WO2018069409A1 - Lyophilized compositions comprising rhannexin v-128, process for their preparation and their use for preparing formulations containing 99mtc-rhannexin v-128 - Google Patents

Lyophilized compositions comprising rhannexin v-128, process for their preparation and their use for preparing formulations containing 99mtc-rhannexin v-128 Download PDF

Info

Publication number
WO2018069409A1
WO2018069409A1 PCT/EP2017/075967 EP2017075967W WO2018069409A1 WO 2018069409 A1 WO2018069409 A1 WO 2018069409A1 EP 2017075967 W EP2017075967 W EP 2017075967W WO 2018069409 A1 WO2018069409 A1 WO 2018069409A1
Authority
WO
WIPO (PCT)
Prior art keywords
rhannexin
buffer
vial
agent
lyophilized
Prior art date
Application number
PCT/EP2017/075967
Other languages
French (fr)
Inventor
Lorenza Fugazza
Maurizio Franco Mariani
Francesca ORLANDI
Daniela Chicco
Donato BARBATO
Original Assignee
Advanced Accelerator Applications International S.A.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Advanced Accelerator Applications International S.A. filed Critical Advanced Accelerator Applications International S.A.
Priority to EP17794236.4A priority Critical patent/EP3541361A1/en
Priority to CN201780063039.XA priority patent/CN110167528A/en
Priority to US16/339,530 priority patent/US20200038526A1/en
Priority to JP2019540703A priority patent/JP2019533723A/en
Publication of WO2018069409A1 publication Critical patent/WO2018069409A1/en
Priority to US17/398,195 priority patent/US20220031872A1/en

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04—Organic compounds
    • A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/087—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins the peptide being an annexin, e.g. annexin V
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/02—Inorganic compounds
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/12—Carboxylic acids; Salts or anhydrides thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
    • A61K47/36—Polysaccharides; Derivatives thereof, e.g. gums, starch, alginate, dextrin, hyaluronic acid, chitosan, inulin, agar or pectin
    • A61K47/40—Cyclodextrins; Derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/0012—Galenical forms characterised by the site of application
    • A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
    • A61K9/16—Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction
    • A61K9/1605—Excipients; Inactive ingredients
    • A61K9/1611—Inorganic compounds
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
    • A61K9/16—Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction
    • A61K9/1605—Excipients; Inactive ingredients
    • A61K9/1617—Organic compounds, e.g. phospholipids, fats
    • A61K9/1623—Sugars or sugar alcohols, e.g. lactose; Derivatives thereof; Homeopathic globules
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
    • A61K9/19—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles lyophilised, i.e. freeze-dried, solutions or dispersions
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis

Definitions

  • Lyophilized compositions comprising rhAnnexin V-128, process for their preparation and their use for preparing formulations containing 99m Tc-rhAnnexin V-128
  • the present invention refers to labelled compounds in particular to Technetium labelled recombinant protein Annexin V-128.
  • rhAnnexin - V- 128 is a known recombinant protein having sequence (SEQ ID N ° 1 ):
  • This recombinant protein is described in Jin M. et al. "Essential Role of B-helix Calcium Binding Sites in Annexin V-Membrane Binding" The Journal of Biological Chemistry - Vol. 279 - No. 39 - pp. 40351-40357 (2004) and is a mutant form of Annexin V, a naturally occurring human serum protein, in which six amino acids (Ala- Gly-Gly-Cys-Gly-His) have been added to the N-terminus of rhAnnexin V (identical to wild type human Annexin V) to form an endogenous 99m Tc-binding site.
  • cysteine in position 316 has been mutated to a serine (see the underlined S in the sequence above); with this mutation, the only cysteine remaining in the rhAnnexin V-128 sequence is the one in position 4, in the N-terminal 99m Tc-binding site.
  • rhAnnexin V-128 is produced by known recombinant techniques in Escherichia coli (See for example Jin M. et al. "Essential Role of B-helix Calcium Binding Sites in Annexin V-Membrane Binding" The Journal of Biological Chemistry - Vol. 279 - No. 39 - pp. 40351 ⁇ 10357 (2004)) and it is stored in frozen form.
  • the modification introduced in the N-terminus allows the binding of the protein with 99m Tc to form the corresponding labelled protein that, thanks to its mechanism of action, has a broad spectrum of potential applications both as a diagnostic tool, as well as for monitoring treatment efficacy and is normally used by intravenous administration.
  • cardiovascular diseases in particular aortic aneurysm
  • chemotherapy card iotoxi city and atherosclerosis can be considered.
  • transplant rejection e.g., transplant rejection
  • autoimmune diseases other than Rheumatoid Arthritis, e.g. Inflammatory Bowel Disease
  • neurodegenerative diseases e.g., rheumatoid Arthritis, e.g. Inflammatory Bowel Disease
  • transplant rejection e.g., transplant rejection
  • autoimmune diseases other than Rheumatoid Arthritis, e.g. Inflammatory Bowel Disease
  • neurodegenerative diseases e.g., neurodegenerative diseases.
  • the cysteine present in the rhAnnexin V-128 can easily lead to dimerization due to the formation of a disulfide bridge between two cysteines, thus decreasing the chemical purity of the preparation.
  • the protein is subjected to protein aggregation, a physical phenomenon in which misfolded proteins aggregate.
  • rhAnnexin V-128 undergoes several stressful process steps (freeze-thawing, bulk formulation, lyophilization), as well as long-term storage and reconstitution with radioactive 99m TcO 4 - solution, during which aggregation is likely to occur. For these reasons the chemical purity is an analytical parameter which has to be carefully monitored in this preparation.
  • the radiochemical purity is also a critical parameter for radiopharmaceuticals. It is essential both for safety reasons and also for its technical/diagnostic performance.
  • the labeling with 99m TcO 4 - occurs through a series of reactions/equilibriums involving REDOX reactions and trans-chelation, and several radiochemical impurities may form if the conditions are not optimal.
  • the recombinant protein rhAnnexin V-128 is sensitive, can flocculate during freeze-thawing, can dimerize through the free SH groups of the Cys, both during the thawing process, the manufacturing process and also during radiolabelling.
  • a specific formulation is necessary for creating suitable conditions leading to a final 99m Tc-rhAnnexin V-128 preparation with high radiochemical and chemical purity, and high stability.
  • Tait's work describes a two vials kit approach (with rhAnnexin V-128 in the form of a solution), that requires a final purification to obtain the 99m Tc-rhAnnexin V- 128.
  • This is not an optimal formulation, as the final purification is an important drawback in routinely clinical practices because it requires a rather complex manipulation of the product, with associated radio safety and sterility issues and not compatible with pharmaceutical quality standards.
  • the described method comprises mainly two steps: 1 ) preparation of a phosphate buffer solution (pH 7.4) containing the protein, glucoheptonate and EDTA as transitional ligands, Stannous salt and diluted hydrochloric acid; 2) 99mTc04 Na is added to the solution in step 1 and the so-obtained solution is mixed in water batch at 35-37 °C to give the labeled product 99mTc-Cys-Annexin V.
  • a phosphate buffer solution pH 7.4
  • 99mTc04 Na is added to the solution in step 1 and the so-obtained solution is mixed in water batch at 35-37 °C to give the labeled product 99mTc-Cys-Annexin V.
  • the Annexin V according to CN 103159842 differs from the present Annexin V -128 since it presents a single Cysteine residue on the C-terminal, which is able to bind Tc-99m, while it lacks the modified N-terminus, with the addition of six amino acids (among which there is one Cys); moreover, in Annexin V -128 the Cys that was present in position 316 has been substituted by a Serine, thus subtracting a residue that favors dimerization via disulphide bonds.
  • This labeling process should be based on direct reconstitution of a pre-formulated single vial possibly without requiring any additional filtration or purification step prior to injection.
  • Figure 1 reports a schematic view of the process for the preparation of the lyophilized rhAnnexin V-128 according to the invention
  • Figure 2 shows SPECT images of 99m Tc-rhAnnexin V-128 uptake in front paws of a healthy mouse (a) and in a mouse model of collagen induced arthritis (b).
  • Figure 3c shows the uptake in the CIA mouse after treatment with an anti-inflammatory drug (no 99m Tc-rhAnnexin V-128 uptake detectable anymore).
  • composition comprising lyophilized rhAnnexin V-128 suitable for the preparation of 99m Technetium formulation for intravenous administration.
  • the present invention allows to overcome the above said problems thanks to a lyophilized composition suitable for intravenous administration comprising Annexin V- 128 in combination with suitable excipients, including particularly an antioxidant agent, in a pH range of 5.0 - 6.6.
  • the present application refers also to a formulation obtained by adding to the above said composition a suitable volume of eluate from a commercial 99m Tc0 4 - generator.
  • the lyophilized composition as above defined includes also a specific buffer.
  • the antioxidant is included with the purpose of decreasing the Annexin V-128 dimer content both during the long-term storage of the lyophilized composition and also in the 99m Tc-rhAnnexin V-128 preparation after labeling. In the absence of the antioxidant the dimer formation was not under control, leading to a non-adequate chemical purity.
  • antioxidant agent allowed to limit the dimer formation and ensure a dimer content below 10% during the long-term storage of the lyophilized composition and also for at least 6 h after radiolabeling.
  • the antioxidant has a key role in maintain a good level of chemical purity and it is not added with the purpose of preventing the re-oxidation of reduced technetium to pertechnetate.
  • Different antioxidants such as sodium metabisulfite, nicotinamide, pyridoxine hydrochloride, a- tocopherol acetate, monothioglycerol, were evaluated.
  • citrate buffer initially the use of citrate buffer was attempted, as this is the buffer in which Annexin V-128 is currently stored. However, a radiochemical purity around 85-90% could only be achieved. With the purpose of shifting the radiochemical purity value above 90%, which is the commonly accepted lower limit for radiopharmaceutical preparations, different buffers, such as lactate, succinate, glycolic, TRIS and histidine, were evaluated. The lactate buffer was chosen, as it allowed to reach radiochemical purity values consistently around 94- 96%.
  • the antioxidant and of the specific buffer allowed also to obtain a single- vial lyophilized composition with a long-term stability of at least 18 months.
  • the lyophilized composition described in the previous art is declared to be stable for 210 days.
  • the antioxidant and the specific buffer mentioned above are included in lyophilized composition comprising also:
  • the composition can also include a radiation stability enhancer and/or a solubilizer.
  • - buffer pH comprised between 5.0 and 6.6, with a concentration above 10 mM - reducing agent: above 0,005 mg/vial;
  • the composition can also include a radiation stability enhancer in a quantity above 0,005 mg/vial and/or a solubilizer in a quantity above 1 mg/vial Several tests were performed during the development in order to define the above- described composition. Initially, the rhAnnexin V-128 lyophilized composition was prepared in presence of citrate buffer, including the following components:
  • the rhAnnexin V-128 lyophilized composition was prepared in presence of lactate buffer, instead of citrate, at different pH values (up to 6.4), in the absence of antioxidant agent.
  • lactate buffer instead of citrate
  • pH increase favors dimer formation, the dimer percentage increasing more rapidly at higher pH, after radiolabeling.
  • a third step the presence antioxidant agent and lactate buffer were tested.
  • a lyophilized composition similar to the previous one was prepared, at a pH of 5.8, including also an antioxidant (sodium metabisulfite).
  • an antioxidant sodium metabisulfite
  • the radiochemical purity was confirmed to be well above 90% and the chemical purity was remarkably improved, giving values around 97-98% (by SEC-HPLC and RP- HPLC) for at least 6 h after radiolabeling.
  • a lyophilized composition according to the present invention can be prepared according to a process comprising the following steps (see also Fig. 1 ):
  • the final 99m Tc-rhAnnexin V-128 formulation suitable for intravenous administration can be prepared by adding to the above said composition a suitable volume of eluate from a commercial 99m Tc0 4 - generator containing up to 740 MBq of radioactivity and keeping the vial under slight rotation for 90 min at room temperature.
  • composition/formulation according to the invention as well as of their process of preparation as above described are the use of an antioxidant agent and the use of a specific buffer, in the pH range 5.0 - 6.6.
  • the lyophilized composition according to the invention has a shelf life of at least 18 months at 2-8 °C, and can be radiolabeled at room temperature, giving a high chemical and radiochemical purity and good stability for at least 6 hours after labeling, with a controlled dimer percentage.
  • composition according to the invention makes the rhAnnexin V-128 available as a lyophilized single vial product that needs just to be reconstituted with a 99m Tc0 4 - solution eluted from a commercially available generator without the need for any final purification.
  • the formulation according to the invention was tested for its diagnostic performance in several animal models (liver apoptosis, collagen induced arthritis model, endocarditis/myocarditis, inflammatory bowel disease, and others).
  • Annexin V-128 was also tested for its toxicity in a complete preclinical toxicology package (designed in accordance with the relevant guidelines and with the input received from regulatory agencies), in 15 days repeated dose toxicology studies in rodent and non-rodent species. A cytokine release assay was also included in the preclinical package. The outcome of these studies showed that Annexin V-128 has a very favorable safety profile (data can be provided if needed).
  • the formulation was tested for its safety and biodistribution in a Phase I study in human volunteers and is currently being tested in Phase II studies in Rheumatology and Cardiovascular indications.
  • excipients were all dissolved in water for injection, in appropriate amounts: - D(+)-Trehalose dehydrate (powder): an appropriate amount was weighed to obtain a concentration of 50 mg/ml in the final bulk solution; - Sodium ⁇ -D-Glucoheptonate dihydrate (stock solution of 60 mg/ml): appropriate volume is added to obtain a concentration of 3 mg/ml in the final bulk solution;
  • the final bulk solution was prepared adding an appropriate volume of rhAnnexin V- 128 solution to an appropriate volume of excipient bulk solution.
  • the final bulk solution was filtered (0.22 ⁇ filter) and automatically filled into the vials (1 mL/vial) and lyophilized.
  • the above said formulation can be used as a diagnostic tool and also for selecting the best treatment as well as for monitoring medical treatment efficacy in rheumatology (for example rheumatoid arthritis, Axial Spondyloarthritis), cardiovascular diseases (as for example aortic aneurysm, chemotherapy cardiotoxicity, endocarditis and myocarditis) atherosclerosis (in particular for the detection and staging of atherosclerotic plaque), oncology, transplant rejection, autoimmune diseases, neurology, and other pathologies having as a hallmark the process of apoptosis and/or as marker of treatment response for treatment-induced apoptosis.
  • rheumatology for example rheumatoid arthritis, Axial Spondyloarthritis
  • cardiovascular diseases as for example aortic aneurysm, chemotherapy cardiotoxicity, endocarditis and myocarditis
  • atherosclerosis in particular for the detection and staging of atherosclerotic plaque

Abstract

It is described a composition comprising lyophilized rhAnnexin V-128 suitable for the preparation of 99mTc-rhAnnexin V-128 formulations suitable for intravenous administration.

Description

Lyophilized compositions comprising rhAnnexin V-128, process for their preparation and their use for preparing formulations containing 99mTc-rhAnnexin V-128
Field of the invention
The present invention refers to labelled compounds in particular to Technetium labelled recombinant protein Annexin V-128.
State of the art
rhAnnexin - V- 128 is a known recombinant protein having sequence (SEQ ID N ° 1 ):
AGGCGHAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLL
TSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMK PSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEE YGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVE QDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTI SGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGA GTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSG DYKKALLLLSGEDD
This recombinant protein is described in Jin M. et al. "Essential Role of B-helix Calcium Binding Sites in Annexin V-Membrane Binding" The Journal of Biological Chemistry - Vol. 279 - No. 39 - pp. 40351-40357 (2004) and is a mutant form of Annexin V, a naturally occurring human serum protein, in which six amino acids (Ala- Gly-Gly-Cys-Gly-His) have been added to the N-terminus of rhAnnexin V (identical to wild type human Annexin V) to form an endogenous 99mTc-binding site.
In addition, cysteine in position 316 has been mutated to a serine (see the underlined S in the sequence above); with this mutation, the only cysteine remaining in the rhAnnexin V-128 sequence is the one in position 4, in the N-terminal 99mTc-binding site.
rhAnnexin V-128 is produced by known recombinant techniques in Escherichia coli (See for example Jin M. et al. "Essential Role of B-helix Calcium Binding Sites in Annexin V-Membrane Binding" The Journal of Biological Chemistry - Vol. 279 - No. 39 - pp. 40351 ^10357 (2004)) and it is stored in frozen form.
As said above the modification introduced in the N-terminus allows the binding of the protein with 99mTc to form the corresponding labelled protein that, thanks to its mechanism of action, has a broad spectrum of potential applications both as a diagnostic tool, as well as for monitoring treatment efficacy and is normally used by intravenous administration.
The most interesting indications are in the field of rheumatology, cardiovascular diseases, oncology, transplant rejection, autoimmune diseases, neurology, but there is room also for other pathologies having as a hallmark the process of apoptosis. With regard to cardiovascular diseases in particular aortic aneurysm, chemotherapy card iotoxi city and atherosclerosis can be considered.
Other indications are also considered, such as transplant rejection, autoimmune diseases (other than Rheumatoid Arthritis, e.g. Inflammatory Bowel Disease ...) or neurodegenerative diseases.
However, the preparation of the 99mTc-rhAnnexin V-128 is rather complicated because of various problems.
The cysteine present in the rhAnnexin V-128 can easily lead to dimerization due to the formation of a disulfide bridge between two cysteines, thus decreasing the chemical purity of the preparation. Moreover the protein is subjected to protein aggregation, a physical phenomenon in which misfolded proteins aggregate.
It should be noted that rhAnnexin V-128 undergoes several stressful process steps (freeze-thawing, bulk formulation, lyophilization), as well as long-term storage and reconstitution with radioactive 99mTcO4- solution, during which aggregation is likely to occur. For these reasons the chemical purity is an analytical parameter which has to be carefully monitored in this preparation.
The radiochemical purity is also a critical parameter for radiopharmaceuticals. It is essential both for safety reasons and also for its technical/diagnostic performance. The labeling with 99mTcO4- occurs through a series of reactions/equilibriums involving REDOX reactions and trans-chelation, and several radiochemical impurities may form if the conditions are not optimal.
Therefore, the recombinant protein rhAnnexin V-128 is sensitive, can flocculate during freeze-thawing, can dimerize through the free SH groups of the Cys, both during the thawing process, the manufacturing process and also during radiolabelling. A specific formulation is necessary for creating suitable conditions leading to a final 99mTc-rhAnnexin V-128 preparation with high radiochemical and chemical purity, and high stability.
In Tait et al. "Structural Requirements for In Vivo Detection of Cell Death with 99mTc- Annexin V"; The Journal of Nuclear Medicine - Vol. 46 - No. 5 - pp. 807-815 (2005) the labelling of rhAnnexin V-128 protein with 99mTc is described.
However, Tait's work describes a two vials kit approach (with rhAnnexin V-128 in the form of a solution), that requires a final purification to obtain the 99mTc-rhAnnexin V- 128. This is not an optimal formulation, as the final purification is an important drawback in routinely clinical practices because it requires a rather complex manipulation of the product, with associated radio safety and sterility issues and not compatible with pharmaceutical quality standards.
The Patent Applications CN 103159842 and Lu C. et al. "Kit formulation for 99mTc- labeling of recombinant Annexin V molecule with a C-terminally engineered cysteine"; J Radioanal Nucl Chem - Vol. 304 - pp. 571-578 (2015) describe a preparation method for the labeling of a different form of Annexin V which is modified on the C- terminus.
The described method comprises mainly two steps: 1 ) preparation of a phosphate buffer solution (pH 7.4) containing the protein, glucoheptonate and EDTA as transitional ligands, Stannous salt and diluted hydrochloric acid; 2) 99mTc04 Na is added to the solution in step 1 and the so-obtained solution is mixed in water batch at 35-37 °C to give the labeled product 99mTc-Cys-Annexin V.
However, the Annexin V according to CN 103159842 differs from the present Annexin V -128 since it presents a single Cysteine residue on the C-terminal, which is able to bind Tc-99m, while it lacks the modified N-terminus, with the addition of six amino acids (among which there is one Cys); moreover, in Annexin V -128 the Cys that was present in position 316 has been substituted by a Serine, thus subtracting a residue that favors dimerization via disulphide bonds.
The process described in the above said patent and article is performed at pH = 7.4 and therefore it could not be applied to a process involving Annexin V-128 since this pH favors dimer formation.
Moreover, in the Patent Applications CN 103159842 and in the publication by Lu et al., above reported, there is no mention of any characterization of the chemical purity and of any antioxidant agent for preventing dimerization, which on the contrary is critical for Annexin V-128 according to the present invention.
From the above said it is evident the necessity to develop a new composition comprising Annexin V-128 allowing an easier labeling process and leading to a final 99mTc- labeled rhAnnexin V-128 formulation with high chemical and radiochemical purity, and high stability.
This labeling process should be based on direct reconstitution of a pre-formulated single vial possibly without requiring any additional filtration or purification step prior to injection.
Brief description of the figures
Figure 1 reports a schematic view of the process for the preparation of the lyophilized rhAnnexin V-128 according to the invention
Figure 2 shows SPECT images of 99mTc-rhAnnexin V-128 uptake in front paws of a healthy mouse (a) and in a mouse model of collagen induced arthritis (b). Figure 3c shows the uptake in the CIA mouse after treatment with an anti-inflammatory drug (no 99mTc-rhAnnexin V-128 uptake detectable anymore).
Summary of the invention
It is described a composition comprising lyophilized rhAnnexin V-128 suitable for the preparation of 99mTechnetium formulation for intravenous administration.
Detailed description of the invention
The present invention allows to overcome the above said problems thanks to a lyophilized composition suitable for intravenous administration comprising Annexin V- 128 in combination with suitable excipients, including particularly an antioxidant agent, in a pH range of 5.0 - 6.6.
Moreover the present application refers also to a formulation obtained by adding to the above said composition a suitable volume of eluate from a commercial 99mTc04- generator.
Preferably the lyophilized composition as above defined includes also a specific buffer.
The antioxidant is included with the purpose of decreasing the Annexin V-128 dimer content both during the long-term storage of the lyophilized composition and also in the 99mTc-rhAnnexin V-128 preparation after labeling. In the absence of the antioxidant the dimer formation was not under control, leading to a non-adequate chemical purity.
The addition of the antioxidant agent allowed to limit the dimer formation and ensure a dimer content below 10% during the long-term storage of the lyophilized composition and also for at least 6 h after radiolabeling.
Therefore, according to the present invention, the antioxidant has a key role in maintain a good level of chemical purity and it is not added with the purpose of preventing the re-oxidation of reduced technetium to pertechnetate. Different antioxidants, such as sodium metabisulfite, nicotinamide, pyridoxine hydrochloride, a- tocopherol acetate, monothioglycerol, were evaluated.
Besides the use of the antioxidant, the control of dimerization and therefore of the chemical purity, is also accomplished by keeping the pH within the range 5.0 - 6.6. Higher pH values favor the dimer formation, while at lower pH values opalescence of the solution was observed, probably due to a decrease in protein solubility.
Regarding the choice of the buffer, initially the use of citrate buffer was attempted, as this is the buffer in which Annexin V-128 is currently stored. However, a radiochemical purity around 85-90% could only be achieved. With the purpose of shifting the radiochemical purity value above 90%, which is the commonly accepted lower limit for radiopharmaceutical preparations, different buffers, such as lactate, succinate, glycolic, TRIS and histidine, were evaluated. The lactate buffer was chosen, as it allowed to reach radiochemical purity values consistently around 94- 96%.
The use of the antioxidant and of the specific buffer allowed also to obtain a single- vial lyophilized composition with a long-term stability of at least 18 months. As a reference, the lyophilized composition described in the previous art (Lu et al., 2015) is declared to be stable for 210 days.
According to the present invention, the antioxidant and the specific buffer mentioned above are included in lyophilized composition comprising also:
- a reducing agent;
- a transchelating agent;
- a lyoprotectant and cake-forming agent
Optionally, the composition can also include a radiation stability enhancer and/or a solubilizer.
In the lyophilized composition according to the invention the above said components are normally present in the following quantities:
- antioxidant agent (with the purpose of achieving a high chemical purity): above 0,005 mg/vial
- buffer: pH comprised between 5.0 and 6.6, with a concentration above 10 mM - reducing agent: above 0,005 mg/vial;
- transchelating agent: above 0,02 mg/vial;
- lyoprotectant and cake-forming agent: above 10 mg/vial
Optionally, the composition can also include a radiation stability enhancer in a quantity above 0,005 mg/vial and/or a solubilizer in a quantity above 1 mg/vial Several tests were performed during the development in order to define the above- described composition. Initially, the rhAnnexin V-128 lyophilized composition was prepared in presence of citrate buffer, including the following components:
- rhAnnexin V-128 (active pharmaceutical ingredient)
- stannous chloride (reducing agent)
- sodium a-D-Glucoheptonate dihydrate (transchelating agent)
- gentisic acid sodium salt hydrate (radiation stability enhancer)
- hydroxyprolpyl-p-cyclodextrin (solubilizer)
- trehalose dihydrate (lyoprotectant and cake-forming agent)
- pH = 5.4 The quantities of each component were slightly modified with the purpose of optimizing the formulation. The various batches of this lyophilized composition, after radiolabeling, gave a radiochemical purity that was never above 90% (as determined by both ITLC and HPLC) and a stability not longer than 1.5 hours.
In a second step, the rhAnnexin V-128 lyophilized composition was prepared in presence of lactate buffer, instead of citrate, at different pH values (up to 6.4), in the absence of antioxidant agent. The so-obtained composition, after radiolabeling, gave an improved radiochemical purity (well above 90% by both ITLC and HPLC). However, in these tests it was also observed that pH increase favors dimer formation, the dimer percentage increasing more rapidly at higher pH, after radiolabeling.
In a third step, the presence antioxidant agent and lactate buffer were tested. A lyophilized composition similar to the previous one was prepared, at a pH of 5.8, including also an antioxidant (sodium metabisulfite). After radiolabeling, the radiochemical purity was confirmed to be well above 90% and the chemical purity was remarkably improved, giving values around 97-98% (by SEC-HPLC and RP- HPLC) for at least 6 h after radiolabeling.
A lyophilized composition according to the present invention can be prepared according to a process comprising the following steps (see also Fig. 1 ):
- Thawing of the frozen rhAnnexin V-128 at a controlled temperature (5°C ± 3°C) - Reduction by the addition of an antioxidant/reducing agent,
- Buffer exchange by tangential flow filtration, to substitute the buffer in which the rhAnnexin V-128 is supplied (normally citrate buffer) with the buffer as above defined;
- Preparation of the excipient bulk solution (consisting of: antioxidant agent, transchelating agent, radiation stability enhancer, solubilizer, lyoprotectant/cake- forming agent as above defined)
- addition of the required amount of rhAnnexin V-128 solution to the excipient bulk solution
- Dispensation of the bulk solution into vials and lyophilization.
The final 99mTc-rhAnnexin V-128 formulation suitable for intravenous administration can be prepared by adding to the above said composition a suitable volume of eluate from a commercial 99mTc04- generator containing up to 740 MBq of radioactivity and keeping the vial under slight rotation for 90 min at room temperature.
It is worth noticing that the so-prepared 99mTc-rhAnnexin V-128 formulation maintains a high chemical and radiochemical purity, as determined by ITLC, SEC-HPLC and RP-HPLC for at least 6 hours.
The essential features of the composition/formulation according to the invention as well as of their process of preparation as above described are the use of an antioxidant agent and the use of a specific buffer, in the pH range 5.0 - 6.6.
These features allow to obtain an injectable formulation with a high radiochemical purity (99mTc-rhAnnexin V-128 monomer by SEC-HPLC and ITLC > 90%) and high chemical purity (rhAnnexin V-128 monomer by SEC-HPLC and RP-HPLC > 90%, dimers < 10%), which are maintained for at least 6 h after radiolabelling.
The lyophilized composition according to the invention has a shelf life of at least 18 months at 2-8 °C, and can be radiolabeled at room temperature, giving a high chemical and radiochemical purity and good stability for at least 6 hours after labeling, with a controlled dimer percentage.
The composition according to the invention makes the rhAnnexin V-128 available as a lyophilized single vial product that needs just to be reconstituted with a 99mTc04- solution eluted from a commercially available generator without the need for any final purification.
Moreover, thanks to the fact that the radiolabeling procedure has been validated, only a limited quality control check (radiochemical purity analysis by ITLC) is required at the hospital level prior injection.
The formulation according to the invention was tested for its diagnostic performance in several animal models (liver apoptosis, collagen induced arthritis model, endocarditis/myocarditis, inflammatory bowel disease, and others).
An example of SPECT images in a collagen induced arthritis model is shown as Figure 2.
Annexin V-128 was also tested for its toxicity in a complete preclinical toxicology package (designed in accordance with the relevant guidelines and with the input received from regulatory agencies), in 15 days repeated dose toxicology studies in rodent and non-rodent species. A cytokine release assay was also included in the preclinical package. The outcome of these studies showed that Annexin V-128 has a very favorable safety profile (data can be provided if needed).
The formulation was tested for its safety and biodistribution in a Phase I study in human volunteers and is currently being tested in Phase II studies in Rheumatology and Cardiovascular indications.
Example 1
Preparation of a lyophilized rhAnnexin V-128 composition suitable for the preparation of 99mTc-rhAnnexin V-128 formulation for intravenous administration
Composition:
rhAnnexin V-128 (0.4 mg);
stannous chloride (0.01 mg);
sodium a-D-Glucoheptonate dihydrate (3 mg)
gentisic acid sodium salt hydrate (0.02 mg)
hydroxypropyl-p-cyclodextrin (5 mg)
sodium metabisulfite (0.02 mg)
trehalose dihydrate (50 mg)
lactate buffer 150 mM, pH 5.8
Preparation:
rhAnnexin V-128 was thawed and introduced into a tangential flow filtration system in order to exchange the buffer. Metabisulfite was also introduced at this step. This filtration procedure was carried on until at least 7 diavolumes of formulation buffer have been exchanged. The dimer content was checked by SEC-HPLC (maximum acceptable value = 5%), and the protein concentration was also assessed (acceptable range 1 -2 mg/mL). At the end of the filtration procedure, the solution was brought to a final concentration of 1 mg/mL of protein.
The other excipients were all dissolved in water for injection, in appropriate amounts: - D(+)-Trehalose dehydrate (powder): an appropriate amount was weighed to obtain a concentration of 50 mg/ml in the final bulk solution; - Sodium α-D-Glucoheptonate dihydrate (stock solution of 60 mg/ml): appropriate volume is added to obtain a concentration of 3 mg/ml in the final bulk solution;
- Gentisic acid sodium salt hydrate (stock solution of 0.1 mg/ml): appropriate volume is added to obtain a concentration of 0.02 mg/ml in the final bulk solution;
- Stannous Chloride dehydrate (stock solution of 1 mg/ml): appropriate volume is added to obtain a concentration of 0.01 mg/ml in the final bulk solution.
The final bulk solution was prepared adding an appropriate volume of rhAnnexin V- 128 solution to an appropriate volume of excipient bulk solution.
The final bulk solution was filtered (0.22 μππ filter) and automatically filled into the vials (1 mL/vial) and lyophilized.
Example 2
Preparation of 99mTc-rhAnnexin V-128 starting from lyophilized composition described in Example 1 .
-The vial cap was flipped off and the vial was placed in a suitable radiation shield; - 2 ml_ of Sodium Pertechnetate Tc-99m solution containing 740 MBq of radioactivity were aseptically added to the vial in the lead shield;
- The vial was removed from the lead shield and placed in an appropriately shielded roller. The vial was kept under slight rotation for 90 min at room temperature:
- The vial was removed from the shielded roller and placed again in a lead shield; A sample of the so-obtained solution was withdrawn and analyzed for its chemical and radiochemical purity (SEC-HPLC, ITLC) immediately after radiolabelling and also after 6 h, and the following results were obtained. These data have been obtained from three different batches.
STANDARD
ACCEPTANCE AVERAGE
TEST METHOD DEVIATION CRITERIA (n=3)
(n=3)
Radiochemical Purity (% 99mTc-
> 90.0% 98.6 0.6 rhAnnexin V-128)
Radiochemical Purity (% 99mTc04 + ITLC
< 8.0% 0.9 0.9 99mTc02) T=0
Radiochemical Purity (% 99mTc-
< 10.0% 0.5 0.2 glucoheptonate)
Radiochemical Purity (% 99mTc-
> 90.0% 98.2 0.5 rhAnnexin V-128)
Radiochemical Purity (% 99mTc04 + ITLC
< 8.0% 1.4 0.6 99mTc02) T=0+6h
Radiochemical Purity (% 99mTc-
< 10.0% 0.4 0.1 glucoheptonate)
Radiochemical Purity (% 99mTc- SEC-HPLC
> 90.0% 96.8 0.5 rhAnnexin V-128) T=0
Radiochemical Purity (% 99mTc- SEC-HPLC
> 90.0% 96.6 0.4 rhAnnexin V-128) T=0+6h
The above said formulation can be used as a diagnostic tool and also for selecting the best treatment as well as for monitoring medical treatment efficacy in rheumatology (for example rheumatoid arthritis, Axial Spondyloarthritis), cardiovascular diseases (as for example aortic aneurysm, chemotherapy cardiotoxicity, endocarditis and myocarditis) atherosclerosis (in particular for the detection and staging of atherosclerotic plaque), oncology, transplant rejection, autoimmune diseases, neurology, and other pathologies having as a hallmark the process of apoptosis and/or as marker of treatment response for treatment-induced apoptosis.

Claims

1 . A lyophilized composition suitable for intravenous administration comprising rhAnnexin V-128 in combination with and antioxidant agent, in a pH range of 5.0 - 6.6.
2. The lyophilized composition according to Claim 1 wherein the antioxidant agent is chosen among: sodium metabisulfite, nicotinamide, pyridoxine hydrochloride, a-tocopherol acetate, monothioglycerol.
3. The lyophilized composition according to Claims 1 and 2, comprising also a buffer, chosen among lactate buffer, succinate buffer, glycolic buffer, TRIS, histidine buffer
4. A lyophilized composition according to Claims 1 - 3, suitable for intravenous administration, comprising:
- an antioxidant agent,
- a buffer having a pH comprised between 5.0 - 6.6
- a reducing agent;
- a transchelating agent;
- a lyoprotectant and cake-forming agent
and possibly a radiation stability enhancer and/or a solubilizer.
5. The lyophilized composition according to claim 4 wherein said components are present in the following quantities:
- the antioxidant agent in a quantity above 0,005 mg/vial
- the buffer having a pH comprised between 5.0 - 6.6 with a concentration above 10 mM
- the reducing agent, in a quantity above 0,005 mg/vial;
- the transchelating agent, in a quantity above 0,02 mg/vial;
- the lyoprotectant and cake-forming agent, in a quantity above 10 mg/vial the radiation stability enhancer and the solubilizer, if present, in a quantity above 0,005 mg/vial and above 1 mg/vial respectively.
6. A process for preparing a single-vial lyophilized formulation according to one of the previous claims comprising the following steps:
- Thawing of the frozen rhAnnexin V-128
- Addition of an antioxidant/reducing agent,
- Buffer exchange by tangential flow filtration, to substitute the buffer in which the rhAnnexin V-128 is supplied with a buffer chosen among lactate buffer, succinate buffer, glycolic buffer, TRIS, histidine buffer ;
- Preparation of the excipient bulk solution including: transchelating agent, radiation stability enhancer, solubilizer, antioxidant agent, lyoprotectant and cake-forming agent
- Addition of the required volume of rhAnnexin V-128 solution to the excipient bulk solution
- Dispensation of the bulk solution into vials and lyophilization
7. A formulation suitable for intravenous administration comprising a 99mTc-rhAnnexin V-128 obtained reacting a single-vial lyophilized rhAnnexin V-128 formulation according to claims 1 - 5 with an eluate deriving from a commercial 99mTc04- generator
8. A process for obtaining a 99mTc-rhAnnexin V-128 according to claim 7 comprising the following steps:
- a suitable volume of eluate from a commercial 99mTc04 " generator containing up to 740 MBq of radioactivity is added to the vial containing the lyophilized formulation as above described;
- the vial is kept under slight rotation for 90 min at room temperature;
- the reaction is completed and the so-obtained solution is stable for 6 hours;
9. Use of a formulation according to Claim 7 as a diagnostic tool, as well as for monitoring medical treatment efficacy.
10. Use according to Claim 9 in rheumatology, cardiovascular diseases, oncology, transplant rejection, autoimmune diseases, neurology, and other pathologies having as a hallmark the process of apoptosis and/or as marker of treatment response for treatment-induced apoptosis.
1 1. Use according to Claims 9 and 10 wherein said cardiovascular diseases are aortic aneurysm, chemotherapy cardiotoxicity and atherosclerosis.
12. Use according to Claim 10 for the detection and management of rheumatoid arthritis, Axial Spondyloarthritis.
13. Use according to Claim 10 for the detection of endocarditis and myocarditis 14. Use according to Claim 1 1 for the detection and staging of atherosclerotic plaque.
PCT/EP2017/075967 2016-10-11 2017-10-11 Lyophilized compositions comprising rhannexin v-128, process for their preparation and their use for preparing formulations containing 99mtc-rhannexin v-128 WO2018069409A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
EP17794236.4A EP3541361A1 (en) 2016-10-11 2017-10-11 Lyophilized compositions comprising rhannexin v-128, process for their preparation and their use for preparing formulations containing 99mtc-rhannexin v-128
CN201780063039.XA CN110167528A (en) 2016-10-11 2017-10-11 Freeze-dried composition comprising rhAnnexin V-128, they preparation method and its be used to prepare containing99mThe purposes of the preparation of Tc-rhAnnexin V-128
US16/339,530 US20200038526A1 (en) 2016-10-11 2017-10-11 Lyophilized Compositions Comprising Rhannexin V-128, Process for Their Preparation and Their Use for Preparing Formulations Containing 99MTc-Rhannexin V-128
JP2019540703A JP2019533723A (en) 2016-10-11 2017-10-11 Lyophilized composition comprising rh annexin V-128, process for preparing the composition, and use of the composition for the preparation of a formulation comprising 99mTc-rh annexin V-128
US17/398,195 US20220031872A1 (en) 2016-10-11 2021-08-10 Lyophilized Compositions Comprising Rhannexin V-128, Process for Their Preparation and Their Use for Preparing Formulations Containing 99MTc-Rhannexin V-128

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
IT102016000101875A IT201600101875A1 (en) 2016-10-11 2016-10-11 Lyophilized compositions comprising rhAnnexin V-128, process for their preparation and their use for the preparation of formulations containing 99mTc-rhAnnexin V-128
IT102016000101875 2016-10-11

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/339,530 A-371-Of-International US20200038526A1 (en) 2016-10-11 2017-10-11 Lyophilized Compositions Comprising Rhannexin V-128, Process for Their Preparation and Their Use for Preparing Formulations Containing 99MTc-Rhannexin V-128
US17/398,195 Continuation US20220031872A1 (en) 2016-10-11 2021-08-10 Lyophilized Compositions Comprising Rhannexin V-128, Process for Their Preparation and Their Use for Preparing Formulations Containing 99MTc-Rhannexin V-128

Publications (1)

Publication Number Publication Date
WO2018069409A1 true WO2018069409A1 (en) 2018-04-19

Family

ID=58609658

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2017/075967 WO2018069409A1 (en) 2016-10-11 2017-10-11 Lyophilized compositions comprising rhannexin v-128, process for their preparation and their use for preparing formulations containing 99mtc-rhannexin v-128

Country Status (6)

Country Link
US (2) US20200038526A1 (en)
EP (1) EP3541361A1 (en)
JP (1) JP2019533723A (en)
CN (1) CN110167528A (en)
IT (1) IT201600101875A1 (en)
WO (1) WO2018069409A1 (en)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103159842A (en) 2013-03-18 2013-06-19 江苏省原子医学研究所 Cys-Annexin V kit used for 99mTc labeling and preparation method and application thereof

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ATE190053T1 (en) * 1994-05-19 2000-03-15 Neorx Corp AROMATIC AMINE-SUBSTITUTED LIGANDS WITH BRIDGED NITROGEN AND SULFUR DONORATOR ATOMS FOR IMAGE FORMING
GB0427392D0 (en) * 2004-12-15 2005-01-19 Amersham Plc Stabilised 99mTc compositions

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103159842A (en) 2013-03-18 2013-06-19 江苏省原子医学研究所 Cys-Annexin V kit used for 99mTc labeling and preparation method and application thereof

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
HARDY JONATHAN W ET AL: "[99mTc]Annexin V-128 SPECT Monitoring of Splenic and Disseminated Listeriosis in Mice: a Model of Imaging Sepsis", MOLECULAR IMAGING & BIOLOGY, ELSEVIER, BOSTON, vol. 17, no. 3, 22 November 2014 (2014-11-22), pages 345 - 354, XP035498291, ISSN: 1536-1632, [retrieved on 20141122], DOI: 10.1007/S11307-014-0804-6 *
JIN M. ET AL.: "Essential Role of B-helix Calcium Binding Sites in Annexin V-Membrane Binding", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 279, no. 39, 2004, pages 40351 - 40357
LAHORTE C M M ET AL: "APOPTOSIS-DETECTING RADIOLIGANDS: CURRENT STATE OF THE ART AND FUTURE PERSPECTIVES", EUROPEAN JOURNAL OF NUCLEAR MEDICINE AND MOLECULAR IMA, SPRINGER VERLAG, HEIDELBERG, DE, vol. 31, no. 6, 1 June 2004 (2004-06-01), pages 887 - 919, XP008064142, ISSN: 1619-7070, DOI: 10.1007/S00259-004-1555-4 *
LU C. ET AL.: "Kit formulation for 99mTc-labeling of recombinant Annexin V molecule with a C-terminally engineered cysteine", J RADIOANAL NUCL CHEM, vol. 304, 2015, pages 571 - 578, XP035920656, DOI: doi:10.1007/s10967-014-3859-6
TAIT ET AL.: "Structural Requirements for In Vivo Detection of Cell Death with Tc-Annexin V", THE JOURNAL OF NUCLEAR MEDICINE, vol. 46, no. 5, 2005, pages 807 - 815, XP002510935
TAIT JONATHAN F ET AL: "Structural requirements for in vivo detection of cell death with Tc-99m-annexin V", THE JOURNAL OF NUCLEAR MEDICINE, SOCIETY OF NUCLEAR MEDICINE, US, vol. 46, no. 5, 1 May 2005 (2005-05-01), pages 807 - 815, XP002510935, ISSN: 0161-5505 *

Also Published As

Publication number Publication date
EP3541361A1 (en) 2019-09-25
US20200038526A1 (en) 2020-02-06
CN110167528A (en) 2019-08-23
JP2019533723A (en) 2019-11-21
US20220031872A1 (en) 2022-02-03
IT201600101875A1 (en) 2018-04-11

Similar Documents

Publication Publication Date Title
Breeman et al. 68Ga-labeled DOTA-peptides and 68Ga-labeled radiopharmaceuticals for positron emission tomography: current status of research, clinical applications, and future perspectives
Sainz-Esteban et al. Comparison of sequential planar 177 Lu-DOTA-TATE dosimetry scans with 68 Ga-DOTA-TATE PET/CT images in patients with metastasized neuroendocrine tumours undergoing peptide receptor radionuclide therapy
CA2279349C (en) Ascorbate-stabilized radiopharmaceutical method and composition
US6066309A (en) Post-labeling stabilization of radiolabeled proteins and peptides
JP2019533728A (en) Preparations for radiotherapy and diagnostic imaging
CA2785576C (en) Formulations suitable for pet imaging with hydrophobic pet agents
CA2065462C (en) Radiopharmaceutical bacteriostats
US20010055563A1 (en) Post-labeling stabilization of radiolabeled proteins and peptides
US20220031872A1 (en) Lyophilized Compositions Comprising Rhannexin V-128, Process for Their Preparation and Their Use for Preparing Formulations Containing 99MTc-Rhannexin V-128
TW201941784A (en) Lyophilized compositions comprising rhAnnexin V-128, process for their preparation, formulations comprising the same and process for their preparation, and use of the same
Das et al. Radiochemical studies, pre-clinical investigation and preliminary clinical evaluation of 170Tm-EDTMP prepared using in-house freeze-dried EDTMP kit
Garnuszek et al. Comparison of chromatographic methods for quality control of DMSA complexes with 99mTc and 188Re at (III) and (V) oxidation states
US20220080059A1 (en) RADIOLABELING AND FORMULATION FOR SCALE UP OF 64Cu-DOTATATE
AU2018372768B2 (en) Pharmaceutical composition comprising tetrofosmin and pharmaceutically acceptable salts thereof
Rayudu In-Hospital Preparation Of Radiotracers Garimella
de Castro et al. Study of" 9" 9" mTc-DMSA biodistribution in experimental animals
KR20230174238A (en) radioactive antineoplastic agent
EP3993839A1 (en) Radiopharmaceutical compound and composition for positron emission tomography (pet) imaging of interleukin-2 receptor positive cells, process for the preparation thereof, related kit and uses thereof
Zakrzewska et al. PREPARATION AND PRE-CLINICAL INVESTIGATION OF L-α-METHYLTYROSINE LABELED WITH IODINE-131 OR IODINE-123 (IMT-131I, IMT-123I)
Cambier et al. 99Tcm-dimercaptopropionyl-HSA prepared from a labelling kit: Preliminary investigations as a blood pool agent
Sohaib et al. Formulation and evaluation of a single vial lyophilized preparation of technetium-99m labeled ethylene dicysteine as a renal scintigraphic agent.
Pawlk et al. Influence of central metal ion on bone deposition of EDTMP chelates with different radionuclides
Beeton et al. Distribution and kinetics of the Kv1. 3-blocking peptide HsTX1 [R14A] in experimental rats
Nanabala et al. Preparation of Patient Doses of [177Lu] Lu‑DOTATATE and [177Lu] Lu‑PSMA‑617 with Carrier Added (CA) and No Carrier Added (NCA)

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17794236

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2019540703

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017794236

Country of ref document: EP

Effective date: 20190513

ENP Entry into the national phase

Ref document number: 2017794236

Country of ref document: EP

Effective date: 20190513