NA means not applicable
  • Example 10 Inhibition capacity Nb 70-A-14 ofMMP8 and TNFR1.
  • Figure 11a shows that the inhibition capacity of the monovalent Nb 70 is higher than that of Nb 70-alb-14 (IC 50 868.3 nM vs 1670 vs). This indicates that Nb 70 needs to be in a certain conformation to inhibit the TNF/TNFR1 signaling pathway and that this conformation is altered by the creation of our trivalent construct resulting in an almost 2-fold reduction in inhibitory activity.
  • the inhibitory capacity of the MMP8-inhibiting unit of Nb 70-alb-14 was determined by the DQ gelatin test ( Figure lib).
  • DQgelatin is a substrate for MMP8 that contains a quenched fluorophore which is released when gelatin is cleaved.
  • First Nb 70-alb-14 was incubated with mMMP8_CD for 30 min after which DQ gelatin was added.
  • the reduced change in fluorescence over time is a measure for the inhibitory capacity of Nb 70-alb-14 for mMMP8_CD.
  • Figure lib left shows that increased amounts of Nb 70-alb-14 reduce the fluorescence over time. The higher the Nb/MMP8 ratio (w/w), the more MMP8 activity is reduced.
  • Nb 70-alb-14 has an IC 5 o of 4.91 ⁇ which is 5.5 times better than the IC 5 o of Nb 14 (26.97739 ⁇ ). This indicates that in the case of MMP8 inhibition the generation of a trivalent construct ameliorates its inhibition capacities.
  • Example 11 Analysis of the serum half-life of Nb 70-alb-14. Serum half-life of Nb 70-alb-14 was determined after a single intraperitoneal (i.p.) injection of 1000 ⁇ g Nb 70-alb-14 in wild type C57BL/6J mice. Blood was taken at various time points for seven consecutive days and serum concentrations of Nb70-alb-14 were determined using hTNFRl ELISA. After i.p.
  • Nb70-alb-14 is absorbed through the peritoneum into the bloodstream (absorption phase) and Nb 70-alb-14 serum levels reach a maximal concentration (C ma x) after 8 h of 48.2 ng/ ⁇ and has an area under the curve (AUC) of 2115+/-323 ( Figure 12a).
  • C ma x maximal concentration
  • AUC area under the curve
  • Nb 70-alb-14 shows biphasic elimination, starting with a distribution and elimination phase that quickly decreases serum Nb 70-alb-14 concentration, followed by slower elimination from the circulation.
  • Nb70-alb-Nbl4 as a Tl/2 of 43.5h.
  • Example 12 In vivo inhibition in CLP.
  • mice were treated with 500 ⁇ g Nb 70-alb-14 immediately after the surgery, and after 24 h and 48 h. In this model, mice are slightly protected and have a delay of mortality and the final mortality rates were lower after treatment. However, further research is needed to see whether survival could be enhanced with a higher dose and a more frequent dosing of Nb 70-alb-14 (Figure 12 C).
  • CLP cecal ligation and puncture
  • hTNFRl transgenic mice As a final proof-of-concept, we subjected hTNFRl transgenic mice (Steeland et al., unpublished results) to severe CLP with high mortality or to sublethal CLP with lower mortality to reproduce the sepsis lethality rates in human (data not shown).
  • CLP cecal ligation and puncture
  • mice behave similarly as WT mice in the CLP model
  • CLP CLP and confirmed a similar sensitivity as in WT mice
  • mice were treated with Nb 70-alb-14 according to the following treatment scheme based on their serum half-life (Tl/2).
  • hTNF l Tg mice were treated with 1 mg Nb 70-alb-14 or PBS directly after the CLP surgery and after 9 h, 24 h and 48 h.
  • Mice treated with Nb 70-alb-14 experienced reduced hypothermia compared to mice treated with PBS ( Figure 15 A).
  • Nb 70-alb-14 expressed in Pichia pastoris.
  • Nb 70-alb-14 consisting of Nb 70 (a Nb that binds human tumor necrosis factor receptor 1 (hTNFRl) and inhibits the TNF/hTNFRl signaling) (Steeland S et al., J Biol Chem 2014).
  • Nb 14 (a Nb that inhibits human and mouse matrix metalloproteinase 8 activity) (Demeestere D et al, Molecular therapy : the journal of the American Society of Gene Therapy 2016) and an anti-albumin Nb, linked to each other with flexible [G 4 S]3 linkers.
  • the C- terminal end of Nb 70 is linked to the N-terminal end of the anti-Alb Nb and its C-terminal end to the N- terminal end of Nb 14, followed by a his 6 -tag ( Figure 8a-b).
  • the different VHH building blocks of Nb 70-alb-14 were designed in the pUC57, with the Nb 14 VHH gene at the N-terminal end and the His 6 -tag at the C-terminal end and the construct was ordered by GenScript.
  • the yeast Pichia pastoris (Strain GS115) expression system was used to express Nb 70-alb-14 and to allow expression in P. pastoris, the sequence was cloned into the pAOXZalfa vector and transformed in wild type GS115 P. pastoris.
  • Nb 70-alb-14 was produced in 6 L of culture medium in baffled shake flasks (Schoonooghe S et al., Methods Mol Biol 2012;907:325- 340).
  • the medium was isolated by centrifugation at 18,000 x g for 30 min at 4°C and diafiltered against 20 mM NaH 2 P0 4 pH 7.5, 500 mM NaCI, 20 mM imidazole and 1 mM PMSF. After loading, the column was washed with 20 column volumes of the same buffer in the presence of 0.1% empigen as detergent. Before elution, the column was equilibrated with 5 column volumes of equilibration buffer without detergent.
  • the Nbs were first eluted with 20 mM NaH2P04 pH 7.5, 20 mM NaCI, 50 mM imidazole and 1 mM PMSF, and then with 400 mM imidazole in the same buffer.
  • the eluate was diluted 20 times with 25 mM sodium acetate pH 5.5 and loaded on a Source 15S column (GE Healthcare) to remove LPS and other contaminants.
  • the Nbs were eluted by a linear gradient over 20 column volumes of NaCI from 0 to 1000 mM in 25 mM sodium acetate pH 5.5. Finally, the recombinant protein was injected on a Superdex 75 gel filtration column with PBS as running solution.
  • the obtained fractions were analyzed with Coomassie stained SDS-PAGE gels and anti-His western blots. Protein concentration was measured by the Micro-BCA assay (Pierce). LPS levels were determined using an EndoSafe-PTS assay (Charles River) that makes use of LAL reagents in a FDA-licensed disposable test cartridge with a handheld reader for real-time endotoxin testing. The LPS concentration was ⁇ 0.5 EU/ml.
  • ELISA ELISA.
  • Microtiter half-area plates (Nunc) were coated overnight at 4°C with 50 ng of the substrate of interest in Tris- buffered saline (TBS) per well. Binding affinity was determined for the following substrates: hTNFRl (PeproTech, 210-07), mMMP8_CD (2), full length mouse MMP8 (mMMP8_FL; R&D systems, 2904-MP- 010) and mouse albumin (Sigma, A3559). Residual protein binding sites were blocked for 1 h at room temperature with TBS supplemented with 0.05% Tween 20 (TBST) and 5% BSA.
  • TBS Tris- buffered saline
  • Nbs were added to the wells at the indicated concentrations in TBST and 2.5% BSA, and incubated for 1 h.
  • a Nb with unrelated specificity was used as negative control: a trivalent Nb consisting of two cAbBclllO Nbs, which is a control Nb targeting anti- -lactamase (Conrath KE et al., Antimicrobial agents and chemotherapy 2001;45:2807-2812), coupled to an anti-albumin Nb, called Nb "Alb-Ctrl-Ctrl".
  • Bound Nbs were detected with a mouse anti-His antibody (1:1000) (AbD SeroTec, MCA1396) followed by anti-mouse IgGl-HRP (1:2000) (GE Healthcare, NA931). Absorption at 450 nm was measured after adding the peroxidase substrate 3,30,5,50-tetra-methyl benzidine (TMB) (BD OptEIA) followed by stopping buffer (1 M H 2 S0 4 ). The background signal at 595 nm was subtracted.
  • TMB peroxidase substrate 3,30,5,50-tetra-methyl benzidine
  • Nb affinity for hTNFRl and mMMP8_CD and mMMP8_FL was determined by Surface Plasmon Resonance (SPR) analysis using BiaCore T200.
  • Human sTNFRl (PeproTech, 210-07), mMMP8_CD (Demeestere D et al, Molecular therapy : the journal of the American Society of Gene Therapy 2016) or mMMP8_FL diluted in NaAc pH 4 (hTNFRl) or pH 5, respectively was chemically immobilized on a CM5 sensor chip using NAS/EDC until a RU of 581, 452.4 or 733.4, respectively was obtained at 25°C.
  • Binding experiments were performed at 25°C in HBS (10 mM Hepes pH 7.5, 150 mM NaCI, 3.5 mM EDTA and 0.005% Tween 20) at a flow rate of 20 ⁇ /min and a 2-fold dilution series of Nb was applied ranging from 250 nM to 1 nM. Between applying different Nb concentrations, the chip was regenerated during 300 s at a flow rate of 30 ⁇ /min with 25 mM NaOH and 500 mM NaCI (hTNFRl coating) or with 20 mM NaOH (MMP8 coating), without any detectable effect on the binding capacity of hTNFRl or MMP8. A blank uncoated channel was used as an online reference during all injections.
  • the HEK-2 blue assay is a colorimetric assay in which HEK-2 blue cells are engineered with multiple genes from the TLR2 pathway (Invitrogen).
  • HEK-2 blue cells stably express optimized alkaline phosphatase under the control of an inducible promoter, and the enzyme is secreted upon induction of the transcription factors NF- ⁇ . Reaction of the enzyme with the HEK-2 blue detection medium can be determined by colorimetry.
  • HEK-2 blue cells in detection medium were seeded at 50,000 cells per well in a 96-well plate (Invitrogen).
  • the inhibitory capacity of the different Nbs for MMP8 was investigated using the EnzChek Gelatinase/Collagenase Assay Kit (Molecular Probes, Life technologies, E12055) according to the manufacturer's instructions.
  • Activity of mMMP8_CD and inhibitory capacity of the Nbs was determined by the changes in fluorescence over time.
  • mice Plotting the activity in function of the logarithmic Nb concentration gives a sigmoidal shaped curve. A nonlinear regression was used to determine the IC50 value with GraphPad Prism 6.0.
  • Mice In this study, wild type C57BL/6J mice and hTNFRl Tg Tg mTNFR _ transgenic mice were used. The generation of the transgenic mice is described in Steeland et al, in preparation. Shortly, a BAC-construct containing the TNFRSF1A gene was injected via pronucleus injection into zygotes of heterozygous Tnfrsfla mice. Via a breeding program, mice were obtained that are full Tnfrsfla knock-out and homozygous for TNFRSF1A. All mice were bred in the specific pathogen free (SPF) facility of the Inflammation Research Center (IRC, Belgium) in a controlled environment (12-hour light-dark cycle; 20°C) with food and water ad libitum.
  • mice were subjected to CLP for induction of polymicrobial, peritoneal sepsis. Sepsis was induced in isoflurane-anesthetized mice by 75%/50% ligation of the cecum, followed by a double/single puncture with a 21-Gauge needle (lethal/sublethal model, respectively), extruding a small amount of cecal contents as described previously (Vanden broucke RE et al., J Neurosci 32:9805-9816). Mice were injected i.p. with broad-spectrum antibiotics (25 mg/kg ceftriaxone and 12.5 mg/kg metronidazole, Sigma) 9 h and 24 h after the CLP procedure.
  • broad-spectrum antibiotics 25 mg/kg ceftriaxone and 12.5 mg/kg metronidazole, Sigma
  • mice were injected i.p. right after, 24 h and 48 h after the CLP surgery with 500 ⁇ g/200 ⁇ Nb 70-al b-14 or with 200 ⁇ D-PBS. Rectal body temperature and lethality were followed after challenge.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Endocrinology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The present invention relates to a composition comprising MMP8 and TNFR1 inactivating antigen binding polypeptides, preferably antigen binding polypeptides comprising antibodies; it relates further to the use of such composition to treat inflammation, such as but not limited to systemic inflammatory response syndrome, sepsis, LPS induced inflammation, renal ischemia/reperfusion injury, ventilation induced lung injury, periodontal inflammation, rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis, ankylosing spondylitis, Lyme arthritis and osteoarthritis.

Description

Means and methods to treat inflammation
The present invention relates to a composition comprising MMP8 and TNFRl inactivating antigen binding polypeptides, preferably antigen binding polypeptides comprising antibodies; it relates further to the use of such composition to treat inflammation, such as but not limited to systemic inflammatory response syndrome, sepsis, LPS induced inflammation, renal ischemia/reperfusion injury, ventilation induced lung injury, periodontal inflammation, rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis, ankylosing spondylitis, Lyme arthritis and osteoarthritis. Severe sepsis and septic shock are important causes of morbidity and mortality in intensive care units (Angus & van der Poll, New Engl J Med 2013; Gotts & Matthay, BMJ (Clinical research ed), 2016; Fleischmann et al., Current estimates and limitations. Am J Respir Crit Care Med, 2016). Current treatment of sepsis patients is limited and focuses mainly on supportive measures (Schuerholz et al. Minerva anestesiologica, 2008;74:181-195). Although many therapeutics have been clinically evaluated, no specific treatment is currently approved to treat the heterogeneous population of sepsis patients (Heming et al., Expert opinion on emerging drugs, 2016; van der Poll, Crit Care, 2016).
The pro-inflammatory cytokine tumor necrosis factor (TNF) is one of the first to be released in response to infection (Blackwell & Christman, Br J Anaesthesia, 1996), and some authors have suggested that the use of TNF inhibitors improves survival rates in animal models of sepsis, but numerous clinical trials failed to demonstrate a statistically significant benefit (Lv et al., Int J Clin Practice, 2014).
TNF signals through two receptors; pro-inflammatory signaling is believed to happen via TNFRl, whereas TNFR2 signaling is believed to be involved in immune regulation and maintaining homeostasis. Since anti-TNF treatment is associated with side-effects that might be due to blockage of TNFRl as well as TNFR2 signals, we believe that selective TNFRl inhibition might be a better and safer approach than inhibition of TNF itself (Van Hauwermeiren et al., Cytokine & growth factor reviews, 2011). It has been shown that TNFRl deficiency protects against death after injection of moderate LPS doses (Vandenbroucke et al., EMBO Mol Med, 2013), but not against very high doses (Rothe et al., Circ Shock, 1994).
Nevertheless, in the TNF-induced lethal shock model, TNFRl-deficiency completely protects against TNF lethality by preventing TNF-induced gut permeability (Van Hauwermeiren et al., J Clin Invest, 2013; Van Hauwermeiren et al., Mucosal Immunol, 2014). Matrix metalloproteinase 8 (MMP8) is a Zn2+-dependent endopeptidase belonging to a structurally related group of MM Ps that are considered important modulators of immunity and involved in several inflammatory diseases (Vandenbroucke & Libert, Nature Rev Drug Discovery, 2014). MM P8 was proposed as a potential drug target for treatment of sepsis and multiple studies with sepsis patients reported correlations between increased MM P8 levels, higher mortality rates, increased organ failure and high plasma C-reactive protein (CRP) levels (Martin et al, Scientific Rep, 2014). In mouse models of sepsis, it was also shown that genetic and pharmacological inhibition of MMP8 improved survival. Additionally, we showed that at the level of the brain barrier located in the choroid plexus (CP), called the blood-cerebrospinal fluid (CSF) barrier, MM P8 was upregulated after LPS-induced endotoxemia and involved in the LPS-induced disruption of the blood-CSF barrier (Vandenbroucke et al., J Neurosci, 2012).
We are the first who thoroughly investigated the potential of combining both MMP8 and TN FRl inhibition and we can show that our approach leads to an unexpected improvement of sepsis outcome compared to single inhibition. We found that both TN FRl and MM P8 play mainly detrimental roles during sepsis and show that both TNFRl and M MP8 inhibition has a cumulative effect in human sepsis patients as well as in mouse models. Even more beneficial we can provide a single construct capable to inhibit both MM P8 and TNFRl. Our pioneering work opens the road for a novel treatment approach for inflammatory diseases and particularly for sepsis and LPS induced inflammation commonly known to be hardly druggable.
Brief description of the figures
FIGURE 1 A-E: sTN FRl and MMP8 levels are increased in human sepsis patients and the levels were correlated with disease severity. Blood was withdrawn daily of sepsis patients after meeting the inclusion criteria and after admission in the intensive care unit (ICU) during 7 consecutive days. (A-B) M MP8 and sTN FRl levels were determined daily in plasma of sepsis patients with Luminex technology and ELISA, respectively and compared with the levels in healthy controls. (C-E) Scatterplots of sTN FRl (C) and MM P8 (D) plasma levels versus SOFA score, and sTNFRl versus MMP8 plasma (E) determined in sepsis patients. Bars represent mean ± SEM and n=13 sepsis patients and n=6 healthy controls.
FIGURE 2 A-B: MMP8 and TN FRl deficiencies leads to elevated expression of Tnfrsfla and Mmp8, respectively, eight hours after LPS injection. Wild type (WT), TN FRl-/- and M MP8-/- mice were injected with 10 mg/kg LPS (LD100) or PBS (untreated) and organs were analyzed after 8 h. (A) Fold change of Tnfrsfla gene expression in WT and M M P8-/- mice compared to untreated mice determined in ileum, choroid plexus and lung. (B) Fold change of Mmp8 gene expression in WT and TN FRl-/- mice compared to untreated mice determined in ileum, choroid plexus and lung. qPCR data were normalized to stable housekeeping genes. Bars represent mean ± SEM and n = 6-7 mice/group (untreated n = 7, WT n = 7, MMP8-/- n = 7, TNFRl-/- n = 6).
FIGURE 3 A-D: Dual deficiency of M MP8 and TN FRl synergistically protects against endotoxemia. Wild type (WT, -■· ), MMP8-/- ( -o ), TNFRl-/-( -«-)and DKO ( ~0- ) mice were injected intraperitoneally with LD100 of LPS (A-B) or with 6 x LD100 of LPS (60 mg/kg) (C-D). Survival and rectal body temperature were monitored. Body temperature and bars present mean ± SEM, n = 2-27 mice/group. (A-B) -■ - WT (n = 7),
-O MMP8-/- (n = 7), -•-TN FRl-/- (n = 6), and -O- DKO (n = 12) (C-D) WT (n = 2), MMP8-/- (n = 12), TN FRl-/- (n = 6), and DKO (n = 27).
Survival curves were compared with Mantel-Cox test and Luminex data were analyzed with a Mann- Whitney test. * for 0.01 < p < 0.05; * * for 0.001 < p < 0.01; * * * for 0.001 < p 0.0001, and * * * * for p < 0.0001.
FIGURE 4 A-l: Dual MMP8/TN FR1 inhibition preserves the intestinal and blood-cerebrospinal fluid barrier and reduces local and systemic inflammation after endotoxemia. Wild type (WT), MMP8-/-, TN FRl-/- and DKO mice were injected intraperitoneally with LD100 of LPS or with PBS (untreated). Mice were euthanized 8 h after LPS injection. (A) Permeability of the intestinal barrier was assessed by measuring leakage of fluorescently labeled dextran from the intestines into the blood circulation. (B-C) Fold change in mRNA gene expression of 116 and Mmpl3 was determined in ileum. (D) Permeability of the blood-CSF (BCSFB) was assessed by measuring leakage of fluorescently labeled dextran from the blood into the CSF during endotoxemia. (E-F) Fold change in mRNA gene expression of 116 and Nos2 was determined in the choroid plexus (CP). (G-l) Luminex technology was used to measure the cytokines IL6, I L17A and the chemokine MCP1 in plasma as indicators of systemic inflammation. qPCR data were normalized to stable housekeeping genes. Bars represent mean ± SEM, n = 4-10 mice/group.
FIGURE 5 A-D: Dual ablation of MMP8 and TN FRl synergistically protects against sepsis induced by cecal ligation and puncture (CLP). Male wild type (WT, -■· ), MM P8-/- ( -O- ), TN FRl-/-( -·-) and DKO ( -D- ) mice were subjected to CLP surgery and treated with broad-spectrum antibiotics 9 and 24 h after CLP, and mortality was monitored. Sham-treated mice underwent the same surgical procedure but without ligation and puncture. Serum and plasma were collected and analyzed 6 h after CLP. Survival (A) and rectal body temperature (B) were monitored for 10 days. C-D: Plasma I L6 levels (C) and KC levels in peritoneal lavage fluid (D) were measured with the Luminex technology. (n=12 sham; n=12 WT; n=6 MMP8-/-; n=ll TN FR1-/-; n=10 DKO). The experiment is done twice and pooled results are shown.
Body temperature data represent bars mean ± SEM, -■· WT, -o~ MMP8-/-, -#-TN FRl-/-, -O- DKO, n = 5-28 mice/group. Survival curves were analyzed with a Mantel-Cox test and Luminex data were analyzed with a two-tailed Mann-Whitney test. * for 0.01 < p < 0.05; * * for 0.001 < p < 0.01; * * * for 0.001 < p 0.0001, and * * * * for p < 0.0001.
FIGURE 6 A-H: Dual ablation of MMP8 and TN FR1 leads to moderate neutrophil efflux from blood to the peritoneum with maintenance of bacterial clearance in peritoneum and blood. Male wild type (WT, -■
), MMP8-/- ( -O- ), TN FRl-/-( -*-) and DKO ( ~0- ) mice were subjected to CLP. Sham-treated mice underwent the same surgical procedure but without ligation and puncture. Six or 24 h after CLP, blood and peritoneal lavage fluid (PLF) were collected for analysis. (A-D) The absolute number of white blood cells (WBC) and neutrophils in circulation (A-B) and in PLF (C-D) 6 h after CLP, determined with Hemavet hematology analyzer. (E-F) Blood and PLF were collected 6 and 24 h after CLP and total bacterial counts were determined and expressed as colony-forming units (CFU) per peritoneal cavity. (G-H) Chemokines
KC and M I P2 in PLF were measured by Luminex technology. Bars represent mean ± SEM, -■ · WT, -O- MMP8-/-, -«-TN FRl-/-, H DKO, n = 6-12 mice/group.
PLF= peritoneal lavage fluid; CFU = colony forming units
FIGURE 7 A-F: In endotoxemia, simultaneous therapeutic inhibition of TNFR1 and MMP8 with biologicals is significantly more protective against lethality than single inhibition. Survival (A) and body temperature (B) were monitored in TNFR1-/- mice that were injected intraperitoneally (i.p.) with LPS (LD75 in TN FR1- /- mice) and with 500 μg anti-MMP8 Nanobody ( -#- ) (N b) or control N b ( -O- ). This injection was repeated 24 h after LPS injection (n = 7 mice/group). Survival (C) and body temperature (D) were monitored in M MP8-/- mice that were injected i.p. with LPS ( LD100 in MMP8-/- mice) and 400 μg anti- TN FRl ( -■· ) or PBS ( -0- ) (n = 5-6 mice/group). Survival (E) and body temperature (F) were monitored in WT mice treated with anti-MM P8 N b and/or anti-TN FRl Ab ( ~*~ ) or PBS ( "v " ) and injected with LPS (LD75 in WT mice). After 24 h, mice received a second injection of both treatments. Mice treated only with anti-MMP8 N b or anti-TN FRl Ab received an additional PBS injection after 24 h. Body temperature data represent mean ± SEM (B-D) or mean only ( F), -*- anti-MM P8 N b, -O N b Al b-Ctrl-Ctrl, -■· anti- TN FRl Ab, -D- PBS, -*" anti-MMP8 Nb + anti-PBS N b, "V PBS + PBS n = 6-17 mice/group. Body temperatures represent mean ± SEM (B, D, H) or mean only (F). Survival curves were analyzed with the Wilcoxon test. * for 0.01 < p < 0.05; ** for 0.001 < p < 0.01.
FIGURE 8 A-B: Structure and gene construct of Nb 70-alb-14. (A) Construction of Nb 70-alb-14. At the N- terminal end of the construct, the C-terminal end of Nb 70 is linked to the N-terminal end of Nb Alb via a [G4S]3 linker. The C-terminal end of Nb Alb is then linked to the N-terminal end of Nb 14 and this Nb is linked to the His6-tag at the C-terminus. (B) Nucleotide sequence of Nb 70-Alb-14. The Nb sequences are shown in bold, the sequence of the [G4S]3 linker is underlined and the His6-tag is shown in italic. FIGURE 9 a-d: Binding Nb 70-alb-14 to hTNFRl, albumin, mMMP8_CD and mMMP8_FL. To determine the binding affinity of Nb 70-Alb-14 to hTNFRl (a), albumin (b), the catalytic domain of mouse MMP8 (mMMP8_CD) (c) and the full length MMP8 (mMMP8_FL) (d), the respective ELISAs were performed. In all ELISAs, binding affinity of Nb 70-Alb-14 was compared with the relevant monovalent Nb: Nb 70 for hTNFRl binding, Nb 14 for MMP8 binding and Nb Alb for albumin binding. A serial 0.2 dilution was applied starting at 6 μΜ (a) or 1 μΜ (b-d). Nb Alb-Ctrl-Ctrl, an irrelevant control Nanobody; 50%: Nanobody concentration that binds 50%.of the substrate. All ELISAs were done in triplicates and data are represented as mean ± S.E.M.
FIGURE 10 a-c: Surface plasmon resonance affinity measurement on immobilized hTNFRl, mMMP8_CD and mMMP8_FL. Surface plasmon resonance sensorgram of Nb 70-alb-14 on immobilized hTNFRl (a), mouse MMP8 catalytic domain (mMMP8_CD) (b), mouse MMP8 full length (mMMP8_FL) (c). The adjusted sensorgram overlays show binding of Nb 70-alb-14 applied in a dilution series ranging from 500 nM to 2.01 nM or 250 nM to 0.97 nM to immobilized hTNFRl or MMP8. Dotted lines show global fitting of the binding data to a two-state binding model. Surface plasmon resonance analyses were performed in duplicate.
FIGURE 11 a-c: Inhibition of TNF/TNFR1 and MMP8 activity by Nb70-alb-14. (a) HEK-2 blue inhibition assay with Nb 70-alb-14 and monovalent equivalents, in which cells were preincubated with a serial 0.2 Nb dilution starting at 5 μΜ. (b-c) The EnzChek collagenase assay was used to determine inhibitory capacity of Nb 70-alb-14 for the mouse catalytic domain of MMP8 (mMMP8_CD). (b) Change in fluorescence (RLU) in function of time as a measure of MMP8 activity. Higher Nb 70-alb-14 concentrations lead to reduced increment of fluorescence over time, (c) Percentage of MMP8 activity in function of Nb/MMP8 ratio. RLU: Relative light units; The HEK-2 blue assays were performed in triplicates, data represent mean ± S.E.M. FIGURE 12 a-d: Serum half life of Nb 70-alb-14 and in vivo efficacy of Nb 70-alb-14 in endotoxemia and CLP.
A: Serum half-life of Nb 70-alb-14 was determined after a single injection of 1000 μg of Nb 70-alb-14 in wild type (WT) mice. Serum concentrations were determined with a hTNFRl ELISA (n =10).
B: Serum half-life of Nb 70-alb-14 was determined in wild type C57BL/6J mice (n=9) after multiple injections of 100 μg of Nb 70-alb-14 where the first injection was followed by 2 consecutive injections after 10 h and 24 h. Serum concentrations were determined by a hTNFRl ELISA.
C: Mice were subjected to cecal ligation and puncture (CLP) and injected with 500 μg Nb 70-alb-14(n=14) or PBS (n=14), directly after the procedure, after 24h and after 48h. Lethality was followed over time. Data represent mean ± S.E.M.
D: Wild type (WT) mice and mice that have a human TNFR1 transgene in a TNFRl-background (hTNFRl Tg mice) were subjected to cecal ligation and puncture (CLP). Mice were treated with broad-spectrum antibiotics 9 and 24 h after CLP, and mortality was monitored. Lethality between the two mouse lines was compared to exclude differences in sensitivity between the WT and hTNFRl mice, (n =11 WT, n =17 hTNFRl Tg mice; p=0.61). This experiment was done twice.
FIGURE 13 A-l: sTNFRl, MMP8 and IL6 plasma levels are increased in human sepsis patients and the levels were correlated with each other and with disease severity
Blood was withdrawn daily of sepsis patients after meeting the inclusion criteria and after admission in the intensive care unit (ICU) during maximally 7 consecutive days or until the end of their stay in ICU. A-C: MMP8, sTNFRl and IL6 levels were determined daily in plasma of sepsis patients with Luminex technology (MMP8) and ELISA and were compared with the levels in healthy controls.
D-H: Scatterplots of sTNFRl (D,F,H) and log(MMP8) (E,G,H) plasma levels versus SOFA score (F,G) and log(IL6) plasma levels (D,E), and sTNFRl versus log(MMP8) plasma (H) determined in sepsis patients. I: Fold induction of MMP8 and TNFRSF1A in whole blood-derived RNA determined in sepsis patients and compared to expression levels determined in healthy controls preference set to 1).
In A-C, data represent min-to-max box and whiskers. MMP8 and sTNFRl plasma levels and MMP8 and TNFRSF1A expression levels were tested with one-way ANOVA, adjusted for multiple comparisons and compared to the healthy controls. MMP8 and IL6 plasma levels were log-transformed. Correlations were tested against zero using a two-sided t-test. n=13 sepsis patients; n=6 healthy controls. * for 0.01 < p < 0.05; ** for 0.001 < p < 0.01; *** for 0.001 < p 0.0001, and **** for p < 0.0001. FIGURE 14 A-D: Mmp8 and Tnfrsfla expression is upregulated after endotoxemia and cecal ligation and puncture (CLP) in different organs
A-B: Wild type (WT) mice were injected with 10 mg/kg LPS (LD100) or PBS (untreated) and organs were analyzed after 8 h. Relative gene expression determined by qPCR of Mmp8 (A) and Tnfrsfla (B) in WT compared to untreated mice determined in liver, choroid plexus (CP) and ileum (n=7 untreated, n=7 LPS for all organs). The experiment is done twice.
C-D: Wild type (WT) mice were subjected to cecal ligation and puncture (CLP). Sham-treated mice underwent the same surgical procedure but without ligation and puncture. Organs were collected and analyzed 6 h after CLP. Relative gene expression of Mmp8 (C) and Tnfrsfla (D) in WT compared to untreated mice determined in liver, lung, choroid plexus (CP) and brain (liver n=4 sham and n=5 CLP; lung n=8 sham and n=12 CLP; CP n=6 sham and n=6 CLP, brain n=6 sham and n=6 CLP). (Mmp8 liver p=0.04 lung p=0.0003, CP p=0.002, brain p=0.04: Tnfrsfla liver p=0.03, lung p=0.0005, CP p=0.004). The experiment is done twice.
qPCR data were normalized to stable housekeeping genes determined by GeNorm. Data represent min- to-max box and whiskers. Statistics between untreated/sham and treated mice were calculated with a two-tailed Mann-Whitney test. * for 0.01 < p < 0.05; ** for 0.001 < p < 0.01; * ** for 0.001 < p 0.0001, and **** for p < 0.0001.
FIGURE 15 A-C: Therapeutic simultaneous abrogation of TNFR1 and MMP8 in cecal ligation and puncture (CLP).
A-B: hTNFRl Tg mice were subjected to cecal ligation and puncture (CLP) under lethal conditions (75% ligation and 2 punctures with 21G needle). Mice were treated with an intraperitoneal injection of 1 mg Nb 70-alb-14 or PBS directly after the CLP surgery and the treatment was repeated after 9, 24 and 48 h. All mice were treated with antibiotics 9 and 24 h after the CLP procedure. Survival (A) and rectal body temperature (B) were monitored for 10 days. (n=18 Nb 70-alb-14, 28% survival; n=16 PBS, 19% survival; p=0.02). This experiment was performed four times and results were pooled.
C: hTNFRl Tg mice were subjected to cecal ligation and puncture (CLP) under sublethal conditions (50% ligation and 1 puncture with 21G needle). Mice were treated as in A.
Body temperatures represent mean ± SEM (B). Survival curves were analyzed with the Wilcoxon test. * for 0.01≤p < 0.05.
Figure 16: Dual ablation of MMP8 and TNFR1 reduces systemic chemokine levels after endotoxemia.
A-F: Wild type (WT), MMP87", TNFR17" and double knockout (DKO) mice were injected intraperitoneal^ with a lethal LPS dose or PBS (untreated). Mice were euthanized 8 h after LPS injection and plasma was collected. Luminex technology was used to determine cytokine levels of IL6 (A) and IL17a (B) and chemokine levels of MCP1 (C), KC (D), MlPlb (E) and ANTES (F) in plasma, (n = 9 untreated; n = 10 WT; n = 9 MMP87-; n = 8 TNFRl/"; n = 7 DKO).
Bars represent mean ± SEM, data were analyzed with a two-tailed Mann-Whitney test, significance levels are indicated * for 0.01 < p < 0.05; ** for 0.001 < p < 0.01; * ** for 0.001 < p 0.0001, and ** ** for p < 0.0001.
Detailed description
The present invention will be described with respect to particular embodiments and with reference to certain drawings but the invention is not limited thereto but only by the claims. Any reference signs in the claims shall not be construed as limiting the scope. The drawings described are only schematic and are non-limiting. In the drawings, the size of some of the elements may be exaggerated and not drawn on scale for illustrative purposes. Where the term "comprising" is used in the present description and claims, it does not exclude other elements or steps. Where an indefinite or definite article is used when referring to a singular noun e.g. "a" or "an", "the", this includes a plural of that noun unless something else is specifically stated.
Furthermore, the terms first, second, third and the like in the description and in the claims, are used for distinguishing between similar elements and not necessarily for describing a sequential or chronological order. It is to be understood that the terms so used are interchangeable under appropriate circumstances and that the embodiments of the invention described herein are capable of operation in other sequences than described or illustrated herein.
The following terms or definitions are provided solely to aid in the understanding of the invention. Unless specifically defined herein, all terms used herein have the same meaning as they would to one skilled in the art of the present invention. Practitioners are particularly directed to Sambrook et al., Molecular Cloning: A Laboratory Manual, 4th ed., Cold Spring Harbor Press, Plainsview, New York (2012); and Ausubel et al., Current Protocols in Molecular Biology (Supplement 114), John Wiley & Sons, New York (2016), for definitions and terms of the art. The definitions provided herein should not be construed to have a scope less than understood by a person of ordinary skill in the art.
An "antigen binding polypeptide" according to the invention typically refers to a polypeptide, which has affinity and specificity comparable to an immunoglobulin, such as an antibody. "MMP8" refers to Matrix metalloproteinase-8, also known as collagenase-2 or neutrophil collagenase and was originally believed to be expressed only by neutrophils. More recently, it has become clear that MMP8 can be expressed in a wide range of cells, such as epithelial cells, fibroblasts and macrophages, mainly during inflammatory conditions (Van Lint and Libert, 2006). Inactive MMP8 is stored in the intracellular granules of neutrophils and is released upon activation to ensure rapid availability of MMP8 at inflammatory sites. The effect of MMP8 expression on cancer progression and its association with several inflammatory disorders has been described (Van Lint and Libert, 2006).
The term "MMP8 inactivating antigen binding polypeptide" as used herein, means that the antigen binding polypeptide significantly reduces the MMP8 activity as measured in an EnzCheck® fluorescein- labeled DQ gelatin conjugate test (Invitrogen). The skilled practitioner knows methods to investigate the ability of an antigen binding polypeptide to reduce the MMP8 activity. Said antigen binding polypeptide can be any antigen binding polypeptide known to the person skilled in the art, such as but not limited to proteins, antibodies, heavy chain antibodies (hcAb), single domain antibodies (sdAb), variable domain of camelid heavy chain antibody (VHH) variable domain of the new antigen receptor (VNA ), engineered CH2 domains (nanoantibodies; Dimitrov, 2009), minibodies (Tramontano et al., 1994), and alphabodies (WO 2010066740). Among others, non-limiting examples of MMP8 inactivating antigen binding polypeptides can be found in WO2012059513. All of these MMP8 inactivating polypeptides can be applied in the aspects and embodiments of this invention.
"TNFR1" refers to Tumor necrosis factor receptor 1. Most of the biological activities of TNF are initiated by binding to TNFR1. For further explanations on TNFR1 regulation the reader is referred to Van Hauwermeiren, F. et al., Cytokine & growth factor reviews, 2014. The term "TNFR1 inactivating antigen binding polypeptide" as used herein, means that the antigen binding polypeptide significantly reduces the TNFR1 activity as measured in an HEK-2 blue assay (Invitrogen). Methods to investigate the ability of an antigen binding polypeptide to reduce the TNFR1 activity are well-known to the skilled practitioner. Said antigen binding polypeptide can be any antigen binding polypeptide known to the person skilled in the art, such as but not limited to proteins, antibodies, heavy chain antibodies (hcAb), single domain antibodies (sdAb), variable domain of camelid heavy chain antibody (VHH) variable domain of the new antigen receptor (VNAR), engineered CH2 domains (nanoantibodies; Dimitrov, 2009), minibodies (Tramontano et al., 1994), and alphabodiesTM (WO 2010066740). For non-limiting examples of TNFR1 inactivating antigen binding polypeptides the reader is referred to WO2008149148, WO2008113515 and Steeland S et al., J Biol Chem. 2015. All of these TNF 1 inactivating polypeptides can be applied in the aspects and embodiments of this invention.
The term "specificity" refers to the ability of a polypeptide to bind preferentially to one antigenic target versus a different antigenic target and does not necessarily imply high affinity.
The term "affinity" refers to the degree to which a polypeptide binds to an antigen in such a way that the equilibrium of antigen and polypeptide shifts toward the presence of a complex formed by their binding. Thus, where an antigen and a polypeptide are combined in relatively equal concentration, a polypeptide of high affinity will bind to the available antigen in such a way that the equilibrium shifts toward high concentration of the resulting complex.
As used herein, the term "potency" is a measure of the biological activity of a polypeptide. Potency of an agent can be determined by any suitable method known in the art. Cell culture based potency assays are often the preferred format for determining biological activity since they measure the physiological response elicited by the agent and can generate results within a relatively short period of time. Various types of cell based assays, based on the mechanism of action of the product, can be used, including but not limited to proliferation assays, cytotoxicity assays, reporter gene assays, cell surface receptor binding assays and assays to measure induction/inhibition of functionally essential protein or other signal molecule (such as phosphorylated proteins, enzymes, cytokines, cA P and the like), all well-known in the art. Results from cell based potency assays can be expressed as "relative potency" as determined by comparison of the polypeptides of the invention to the response obtained for the corresponding reference polypeptides, optionally further comprising an irrelevant polypeptide, such as Nb Alb-Ctrl-Ctrl (cf. examples section).
The term "antibody" as used herein, refers to an immunoglobulin molecule which specifically binds with an antigen. Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. Such an antibody is commonly composed of 4 chains, 2 heavy- and 2 light chains, and is thus tetrameric. An exception thereto are camel antibodies that are composed of heavy chain dimers and are devoid of light chains, but nevertheless have an extensive antigen- binding repertoire.
Antibodies of the present invention can thus exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, Fv, Fab and F(ab)2, as well as single chain antibodies and humanized antibodies (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, NY; Worn and Pluckthun, 2001; Koerber et al., 2015.). A "VHH" according to the invention refers to a variable domain of a heavy chain camelid antibody. Camelid antibodies, and the VHH derived sequences are known to the person skilled in the art. Camelid antibodies have been described, amongst others in WO9404678 and in WO2007118670.
An antibody usually has both variable and constant regions whereby the variable regions are mostly responsible for determining the specificity of the antibody and will comprise complementarity determining regions (CDRs).
The term "complementarity determining region" or "CDR" refers to a variable loop within the variable regions of either heavy or light chains and contains the amino acid sequences capable of specifically binding to antigenic targets. These CDR regions account for the basic specificity of the antibody for a particular antigenic determinant structure. Such regions are also referred to as "hypervariable regions." The CDRs represent non-contiguous stretches of amino acids within the variable regions but, regardless of species, the positional locations of these critical amino acid sequences within the variable heavy and light chain regions have been found to have similar locations within the amino acid sequences of the variable chains. The variable regions of the heavy and light chains of all canonical antibodies each have 3 CDR regions, each non- contiguous with the others for the respective light and heavy chains. The accepted CDR regions have been described by Kabat et al. (1991).
According to the invention, the MMP8 inactivating antigen binding protein and the TNFR1 inactivating antigen binding protein are present in one molecule. "Present in one molecule" according to the invention refers to attachment of the MMP8 inactivating antigen binding protein and the TNFR1 inactivating antigen binding protein. Attachment can be achieved in several ways as known in the art. For example, the MMP8 inactivating antigen binding protein and the TNFR1 inactivating antigen binding protein can be covalently bound to each other. As an alternative approach, the MMP8 inactivating antigen binding protein and the TNFR1 inactivating antigen binding protein are present in one molecule and are coupled by a linker. Optionally, a linker sequence can be used. An expert in this field knows how to choose an appropriate linker in between the various types of linkers known in the art. A further antigen binding protein can also be used as linker sequence to combine the MMP8 inactivating antigen binding protein and the TNFR1 inactivating antigen binding protein are present in one molecule; one such example is described further herein.
A "nucleic acid" as used herein refers to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. This term refers only to the primary structure of the molecule. Thus, this term includes double- and single-stranded DNA, and RNA. It also includes known types of modifications, for example, methylation, "caps" substitution of one or more of the naturally occurring nucleotides with an analog. The term "vector", as used herein, includes any vector known to the skilled person, including plasmid vectors, cosmid vectors, phage vectors, such as lambda phage, viral vectors, such as adenoviral, AAV or baculoviral vectors, or artificial chromosome vectors such as bacterial artificial chromosomes (BAC), yeast artificial chromosomes (YAC), or PI artificial chromosomes (PAC). Said vectors include expression as well as cloning vectors. Expression vectors comprise plasmids as well as viral vectors and generally contain a desired coding sequence and appropriate DNA sequences necessary for the expression of the operably linked coding sequence in a particular host organism (e.g., bacteria, yeast, plant, insect, or mammal) or in in vitro expression systems. Cloning vectors are generally used to engineer and amplify a certain desired DNA fragment and may lack functional sequences needed for expression of the desired DNA fragments.
According to the invention, a "host cell" refers to a cell which is suitable for transformation with a vector comprising a nucleic acid of the disclosure. Said host cell can be any host cell known to the person skilled in the art and includes, but is not limited to bacterial cells, fungal cells including yeast cells, insect cells and mammalian cells. Particularly host cells, which can be used for the production of MMP8 and/or TNFR1 inactivating antigen binding polypeptides are envisaged herein.
The term "inflammatory disease" is known to the person skilled in the art. The list of inflammatory diseases includes, but is not limited to systemic inflammatory response syndrome, sepsis, LPS induced inflammation, renal ischemia/reperfusion injury, ventilation induced lung injury, periodontal inflammation, rheumatoid arthritis, multiple sclerosis, ankylosing spondylitis, Lyme arthritis and osteoarthritis.
A "pharmaceutical composition" refers to a composition comprising the MMP8 and TNFR1 inactivating antigen binding polypeptides, nucleic acids and vectors as referred to herein in a pharmaceutically effective amount and a pharmaceutically acceptable carrier. A pharmaceutically acceptable carrier is preferably a carrier that is relatively non-toxic and innocuous to a patient at concentrations consistent with effective activity of the active ingredient so that any side effects ascribable to the carrier do not vitiate the beneficial effects of the active ingredient. It is likely that the MMP8 and TNFRl inactivating antigen binding polypeptides, nucleic acids and vectors according to the invention are administered as a combination therapy in combination with at least one further anti-inflammatory agent. Explicitly within the scope of the present application is the combined administration of the MMP8 and TNFRl inactivating antigen binding polypeptides, nucleic acids and vectors as disclosed herein with anti-infectious agents. Typically, these anti-infectious reagents are antibiotics.
Such a pharmaceutical composition can be utilized to achieve the desired pharmacological effect by administration to a patient in need thereof. A patient, for the purpose of this invention, is a mammal, particularly a human, in need of treatment for the particular condition or disease. Also within the scope of the present invention are veterinary applications. A pharmaceutically effective amount of polypeptides, nucleic acids and vectors of the invention and a pharmaceutically acceptable carrier is preferably that amount which produces a result or exerts an influence on the particular condition being treated.
It is an object of the invention to provide therapeutic agents, particularly pharmaceutical compositions, inactivating both Matrix Metallo-Proteinase 8 (MMP8) and Tumor necrosis factor receptor 1 (TNFRl). Such therapeutic agents can be useful in the treatment of inflammatory diseases.
This is achieved, according to a first aspect, by providing a composition comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a Tumor necrosis factor receptor 1 (TNFRl) inactivating antigen binding polypeptide. A series of candidate MMP8 inactivating antigen binding polypeptides and TNFRl inactivating antigen binding polypeptides to be included in such composition have been described hereinabove. More specific MMP8 inactivating antigen binding polypeptides and TNFRl inactivating antigen binding polypeptides to be included in such composition are described hereafter.
In an embodiment of the invention a composition is provided comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody. In another embodiment of the invention a composition is provided comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
In a further embodiment of the invention a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide is provided wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
SEQ ID NOs 1 to 3 refer to the sequence of the CDRs of the MMP8 inactivating antigen binding polypeptide:
SEQ ID NO: 1: GFTLDYYNIG
SEQ ID NO: 2: CISSSGGRTNYADSVKG
SEQ ID NO: 3: CMATTEGYEYDY
In another embodiment of the invention a composition is provided comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a composition is provided comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In a further embodiment of the invention a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
SEQ ID NOs 4 to 6 refer to the sequence of the CDRs of the TNFRl inactivating antigen binding polypeptide:
SEQ ID NO: 4: VRTFSSYAMG
SEQ ID NO: 5: AISWSGGSTYYADSVKG
SEQ ID NO: 6: LHEDLYEYDY
In another embodiment of the invention a composition is provided comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a composition is provided comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In a further embodiment of the invention a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a composition is provided comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a composition is provided comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
According to a particular embodiment, a composition is provided comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule.
In an embodiment of the invention a composition is provided comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody. In another embodiment of the invention a composition is provided comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
In a further embodiment of the invention a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide is provided, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a composition is provided comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a composition is provided comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment of the invention a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a composition is provided comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a composition is provided comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In a further embodiment of the invention a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a composition is provided comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In one embodiment of the invention a composition is provided comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further aspect, the invention relates to an isolated polypeptide comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, and to compositions, such as pharmaceutical compositions, comprising such isolated polypeptide.
In one embodiment, such isolated polypeptide may be comprising a MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment, such isolated polypeptide may be comprising a TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID Nos.
In yet another embodiment, such isolated polypeptide may be comprising a MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID Nos; and may be comprising a TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID Nos. One non-limiting example of such isolated polypeptide is one comprising the amino acid sequence depicted in SEQ ID NO: 7 (except for 6xHis-tag this is the amino acid sequence encoded by the nucleotide sequence of Figure 8B). According to a particular embodiment, a composition is provided comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity.
SEQ ID NO: 7:
QVQLQESGGGLVQAGGPLRLSCAASVR FSSYAMGWFRQAPGKEREFVAAI SWSGGS YY ADSVKGRF I SRDNAKNTVYLQMNSLKPEDTAVYYCAVLHEDLYEYDYWGQGTQVTVSSG GGGSGGGGSGGGGSQVQLQESGGGLVQPGGSLRLSCEASGFTFSRFGMTWVRQAPGKGVE WVSGI SSLGDS LYADSVKGRF I SRDNAKNTLYLQMNSLKPEDTAVYYC IGGSLNPGG QGTQVTVSSGGGGSGGGGSGGGGSQVQLQESGGGLVQPGGSLRLSCTASGFTLDYYNIGW FRQAPGKERERVSCI SSSGGRTNYADSVKGRF I SRDNAKNTVYLQMNSLKPEDTGVYYC AHCMATTEGYEYDYWGQGTQVTVS
SEQ ID NO: 7 depicts a tri-specific nanobody construct with the structure anti-TNFRl- anti-Albumine- anti-MMP8. The different building blocks of this construct are linked by a (G4S)3- linker. Based on the present disclosure and the underlying example section the skilled practitioner can modify the structure of this construct according to the actual needs. Modified constructs also fall under the scope of the present application and the invention should not be limited by the structure or particular sequence of the specific construct as disclosed. In an embodiment of the invention a composition is provided comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody . In another embodiment of the invention a composition is provided comprising a Matrix Metallo- Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
In a further embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided wherein said MMP8 inactivating antigen binding polypeptide comprises a CDR1 sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDR1, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In another embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDR1 sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In another embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In a further embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In a further embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. According to a particular embodiment, a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity. In an embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody. An exemplary nucleotide sequence is the one defined by SEQ ID NO: 28.
In another embodiment of the invention a nucleic acid is provided encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
In a further embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide is provided wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide is provided wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In one embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In a further embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In another embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In one embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In a further embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In another embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In another embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
According to a particular embodiment, a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity.
In an embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNF 1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody. In another embodiment of the invention a vector is provided comprising a nucleic acid encoding at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
In a particular embodiment, the composition, nucleic acid and vector according to the invention as described above are provided for use as a medicament.
In another particular embodiment, the composition, nucleic acid and vector according to the invention as described above are provided for use to treat an inflammatory disease.
In a preferred embodiment, the composition, nucleic acid and vector according to the invention as described above are provided for use to treat an inflammatory disease, wherein said inflammatory disease is selected from the list of diseases consisting of systemic inflammatory response syndrome, sepsis, LPS induced inflammation, renal ischemia/reperfusion injury, ventilation induced lung injury, periodontal inflammation, rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis, ankylosing spondylitis, Lyme arthritis and osteoarthritis.
In a particularly preferred embodiment, the composition, nucleic acid and vector according to the invention as described above are provided for use to treat an inflammatory disease, wherein said inflammatory disease is sepsis.
In another particularly preferred embodiment, the composition, nucleic acid and vector according to the invention as described above are provided for use to treat an inflammatory disease, wherein said inflammatory disease is LPS induced inflammation.
In a particular embodiment, a pharmaceutical composition is provided comprising the composition, nucleic acid and vector according to the invention as described above and a pharmaceutically acceptable carrier. In another particular embodiment, a kit is provided comprising the composition, nucleic acid and vector according to the invention as described above. In a further embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide is provided wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide is provided wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In a further embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFRl inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In another embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In another embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In one embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In a further embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs. In another embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
In one embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide, wherein said MMP8 inactivating antigen binding polypeptide and said TNFR1 inactivating antigen binding polypeptide are present in one molecule and wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH and wherein said MMP8 inactivating antigen binding polypeptide comprises a CDRl sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs and wherein said TNFR1 inactivating antigen binding protein comprises a CDRl sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDRl, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
According to a particular embodiment, a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNF 1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity. In an embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody.
In another embodiment of the invention a host cell is provided comprising a nucleic acid or a vector comprising said nucleic acid, wherein said nucleic acid encodes at least one antigen binding polypeptide of a composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a TNFR1 inactivating antigen binding polypeptide depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity, wherein said antigen binding polypeptides comprise an antibody, wherein said antibody is a VHH.
In one embodiment of the invention, said antigen binding protein is derived from a camelid antibody, preferably from a heavy chain camelid antibody, devoid of light chains, such as a variable domain of a heavy chain camelid antibody (VHH).
Preferably, said VHH comprises a sequence selected from the group consisting of SEQ ID N° 1 - SEQ ID N°6. In one embodiment a composition is provided comprising a MMP8 inactivating antigen binding polypeptide, a TNFR1 inactivating antigen binding polypeptide and at least one antigen binding polypeptide directed against a third target.
Accordingly, the present invention also relates to a trispecific or multispecific polypeptide, comprising or essentially consisting of at least three binding moieties, such as three immunoglobulin single variable domains (ISVs), wherein at least one of said at least three binding moieties is directed against a first target, at least one of said at least three binding moieties is directed against a second target and at least a third binding moiety increasing half-life, such as e.g. an Albumin binder. As will be clear from the further description above and herein, the polypeptides of the invention can be used as "building blocks" to form polypeptides of the invention, e.g., by suitably combining ISVs with other groups, residues, moieties or binding units, in order to form compounds or constructs as described herein (such as, without limitations, bi-/tri-/tetra-/ multivalent polypeptides and bi-/tri-/tetra- /multispecific polypeptides of the invention described herein) which combine within one molecule one or more desired properties or biological functions. Examples of ways in which the valence and specificity of polypeptides of the invention can be adapted and examples of such polypeptides with adapted valence and specificity will be clear to the skilled person based on the disclosure herein; and such bi-/tri- /tetra-/ multivalent polypeptides and bi-/tri-/tetra-/multispecific polypeptides form a further aspect of the invention.
The process of designing/selecting and/or preparing the composition comprising a MMP8 inactivating antigen binding polypeptide and a TNF 1 inactivating antigen binding polypeptide of the invention, starting from an amino acid sequence of the invention, is also referred to herein as "formatting" said amino acid sequence of the invention; and an amino acid of the invention that is made part of a compound or polypeptide of the invention is said to be "formatted" or to be "in the format of said compound or polypeptide of the invention". Examples of ways in which an amino acid sequence of the invention can be formatted and examples of such formats will be clear to the skilled person based on the disclosure herein; and such formatted polypeptides form a further aspect of the invention. Moreover, examples of ways in which the antigen binding affinity of polypeptides of the invention can be adapted and examples of such polypeptides with adapted antigen binding affinities will be clear to the skilled person based on the disclosure herein; and such polypeptides with adapted antigen binding affinities form a further aspect of the invention. Among others, non-limiting examples of MMP8 inactivating antigen binding polypeptides can be found in WO2012059513.
For non-limiting examples of TNFR1 inactivating antigen binding polypeptides the reader is referred to WO2008149148, WO2008113515 and Steeland S et al., J Biol Chem. 2015.
In a specific, but non-limiting aspect of the invention, which will be further described herein, the polypeptides of the invention have an increased half-life in serum (as further described herein). More specifically, the half-life of ISVs according to the invention is increased when compared to the immunoglobulin single variable domain from which they have been derived. For example, an immunoglobulin single variable domain of the invention may be linked (chemically or otherwise) to one or more groups or moieties that extend the half-life (such as PEG), so as to provide a derivative of an amino acid sequence of the invention with increased half-life. Some examples of such methods to increase the half-life of polypeptides of the invention are known to the skilled person and are further explained based on the disclosure herein, and for example comprise polypeptides of the invention that have been chemically modified to increase the half-life thereof (for example, by means of pegylation); polypeptides of the invention that comprise at least one additional binding site for binding to a serum protein (such as serum albumin); or polypeptides of the invention which comprise at least one amino acid sequence of the invention that is linked to at least one moiety (and in particular at least one amino acid sequence) which increases the half-life of the amino acid sequence of the invention. Examples of polypeptides of the invention which comprise such half-life extending moieties or immunoglobulin single variable domains for example include, without limitation, polypeptides in which the one or more immunoglobulin single variable domains of the invention are suitably linked to one or more serum proteins or fragments thereof (such as (human) serum albumin or suitable fragments thereof) or to one or more binding units that can bind to serum proteins (such as, for example, domain antibodies, immunoglobulin single variable domains that are suitable for use as a domain antibody, single domain antibodies, immunoglobulin single variable domains that are suitable for use as a single domain antibody, "dAb"'s, immunoglobulin single variable domains that are suitable for use as a dAb, or Nanobodies that can bind to serum proteins such as serum albumin (such as human serum albumin), serum immunoglobulins such as IgG, or transferrin; reference is made to the further description and references mentioned herein); polypeptides in which an amino acid sequence of the invention is linked to an Fc portion (such as a human Fc) or a suitable part or fragment thereof; or polypeptides in which the one or more immunoglobulin single variable domains of the invention are suitable linked to one or more small proteins or peptides that can bind to serum proteins, such as, without limitation, the proteins and peptides described in WO 91/01743, WO 01/45746, WO 02/076489, WO2008/068280, WO2009/127691 and PCT/EP2011/051559.
Generally, the polypeptides of the invention with increased half-life preferably have a half-life that is at least 1.5 times, preferably at least 2 times, such as at least 5 times, for example at least 10 times or more than 20 times, greater than the half-life of the corresponding amino acid sequence of the invention per se. For example, the polypeptides of the invention with increased half-life may have a half-life e.g., in humans that is increased with more than 1 hours, preferably more than 2 hours, more preferably more than 6 hours, such as more than 12 hours, or even more than 24, 48 or 72 hours, compared to the corresponding amino acid sequence of the invention per se.
In a preferred, but non-limiting embodiment of the invention, such polypeptides of the invention have a serum half-life e.g. in humans that is increased with more than 1 hours, preferably more than 2 hours, more preferably more than 6 hours, such as more than 12 hours, or even more than 24, 48 or 72 hours, compared to the corresponding amino acid sequence of the invention per se.
In another preferred, but non-limiting embodiment of the invention, such polypeptides of the invention exhibit a serum half-life in human of at least about 12 hours, preferably at least 24 hours, more preferably at least 48 hours, even more preferably at least 72 hours or more.
Usually, for easy of expression and production, a polypeptide of the invention will be a linear polypeptide. However, the invention in its broadest sense is not limited thereto. For example, when a polypeptide of the invention comprises three or more building blocks, ISVs or Nanobodies, it is possible to link them by use of a linker with three or more "arms", which each "arm" being linked to a building block, ISV or Nanobody, so as to provide a "star-shaped" construct. It is also possible, although usually less preferred, to use circular constructs. According to the invention, polypeptides are linked to one or more serum proteins or fragments thereof in such a way that linkage leads to an increased half-life of the polypeptides. The effect of different shapes of the construct can be tested during routine experimentation and non-limiting examples of ways in which the polypeptides can be linked are illustrated in the present disclosure; such linked polypeptides with an increased half-life form a further aspect of the invention.
The compounds or polypeptides of the invention can generally be prepared by a method which comprises at least one step of suitably linking the one or more immunoglobulin single variable domains of the invention to the one or more further groups, residues, moieties or binding units, optionally via the one or more suitable linkers, so as to provide the compound or polypeptide of the invention. Polypeptides of the invention can also be prepared by a method which generally comprises at least the steps of providing a nucleic acid that encodes a polypeptide of the invention, expressing said nucleic acid in a suitable manner, and recovering the expressed polypeptide of the invention. Such methods can be performed in a manner known per se, which will be clear to the skilled person, for example on the basis of the methods and techniques further described herein. Also within the scope of the present invention are compounds or constructs, which comprise or essentially consist of one or more derivatives as described herein, and optionally further comprise one or more other groups, residues, moieties or binding units, optionally linked via one or more linkers. In one embodiment, said one or more other groups, residues, moieties or binding units are immunoglobulin single variable domains.
In the compounds or constructs described above, the one or more polypeptides of the invention and the one or more groups, residues, moieties or binding units may be linked directly to each other and/or via one or more suitable linkers or spacers. For example, when the one or more groups, residues, moieties or binding units are immunoglobulin single variable domains, the linkers may also be immunoglobulin single variable domains, so that the resulting compound or construct is a fusion protein or fusion polypeptide. In the polypeptides of the invention, the two or more building blocks, ISVs or Nanobodies and the optionally one or more polypeptides and one or more other groups, drugs, agents, residues, moieties or binding units may be directly linked to each other (as for example described in WO 99/23221) and/or may be linked to each other via one or more suitable spacers or linkers, or any combination thereof. Suitable spacers or linkers for use in multivalent and multispecif ic polypeptides will be clear to the skilled person, and may generally be any linker or spacer used in the art to link amino acid sequences. Preferably, said linker or spacer is suitable for use in constructing polypeptides that are intended for pharmaceutical use.
Some particularly preferred spacers include the spacers and linkers that are used in the art to link antibody fragments or antibody domains. These include the linkers mentioned in the general background art cited above, as well as for example linkers that are used in the art to construct diabodies or ScFv fragments (in this respect, however, it should be noted that, whereas in diabodies and in ScFv fragments, the linker sequence used should have a length, a degree of flexibility and other properties that allow the pertinent VH and VL domains to come together to form the complete antigen-binding site, there is no particular limitation on the length or the flexibility of the linker used in the polypeptide of the invention, since each nanobody by itself forms a complete antigen-binding site).
For example, a linker may be a suitable amino acid sequence, and in particular amino acid sequences of between 1 and 50, preferably between 1 and 30 amino acid residues. Some preferred examples of such amino acid sequences include gly-ser linkers, for example of the type (glyxsery)z, such as (for example (gly ser)3 or (gly3ser2)3, as described in WO 99/42077 and the (G4S)3, GS30, GS15, GS9 and GS7 linkers described in the applications by Ablynx mentioned herein (see for example WO 06/040153 and WO 06/122825), as well as hinge-like regions, such as the hinge regions of naturally occurring heavy chain antibodies or similar sequences (such as described in WO 94/04678). The preferred linker is (G4S)3. Some other linkers are poly-alanine (such as AAA), as well as the linkers GS30 (SEQ ID NO: 85 in WO 06/122825) and GS9 (SEQ ID NO: 84 in WO 06/122825). Other suitable linkers generally comprise organic compounds or polymers, in particular those suitable for use in polypeptides for pharmaceutical use. For instance, poly(ethyleneglycol) moieties have been used to link antibody domains, see for example WO 04/081026.
It is encompassed within the scope of the invention that the length, the degree of flexibility and/or other properties of the linker(s) used (although not critical, as it usually is for linkers used in ScFv fragments) may have some influence on the properties of the final polypeptide of the invention, including but not limited to the affinity, specificity or avidity for a chemokine, or for one or more of the other antigens. Based on the disclosure herein, the skilled person will be able to determine the optimal linker(s) for use in a specific polypeptide of the invention, optionally after some limited routine experiments. For example, in multivalent polypeptides of the invention that comprise building blocks, ISVs or Nanobodies directed against a first and second target, the length and flexibility of the linker are preferably such that it allows each building block, ISV or Nanobody of the invention present in the polypeptide to bind to its cognate target, e.g. the antigenic determinant on each of the targets. Again, based on the disclosure herein, the skilled person will be able to determine the optimal linker(s) for use in a specific polypeptide of the invention, optionally after some limited routine experiments. It is also within the scope of the invention that the linker(s) used confer one or more other favourable properties or functionality to the polypeptides of the invention, and/or provide one or more sites for the formation of derivatives and/or for the attachment of functional groups (e.g. as described herein for the derivatives of the Nanobodies of the invention). For example, linkers containing one or more charged amino acid residues can provide improved hydrophilic properties, whereas linkers that form or contain small epitopes or tags can be used for the purposes of detection, identification and/or purification. Again, based on the disclosure herein, the skilled person will be able to determine the optimal linkers for use in a specific polypeptide of the invention, optionally after some limited routine experiments. Finally, when two or more linkers are used in the polypeptides of the invention, these linkers may be the same or different. Again, based on the disclosure herein, the skilled person will be able to determine the optimal linkers for use in a specific polypeptide of the invention, optionally after some limited routine experiments.
It will be appreciated that the order of the first building block and the second building block on the polypeptide (orientation) can be chosen according to the needs of the person skilled in the art, as well as the relative affinities which may depend on the location of these building blocks in the polypeptide, and whether the polypeptide comprises a linker, is a matter of design choice. However, some orientations, with or without linkers, may provide preferred binding characteristics in comparison to other orientations. For instance, the order of the first and the second building block in the polypeptide of the invention can be (from N-terminus to C-terminus): (i) first building block (e.g. a first ISV such as a first Nanobody) - [linker] -second building block (e.g. a second ISV such as a second Nanobody); or (ii) second building block (e.g. a second ISV such as a second Nanobody) - [linker] -first building block (e.g. a first ISV such as a first Nanobody); (wherein the linker is optional). All orientations are encompassed by the invention, and polypeptides that contain an orientation that provides desired binding characteristics can be easily identified by routine screening, for instance as exemplified in the examples section.
A further embodiment of the invention is a nucleic acid encoding a MMP8 inactivating antigen binding and/or a TNFRl inactivating antigen binding polypeptide according to the invention. In a preferred embodiment, said nucleic acid is operably linked to a promoter, thereby allowing expression of the MMP8 and/or TNFRl inactivating polypeptide in a selected host. "Operably linked" refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manner. A promoter sequence "operably linked" to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the promoter sequence. "Promoter sequence" as used here refers to a functional DNA sequence unit that, when operably linked to a coding sequence and possibly placed in the appropriate inducing conditions, is sufficient to promote transcription of said coding sequence.
In still another embodiment of the invention a host cell transformed with a vector comprising a nucleic acid according to the invention is provided. Said host cell can be any host cell known to the person skilled in the art and includes, but is not limited to bacterial cells, fungal cells including yeast cells, insect cells and mammalian cells. Preferably said host cell is a bacterial cell or a yeast cell.
Still another aspect of the invention is the use of a host cell according to the invention, for the production of a MMP8 and/or TNFRl inactivating antigen binding polypeptide. Said production will normally comprise (a) the cultivation of the host cell (b) creating conditions allowing the expression of the nucleic acid encoding the MMP8 and/or TNF 1 inactivating antigen binding polypeptides - either in parallel with the cultivation or at the end of the cultivation (c) isolating the MMP8 and/or TNFR1 inactivating antigen binding polypeptide. The MMP8 and/or TNFR1 inactivating antigen binding polypeptide can be secreted in the medium, or it may remain intracellular, requiring disruption of the host cell for the isolation of the MMP8 and/or TNFR1 inactivating antigen binding polypeptide.
Pharmaceutical composition- Route of administration
In one embodiment, a pharmaceutical composition is provided comprising the polypeptides, nucleic acids and vectors according to the invention and a pharmaceutically acceptable carrier. Such a pharmaceutical composition can be utilized to achieve the desired pharmacological effect by administration to a patient in need thereof.
A patient, for the purpose of this invention, is a mammal, particularly a human, in need of treatment for the particular condition or disease.
The terms "treatment" or "treating" or "treat" can be used interchangeably and are defined by a therapeutic intervention that slows, interrupts, arrests, controls, stops, reduces, or reverts the progression or severity of a sign, symptom, disorder, condition, or disease, but does not necessarily involve a total elimination of all disease-related signs, symptoms, conditions, or disorders. However, it will be understood that the aforementioned terms do not imply that symptoms are present.
Therefore, the present invention includes pharmaceutical compositions that are comprised of a pharmaceutically acceptable carrier and a pharmaceutically effective amount of polypeptides, nucleic acids and vectors of the invention and a pharmaceutically acceptable carrier. A pharmaceutically acceptable carrier is preferably a carrier that is relatively non-toxic and innocuous to a patient at concentrations consistent with effective activity of the active ingredient so that any side effects ascribable to the carrier do not vitiate the beneficial effects of the active ingredient. A pharmaceutically effective amount of polypeptides, nucleic acids and vectors of the invention and a pharmaceutically acceptable carrier is preferably that amount which produces a result or exerts an influence on the particular condition being treated. The polypeptides, nucleic acids and vectors of the invention and a pharmaceutically acceptable carrier can be administered with pharmaceutically acceptable carriers well known in the art using any effective conventional dosage form, including immediate, slow and timed release preparations, and can be administered by any suitable route such as any of those commonly known to those of ordinary skill in the art. For therapy, the pharmaceutical composition of the invention can be administered to any patient in accordance with standard techniques. The administration can be by any appropriate mode, including orally, parenterally, topically, nasally, ophthalmically, intrathecal^, intracerebroventricularly, sublingually, rectally, vaginally, and the like. Still other techniques of formulation as nanotechnology and aerosol and inhalant are also within the scope of this invention. The dosage and frequency of administration will depend on the age, sex and condition of the patient, concurrent administration of other drugs, counter-indications and other parameters to be taken into account by the clinician. The pharmaceutical composition of this invention can be lyophilized for storage and reconstituted in a suitable carrier prior to use.
When prepared as lyophilization or liquid, physiologically acceptable carrier, excipient, stabilizer need to be added into the pharmaceutical composition of the invention (Remington's Pharmaceutical Sciences 22th edition, Ed. Allen, Loyd V, Jr. (2012). The dosage and concentration of the carrier, excipient and stabilizer should be safe to the subject (human, mice and other mammals), including buffers such as phosphate, citrate, and other organic acid; antioxidant such as vitamin C, small polypeptide, protein such as serum albumin, gelatin or immunoglobulin; hydrophilic polymer such as PVP, amino acid such as amino acetate, glutamate, asparagine, arginine, lysine; glycose, disaccharide, and other carbohydrate such as glucose, mannose or dextrin, chelate agent such as EDTA, sugar alcohols such as mannitol, sorbitol; counterions such as Na+, and /or surfactant such as as TWEEN™, PLURONICS™ or PEG and the like.
The preparation containing pharmaceutical composition of this invention should be sterilized before injection. This procedure can be done using sterile filtration membranes before or after lyophilization and reconstitution.
The pharmaceutical composition is usually filled in a container with sterile access port, such as an i.v. solution bottle with a cork. The cork can be penetrated by hypodermic needle.
In one embodiment, the polypeptides, nucleic acids and vectors according to the invention are provided for use as a medicament. Said medicament is needed in a therapeutically effective amount. One of ordinary skill in the art will recognize that the potency and, therefore, an "effective amount" can vary for the polypeptides, nucleic acids and vectors of the present invention. One skilled in the art can readily assess the potency of the polypeptides, nucleic acids and vectors according to the invention.
The dosage and concentration can be adjusted according to the actual situation as the effective amount needed will depend upon the severity of the disease and the general state of the patient's health. One skilled in the art knows how to choose proper dosage and injection means according to the actual situation.
Furthermore, the skilled clinician will be able to determine the appropriate dosing interval to treat a disease. The animal experiments presented in the example section disclose credible instructions on how to determine an effective amount for the treatment of a human. Further on, the principle for adjusting between different species such as mice and human can be seen in Mordenti, J. and Chappell, W. "The use of interspecies scaling in toxicokinetics" in Toxicokinetics and New Drug Development, Yacobi et al.; Pergamon Press, New York 1989, pp.42-96.
Treatment performed using the compositions described herein is considered "effective" if one or more symptoms are reduced, relative to such symptoms present before treatment, or relative to such symptoms in an individual (human or model animal) not treated with such composition or other suitable control. Symptoms will obviously vary depending upon the disease or disorder targeted, but can be measured by an ordinarily skilled clinician or technician. Such symptoms can be measured, for example, by monitoring the level of one or more biochemical indicators of the disease or disorder (e.g., levels of an enzyme or metabolite correlated with the disease, affected cell numbers, etc.), by monitoring physical manifestations (e.g., inflammation, etc.), or by an accepted clinical assessment scale. A sustained (e.g., one day or more, preferably longer) reduction in disease or disorder symptoms by one or more points on a given clinical scale is indicative of "effective" treatment. Similarly, prophylaxis performed using a composition as described herein is "effective" if the onset or severity of one or more symptoms is delayed, reduced or abolished relative to such symptoms in a similar individual (human or animal model) not treated with the composition. The embodiments illustrated and discussed in this specification are intended only to teach those skilled in the art the best way known to the inventors to make and use the invention. Modifications and variation of the above-described embodiments of the invention are possible without departing from the invention, as appreciated by those skilled in the art in light of the above teachings. It is therefore understood that, within the scope of the claims and their equivalents, the invention may be practiced otherwise than as specifically described. The invention will now be further described by means of the following non-limiting preferred aspects, examples and figures.
The entire contents of all of the references (including literature references, issued patents, published patent applications, and co-pending patent applications) cited throughout this application are hereby expressly incorporated by reference, in particular for the teaching that is referenced hereinabove.
Examples
Example 1: MMP8 and sTNFRl plasma levels are elevated in human severe sepsis and septic shock.
After admission to the intensive care unit (ICU), thirteen patients were enrolled within 24 h after meeting the criteria for severe sepsis or septic shock defined at the consensus conference of 2001 (Levy et al. 2003, Intensive Care Med 29:530-538) and after a signed informed consent was obtained from the patient itself or a legal representative. Recently, a new consensus definition has been published (Singer et al. 2016, JAMA 315:801-810) but they were published after the initiation of the study so we applied the old definition. Patients' characteristics such as initial SOFA score, site of infection, the presence of septic shock and treatments were summarized in Table 1.
Table 1 Clinical characteristics of patients including in the study
Figure imgf000051_0001
Patient SOFA score @ Site of infection Septic Treatment number time of ICU shock?
admission
11 7 Pneumonia NA Augmentin, Biclar,
Solumedrol
12 13 Pneumonia Yes Augmentin, Biclar,
Meronem, Negaban
13 6 Infection with unknown focus Yes Tazocin, Flagyl, Tavanic
NA: Not available
Male or female patients > 18 years of age were included after meeting two of following criteria of severe sepsis: hyper- or hypothermia (>38°C or < 36°C); heart rhythm > 90/min; respiratory rate > 20/min and leukocytosis or leukopenia (> 12000/mm3 or < 4000/mm3), in addition to a suspected or present source of infection and elevated lactate levels (> 12 mg/dl) OR urinary output < 0.5 ml/kg/h during > 2 h despite adequate fluid resuscitation OR acute lung injury with Pa02/Fi02 < 250 in the absence of pneumonia as an infection source OR acute lung injury with Pa02/Fi02 < 200 in the presence of pneumonia as an infection source OR thrombocytopenia (< 100000/μΙ) OR coagulopathy (INR > 1.5). Patients with septic shock were included when they fulfilled the criteria of severe sepsis in addition to persistent hypotension despite adequate fluid resuscitation (systolic pressure < 90 mmHg or reduction of > 40 mmHg compared to baseline) OR the need for vasopressors despite adequate fluid resuscitation.
Patients were excluded after meeting the following criteria: age < 18 year, the use of immunosuppressive medication and patients with HIV, hematological malignancies, liver cirrhosis or chronic kidney insufficiency.
From patients meeting the inclusion criteria, blood was withdrawn within 24 h of diagnosis (day 1) and from then every day until the end of their stay in ICU. The CRP levels and sequential organ failure (SOFA) score were determined daily. Blood was collected in heparin-coated vials for other cytokine analysis or in EDTA-coated vials to determine whole blood RNA expression. Control patients had blood withdrawn at ambulatory centersr Thirteen patients and six healthy controls were included in this study. Real-time qPCR was performed (see further) on total RNA was isolated from whole blood using the NucleoSpin® RNA blood kit (Macherey-Nagel) according to manufacturer's guidelines. Bio-Plex and ELISA were performed on plasma to determine MMP8, IL6 and sTNFRl levels (see further). To demonstrate a link between MMP8 and sTNFRl levels on the one hand and disease severity on the other hand, we correlated MMP8 and sTNFRl levels with the CRP, the SOFA score and IL6 levels (see Statistics). MMP8 and sTNFRl levels were also correlated with each other. We could show that both MMP8 and sTNFRl protein levels were increased in plasma of sepsis patients compared to healthy controls already from day one of ICU admission and they remained elevated the following days (Figure 1A-B, Figure 13A-B). To demonstrate a link between MMP8 and sTNFRl levels on the one hand and disease severity on the other hand, we measured IL6 and CRP plasma levels in those patients and correlated them with each other. This revealed that MMP8 and sTNFRl levels were positively correlated with IL6 (Figure 13C) and CRP levels but also with the sequential organ failure assessment (SOFA) score, an objective score that describes the incidence and severity of organ dysfunction in critically ill patients (Vincent JL, et al., Intensive care medicine 1996;22:707-710) (Figure 1C-D). More importantly, MMP8 and sTNFRl levels were also correlated with each other (Figure IE). Also MMP8 and TNFRSFIA mRNA expression in whole blood-derived RNA of sepsis patients was increased on day 1 after ICU admission compared to healthy control patients (data not shown) but no correlation was found between expression levels and disease severity, except for TNFRSFIA and CRP (data not shown). By measuring IL6 plasma levels in the sepsis patients, it was shown that the levels on day 1 were elevated but not significantly due to high interpatient variability. They were the highest at day 2 in ICU and then they gradually decrease although they remain significantly higher than in healthy controls. We also determined plasma Ιίΐβ levels but these did not exceed the detection limit (data not shown). The levels of sTNFRl, MMP8 and IL6 follow the same pattern and we correlated them with each other and with disease severity. Our data revealed that TNFR1 and MMP8 plasma levels were positively correlated with IL6 (r 0.53 and 0.59, Figures 13D and E, Table 2) and CRP levels (r 0.39 and 0.53), and also with the sequential organ failure assessment (SOFA) score (r 0.58 and 0.51), an objective score that describes the incidence and severity of organ dysfunction in critically ill patients (Vincent et al., 1996, Intensive Care Med 22:707-710) (Figures 13F and G, Table 2). As expected, IL6 plasma levels were also correlated with the SOFA score (r 0.47, p=0.0013) (Table 2). More importantly, MMP8 and sTNFRl levels were also correlated with each other (r 0.66, Figure 13H). Also TNFRSFIA mRNA expression in whole blood-derived RNA of sepsis patients was significantly increased and MMP8 mRNA expression tended to be increased from the first day after ICU admission compared to healthy control patients (Figure 131) but no correlation was found between mRNA levels and disease severity, except for TNFRSFIA and CRP (Table 2). Table 2 Pearson correlation coefficients for inflammatory markers and disease score in sepsis patients
Figure imgf000054_0001
Upper values: correlation coefficients r; lower values: corresponding p-value;
Correlations with correlation value > 0.4 and p-values < 0.005 in bold
Collectively, these data indicate that increments in both TNFRl and MMP8 are features of sepsis, meaning that those two molecules together may form interesting markers of sepsis severity and/or drug targets to treat sepsis.
Example 2: Increased Tnfrsfla and Mmp8 expression during endotoxemia compensate for the loss of MMP8 and TNFRl in deficient mice.
Since we found that in human sepsis patients MMP8 and sTNFRl plasma levels are positively correlated with sepsis severity and with each other, we studied the interaction of the TNFRl and MMP8 pathways in endotoxemia. Therefore, we investigated Tnfrsfla and Mmp8 expression levels in organs of wildtype (WT) mice and compared them with those in MMP87" and TNFRl7" mice. Eight hours after LPS-injection, we observed that MMP87" mice display a more pronounced Tnfrsfla upregulation in ileum, choroid plexus and lung compared to WT mice (Figure 2A). Inversely, TNFRl7" mice display increased Mmp8 expression in ileum and lung, but not in choroid plexus (Figure 2B). These data are also depicted in Figures 14 A-B.
Next, we studied whether Tnfrsfla and Mmp8 expression is also increased in septic mice, using the cecal ligation and puncture (CLP) model (Figures. 14C-D). Six hours after CLP, Mmp8 expression was significantly increased in liver, lung, CP and brain compared to sham-treated mice (Figure 14C). Also Tnfrsfla expression was increased in multiple organs e.g. liver, lung and CP, but not in brain (Figure 14D). These results clearly show the involvement of the two mediators in the pathology of sepsis. Together, these data suggest that loss of MMP8 or TNFRl leads to increased expression of Tnfrsfla or Mmp8, respectively, and that this might reflect a compensation mechanism that arises by abrogation or inhibition of only one single pathway. Consequently, deficiency or inhibition of both MMP8 and TNFRl might provide stronger protection against endotoxemia-induced lethality compared to single deficiency. Example 3: Combined genetic deficiency of MMP8 and TNFRl leads to superior protection against endotoxemia.
To investigate whether abrogation of both MMP8 and TNFRl could increase protection in endotoxemia, we generated double knockout (DKO) mice by crossing MMP87" and TNFRl7" mice and analyzed their susceptibility to endotoxemia. Initially, all mice were injected with a dose of LPS which is LDioo for WT mice, and both MMP87" and TNFRl7" mice showed partial but significant protection (survival rate of 57% and 83%, respectively). DKO mice, however, were completely protected (Figure 3A-B). To further investigate the magnitude of protection, all mice were injected with 6 x LDioo of WT mice. As shown in Figure 3C-D, DKO mice were highly resistant (survival rate of 81,5%) to hypothermia and death induced by this LPS dose, which is in sharp contrast to the WT and single deficient mice, all of which died 24 to 30 h after challenge. Eight hours after LPS, extremely high systemic levels of pro-inflammatory cytokines, such as IL6 and IL17A, were found in serum of WT mice (Figure 16 A-B). IL6 levels in single KO mice were not significantly lower compared to WT mice but they were completely reduced in the DKO mice. Levels of IL17a were already lower in the single KO mice, and the same trend was seen in the DKO mice. Similarly, secretion of chemokines like MCP1, KC, RANTES and MlPlb (Figure 16 C-F) was reduced in DKO mice compared to WT mice while this was not always the case in the single deficient mice. Altogether, this shows that deficiency in both TNFRl and MMP8 leads to superior protective patterns by completely blunting the systemic inflammation compared to single KO mice. To further explore this remarkable and robust protective phenotype, all four strains were injected with the LDioo LPS dose in further experiments, followed by detailed analysis of different organs.
Example 4: Both MMP8 and TNFR1 are involved in the increased permeability of intestinal and blood- cerebrospinal fluid barriers during endotoxemia.
To understand the mechanisms behind the extreme resistance of DKO mice to lethal endotoxemia, we studied intestinal and blood-CSF barrier permeability during endotoxemia. We found that LPS induced intestinal permeability in WT mice but less so in MMP87" and DKO mice. We found no protection in TNFRl7- mice at this level (Figure 4A). At the level of the blood-CSF barrier, an additive protective effect was observed in the DKO mice (Figure 4D).
Example 5: MMP8/TNFR1 double deficiency blunts local and systemic inflammation during endotoxemia.
Based on our finding that Tnfrsfla expression was increased in the intestine and choroid plexus of MMP8" _ mice and Mmp8 expression was increased in the intestine of TNFRl7- mice (Figure 2A-B), we decided to investigate the degree of local inflammation in both ileum and choroid plexus. We found that in both organs, simultaneous removal of MMP8 and TNFR1 had an additive protective effect on inflammatory gene induction. Induction of 116 expression in both organs, Mmpl3 expression in the ileum and Nos2 expression in the choroid plexus were significantly reduced in the single KOs, but induction was completely prevented in DKO mice (Figure 4B-C and E-F). Similar findings were found in lung, liver, spleen and cortex/hypothalamus (data not shown). Moreover, eight hours after LPS injection, extremely high systemic levels of pro-inflammatory cytokines, such as IL6 and IL17A, were found in serum of WT mice, and these levels were much reduced in DKO mice (Figure 4G-H). Similarly, secretion of chemokines MCPl (Figure 41), KC, RANTES, MlPla and MlPlb (data not shown) was reduced in DKO mice while this was not always the case in single KO mice. Altogether, this shows that deficiency in both TNFR1 and MMP8 leads to superior protective patterns in gene expression and cytokine release compared to single KO mice.
Example 6: Combined deficiency of MMP8 and TNFR1 leads to superior protection against CLP and is accompanied by reduced systemic inflammation and liver damage.
Since combined inhibition of MMP8 and TNFR1 confers strong protection against endotoxemia, we verified the results using the CLP model, which is a model of septic peritonitis and is more representative of human polymicrobial sepsis (Dejager L et al., Trends in microbiology 2011;19:198-208). We previously reported that MMP87" mice have a significantly better outcome than WT mice after CLP (Vandenbroucke RE et al., The Journal of neuroscience : the official journal of the Society for Neuroscience 2012;32:9805- 9816). However, the outcome of TNFRl7- mice in the CLP model is more an issue of controversy, thus it is likely that the TNF/TNFR1 axis plays a mediatory role in the model without being a good drug target to increase survival (Ebach DR et al., Shock 2005;23:311-318). As shown in Figure 5 A-C, DKO mice subjected to CLP were significantly protected against hypothermia and lethality compared to WT and single KO mice (survival rate of 24% in WT, 20% in TNFR1-/-, 40% in MMP8-/- and 76% in DKO mice) and also reduced serum IL6 levels were observed in those mice. Strikingly, though TNFRl7- mice displayed reduced hypothermia for a period of 72 h after initiation of CLP compared to WT mice, they eventually died at a similar rate as WT mice. These data demonstrate that the combination of TNFR1 and MMP8 deficiency is needed to obtain protection against CLP-induced death. The protection in the DKO mice is accompanied by lower systemic IL6 levels and also in the peritoneal lavage fluid chemokine levels like KC were significantly lower in DKO mice than in WT or single KO mice (Figure 5 C-D).
Example 7: Double deficiency abrogates neutrophil efflux and protects against neutrophil depletion in CLP
Because of the promising phenotype of the DKO mice in the CLP model, we continued to document the resistance of DKO mice in more detail. First, we examined the effects of dual deficiency on the innate immune response during the initial hyperinflammatory state. We observed that early after CLP, blood neutrophil levels significantly decreased in WT and TNFRl7- mice but not in MMP87- and DKO mice (Figure 6A-B). In WT mice, neutrophils accumulated in the peritoneal fluid lavage (PFL). Conversely, in TNFRl7- mice the reduced number of blood neutrophils could not be explained by an efflux to the peritoneum (Figure 6C-D). In MMP87- and DKO mice, there was only a minor WBC influx and no significant neutrophil influx in the peritoneum after CLP.
To address the biological effect of the presence or absence of this blood-to-peritoneum neutrophil flux, we investigated the bactericidal effect of the neutrophils in blood and PFL 6 and 24 h after CLP. On the one hand, we found that neutrophil efflux in WT mice was associated with increased bacterial content in blood, despite more efficient bacterial clearance in the peritoneum. On the other hand, clearance of bacteria in the peritoneum was diminished in MMP87- and TNFRl7- mice and intermediate in DKO mice, though neutrophil numbers were similar (Figure 6D-F). Strikingly, blood of MMP87- mice contained more bacteria than that of DKO mice, and this was not correlated with the number of neutrophils, as in both genotypes there was no neutrophil efflux from blood to the peritoneum (Figure 6B,D,E). This may point towards a failed bacterial clearance in the blood of MMP87- mice. We next investigated neutrophil- attracting chemokines in PFL to understand the reduced neutrophil influx to the peritoneum in the DKOs and respective single KOs. Surprisingly, TNFRl7- and MMP87- mice did not have lower levels of neutrophil chemokines KC and MIP2 in PFL than WT mice (Figure 6G-H), pointing to an inefficient chemokine response in those mice as the reduced number of neutrophils in DKO mice could be explained by a reduction in PFL chemokines. Collectively, these data suggest that the protection seen in DKO mice can be attributed to a better control of intraperitoneal bacteria, as it is known that failure of this control ultimately leads to shock and death because of an overwhelming innate immune response (Lee MO et al., Journal of leukocyte biology 2011;89:423-432). Additionally, as the neutrophil load in blood and peritoneum remained balanced in DKO mice, enough bacterial clearance in both blood and peritoneum is maintained, eventually protecting against severe bacterial sepsis (Secher T et al., J Immunol 2009;182:7855-7864).
Example 8: Blocking TNFR1 and MMP8 simultaneously with antibodies provides stronger protection than single treatments and reproduces the DKO phenotvpe after endotoxemia.
To determine whether combining TNF 1 and MMP8 inhibition is useful as a new therapeutic strategy, we used a commercially available anti-mouse TNFR1 monoclonal antibody (Ab) and a specific in-housed generated anti-MMP8 Nanobody (Nb) (Demeestere D et al., Molecular therapy : the journal of the American Society of Gene Therapy 2016) in several therapeutic setups. First, TNFR17" mice were injected with the anti-MMP8 Nb and LPS (LD75 in TNFR17" mice). This treatment completely protected against hypothermia and death (Figure 7 A-B). Next, we injected MMP87" mice with anti-TNFRl Ab and a lethal dose of LPS. Again, though Ab-treated mice experienced severe hypothermia, the survival rates were significantly higher (20%) compared to vehicle-treated mice (0%) (Figure 7 C-D). As final proof-of- concept, we tested whether the combination of both therapies could improve survival during endotoxemia in WT mice compared to the single treatments and injection of control vehicle.
Ultimately, we co-injected WT mice with the combined treatment of anti-TNFRl Ab and anti-MMP8 Nb which markedly diminished mortality and protected against hypothermia (100% survival) compared to single anti-MMP8 therapy (36% survival) or no treatment (44% survival) (Figure 7 E-F). Combined therapy also seemed to perform better than single anti-TNFRl therapy (71% survival).
Materials and Methods
Mice: C57BL/6J wildtype (WT), C57BL/6J TNFR1 (TNFR1-/-) and C57BL/6J MMP8 deficient (MMP8-/-) and C57BL/6J TNFR1-/-MMP8-/- mice (DKO) mice were used. TNFR1-/- and MMP8-/- mice are described by M. Rothe ( Rothe J et al., Nature 1993;364:798-802) and Balbin (Balbin M et al., Nature genetics 2003;35:252-257), respectively. DKO mice were generated by intercrossing TNFR1-/- and MMP8-/- mice. All mice were housed in SPF conditions with 12-12 h light and dark cycles and free access to food and water. We used age- (8-12 weeks) and gender-matched mice. All experiments were approved by the animal ethics committee of Ghent University.
Patients: The clinical study protocol was approved by the ethics committee of the University Hospital of Ghent. Patient selection and sample collection was conducted as described in online supplement. Endotoxemia model: Mice were injected intraperitoneal^ (i.p.) with lipopolysaccharide (LPS) from Salmonella enterica serotype abortus equi (Sigma). The doses corresponded to LD100 (10 mg/kg) or 6 x LD100 for WT mice (60 mg/kg) or the lethal dose for TNFR17" and MMP87" mice (20 mg/kg). Control mice were injected with PBS. Rectal body temperature was followed after challenge. Body temperature of dead mice is set to 24°C as long as the remaining living mice form the same group are monitored. Organs and blood were isolated 8 h after injection of 10 mg/kg LPS for further analysis.
CLP procedure: Mice were subjected to CLP for induction of polymicrobial, peritoneal sepsis according to Wichterman & Chaudry 1980 (J Surgic Res 29:189-201). Sepsis was induced in isoflurane-anesthetized mice by 75% ligation of the cecum, followed by a single through-and-through puncture with a 21-Gauge needle, extruding a small amount of cecal contents as described previously (Vandenbroucke RE et al. 2012, J Neurosci 32:9805-9816). During lethality studies, mice were injected i.p. with broad-spectrum antibiotics (25 mg/kg ceftriaxone and 12.5 mg/kg metronidazole, Sigma) 9 h and 24 h after the CLP procedure. Sham-operated mice underwent the same procedure but without ligation and puncture. The cecum of mice subjected to sublethal CLP was 50% ligated and punctured only once. Rectal body temperature was followed after challenge during several days. Body temperature of dead mice is set to 24°C as long as the remaining living mice from the same group are monitored. After 6 h or 24 h, blood and organs were collected and peritoneal lavage was performed with 4 ml of ice-cold PBS.
Therapeutic inhibition of MMP8 and TNFR1 in endotoxemia: MMP8-/- and TNFR1-/- mice were injected i.p. with 10 mg/kg Armenian hamster anti-TNFRl antibody (R&D) or 25 mg/kg trivalent anti-MMP8 Nanobody (Demeestere D et al., Molecular therapy : the journal of the American Society of Gene Therapy 2016), respectively, and an LD100 injection of LPS. Control mice were treated with control Nb (Steeland S, The Journal of biological chemistry 2014) or PBS. Similarly, LPS-injected WT mice were treated with 10 mg/kg anti-TNFRl antibody, 25 mg/kg anti-MMP8 Nanobody, a combination of both, or with vehicle. Statistics: Statistics were performed using GraphPad Prism (GraphPad Software, Inc.). Survival curves were compared with a Mantel-Cox test. Bars represent mean ± SEM. Data were analyzed with a Mann- Whitney test unless mentioned differently. Pearson correlations were calculated between the variants. Variants showing a non-normal distribution (visual inspection) were log-transformed. Correlations were tested against zero using a two-sided t-test. Significance levels are indicated * for 0.01 < p < 0.05; ** for 0.001 < p < 0.01; *** for 0.001 < p 0.0001, and **** for p < 0.0001. Real-time qPCR: Tissue sample, except choroid plexus, were isolated and stored in RNALater (Ambion). Choroid plexus was snap-frozen. RNA was isolated using the InviTrap Spin Universal RNA Mini kit (Isogen Life Science) for liver and the RNeasy Mini Kit (Qiagen) for all other organs. RNA concentration was measured using the Nanodrop 1000 (Thermo Scientific) and cDNA was synthesized by the iScript cDNA Synthesis Kit (Bio-Rad). qPCR was performed with the Light Cycler 480 system (Roche) using Sensifast Bioline Mix (Bio-Line). Expression levels were normalized to the expression of the two most stable housekeeping genes, which were determined for each organ using geNorm (Vandesompele et al. 2002, Genome Biol 3:research0034): liver, hypoxanthine-guanine phosphoribosyltransferase (Hprt) and ribosomal protein (Rpl); ileum, ribosomal protein (Rpl) and Gapdh; lung: Rpl and Hprt; brain: Hprt and Ubc; and choroid plexus (CP): Gapdh and Rpl. For qPCRs on whole blood-derived mRNA of sepsis patients, housekeeping genes were 60S acidic ribosomal protein P0 (RPLP0) and 60S ribosomal protein L13a (RPL13A).
Primer sequences
Mmp8: forward 5'-ATTCCCAAGGAGTGTCCAAGC-3' (SEQ ID NO:8); reverse 5'- TG ATTGTC ATATCTCC AG C ACTG G -3' (SEQ ID NO:9);
Tnfrsfla: forward 5'-CCGGGAGAAGAGGGATAGCTT-3' (SEQ ID NO:10); reverse 5'- TCGGACAGTCACTCACCAAGT-3' (SEQ ID NO:ll);
MMP8: forward 5'-TTTTGATGCCGAAGAAACATGGA-3' (SEQ ID NO:12), reverse 5'- GTGAGCGAGCCCCAAAGAA-3' (SEQ ID NO:13);
TNFRSF1A: forward 5'-CCTCAGGGGTTATTGGACTGG-3' (SEQ ID NO:14), reverse 5'- G G G G AC AC AC ACT ATCTCTCT-3' (SEQ ID NO:15);
Gapdh: forward 5'-TGAAGCAGGCATCTGAGGG-3' (SEQ ID NO: 16), reverse 5'- CGAAGGTGGAAGAGTGGGAG-3' (SEQ ID NO:17);
Ubc: forward 5'-AGGTCAAACAGGAAGACAGAC GTA-3' (SEQ ID NO:18), reverse 5'- TCACACCCAAGAACAAGCACA-3' (SEQ ID NO:19);
Hprt: forward 5'-AGTGTTGGATACAGG CCAGAC-3' (SEQ ID NO:20), reverse 5'- CGTGATTCAAATCCCTGAAGT-3' (SEQ ID NO:21);
Rpl: forward 5' -CCTG CTG CTCTC AAG GTT-3' (SEQ ID NO:22), reverse 5' -TG GTTGTC ACTG CCTCGTACTT-3' (SEQ ID NO:23);
RPLP0: forward 5'-CATGCTCAACATCTCCCCCTTCTCC-3' (SEQ ID NO:24), reverse 5'- GGGAAGGTGTAATCCGTCTCCACAG-3' (SEQ ID NO:25);
RPL13A: forward 5'-CCTGGAGGAGAAGAGGAAAGAGA-3' (SEQ ID NO:26), reverse 5'- TTGAGGACCTCTGTGTATTTGTCAA-3' (SEQ ID NO:27). Plasma cytokine, chemokine and MMP8 determination: Levels of cytokines and chemokines were measured in plasma and peritoneal lavage fluid using a multiplex method (Bio-Plex Pro-assay Bio-Rad). MMP8 levels in human heparin plasma were detected with the Luminex Fluorokine Map Multiplex Human MMP Assay (R&D Systems). All techniques were performed according to the manufacturer's guidelines.
ELISA: Soluble human TNFR1 and IL6 levels were determined in human heparin plasma with the human TNFRSFIA ELISA Pair set (Sino Biological Inc.), the human IL6 ready-set-go kit (eBioscience) according to the manufacturer's guidelines. The following examples focus on the design and use of a trispecific construct capable of inhibition of both TNFR1 and MMP8.
Example 9: Binding affinity of Nb 70-alb-14.
We characterized the binding affinity of Nb 70-alb-14 to human TNFR1, mouse MMP8 and albumin with ELISA and surface plasmon resonance (SPR). First, via ELISA we determined the affinity of Nb 70-alb-14 to human TNFR1 (hTNFRl) and to the catalytic domain of MMP8 (mMMP8_CD) (Figure 9 a and c, respectively), but as the full length of MMP8 is present in vivo, we also verified the affinity to the full length domain of MMP8 (mMMP8_FL) (Figure 9 d). We compared the affinities with the affinity of the respective monovalent Nbs: Nb 70, Nb 14 and Nb Alb. As shown in Figure 9 a and c, the binding affinities of Nb 70-alb-14 to hTNFRl and mMMP8_CD are completely preserved compared to the affinity of Nb 70 (Kd 122.8 and 94.49 nM respectively). The affinity of Nb70-alb-14 to MMP8_FL was even ameliorated compared to Nbl4 (Figure 9d). The affinity of Nb70-alb-14 for mouse albumin was lower than that of Nb Ctrl (a trivalent Nb consisting of two irrelevant Nbs coupled to Nb Alb, or monovalent Nb Alb, respectively) (Figure 9b). The generation of a trispecific Nb also did not really alter the binding affinity to MMP8: binding to the catalytic domain of MMP8 (Kd Nb 70-alb-14 1.482 nM and Nb 14 0.66 nM) was completely preserved and the affinity of Nb 70-alb-14 to full-length MMP8 even increased compared to Nb 14 (Kd 0.9458 and 6.925 nM, respectively) (Table 3). The affinity of Nb 70-alb-14 for mouse albumin was lower than that of Nb Alb-Ctrl-Ctrl and of Nb Alb (25.89 nM, 3.55 nM and 0.8249 nM, respectively). Surface plasmon analysis (SPR) analysis confirmed the trends we observed with the ELISA with only some slight differences (Table 3 and Figure 10). Nb 70-alb-14 has fast kinetics of association to immobilized hTNFRl (Kai 7.523E4 1/Ms) with an overall equilibrium affinity of 75.4 nM (Figure 10a) but to MMP8_CD and MMP8_FL the association kinetics are a little bit slower (Kai 5.074E4 1/Ms and Kai 3.140E4 1/Ms, respectively) (Figure lOb-c). Nevertheless, their overall equilibrium affinities (KD) are in the nanomolar range, 293.5 nM to MMP8_CD and 164.7 nM to MMP8_FL. Strikingly, the association kinetics to MMP8_CD are better than to MMP8_FL, but the KDto MMP8_FL is better which is good as in vivo mainly MMP8_FL is present. Table 3
Equilibrium constant (KD) of Nb 70-alb-14, Nb 14 and Nb 70 determined by surface plasmon resonance (SPR)1 and Kd by ELISA to immobilized mouse catalytic domain MMP8 (mMMP8_CD), mouse full length domain (mMMP8_FL), human TNFR1 (hTNFRl) and albumin. NA means not applicable
Figure imgf000062_0001
Example 10: Inhibition capacity Nb 70-A-14 ofMMP8 and TNFR1.
First, we used HEK-2 blue cells to determine the ability of Nb 70-alb-14 to inhibit the TNF/hTNFRl signaling cascade. In this assay, TNF/hTNFRl signaling activates NF-κΒ (Wajant H and Scheurich P, The FEBS journal 2011;278:862-876) resulting in the transcription and secretion of the reporter protein alkaline phosphatase, which can be detected by purple/blue coloration of the HEK-2 blue detection medium. We used this system in the presence of increasing concentrations of Nb 70-alb-14 and its monovalent respective Nbs: Nb 70 and Nbl4. Figure 11a shows that the inhibition capacity of the monovalent Nb 70 is higher than that of Nb 70-alb-14 (IC50 868.3 nM vs 1670 vs). This indicates that Nb 70 needs to be in a certain conformation to inhibit the TNF/TNFR1 signaling pathway and that this conformation is altered by the creation of our trivalent construct resulting in an almost 2-fold reduction in inhibitory activity.
Next, the inhibitory capacity of the MMP8-inhibiting unit of Nb 70-alb-14 was determined by the DQ gelatin test (Figure lib). DQgelatin is a substrate for MMP8 that contains a quenched fluorophore which is released when gelatin is cleaved. First Nb 70-alb-14 was incubated with mMMP8_CD for 30 min after which DQ gelatin was added. The reduced change in fluorescence over time is a measure for the inhibitory capacity of Nb 70-alb-14 for mMMP8_CD. Figure lib, left shows that increased amounts of Nb 70-alb-14 reduce the fluorescence over time. The higher the Nb/MMP8 ratio (w/w), the more MMP8 activity is reduced. Nb 70-alb-14 has an IC5o of 4.91 μΜ which is 5.5 times better than the IC5o of Nb 14 (26.97739 μΜ). This indicates that in the case of MMP8 inhibition the generation of a trivalent construct ameliorates its inhibition capacities. Example 11: Analysis of the serum half-life of Nb 70-alb-14. Serum half-life of Nb 70-alb-14 was determined after a single intraperitoneal (i.p.) injection of 1000 μg Nb 70-alb-14 in wild type C57BL/6J mice. Blood was taken at various time points for seven consecutive days and serum concentrations of Nb70-alb-14 were determined using hTNFRl ELISA. After i.p. injection, Nb70-alb-14 is absorbed through the peritoneum into the bloodstream (absorption phase) and Nb 70-alb-14 serum levels reach a maximal concentration (Cmax) after 8 h of 48.2 ng/μΙ and has an area under the curve (AUC) of 2115+/-323 (Figure 12a). Once Cmax is reached, Nb 70-alb-14 shows biphasic elimination, starting with a distribution and elimination phase that quickly decreases serum Nb 70-alb-14 concentration, followed by slower elimination from the circulation. In the end, Nb70-alb-Nbl4 as a Tl/2 of 43.5h. Multiple injections of 100 μg Nb 70-alb-14 (first injection followed by 2 consecutive injections after 10 h and 24 h) results in a peak concentration 300 ng/μΙ after 28 h (Figure 12b). After reaching Cmax the serum levels decrease more steadily than the serum levels decrease after the Cmax when only a single injection is given. Twenty hours after the Cmax has been reached, the concentrations were halved.
Example 12: In vivo inhibition in CLP.
We subjected mice to a clinically relevant model of human peritonitis, namely cecal ligation and puncture (CLP). Mice were treated with 500 μg Nb 70-alb-14 immediately after the surgery, and after 24 h and 48 h. In this model, mice are slightly protected and have a delay of mortality and the final mortality rates were lower after treatment. However, further research is needed to see whether survival could be enhanced with a higher dose and a more frequent dosing of Nb 70-alb-14 (Figure 12 C).
As a final proof-of-concept, we subjected hTNFRl transgenic mice (Steeland et al., unpublished results) to severe CLP with high mortality or to sublethal CLP with lower mortality to reproduce the sepsis lethality rates in human (data not shown). First, the sensitivity of hTNFRl Tg mice in cecal ligation and puncture (CLP) was analyzed: because the TNFRl-binding unit Nb 70 only binds and inhibits human TNFRl, we relied on human TNFRl transgenic (hTNFRl Tg) mice as we described previously (Steeland et al., unpublished results). To ensure that the hTNFRl Tg mice behave similarly as WT mice in the CLP model, we subjected them to CLP and confirmed a similar sensitivity as in WT mice (Figure 12 D). Mice were treated with Nb 70-alb-14 according to the following treatment scheme based on their serum half-life (Tl/2). hTNF l Tg mice were treated with 1 mg Nb 70-alb-14 or PBS directly after the CLP surgery and after 9 h, 24 h and 48 h. Mice treated with Nb 70-alb-14 experienced reduced hypothermia compared to mice treated with PBS (Figure 15 A). Eventually, mortality rates were reduced when mice subjected to severe CLP were treated with Nb 70-alb-14 compared to PBS treated mice (survival rate of 28% vs. 19%, Figure 15 B), but also when they were subjected to less severe CLP (survival rate of 75% vs. 50%, data not shown). This shows that simultaneous inhibition MMP8 and TNFR1 is useful and can protect against sepsis. Material and methods
Generation of Nb 70-alb-14 expressed in Pichia pastoris. We generated Nb 70-alb-14 consisting of Nb 70 (a Nb that binds human tumor necrosis factor receptor 1 (hTNFRl) and inhibits the TNF/hTNFRl signaling) (Steeland S et al., J Biol Chem 2014). Nb 14 (a Nb that inhibits human and mouse matrix metalloproteinase 8 activity) (Demeestere D et al, Molecular therapy : the journal of the American Society of Gene Therapy 2016) and an anti-albumin Nb, linked to each other with flexible [G4S]3 linkers. The C- terminal end of Nb 70 is linked to the N-terminal end of the anti-Alb Nb and its C-terminal end to the N- terminal end of Nb 14, followed by a his6-tag (Figure 8a-b).
The different VHH building blocks of Nb 70-alb-14 were designed in the pUC57, with the Nb 14 VHH gene at the N-terminal end and the His6-tag at the C-terminal end and the construct was ordered by GenScript. The yeast Pichia pastoris (Strain GS115) expression system was used to express Nb 70-alb-14 and to allow expression in P. pastoris, the sequence was cloned into the pAOXZalfa vector and transformed in wild type GS115 P. pastoris. After selection of an appropriate expression clone, Nb 70-alb-14 was produced in 6 L of culture medium in baffled shake flasks (Schoonooghe S et al., Methods Mol Biol 2012;907:325- 340). The medium was isolated by centrifugation at 18,000 x g for 30 min at 4°C and diafiltered against 20 mM NaH2P04 pH 7.5, 500 mM NaCI, 20 mM imidazole and 1 mM PMSF. After loading, the column was washed with 20 column volumes of the same buffer in the presence of 0.1% empigen as detergent. Before elution, the column was equilibrated with 5 column volumes of equilibration buffer without detergent. The Nbs were first eluted with 20 mM NaH2P04 pH 7.5, 20 mM NaCI, 50 mM imidazole and 1 mM PMSF, and then with 400 mM imidazole in the same buffer. The eluate was diluted 20 times with 25 mM sodium acetate pH 5.5 and loaded on a Source 15S column (GE Healthcare) to remove LPS and other contaminants. After equilibration, the Nbs were eluted by a linear gradient over 20 column volumes of NaCI from 0 to 1000 mM in 25 mM sodium acetate pH 5.5. Finally, the recombinant protein was injected on a Superdex 75 gel filtration column with PBS as running solution. The obtained fractions were analyzed with Coomassie stained SDS-PAGE gels and anti-His western blots. Protein concentration was measured by the Micro-BCA assay (Pierce). LPS levels were determined using an EndoSafe-PTS assay (Charles River) that makes use of LAL reagents in a FDA-licensed disposable test cartridge with a handheld reader for real-time endotoxin testing. The LPS concentration was < 0.5 EU/ml.
ELISA. To determine the binding affinity of the purified Nbs, we performed different ELISAs. Microtiter half-area plates (Nunc) were coated overnight at 4°C with 50 ng of the substrate of interest in Tris- buffered saline (TBS) per well. Binding affinity was determined for the following substrates: hTNFRl (PeproTech, 210-07), mMMP8_CD (2), full length mouse MMP8 (mMMP8_FL; R&D systems, 2904-MP- 010) and mouse albumin (Sigma, A3559). Residual protein binding sites were blocked for 1 h at room temperature with TBS supplemented with 0.05% Tween 20 (TBST) and 5% BSA. Next, Nbs were added to the wells at the indicated concentrations in TBST and 2.5% BSA, and incubated for 1 h. A Nb with unrelated specificity was used as negative control: a trivalent Nb consisting of two cAbBclllO Nbs, which is a control Nb targeting anti- -lactamase (Conrath KE et al., Antimicrobial agents and chemotherapy 2001;45:2807-2812), coupled to an anti-albumin Nb, called Nb "Alb-Ctrl-Ctrl". Bound Nbs were detected with a mouse anti-His antibody (1:1000) (AbD SeroTec, MCA1396) followed by anti-mouse IgGl-HRP (1:2000) (GE Healthcare, NA931). Absorption at 450 nm was measured after adding the peroxidase substrate 3,30,5,50-tetra-methyl benzidine (TMB) (BD OptEIA) followed by stopping buffer (1 M H2S04). The background signal at 595 nm was subtracted.
Surface Plasmon Resonance (SPR) analysis. Nb affinity for hTNFRl and mMMP8_CD and mMMP8_FL was determined by Surface Plasmon Resonance (SPR) analysis using BiaCore T200. Human sTNFRl (PeproTech, 210-07), mMMP8_CD (Demeestere D et al, Molecular therapy : the journal of the American Society of Gene Therapy 2016) or mMMP8_FL diluted in NaAc pH 4 (hTNFRl) or pH 5, respectively was chemically immobilized on a CM5 sensor chip using NAS/EDC until a RU of 581, 452.4 or 733.4, respectively was obtained at 25°C. Binding experiments were performed at 25°C in HBS (10 mM Hepes pH 7.5, 150 mM NaCI, 3.5 mM EDTA and 0.005% Tween 20) at a flow rate of 20 μΙ/min and a 2-fold dilution series of Nb was applied ranging from 250 nM to 1 nM. Between applying different Nb concentrations, the chip was regenerated during 300 s at a flow rate of 30 μΙ/min with 25 mM NaOH and 500 mM NaCI (hTNFRl coating) or with 20 mM NaOH (MMP8 coating), without any detectable effect on the binding capacity of hTNFRl or MMP8. A blank uncoated channel was used as an online reference during all injections. To analyze the results and determine kinetics of association (Ka) and dissociation (Kd), the sensograms were fitted by subtracting the signal of the reference flow cell using BiaCore T200 software. The curves of Nb 70-A-14 were fitted with a bivalent binding model. Curves were analyzed using BiaCore's evaluation software and interpreted visually.
Inhibition of hTNFRl signaling via HEK-2 blue assay. The HEK-2 blue assay is a colorimetric assay in which HEK-2 blue cells are engineered with multiple genes from the TLR2 pathway (Invitrogen). HEK-2 blue cells stably express optimized alkaline phosphatase under the control of an inducible promoter, and the enzyme is secreted upon induction of the transcription factors NF-κΒ. Reaction of the enzyme with the HEK-2 blue detection medium can be determined by colorimetry. HEK-2 blue cells in detection medium were seeded at 50,000 cells per well in a 96-well plate (Invitrogen). After 3 h, cells were incubated for 30 min with a serial dilution of Nb starting at 5000 μΜ at 37°C. Next, 100 lU/ml hTNF was added and incubation continued for 18 h at 37°C. Absorption of the culture medium was measured at 655 nm with a plate reader. GraphPad Prism 6.0 was used to determine IC5o values based on a non-linear regression model and a dose-response inhibition equation. Inhibitory capacity of the anti-MMP8 Nanobodies. The inhibitory capacity of the different Nbs for MMP8 was investigated using the EnzChek Gelatinase/Collagenase Assay Kit (Molecular Probes, Life technologies, E12055) according to the manufacturer's instructions. In short, DQ gelatin (1:4) was incubated with recombinant mMMP8_CD after pre-incubation of 30 min with increasing amounts of Nb. Changes in fluorescence over time by cleavage of DQ-gelatin were followed for 2 h at 37°C in a fluorescence microplate reader
Figure imgf000066_0001
= 495/515 nm) (Fluostar Omega). Activity of mMMP8_CD and inhibitory capacity of the Nbs was determined by the changes in fluorescence over time. Plotting the activity in function of the logarithmic Nb concentration gives a sigmoidal shaped curve. A nonlinear regression was used to determine the IC50 value with GraphPad Prism 6.0. Mice. In this study, wild type C57BL/6J mice and hTNFRlTg TgmTNFR _ transgenic mice were used. The generation of the transgenic mice is described in Steeland et al, in preparation. Shortly, a BAC-construct containing the TNFRSF1A gene was injected via pronucleus injection into zygotes of heterozygous Tnfrsfla mice. Via a breeding program, mice were obtained that are full Tnfrsfla knock-out and homozygous for TNFRSF1A. All mice were bred in the specific pathogen free (SPF) facility of the Inflammation Research Center (IRC, Belgium) in a controlled environment (12-hour light-dark cycle; 20°C) with food and water ad libitum.
Pharmacokinetics. To determine the in vivo pharmacokinetic properties of Nb 70-alb-14 eight-week-old female C57BL/6J mice were intraperitoneally (i.p.) injected with Nb 70-alb-14. Blood was sampled via retro-orbital blood collection at different time points (1, 8, 10, 24, 30, 48 and 72 h) after a single N b 70- al b-14 injection (1000 μg) or multiple injections (100 μg at t=0, 10 and 24h). Blood was stored overnight at 4°C and supernatant was collected from clotted blood and centrifuged at 14,000 g for 15 min at 4°C. N b serum concentrations were determined by hTN FRl ELISA as described above.
CLP procedure. Mice were subjected to CLP for induction of polymicrobial, peritoneal sepsis. Sepsis was induced in isoflurane-anesthetized mice by 75%/50% ligation of the cecum, followed by a double/single puncture with a 21-Gauge needle (lethal/sublethal model, respectively), extruding a small amount of cecal contents as described previously (Vanden broucke RE et al., J Neurosci 32:9805-9816). Mice were injected i.p. with broad-spectrum antibiotics (25 mg/kg ceftriaxone and 12.5 mg/kg metronidazole, Sigma) 9 h and 24 h after the CLP procedure. Mice were injected i.p. right after, 24 h and 48 h after the CLP surgery with 500 μg/200 μΙ Nb 70-al b-14 or with 200 μΙ D-PBS. Rectal body temperature and lethality were followed after challenge.

Claims

Claims
1. A composition comprising a Matrix Metallo-Proteinase 8 (MMP8) inactivating antigen binding polypeptide and a Tumor necrosis factor receptor 1 (TNFRl) inactivating antigen binding polypeptide.
2. A composition according to claim 1, wherein said antigen binding polypeptides comprise an antibody.
3. A composition according to claim 2, wherein said antibody is a VHH.
4. A composition according to any one of claims 1 to 3, wherein said MMP8 inactivating antigen binding polypeptide comprises a CDR1 sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDR1, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
5. A composition according to any one of claims 1 to 4, wherein said TNFRl inactivating antigen binding protein comprises a CDR1 sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDR1, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
6. A composition according to any one of claims 1 to 5, wherein said MMP8 inactivating antigen binding polypeptide and said TNFRl inactivating antigen binding polypeptide are present in one molecule.
7. A composition according to claim 6 depicted in SEQ ID NO: 7 or a variant thereof with at least 90% sequence identity.
8. An isolated polypeptide comprising a MMP8 inactivating antigen binding polypeptide and a TNFRl inactivating antigen binding polypeptide.
9. The isolated polypeptide according to claim 8 wherein said MMP8 inactivating antigen binding polypeptide comprises a CDR1 sequence depicted in SEQ ID NO: 1, a CDR2 sequence depicted in SEQ ID NO: 2 and a CDR3 sequence depicted in SEQ ID NO: 3 and wherein CDR1, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID NOs.
10. The isolated polypeptide according to claim 8 wherein said TNFRl inactivating antigen binding protein comprises a CDR1 sequence depicted in SEQ ID NO: 4, a CDR2 sequence depicted in SEQ ID NO: 5 and a CDR3 sequence depicted in SEQ ID NO: 6 and wherein CDR1, CDR2 and/or CDR3 have a 1-, 2- or 3-amino acid difference with any of said foregoing respective SEQ ID Nos.
11. The isolated polypeptide according to claim 8 comprising the amino acid sequence depicted in SEQ ID NO: 7.
12. A nucleic acid encoding at least one antigen binding polypeptide according to any one of claims 1 to 11.
13. A vector comprising a nucleic acid according to claim 12.
14. A host cell comprising a nucleic acid according to claim 12 or a vector according to claim 13.
15. A composition according to any one of claims 1 to 7, an isolated polypeptide according to any of claims 8 to 11, a nucleic acid according to claim 12 or a vector according to claim 13 for use as a medicament.
16. A composition according to any one of claims 1 to 7, an isolated polypeptide according to any of claims 8 to 11, a nucleic acid according to claim 12 or a vector according to claim 13 for use to treat an inflammatory disease.
17. A composition according to any one of claims 1 to 7, an isolated polypeptide according to any of claims 8 to 11, a nucleic acid according to claim 12 or a vector according to claim 13 for use to treat an inflammatory disease, wherein said inflammatory disease is selected from the list of diseases consisting of systemic inflammatory response syndrome, sepsis, LPS induced inflammation, renal ischemia/reperfusion injury, ventilation induced lung injury, periodontal inflammation, rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis, ankylosing spondylitis, Lyme arthritis and osteoarthritis.
18. A pharmaceutical composition comprising a composition according to any one of claims 1 to 7, an isolated polypeptide according to any of claims 8 to 11, a nucleic acid according to claim 8 or a vector according to claim 9 and a pharmaceutically acceptable carrier.
19. A kit comprising a composition according to any one of claims 1 to 7, an isolated polypeptide according to any of claims 8 to 11, a nucleic acid according to claim 8 or a vector according to claim 9.
PCT/EP2017/076427 2016-10-18 2017-10-17 Means and methods to treat inflammation Ceased WO2018073216A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1617622.4 2016-10-18
GBGB1617622.4A GB201617622D0 (en) 2016-10-18 2016-10-18 Means and methods to treat inflammation

Publications (1)

Publication Number Publication Date
WO2018073216A1 true WO2018073216A1 (en) 2018-04-26

Family

ID=57680868

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2017/076427 Ceased WO2018073216A1 (en) 2016-10-18 2017-10-17 Means and methods to treat inflammation

Country Status (2)

Country Link
GB (1) GB201617622D0 (en)
WO (1) WO2018073216A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018220235A1 (en) * 2017-06-02 2018-12-06 Merck Patent Gmbh Mmp13 binding immunoglobulins
US11813307B2 (en) 2017-06-02 2023-11-14 Merck Patent Gmbh Polypeptides binding ADAMTS5, MMP13 and aggrecan

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020155113A1 (en) * 2001-03-13 2002-10-24 Miyoung Chun Methods for treating or preventing cardiovascular disorders by modulating metalloprotease function
US20060002935A1 (en) * 2002-06-28 2006-01-05 Domantis Limited Tumor Necrosis Factor Receptor 1 antagonists and methods of use therefor
EP1972637A1 (en) * 2007-03-19 2008-09-24 Universität Stuttgart huTNFR1 selective antagonists
WO2008149148A2 (en) * 2007-06-06 2008-12-11 Domantis Limited Polypeptides, antibody variable domains and antagonists
WO2012059513A1 (en) * 2010-11-04 2012-05-10 Vib Vzw Mmp8 inactivating antigen binding proteins
WO2012122464A1 (en) * 2011-03-10 2012-09-13 New York University Methods and compositions for modulating tnf/tnfr signaling
US20130022605A1 (en) * 2002-06-28 2013-01-24 Brewis Neil D Antagonists against tnfr1 and methods of use therefor

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020155113A1 (en) * 2001-03-13 2002-10-24 Miyoung Chun Methods for treating or preventing cardiovascular disorders by modulating metalloprotease function
US20060002935A1 (en) * 2002-06-28 2006-01-05 Domantis Limited Tumor Necrosis Factor Receptor 1 antagonists and methods of use therefor
US20130022605A1 (en) * 2002-06-28 2013-01-24 Brewis Neil D Antagonists against tnfr1 and methods of use therefor
EP1972637A1 (en) * 2007-03-19 2008-09-24 Universität Stuttgart huTNFR1 selective antagonists
WO2008149148A2 (en) * 2007-06-06 2008-12-11 Domantis Limited Polypeptides, antibody variable domains and antagonists
WO2012059513A1 (en) * 2010-11-04 2012-05-10 Vib Vzw Mmp8 inactivating antigen binding proteins
WO2012122464A1 (en) * 2011-03-10 2012-09-13 New York University Methods and compositions for modulating tnf/tnfr signaling

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
SOPHIE STEELAND ET AL: "Generation and Characterization of Small Single Domain Antibodies Inhibiting Human Tumor Necrosis Factor Receptor 1", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 290, no. 7, 23 December 2014 (2014-12-23), pages 4022 - 4037, XP055436881, ISSN: 0021-9258, DOI: 10.1074/jbc.M114.617787 *
T. SECHER ET AL: "Crucial Role of TNF Receptors 1 and 2 in the Control of Polymicrobial Sepsis", THE JOURNAL OF IMMUNOLOGY, vol. 182, no. 12, 3 June 2009 (2009-06-03), US, pages 7855 - 7864, XP055436517, ISSN: 0022-1767, DOI: 10.4049/jimmunol.0804008 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018220235A1 (en) * 2017-06-02 2018-12-06 Merck Patent Gmbh Mmp13 binding immunoglobulins
CN110997001A (en) * 2017-06-02 2020-04-10 默克专利股份有限公司 MMP13 binding to immunoglobulins
JP2020521804A (en) * 2017-06-02 2020-07-27 メルク パテント ゲゼルシャフト ミット ベシュレンクテル ハフツングMerck Patent Gesellschaft mit beschraenkter Haftung MMP13 binding immunoglobulin
US11813307B2 (en) 2017-06-02 2023-11-14 Merck Patent Gmbh Polypeptides binding ADAMTS5, MMP13 and aggrecan
US12129308B2 (en) 2017-06-02 2024-10-29 Merck Patent Gmbh MMP13 binding immunoglobulins

Also Published As

Publication number Publication date
GB201617622D0 (en) 2016-11-30

Similar Documents

Publication Publication Date Title
US10093727B2 (en) Pan-ELR+ CXC chemokine antibodies
JP2023120208A (en) Polypeptides and fusion proteins thereof that bind to complement component C5 or serum albumin
EP2970447B1 (en) Pan-elr+ cxc chemokine antibodies
EP3114139B1 (en) Anti eotaxin-2 antibodies that recognize additional ccr3-binding chemokines
JP2010502208A (en) Serum albumin binding protein with long half-life
KR20200038562A (en) Composition for prophylaxis or treatment of il-8 related diseases
TW201439118A (en) BMP-6 antibodies
JP2021506773A (en) Use of FXIIa inhibitors in the treatment of renal fibrosis and / or chronic kidney disease
JP2026016529A (en) Polypeptide inhibitors of neutrophil elastase activity and uses thereof
WO2018073216A1 (en) Means and methods to treat inflammation
US20220396618A1 (en) Rage antibodies, fragments and uses thereof
CN108431039B (en) Improved P2X7 receptor binding agents and polypeptides comprising the same
JP2018528975A (en) Method for treating ADAMTS13 deficiency and congenital thrombotic thrombocytopenic purpura in pediatric patients
US8092800B2 (en) Antibodies against Candida antigens
US20260008865A1 (en) Antibodies, compositions, and methods of treatment
TWI877179B (en) Anti-angpt2 antibodies
JP2023526051A (en) Use of complement factor D inhibitors alone or in combination with anti-C5 antibodies for the treatment of paroxysmal nocturnal hemoglobinuria
US12098186B1 (en) Multivalent anti-SARS-CoV-2 nanobodies
JP7565607B2 (en) PSMP antagonists for use in the treatment of pulmonary, renal, or hepatic fibrotic diseases - Patents.com
JP7812985B2 (en) Methods for detecting pathogenic antiphospholipid antibodies and identifying inhibitors
WO2025129160A1 (en) Mabs for inhibiting human rage by blocking binding to heparan sulfate
CN115244081A (en) Anti-adrenomedullin (ADM) binders for the treatment of patients with shock
KR20120027063A (en) Human monoclonal antibody scfv to urokinase plasminogen activator and medical use thereof
KR20230123477A (en) Methods for treating or preventing acute respiratory distress syndrome
HK40027205A (en) Polypeptides that bind complement component c5 or serum albumin and fusion proteins thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17793593

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 17793593

Country of ref document: EP

Kind code of ref document: A1