WO2018045083A1 - Use of cgrp receptor antagonists in neuroprotection and neurological disorders - Google Patents
Use of cgrp receptor antagonists in neuroprotection and neurological disorders Download PDFInfo
- Publication number
- WO2018045083A1 WO2018045083A1 PCT/US2017/049460 US2017049460W WO2018045083A1 WO 2018045083 A1 WO2018045083 A1 WO 2018045083A1 US 2017049460 W US2017049460 W US 2017049460W WO 2018045083 A1 WO2018045083 A1 WO 2018045083A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- leu
- ala
- arg
- thr
- ser
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/02—Drugs for disorders of the nervous system for peripheral neuropathies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/04—Centrally acting analgesics, e.g. opioids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/06—Antiglaucoma agents or miotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P39/00—General protective or antinoxious agents
- A61P39/02—Antidotes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/57527—Calcitonin gene related peptide
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present embodiments relate to the therapeutic use of antagonists of the calcitonin gene-related peptide (CGRP) receptor for neuroprotection and in the treatment of acute and chronic diseases and disorders associated with neurodegeneration, including for example, treatment of glaucoma.
- CGRP calcitonin gene-related peptide
- Calcitonin gene-related peptide a member of the calcitonin family of peptides, is a potent 37-amino acid peptide vasodilator that has an important role in the pathogenesis of several pain syndromes, such as migraine, and thermal injury. In addition to its role in vasodilation, CGRP can exert a broad range of biological effects.
- CGRP calcitonin gene-related peptide
- CT/CGRP calcitonin/calcitonin gene-related peptide family of peptide hormones, which can act as a sensory neuropeptide with potent vasodilatory and cardiotonic action as described in U.S. Pat. No. 4,530,838 to Evans, et al.
- CGRP is present in both the central and peripheral nervous systems and is concentrated in those areas of the body receiving sensory input from the dorsal horn with limited amounts associated with autonomic input.
- the peptide is present in the nuclei of sensory and motor cranial nerves and in cell bodies in the hypothalamus, preoptic area, ventromedial thalamus, hippocampus, and the like (Poyner e/ a/. 1992).
- the CT/CGRP peptide family includes calcitonin gene-related peptide (CGRP), adrenomedullin (ADM), intermedin (IM), calcitonin (CT) and amylin.
- CGRP calcitonin gene-related peptide
- ADM adrenomedullin
- IM intermedin
- CT calcitonin
- amylin amylin.
- GPCRs G protein-coupled receptors
- CTR calcitonin receptor
- CLR calcitonin receptor-like receptor
- RAMP receptor activity modifying protein
- CGRP calcitonin gene-related peptide
- ADM adrenomedullin
- IM intermedin
- the CGRP receptors are composed of 3 subunits: a 7 transmembrane protein called the calcitonin-like receptor (CLR), a single transmembrane protein that determines ligand specificity called receptor activity modifying protein 1 (RAMPl) and an intracellular protein called receptor component protein (RCP).
- CLR calcitonin-like receptor
- RAMPl receptor activity modifying protein 1
- RCP receptor component protein
- the CGRP receptor is coupled to the Gas signaling pathway leading to increased intracellular cAMP and activated protein kinase A (PKA) (Poyner et al, 2002).
- PKA protein kinase A
- CGRP receptors are found in multiple areas, including for example: 1) the cerebrovasculature smooth muscle, where they can cause relaxation of the vessels (Poyner et ah, 2002); 2) dural mast cells from which CGRP has been shown to release pro- inflammatory cytokines and inflammatory agents during neurogenic inflammation (Marquest et ah, 2006); 3) trigeminal ganglia neurons (Zhang et ah, 2007) and second order sensory neurons within trigeminal nuclei in the caudal brainstem which is responsible for the transfer of pain sensation (Russo et ah, 2015).
- CGRP receptors are expressed in the central and peripheral nervous system (Cumberbatch et ah, 1999; Marquez de Prado et ah, 2006,). Inhibitors at the receptor level to CGRP are postulated to be useful in pathophysiologic conditions where excessive CGRP receptor activation has occurred. Some of these include neurogenic vasodilation, neurogenic inflammation, migraine, cluster headache and other headaches, thermal injury, circulatory shock, menopausal flushing, and asthma. CGRP receptor activation has particularly been implicated in the pathogenesis of migraine headache (Edvinsson et ah 2001; Grant et ah, 2002). Migraines are noted for the strength of the headache that ensues with its pathology.
- CGRP-containing nerve fibers innervate cerebral and dural vessels where CGRP is believed to prolong vasodilation.
- serum levels of CGRP are elevated during migraine (Goadsby, et ah 1990), and treatment with anti-migraine drugs returns CGRP levels to normal coincident with alleviation of headache (Gallai, et ah 1995).
- Migraineurs exhibit elevated basal CGRP levels compared to controls (Ashina, et ah, 2000).
- CGRP antagonist peptides and their use in the treatments of migraines have been described in U.S. patent application 13/821,936 filed on March 8, 2013 (Soares et al), hereby incorporated by reference in its entirety.
- Nerve injury can also lead to high levels of CGRP in the nerves and spinal cord.
- levels of CGRP mRNA were markedly increased in pigs that sustained neuritis neuropathy due to sciatic nerve injury (Castel et al. 2016).
- Antagonists of the CGRP receptor are known, including small molecule, peptide and antibody antagonists.
- Small molecule antagonists of the CGRP receptor include, for example, the gepant class of molecules, such as olcegepant, telcagepant and ubrogepant.
- Peptide antagonists include, for example, truncated CGRP peptides such as CGRP (8-37), CGRP (28-37), [Tyr°]CGRP (28-37), and CGRP (12-37); h-a-CGRP (9-37), h-a-CGRP (10- 37), h-a-CGRP (11-37) (Mimeault, M.
- Non-truncated peptide antagonists of CGRP receptors are described, for example, herein and in Soares, CJ, PCT Patent Publication WO 2013/112912, published August 1, 2013. Such non-truncated, or full length peptide antagonists of CGRP receptors have been shown to be highly potent antagonists that would not be expected to have off- target effects, as seen with many small molecule antagonists. Additionally, antibodies binding CGRP receptors are known, such as AMG 334, as are antibodies to the CGRP hgand, such as LY2951742, ALD403 and TEV-48125. To date, such CGRP receptor and ligand antibodies have been investigated for use in treatment of pain-related disorders such as migraine and osteoarthritis pain.
- neurodegenerative disease refers to the progressive loss of structure and/or function of the neurons including the death of neurons.
- Examples of neurodegenerative disease include glaucoma, amyotrophic lateral sclerosis, multiple sclerosis, Creutzfeld- Jakob disease, epilepsy, Parkinson's, Alzheimer's, diabetic neuropathy and Huntington's disease (Gupta, et al, 2007; Song et al, 2016; Mufson et al).
- no cures exist for such diseases which typically result in progressive degeneration and/or the death of neuron cells and can result in death of the patient.
- Neurodegeneration can be found in many different levels of neuronal circuitry ranging from molecular to systemic.
- Glaucoma is a neurodegenerative disease that is one of the most common causes of blindness, affecting over 70 million people worldwide.
- An age-related, chronic degenerative disease of the optic nerve, retina, and brain, glaucoma exhibits similarities to the molecular and cellular features of other chronic degenerations of the neurologic systems, including amyotrophic lateral sclerosis.
- the underlying mechanisms leading to glaucoma are still under investigation, however one well-established cause of glaucoma is the damage to retinal ganglion cells from the result of mechanical injury stemming from intraocular pressure caused by disruption of the trabecular meshwork (Nafissi et al. 2015).
- Glaucoma comprises a group of several eye diseases that lead to damage to the optic nerve and, too often, vision loss. While glaucoma is generally characterized by the increase of intraocular pressure (IOP), damage to the ganglion cells of the retina and the optic nerve without concomitant increase in IOP is also a known form of glaucoma (normotensive glaucoma). Similarly, genetic mutation and oxidative insult can lead to ganglion cell apoptosis. As such, there is a need to develop strategies for protecting the ganglion cells of the retina and the optic nerve.
- IOP intraocular pressure
- axonopathy a disorder affecting primarily the normal functioning of axons of peripheral nerve fibers in the brain can also lead to glaucoma (Chader et al, 2016).
- the changes in the optic nerve and the optic nerve head can include impairment of transport of molecules in the fibers of the optic nerve that causes glaucomatous damage to accumulate as the patient gets older.
- Injury of specialized brain structures is also seen in the early stages of glaucoma. Glaucoma can also stem from a complication from diabetic eye disease. People with diabetes are twice as likely to develop glaucoma compared to non-diabetics as they age.
- neurodegeneration is a complex disease, in which several groups of people are at a substantially higher risk than the general population for developing diseases that affect the nerve fibers.
- One of the greatest risk factor for neurodegenerative diseases is aging. For example, mitochondrial DNA mutations as well as oxidative stress are associated both with aging and other neurodegeneration.
- Aging is another factor that can lead to glaucoma.
- aging can play a role in the development of primary open-angle glaucoma (POAG).
- POAG primary open-angle glaucoma
- advances in other age-related diseases may be useful in the development of a variety of treatments.
- methods that are developed to protect the neurons of the optic tract may also be applied to other nervous system diseases, such as Alzheimer's disease and AMD, for example, where neurons are in need of protection.
- Methods to protect neurons can lead to inhibiting the onset of neurodegenerative diseases and inhibiting damage of neurons, including retinal neurons, such as photoreceptor cells against cell death (apoptosis) or can lead to slowing of neurodegenerative disease progression and associated damage to neurons.
- retinal neurons such as photoreceptor cells against cell death (apoptosis)
- apoptosis apoptosis
- these new methods can be used to prevent and/or slow nerve injury or protect retinal neurons or nerves in the peripheral or central nervous system.
- CGRP receptor antagonists including, for example, peptide antagonists
- CGRP receptor antagonists and compositions comprising the same can be used to treat neurodegenerative diseases.
- these CGRP antagonist peptides and compositions can be used to protect neurons from acute or chronic damage, inhibiting or slowing cell death and thereby treating disorders associated with neuronal damage such as, for example, glaucoma, neuropathy, spontaneous nerve activity and neuritis.
- CGRP receptor antagonists to reduce levels of LDL, thereby treating diseases resulting from high LDL levels.
- a method of reducing spontaneous activity of nerves in a patient, in need thereof comprises administering to the patient an effective amount of CGRP receptor antagonist including a pharmaceutically acceptable salt thereof.
- the CGRP receptor antagonist is a peptide comprising a structure of Formula I:
- X 1 is a modified N- terminal fragment (i.e., region) of calcitonin gene-related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the residue at the C-terminal end of the region is Cys, and wherein the residue immediately preceding the C-terminal Cys residue of the region is a non-threonine substitution of the threonine (Thr) residue of position 6 of human CGRP, Y 1 is a central core region wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix, and Z 1 is a modified C-terminal fragment (i.e., region) of calcitonin gene-related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal fragment is
- the CGRP receptor antagonist is a peptide comprising a sequence set forth in one of SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala- Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn- Val-Gly-Ser-Lys-Ala-Phe-NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr-Ala-Ser-Cys-Val- Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly- Ser-Lys-Ala-Phe-NH2), SEQ ID NO: 3 (NH2-Ala-Cys-As
- the CGRP receptor antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the CGRP receptor antagonist is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally, via inhalation, intramuscularly, sublingually or orally.
- the effective amount comprises an amount of about 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 90 ⁇ g, 100 ⁇ g, 200 ⁇ g, 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 5 mg, 10 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- the administering is performed at least once daily, once a week, twice a week or three times a week, or four times a week.
- the spontaneous nerve activity is due to a nerve injury or neurodegenerative disease.
- the nerve injury is from a physical injury, diabetes, cancer, diabetic neuropathy, head injury, seizures, infection, or ingestion of a pharmaceutical or drug, such as a chemotherapeutic.
- the neurodegenerative disease is amyotrophic lateral sclerosis, multiple sclerosis, Creutzfeld- Jakob disease, epilepsy, Parkinson's, Alzheimer's, glaucoma, cerebrovascular ischemia, motor neuron disease, dementia, diabetic neuropathy or
- the patient has been identified or selected to receive a drug for neurodegenerative diseases, neurovascular disorder or disease such as cancer.
- the drug is associated with spontaneous nerve activity and/or nerve damage.
- the nerve injury is from a pharmaceutical or drug
- the pharmaceutical or drug is a heart medication (i.e. almitrine), an anti-cancer drug, antibiotic (i.e. chlorampheticol, Cipro), anti-fungal, immunosuppressant drug (i.e.
- Cyclosporine muscle relaxant (i.e. Hydrazaline), anti-seizure medications (i.e. Phenytoin), anti-viral, anti-HIV drug, anti-inflammatory, centrally-acting muscle relaxant, nootropica agent, apoptosis inhibitor, growth factor agonist, smooth muscle relaxantium, chloroquine, isoniazid, metronidazole, nitrofurantoin, thalidomide, etanercept, infliximab, leflunomide, dapsone, phenytoin, disulfiram, didanosine, stavudine, Kenalog-40, triamcinolone, Clinacort or antiparasitic.
- the method further comprises introducing, providing or administering to said patient the drug before, during or after administering the CGRP receptor antagonist.
- the CGRP receptor antagonist is used in combination with the drug.
- the method further comprises monitoring or measuring a level of nerve activity function in said patient before, during or after administration of the effective amount of CGRP receptor antagonist.
- the nerves are C-Nociceptors or Group C nerve fibers.
- the method further comprises reducing pain associated with spontaneous nerve activity in a patient in need thereof, by administration of a CGRP antagonist.
- the CGRP receptor antagonist is administered within a pharmaceutically acceptable formulation.
- a method of providing neuroprotection in a patient in need thereof comprises administering to the patient an effective amount of CGRP receptor antagonist including a pharmaceutically acceptable salt thereof.
- the CGRP receptor antagonist is a peptide comprising a structure of Formula I:
- X 1 is a modified N-terminal fragment (i.e. region) of calcitonin gene-related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the C-terminal residue of the fragment is Cys, and wherein the residue immediately preceding the C-terminal Cys residue of the region is a non-threonine substitution of a threonine (Thr) residue
- Y 1 is a central core wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix
- Z 1 is a modified C-terminal fragment (i.e.
- calcitonin gene-related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal fragment is phenylalanine (Phe), tyrosine (Tyr), proline (Pro) or hydroxyproline (Hyp).
- the CGRP receptor antagonist comprises a sequence set forth in one of SEQ ID NO: 1 (NH2-Ala-Cys- Asp-Thr-Ala-Ala-Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr- Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr- Ala-Ser-Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg- Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2), SEQ ID NO: 3 (NH2-Ala-Cys-Asp-Thr-A
- the CGRP antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the CGRP receptor antagonist is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally, via inhalation, intramuscularly, sublingually or orally.
- the effective amount comprises an amount of about 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 90 ⁇ g, 100 ⁇ g, 200 ⁇ g, 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 5 mg, 10 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- the administering is performed at least once daily, once a week, twice a week or three times a week, or four times a week.
- the patient is suffering from a nerve injury, neurodegenerative disease or a disease such as cancer.
- the nerve injury is from a physical injury, diabetes, cancer, diabetic neuropathy, head injury, seizures, infection, or ingestion of a pharmaceutical or a drug, such as a chemotherapeutic.
- the neurodegenerative disease is amyotrophic lateral sclerosis, multiple sclerosis, Creutzfeld- Jakob disease, epilepsy, Parkinson's, Alzheimer's, glaucoma, cerebrovascular ischemia, motor neuron disease, dementia, diabetic neuropathy, Huntington's disease, seizures or head injury.
- the patient has been identified or selected to receive neuroprotection treatment.
- the method further comprises monitoring or measuring a level of nerve activity function in said patient before, during or after administration of the effective amount of CGRP receptor antagonist.
- the patient has been identified or selected to receive a drug.
- the drug is associated with side effects related to neuronal dysfunction.
- the drug associated with neuronal dysfunction is a heart medication (i.e. almitrine), an anti-cancer drug, antibiotic (i.e. chlorampheticol, Cipro), antifungal, immunosuppressant drug (i.e. Cyclosporine), muscle relaxant (i.e. Hydrazaline), antiseizure medications (i.e.
- Phenytoin anti-viral, anti-HIV drug, anti-inflammatory, centrally- acting muscle relaxant, nootropica agent, apoptosis inhibitor, growth factor agonist, smooth muscle relaxantium, chloroquine, isoniazid, metronidazole, nitrofurantoin, thalidomide, etanercept, infliximab, leflunomide, dapsone, phenytoin, disulfiram, didanosine, stavudine, Kenalog-40, triamcinolone, Clinacort or antiparasitic.
- the CGRP receptor antagonist is administered within a pharmaceutically acceptable formulation.
- the method further comprises introducing, providing or administering to said patient the drug before, during or after administering the CGRP receptor antagonist.
- the CGRP receptor antagonist is used in combination with the drug.
- a method of treating neuritis in a patient in need thereof comprises administering to the patient an effective amount of CGRP receptor antagonist or pharmaceutically acceptable salt thereof.
- the CGRP receptor antagonist is a peptide or pharmaceutically acceptable salt thereof comprising a structure of Formula I:
- X 1 is a modified N-terminal fragment (i.e. region) of calcitonin gene-related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the amino acid residue at the C-terminal end of the fragment (region) is Cys, and wherein the residue immediately preceding the C- terminal Cys residue is a non-threonine substitution of the threonine (Thr) residue found at position 6 of human CGRP, Y 1 is a central core region wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix, and Z 1 is a modified C-terminal fragment (i.e.
- calcitonin gene-related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal fragment is phenylalanine (Phe), tyrosine (Tyr), proline (Pro) or hydroxyproline (Hyp).
- the CGRP receptor antagonist is a peptide comprising a sequence set forth in one of SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr- Ala-Ala-Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg- Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr-Ala-Ser- Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn- Val-Gly-Ser-Lys-Ala-Phe-NH2), SEQ ID NO: 3 (NH2-Ala-Cys-Asp-
- the CGRP antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the CGRP receptor antagonist is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally, via inhalation, intramuscularly, sublingually or orally.
- the effective amount comprises an amount of about 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 90 ⁇ g, 100 ⁇ g, 200 ⁇ g, 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 5 mg, 10 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- the administering is performed at least once daily, once a week, twice a week or three times a week, or four times a week.
- the method further comprises monitoring or measuring a level of nerve activity function in said patient before, during or after administration of the effective amount of CGRP receptor antagonist.
- the patient has been identified or selected to receive a drug.
- the drug can cause neuronal dysfunction.
- the neuritis is from a physical injury, vascular injury, toxin, aging, a genetic disorder, infection (viral or bacterial), diphtheria, herpes zoster (shingles), leprosy, Lyme disease, chemical injury such as chemotherapy, radiation therapy, alcoholism, autoimmune disease, multiple sclerosis, Guillain-Barre syndrome, beriberi (vitamin Bl deficiency), cancer, Celiac disease, diabetes (Diabetic neuropathy), hypothyroidism, porphyria, vitamin B12 deficiency, vitamin B6 excess, brachial neuritis, cranial neuritis, Bell's palsy, optic neuritis or vestibular neuritis.
- a physical injury vascular injury, toxin, aging, a genetic disorder, infection (viral or bacterial), diphtheria, herpes zoster (shingles), leprosy, Lyme disease, chemical injury such as chemotherapy, radiation therapy, alcoholism, autoimmune disease, multiple sclerosis, Gu
- the CGRP receptor antagonist is administered within a pharmaceutically acceptable formulation.
- the drug causing neuronal dysfunction is a heart medication (i.e. almitrine), an anti-cancer drug, antibiotic (i.e. chlorampheticol, Cipro), anti-fungal, immunosuppressant drug (i.e. Cyclosporine), muscle relaxant (i.e. Hydrazaline), anti-seizure medications (i.e.
- Phenytoin anti -viral, anti-HIV drug, anti-inflammatory, centrally-acting muscle relaxant, nootropica agent, apoptosis inhibitor, growth factor agonist, smooth muscle relaxantium, chloroquine, isoniazid, metronidazole, nitrofurantoin, thalidomide, etanercept, infliximab, leflunomide, dapsone, phenytoin, disulfiram, didanosine, stavudine, Kenalog-40, triamcinolone, Clinacort or antiparasitic.
- the method further comprises introducing, providing or administering to said patient the drug before, during or after administering the CGRP receptor antagonist.
- a method of treating glaucoma in a patient comprises administering to the patient an effective amount of CGRP receptor antagonist or pharmaceutically acceptable salt thereof.
- the CGRP receptor antagonist is a peptide or pharmaceutically acceptable salt thereof comprising a structure of Formula I:
- X is a modified N-terminal fragment (i.e., region) of calcitonin gene-related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the residue at the C-terminal end of the fragment is Cys, and wherein the residue immediately preceding the C-terminal Cys residue of the region is a non-threonine substitution of the threonine (Thr) residue of position 6 of human CGRP, Y 1 is a central core region wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix and Z 1 is a modified C-terminal fragment (i.e.
- calcitonin gene- related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal region is phenylalanine (Phe), tyrosine (Tyr), proline (Pro) or hydroxyproline (Hyp).
- the CGRP receptor antagonist is a peptide comprising a sequence set forth in one of SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala- Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn- Val-Gly-Ser-Lys-Ala-Phe-NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr-Ala-Ser-Cys-Val- Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly- Ser-Lys-Ala-Phe-NH2), SEQ ID NO: 3 (NH2-Ala-Cys-As
- the CGRP antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the CGRP receptor antagonist is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally via inhalation, intramuscularly, sublingually or orally.
- the effective amount comprises an amount of about 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 90 ⁇ g, 100 ⁇ g, 200 ⁇ ⁇ , 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- the administering is performed at least four times a day, three times a day, two times a day, or once a day.
- the patient has diabetes.
- the patient has been identified or selected to receive a drug for glaucoma.
- the drug can cause nerve or central nervous system damage or neuronal dysfunction (i.e. beta blocker).
- the CGRP receptor antagonist is administered within a pharmaceutically acceptable formulation.
- the method further comprises introducing, providing or administering to said patient the drug before, during or after administering the CGRP receptor antagonist.
- the CGRP receptor antagonist is used in combination with the drug.
- a method of reducing LDL in a patient in need thereof comprises administering to the patient an effective amount of CGRP receptor antagonist or pharmaceutically acceptable salt thereof.
- the CGRP receptor antagonist is a peptide or pharmaceutically acceptable salt thereof comprising a structure of Formula I:
- X is a modified N- terminal fragment (i.e., region) of calcitonin gene-related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the residue at the C-terminal end of the region is Cys, and wherein the residue immediately preceding the C-terminal Cys residue of the region is a non-threonine substitution of the threonine (Thr) residue of position 6 of human GCRP, Y 1 is a central core region wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix and Z 1 is a modified C-terminal fragment (i.e., region) of calcitonin gene-related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal fragment is pheny
- the CGRP receptor antagonist is a peptide comprising a sequence set forth in one of SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala- Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn- Val-Gly-Ser-Lys-Ala-Phe-NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr-Ala-Ser-Cys-Val- Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly- Ser-Lys-Ala-Phe-NH2), SEQ ID NO: 3 (NH2-Ala-Cys-As
- the CGRP antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the patient is suffering from high LDL concentration in the blood.
- the method further comprises monitoring or measuring the level or amount of LDL in said patient before, during, or after administration of the effective amount of CGRP receptor antagonist.
- the patient is a male.
- the patient has familial hypercholesterolemia.
- the CGRP receptor antagonist is administered dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intravenously, buccally, intramuscularly, sublingually or orally.
- the effective amount comprises an amount of about 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 90 ⁇ ⁇ , 100 ⁇ ⁇ , 200 ⁇ ⁇ , 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- the administering is performed at least four times a day, three times a day, two times a day, or once a day.
- a method of protecting a patient from nerve damage or nerve inflammation comprises administering to the patient an effective amount of CGRP receptor antagonist or pharmaceutically acceptable salt thereof.
- the patient suffers from a post ischemic event.
- the CGRP receptor antagonist is a peptide or a pharmaceutically acceptable salt thereof comprising a structure of Formula I:
- X is a modified N- terminal fragment (i.e., region) of calcitonin gene-related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the residue at the C-terminal end of the region is Cys, and wherein the residue immediately preceding the C-terminal Cys residue of the region is a non-threonine substitution of the threonine (Thr) residue of position 6 of human CGRP, Y 1 is a central core region wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix and Z 1 is a modified C-terminal fragment (i.e., region) of calcitonin gene-related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the Zl region is phenylalanine (P
- the CGRP receptor antagonist is a peptide comprising a sequence set forth in one of SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala-Cys-Val-Leu- Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser- Lys-Ala-Phe-NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr-Ala-Ser-Cys-Val-Leu-Gly-Arg- Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala- Phe-NH2), SEQ ID NO: 3 (NH2-Ala-Cys-Asp-Thr
- the CGRP antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the CGRP receptor antagonist is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally, via inhalation, intramuscularly, sublingually or orally.
- the effective amount comprises an amount of about 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 90 ⁇ g, 100 ⁇ g, 200 ⁇ g, 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- the administering is performed at least four times a day, three times a day, two times a day, or once a day.
- an effective amount of calcitonin gene-related peptide (CGRP) receptor antagonist, or a pharmaceutically acceptable salt thereof is provided, for use in reducing spontaneous nerve activity of nerves in a patient in need thereof.
- the CGRP receptor antagonist is a peptide comprising a structure of Formula I:
- XI is a modified N- terminal fragment (i.e., region) of calcitonin gene- related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the residue at the C- terminal end of the region is Cys, and wherein the residue immediately preceding the C- terminal Cys residue of the region is a non-threonine substitution of the threonine (Thr) residue of position 6 of human CGRP;
- Cys cysteine
- Thr threonine
- Yl is a central core region wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix; and
- Zl is a modified C-terminal fragment (i.e., region) of calcitonin gene- related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal fragment is phenylalanine (Phe), tyrosine (Tyr), proline (Pro) or hydroxyproline (Hyp).
- Phe phenylalanine
- Tyr tyrosine
- Pro proline
- Hyp hydroxyproline
- the CGRP receptor antagonist comprises a sequence set forth in one of SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala-Cys-Val-Leu- Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser- Lys-Ala-Phe-NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr-Ala-Ser-Cys-Val-Leu-Gly-Arg- Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala- Phe-NH2), SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala-
- the CGRP receptor antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the CGRP receptor antagonist is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally, via inhalation, intramuscularly, sublingually or orally.
- the CGRP receptor antagonist for use is in a pharmaceutical vehicle formulated for topical, dermal, intradermal, subcutaneous, dermal infusion, subcutaneous infusion, intraocular, buccal, intravenous, nasal, inhalation, intramuscular, sublingual or oral administration.
- the effective amount of calcitonin gene-related (CGRP) comprises an amount of about 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 90 ⁇ g, 100 ⁇ g, 200 ⁇ g, 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 5 mg, 10 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- the calcitonin gene-related peptide (CGRP) receptor antagonist for use, is administered at least once daily, once a week, twice a week, three times a week, or four times a week.
- the spontaneous nerve activity is due to a nerve injury or neurodegenerative disease.
- the nerve injury is from a physical injury, diabetes, cancer, diabetic neuropathy, head injury, seizures, infection, or ingestion of a pharmaceutical or drug, such as a chemotherapeutic.
- the neurodegenerative disease is amyotrophic lateral sclerosis, multiple sclerosis, Creutzfeld- Jakob disease, epilepsy, Parkinson's, Alzheimer's, glaucoma, cerebrovascular ischemia, motor neuron disease, dementia, diabetic neuropathy or Huntington's disease.
- the patient has been identified or selected to receive a drug for neurodegenerative diseases, neurovascular disorder or disease such as cancer.
- the nerve injury is from a pharmaceutical or drug, wherein the pharmaceutical or drug is a heart medication (i.e. almitrine), an anti-cancer drug, antibiotic (i.e. chlorampheticol, Cipro), anti-fungal, immunosuppressant drug (i.e. Cyclosporine), muscle relaxant (i.e. Hydrazaline), anti-seizure medications (i.e.
- a heart medication i.e. almitrine
- antibiotic i.e. chlorampheticol, Cipro
- anti-fungal i.e. chlorampheticol, Cipro
- immunosuppressant drug i.e. Cyclosporine
- muscle relaxant i.e. Hydrazaline
- anti-seizure medications i.e.
- Phenytoin anti-viral, anti-HJV drug, anti-inflammatory, centrally-acting muscle relaxant, nootropica agent, apoptosis inhibitor, growth factor agonist, smooth muscle relaxantium, chloroquine, isoniazid, metronidazole, nitrofurantoin, thalidomide, etanercept, infliximab, leflunomide, dapsone, phenytoin, disulfiram, didanosine, stavudine, Kenalog-40, triamcinolone, Clinacort or antiparasitic.
- the drug is administered to said patient before, during or after administering the CGRP receptor antagonist.
- the CGRP receptor antagonist is used in combination with the drug.
- a level of nerve activity function is monitored or measured in said patient before, during or after administration of the effective amount of CGRP receptor antagonist.
- the nerves are C-Nociceptors or Group C nerve fibers.
- the calcitonin gene-related peptide (CGRP) receptor antagonist reduces pain associated with spontaneous nerve activity in the patient in need thereof.
- the CGRP receptor antagonist is administered within a pharmaceutically acceptable formulation.
- an effective amount of calcitonin gene-related peptide (CGRP) receptor antagonist or pharmaceutically acceptable salt thereof, for use in providing neuroprotection in a patient in need thereof is provided.
- the CGRP receptor antagonist is a peptide comprising a structure of Formula I:
- XI is a modified N-terminal fragment (i.e. region) of calcitonin gene- related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the C-terminal residue of the fragment is Cys, and wherein the residue immediately preceding the C-terminal Cys residue of the region is a non-threonine substitution of a threonine (Thr) residue;
- Cys cysteine
- Thr threonine
- Yl is a central core wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix; and
- Zl is a modified C-terminal fragment (i.e. region) of calcitonin gene- related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal fragment is phenylalanine (Phe), tyrosine (Tyr), proline (Pro) or hydroxyproline (Hyp).
- Phe phenylalanine
- Tyr tyrosine
- Pro proline
- Hyp hydroxyproline
- the CGRP receptor antagonist comprises a sequence set forth in one of SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala-Cys-Val-Leu- Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser- Lys-Ala-Phe-NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr-Ala-Ser-Cys-Val-Leu-Gly-Arg- Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala- Phe-NH2), SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala-
- the CGRP antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the CGRP receptor antagonist is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally, via inhalation, intramuscularly, sublingually or orally.
- the CGRP receptor antagonist is in a pharmaceutical vehicle formulated for topical, dermal, intradermal, subcutaneous, dermal infusion, subcutaneous infusion, intraocular, buccal, intravenous, nasal, inhalation, intramuscular, sublingual or oral administration.
- the effective amount comprises an amount of about 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ ⁇ , 90 ⁇ ⁇ , 100 ⁇ ⁇ , 200 ⁇ ⁇ , 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 5 mg, 10 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- the calcitonin gene-related peptide (CGRP) receptor antagonist for use, is administered at least once daily, once a week, twice a week, three times a week, or four times a week. In some embodiments of the calcitonin gene-related peptide (CGRP) receptor antagonist for use, the patient is suffering from a nerve injury, neurodegenerative disease or a disease such as cancer.
- the nerve injury is from a physical injury, diabetes, cancer, diabetic neuropathy, head injury, seizures, infection, or ingestion of a pharmaceutical or drug, such as a chemotherapeutic.
- a pharmaceutical or drug such as a chemotherapeutic.
- the pharmaceutical or drug is associated with side effects related to neuronal dysfunction.
- the neurodegenerative disease is amyotrophic lateral sclerosis, multiple sclerosis, Creutzfeld-Jakob disease, epilepsy, Parkinson's, Alzheimer's, glaucoma, cerebrovascular ischemia, motor neuron disease, dementia, diabetic neuropathy, Huntington's disease, seizures or head injury.
- the patient has been identified or selected to receive neuroprotection treatment.
- a level of nerve activity function is monitored or measured in said patient before, during or after administration of the effective amount of CGRP receptor antagonist.
- the patient has been identified or selected to receive a drug.
- the drug is associated with side effects related to neuronal dysfunction.
- the drug associated with neuronal dysfunction is a heart medication (i.e.
- almitrine an anti-cancer drug
- antibiotic i.e. chlorampheticol, Cipro
- anti-fungal i.e. chlorampheticol, Cipro
- immunosuppressant drug i.e. Cyclosporine
- muscle relaxant i.e. Hydrazaline
- anti-seizure medications i.e.
- Phenytoin anti -viral, anti-HIV drug, anti-inflammatory, centrally-acting muscle relaxant, nootropica agent, apoptosis inhibitor, growth factor agonist, smooth muscle relaxantium, chloroquine, isoniazid, metronidazole, nitrofurantoin, thalidomide, etanercept, infliximab, leflunomide, dapsone, phenytoin, disulfiram, didanosine, stavudine, Kenalog-40, triamcinolone, Clinacort or antiparasitic.
- the CGRP receptor antagonist is administered within a pharmaceutically acceptable formulation.
- the drug is introduced, provided or administered to said patient before, during or after administering the CGRP receptor antagonist.
- the CGRP receptor antagonist is used in combination with the drug.
- an effective amount of calcitonin gene-related peptide (CGRP) receptor antagonist or pharmaceutically acceptable salt thereof, for use in treating neuritis in a patient in need thereof is provided.
- the CGRP receptor antagonist or pharmaceutically acceptable salt thereof comprises a structure of Formula I:
- XI is a modified N-terminal fragment (i.e. region) of calcitonin gene- related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the amino acid residue at the C-terminal end of the fragment (region) is Cys, and wherein the residue immediately preceding the C-terminal Cys residue is a non-threonine substitution of the threonine (Thr) residue found at position 6 of human CGRP;
- Cys cysteine
- Thr threonine
- Yl is a central core region wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix; and
- Zl is a modified C-terminal fragment (i.e. region) of calcitonin gene- related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal fragment is phenylalanine (Phe), tyrosine (Tyr), proline (Pro) or hydroxyproline (Hyp).
- Phe phenylalanine
- Tyr tyrosine
- Pro proline
- Hyp hydroxyproline
- the CGRP receptor antagonist comprises a sequence set forth in one of SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala-Cys-Val-Leu- Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser- Lys-Ala-Phe-NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr-Ala-Ser-Cys-Val-Leu-Gly-Arg- Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala- Phe-NH2), SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala-
- the CGRP antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the CGRP receptor antagonist is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally, via inhalation, intramuscularly, sublingually or orally.
- the CGRP receptor antagonist is in a pharmaceutical vehicle formulated for topical, dermal, intradermal, subcutaneous, dermal infusion, subcutaneous infusion, intraocular, buccal, intravenous, nasal, inhalation, intramuscular, sublingual or oral administration.
- the effective amount comprises an amount of 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 90 ⁇ ⁇ , 100 ⁇ ⁇ , 200 ⁇ ⁇ , 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 5 mg, 10 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- the calcitonin gene-related peptide (CGRP) receptor antagonist for use, is administered at least once daily, once a week, twice a week, three times a week, or four times a week. In some embodiments of the calcitonin gene-related peptide (CGRP) receptor antagonist for use, a level of nerve activity function is monitored or measured in said patient before, during or after administration of the effective amount of CGRP receptor antagonist. In some embodiments of the calcitonin gene-related peptide (CGRP) receptor antagonist for use, the patient has been identified or selected to receive a drug.
- the drug can cause neuronal dysfunction.
- the drug causing neuronal dysfunction is a heart medication (i.e. almitrine), an anti-cancer drug, antibiotic (i.e. chlorampheticol, Cipro), anti-fungal, immunosuppressant drug (i.e. Cyclosporine), muscle relaxant (i.e. Hydrazaline), anti-seizure medications (i.e.
- Phenytoin anti-viral, anti-HIV drug, anti-inflammatory, centrally-acting muscle relaxant, nootropica agent, apoptosis inhibitor, growth factor agonist, smooth muscle relaxantium, chloroquine, isoniazid, metronidazole, nitrofurantoin, thalidomide, etanercept, infliximab, leflunomide, dapsone, phenytoin, disulfiram, didanosine, stavudine, Kenalog-40, triamcinolone, Clinacort or antiparasitic.
- the neuritis is from a physical injury, vascular injury, toxin aging, a genetic disorder, infection (viral or bacterial), diphtheria, herpes zoster (shingles), leprosy, Lyme disease, chemical injury such as chemotherapy, radiation therapy, alcoholism, autoimmune disease, multiple sclerosis, Guillain-Barre syndrome, beriberi (vitamin Bl deficiency), cancer, Celiac disease, diabetes (Diabetic neuropathy), hypothyroidism, porphyria, vitamin B12 deficiency, vitamin B6 excess, brachial neuritis, cranial neuritis, Bell's palsy, optic neuritis or vestibular neuritis.
- a physical injury vascular injury, toxin aging, a genetic disorder, infection (viral or bacterial), diphtheria, herpes zoster (shingles), leprosy, Lyme disease, chemical injury such as chemotherapy, radiation therapy, alcoholism, autoimmune disease, multiple sclerosis, Guilla
- the CGRP receptor antagonist is administered within a pharmaceutically acceptable formulation.
- the drug is administered before, during or after administering the CGRP receptor antagonist.
- an effective amount of calcitonin gene-related peptide (CGRP) receptor antagonist or pharmaceutically acceptable salt thereof for use in treating glaucoma in a patient provided.
- the CGRP receptor antagonist is a peptide or pharmaceutically acceptable salt thereof comprising a structure of Formula I:
- XI is a modified N- terminal fragment (i.e., region) of calcitonin gene- related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the residue at the C- terminal end of the fragment is Cys, and wherein the residue immediately preceding the C- terminal Cys residue of the region is a non-threonine substitution of the threonine (Thr) residue of position 6 of human CGRP;
- Cys cysteine
- Thr threonine
- Yl is a central core region wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix; and
- Zl is a modified C-terminal fragment (i.e. region) of calcitonin gene- related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal region is phenylalanine (Phe), tyrosine (Tyr), proline (Pro) or hydroxyproline (Hyp).
- Phe phenylalanine
- Tyr tyrosine
- Pro proline
- Hyp hydroxyproline
- the CGRP antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the CGRP receptor antagonist is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally via inhalation, intramuscularly, sublingually or orally.
- the CGRP receptor antagonist is in a pharmaceutical vehicle formulated for topical, dermal, intradermal, subcutaneous, dermal infusion, subcutaneous infusion, intraocular, buccal, intravenous, nasal, inhalation, intramuscular, sublingual or oral administration.
- the effective amount comprises an amount of about 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ ⁇ , 90 ⁇ ⁇ , 100 ⁇ ⁇ , 200 ⁇ ⁇ , 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- the calcitonin gene-related peptide (CGRP) receptor antagonist for use, is administered at least four times a day, three times a day, two times a day, or once a day.
- the patient has diabetes.
- the patient has been identified or selected to receive a drug for glaucoma.
- the drug is associated with nerve or central nervous system damage or neuronal dysfunction.
- the drug is a beta blocker. In some embodiments of the calcitonin gene-related peptide (CGRP) receptor antagonist for use, the CGRP receptor antagonist is administered within a pharmaceutically acceptable formulation. In some embodiments of the calcitonin gene-related peptide (CGRP) receptor antagonist for use, the drug is introduced, provided or administered to said patient before, during or after administering the CGRP receptor antagonist. In some embodiments of the calcitonin gene- related peptide (CGRP) receptor antagonist for use, the CGRP receptor antagonist is used in combination with the drug.
- an effective amount of calcitonin gene-related peptide (CGRP) receptor antagonist or pharmaceutically acceptable salt thereof for use in reducing LDL in a patient in need thereof is provided.
- the CGRP receptor antagonist is a peptide or pharmaceutically acceptable salt thereof comprising a structure of Formula I:
- XI is a modified N- terminal fragment (i.e., region) of calcitonin gene- related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the residue at the C- terminal end of the region is Cys, and wherein the residue immediately preceding the C- terminal Cys residue of the region is a non-threonine substitution of the threonine (Thr) residue of position 6 of human GCRP;
- Cys cysteine
- Thr threonine
- Yl is a central core region wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix; and
- Zl is a modified C-terminal fragment (i.e., region) of calcitonin gene- related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal fragment is phenylalanine (Phe), tyrosine (Tyr), proline (Pro) or hydroxyproline (Hyp).
- Phe phenylalanine
- Tyr tyrosine
- Pro proline
- Hyp hydroxyproline
- the CGRP receptor antagonist comprises a sequence set forth in one of SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala-Cys-Val-Leu- Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser- Lys-Ala-Phe-NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr-Ala-Ser-Cys-Val-Leu-Gly-Arg- Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala- Phe-NH2), SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala-
- the CGRP antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the patient is suffering from high LDL concentration in the blood.
- a level or amount of LDL in said patient is monitored or measured before, during, or after administration of the effective amount of CGRP receptor antagonist.
- the patient is a male. In some embodiments of the calcitonin gene-related peptide (CGRP) receptor antagonist for use, the patient has familial hypercholesterolemia. In some embodiments of the calcitonin gene-related peptide (CGRP) receptor antagonist for use, the CGRP receptor antagonist is in a pharmaceutical vehicle formulated for topical, dermal, intradermal, subcutaneous, dermal infusion, subcutaneous infusion, intraocular, buccal, intravenous, nasal, inhalation, intramuscular, sublingual or oral administration.
- the effective amount comprises an amount of about 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 90 ⁇ g, 100 ⁇ g, 200 ⁇ ⁇ , 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- the calcitonin gene-related peptide (CGRP) receptor antagonist for use, is administered at least four times a day, three times a day, two times a day, or once a day.
- an effective calcitonin gene-related peptide (CGRP) receptor antagonist or a pharmaceutically acceptable salt thereof for use in protecting a patient from nerve damage or nerve inflammation is provided.
- the patient suffers from a post ischemic event.
- the CGRP receptor antagonist is a peptide or a pharmaceutically acceptable salt thereof comprising a structure of Formula I:
- XI is a modified N- terminal fragment (i.e., region) of calcitonin gene- related peptide comprising from five to seven amino acid residues, wherein only two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the residue at the C- terminal end of the region is Cys, and wherein the residue immediately preceding the C- terminal Cys residue of the region is a non-threonine substitution of the threonine (Thr) residue of position 6 of human CGRP;
- Cys cysteine
- Thr threonine
- Yl is a central core region wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix; and
- Zl is a modified C-terminal fragment (i.e., region) of calcitonin gene- related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid of the Zl region is phenylalanine (Phe), tyrosine (Tyr), proline (Pro) or hydroxyproline (Hyp).
- Phe phenylalanine
- Tyr tyrosine
- Pro proline
- Hyp hydroxyproline
- the CGRP receptor antagonist comprises a sequence set forth in one of SEQ ID NO: 1 (NH2-Ala-Cys-Asp-Thr-Ala-Ala-Cys-Val-Leu-Gly-Arg-Leu- Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe- NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr-Ala-Ser-Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln- Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2), SEQ ID NO: 2 (NH2-Ala-Cys-Asp-Thr-Ala-S
- the CGRP antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13.
- the CGRP receptor antagonist is in a pharmaceutical vehicle formulated for topical, dermal, intradermal, subcutaneous, dermal infusion, subcutaneous infusion, intraocular, buccal, intravenous, nasal, inhalation, intramuscular, sublingual or oral administration.
- the calcitonin gene-related peptide (CGRP) receptor antagonist for use, is administered at least four times a day, three times a day, two times a day, or once a day.
- the effective amount comprises an amount of about 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 90 ⁇ g, 100 ⁇ ⁇ , 200 ⁇ ⁇ , 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 500 mg, 600 mg, 700 mg, 800 mg, 900 mg or 1000 mg or any amount in between a range defined by any two aforementioned values.
- Figure 1 shows an example of a spontaneously active C-nociceptor before and after CGRP antagonist (SEQ ID NO: 1; NH 2 - ACDTAACVLGRLSQELHRLQTYPRTNVGSKAF-NH 2 ) administration.
- Top panel individual sweep of the recorded electrical activity in response to stimulation of the receptive field.
- Bottom panel latency raster plot showing the profile of a spontaneous C nociceptor. The arrow indicates moment of administration of the CGRP antagonist compound.
- Figure 2 shows an analysis of the spontaneous activity before and after the CGRP receptor antagonist administration.
- 2 A and 2B Comparison of two measures of spontaneous activity, SLI/lOmin (2B) and TI (%) (2C) obtained 10 min before and 10 min after the CGRP receptor antagonist administration. No significant differences were observed (paired i-test).
- Figure 3 shows an analysis of the spontaneous activity after the CGRP receptor antagonist administration. As shown is a comparison of two measurements of spontaneous activity, SLI/lOmin (3 A) and ⁇ (%) (3B), obtained for each 10 minute bins throughout the 90 min after the drug administration.
- Figure 4 shows the measurement of the number of RGCs (Retinol ganglion cells).
- Figure 5 shows the experimental data for experiments in which the total number of optic nerve axons were accessed.
- Figure 5A control and 5B CGRP receptor antagonist (SEQ ID NO: 1; NH 2 -ACDTAACVLGRLSQELHRLQTYPRTNVGSKAF-NH 2 )) show that the total number of optic nerve axons did not differ significantly between lasered and contralateral control eyes in any of the treatment groups, although the vehicle treatment group showed the highest decrease in the total number of axons amongst all treatment groups and the CGRP antagonist (SEQ ID NO: 1; NH 2 - ACDTAACVLGRLSQELHRLQTYPRTNVGSKAF-NH 2 ) group showed the smallest decrease in the total number of axons (paired sample t-test, P>0.05 in all groups).
- antagonist refers to a biologically active ligand which binds to a complementary biologically active receptor and inhibits the physiological response of the receptor.
- a “CGRP receptor antagonist” and “CGRP antagonist” refers to a ligand that binds to a CGRP receptor and inhibits the physiological response of that receptor.
- agonist refers to a biologically active ligand which binds to its complementary biologically active receptor and activates the latter either to cause a biological response in the receptor or to enhance preexisting biological activity of the receptor.
- pharmaceutically acceptable salt refers to the non-toxic alkali metal, alkaline earth metal, and ammonium salts commonly used in the pharmaceutical industry including the sodium, potassium, lithium, calcium, magnesium, barium, ammonium, and protamine zinc salts, which are prepared by methods well known in the art.
- non-toxic acid addition salts which are generally prepared by reacting the modified calcitonin gene-related peptide antagonists disclosed herein with a suitable organic or inorganic acid.
- Representative salts include the hydrochloride, hydrobromide, sulfate, bisulfate, acetate, oxalate, valerate, oleate, laurate, borate, benzoate, lactate, phosphate, tosylate, citrate, maleate, fumarate, succinate, tartrate, napsylate, and the like.
- the term refers to those salts which retain the biological effectiveness and properties of the free bases and which are not biologically or otherwise undesirable, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like, and organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malic acid, malonic acid, succinic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, menthanesulfonic acid, ethanesulfonic acid, p- toluenesulfonic acid, salicylic acid and the like.
- inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like
- organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, ox
- Percent (%) amino acid sequence identity is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full- length of the sequences being compared.
- a % amino acid sequence identity value is determined by dividing (a) the number of matching identical amino acid residues between the each or all of the polypeptide amino acid sequence of the reference chimeric receptor sequence provided in Table 2 and the comparison amino acid sequence of interest as determined by WU- BLAST-2 by (b) the total number of amino acid residues of the polypeptide of interest.
- the percent sequence identity of amino acids or nucleic acids are determined by computer software.
- spontaneous nerve activity or “spontaneous activity of nerves” refers to the neural oscillation or rhythmic or repetitive neural activity in the nervous system. This oscillation can be generated in many ways by individual neurons or by the interaction between neurons. These neural oscillations can play an important role in neurological disorders such as during seizure activity in epilepsy and in the tremors in patients suffering from Parkinson's disease, for example.
- Epilepsy is a common chronic neurological disorder characterized by seizures.
- a tremor, as described herein, can be an involuntary, somewhat rhythmic muscle contraction and relaxation involving to-and-fro movements of one or more body parts.
- tremors can include tremors of the hands, arms, eyes, face, head, vocal cords, trunk, and legs.
- Spontaneous nerve activity can also occur in C-fibers after partial damage to a nerve.
- a method of reducing spontaneous activity in nerves in a patient following nerve injury comprises administering to the patient an effective amount of CGRP receptor antagonist.
- the CGRP receptor antagonist is a peptide antagonist.
- the peptide antagonist comprises a sequence set forth in any of SEQ ID NOS: 1-15, 57 and 58. As described in an exemplary embodiment herein, the peptide antagonist comprising the sequence set forth in SEQ ID NO: 1 was used in a rat model having pathological spontaneous activity in C-nociceptors and C nerve fibers.
- neurodegenerative disease is any disease of a group of hereditary or sporadic conditions characterized by progressive dysfunction, degeneration and death of specific populations of neurons which are often synaptically interconnected.
- neurodegeneration refers to the progressive loss of structure or function of neurons and can include the death of neurons.
- Neurodegeneration can be caused by neurodegenerative nerve disease, which can affect the body's activities such as balance, movement, talking, breathing, vision and heart function, for example. Examples for causes of neurodegeneration can include but is not limited to genetics, predisposition to medical conditions, alcoholism, tumor stroke, toxins, chemicals and viruses. In some cases the cause is unknown.
- Degenerative nerve diseases, or neurodegenerative diseases can include Alzheimer's disease, Amyotrophic lateral sclerosis, Friedreich's ataxia, Huntington's disease, Lewy body disease, Parkinson's disease, Spinal muscular atrophy, diabetic neuropathy and glaucoma, for example.
- a method for treating, preventing or ameliorating the effects of neurodegeneration is provided.
- the cause of neurodegeneration can be from genetics, predisposition to medical conditions, alcoholism, tumor, stroke, toxins, chemicals and viruses.
- neurovascular disorder or "neuromuscular disease” encompasses many diseases and ailments that can impair the functioning of the muscles, either directly, being pathologies of the voluntary muscle, or indirectly, being pathologies of nerves or neuromuscular junctions.
- neurovascular disorders can include muscular weakness, rigidity, loss of muscular control, myoclonus (twitching, spasming), and myalgia (muscle pains).
- nerve injury can include injury to the peripheral nerves such as laceration, focal contusion, stretch/ traction injury, compression, drug injection injury, drugs, chemotherapeutic, neurovascular disorder, electrical injury, brachial plexus injury, foot drop injury, injury to the peroneal nerve and sciatic nerve, meralgia parasthetic (injury to the lateral femoral cutaneous nerve and femoral nerve, spinal accessory nerve injury (injury to the spinal accessory nerve and cranial nerve) and traumatic nerve injury.
- a method is provided for treating a patient suffering from a nerve injury.
- the nerve injury is from a laceration, focal contusion, stretch/ traction injury, compression, drug injection injury, electrical injury, brachial plexus injury, foot drop injury, injury to the peroneal nerve and sciatic nerve, Meralgia parasthetic (injury to the lateral femoral cutaneous nerve and femoral nerve or spinal accessory nerve injury (injury to the spinal accessory nerve and cranial nerve). Nerve injury can also lead to neurodegeneration.
- Treatments for nerve injury and neurodegenerative diseases can include but is not limited to a cell cycle inhibitor, a neuroprotectant, a nootropic agent, anticonvulsant agent, anxiolytic drug, antipsychotic drug, an analgesic, vasoprotectant, anti-amyloidogenic, immunomodulatory, anti-inflammatory, anti-parkinsonian, immunosuppressant, vasodilatory agent, immunostimulant, vasoprotectant, metabolic modulator, antihypertensive, centrally-acting muscle relaxant, nootropica agent, apoptosis inhibitor, growth factor agonist, smooth muscle relaxantium, neurotrophic agent, metabolic activator, ionotropic glutamate receptor antagonist, antihypertensive agent, antihypercholesterolemic agent, anti-amyloidogenic agent, anxiolytic; imaging agent; BDZ agonist, Class IV antiarrhythmic agent, TRH agonist and a cardioprotectant.
- Drugs for neuritis can include but is not limited to
- neuroprotection refers to the preservation of neuronal structure and/or function. During a neurodegenerative insult the relative preservation of neuronal integrity implies a reduction in the rate of neuronal loss over time. As such developing methods to prevent further damage to the nerves have been explored. For example, increased levels of oxidative stress can be caused in part by neuroinflammation which can further lead to more damage by oxidative stress. Without being limiting, antioxidants such as acetylcysteine, cocin, fish oil, and resveratrol have been tested to investigate their role in neuroprotection. In some embodiments described herein, a method of providing neuroprotection in a patient in need thereof is provided. The method comprises administering to the patient an effective amount of CGRP receptor antagonist.
- Some pharmaceuticals can affect the cells of the nervous system by neurotoxicity or by neuropathy.
- Chemotherapy drugs can affect or damage the central nervous system, the peripheral nervous system and part of the peripheral nervous system called the cranial nerves.
- a method of treating a patient suffering from nerve damage is provided.
- nerve damage is caused by pharmaceuticals such as chemotherapeutics.
- the chemotherapeutics comprises cis-platinum chemotherapy or 5-Fluorouracil (5-FU) chemotherapy.
- Cis-platinum chemotherapy can include, but is not limited to the use of cisplatin, cisplatinum, platamin, neoplatin, cismaplat or cis-diamminedichloridoplatinum(III).
- the use of these types of chemotherapeutics can cause neurotoxicity, including but not limited to visual perception and hearing disorders.
- C-Nociceptors are sensory nerve cells that respond to damaging or potentially damaging stimuli by sending signals to the spinal cord and brain. This process is called nociception, and can cause the perception of pain in sentient beings.
- Nociceptors are sensory neurons that are found in any area of the body that can sense noxious stimuli either externally or internally. Without being limiting, they can be found in tissues such as skin (cutaneous nociceptors), cornea and mucosa, for example.
- Internal nociceptors are in a variety of organs, such as the muscle, joint, bladder, gut and continuing along the digestive tract. The cell bodies of these neurons are located in either the dorsal root ganglia or the trigeminal ganglia.
- the trigeminal ganglia are specialized nerves for the face, whereas the dorsal root ganglia associate with the rest of the body.
- a method of treating a nerve injury comprises administering to the patient an effective amount of CGRP receptor antagonist.
- the nerve injury is at a C-nociceptor or in group C nerve fibers.
- Group C nerve fibers are one of three classes of nerve fibers in the central nervous system and peripheral nervous system.
- the C group fibers are unmyelinated and have a small diameter and low conduction velocity. They include Postganglionic fibers in the autonomic nervous system (ANS), and nerve fibers at the dorsal roots (IV fiber). These fibers carry sensory information. Damage or injury to these nerve fibers causes neuropathic pain.
- EMNG electromyoneurography
- EMNG electromyoneurography
- a method of treating a nerve injury in a patient wherein the patient is administered an effective amount of a CGRP antagonist peptide.
- the method further comprises monitoring or measuring a level of nerve activity function in said patient before, during or after administration of the effective amount of CGRP receptor antagonist.
- the monitoring is performed by electromyoneurography.
- nerve conduction velocity test is a test commonly used to evaluate the function, and the ability of the electrical conduction of the motor and sensory nerves of the human body.
- Nerve conduction velocity (NCV) is a common measurement made during this test.
- a nerve conduction velocity test measures how quickly electrical impulses move along a nerve.
- a method of treating a nerve injury in a patient is provided, wherein the patient is administered an effective amount of a CGRP antagonist peptide.
- the method further comprises monitoring or measuring a level of nerve activity function in said patient before, during or after administration of the effective amount of CGRP receptor antagonist.
- the monitoring is performed by nerve conduction velocity test.
- Diabetes is a group of metabolic diseases in which there are high blood sugar levels over a prolonged period.
- Diabetic neuropathy as described herein refers to a type of nerve damage that can occur when one has diabetes. High blood sugar can injure nerve fibers throughout the patient's body, but diabetic neuropathies can often damages nerves in the legs and feet, for example.
- a method of treating a patient suffering from neuropathy is provided, wherein the patient is administered an effective amount of a CGRP antagonist.
- the neuropathy is diabetic neuropathy.
- Diabetic neuropathy is a common serious complication of diabetes. Yet one can often prevent diabetic neuropathy or slow its progress with tight blood sugar control and a healthy lifestyle. Depending on the affected nerves, symptoms of diabetic neuropathy can range from pain and numbness in the patient's extremities to problems with the patient's digestive system, urinary tract, blood vessels and heart. For some people, these symptoms are mild; for others, diabetic neuropathy can be painful, disabling and even fatal. In some cases, medication is required to control the pain stemming from diabetic neuropathy.
- glaucoma is a group of eye diseases which result in damage to the optic nerve and vision loss.
- the risk factors for glaucoma include but are not limited to increased pressure in the eye, a family history of the condition, migraines, high blood pressure, diabetes and obesity.
- a value equal to or greater than 21 mmHg or 2.8 kPa is often used with higher pressures leading to a greater risk.
- Treatment for glaucoma can include but is not limited to beta-blockers, carbonic anhydrase inhibitors, hyperosmotics, cholinergics, adrenergic agonists and prostaglandin analogs.
- some patients can have high eye pressure for years and never develop damage.
- optic nerve damage may occur with normal pressure, known as normal-tension glaucoma.
- a method of providing neuroprotection to the optic nerve comprises administering to the patient an effective amount of CGRP receptor antagonist.
- the patient is suffering from glaucoma.
- the patient is suffering from diabetes.
- Open-angle glaucoma is the most common form of glaucoma and accounts for at least 90% of all glaucoma cases. Open-angle glaucoma is caused by the slow clogging of the drainage canals, resulting in increased eye pressure, has a wide and open angle between the iris and cornea, develops slowly and is a lifelong condition having symptoms and damage that are not noticed.
- the term "open-angle" means that the angle where the iris meets the cornea has a wide and open angle between the iris and the cornea. It is the most common type of glaucoma, and affects about three million Americans.
- Angle closure glaucoma is a less common form of glaucoma and is caused by blocked drainage canals, resulting in a sudden rise in intraocular pressure.
- angle closure glaucoma the iris is not as wide and open as it should be and has a closed or narrow angle between the iris and cornea. This type of glaucoma develops very quickly, has very noticeable symptoms and damage and demands immediate medical attention.
- open-angle and angle-closure glaucoma can include secondary glaucoma, pigmentary glaucoma, pseudoexfoliative glaucoma, traumatic glaucoma, nuerovascular glaucoma, iridocorneal endothelial syndrome (ICE) and Uveitic glaucoma. Vision loss from any type of glaucoma, once it has occurred is permanent.
- FH familial hypercholesterolemia
- LDL low-density lipoprotein
- a method of lowering levels of LDL in a patient suffering from FH comprises administering to the patient an effective amount of CGRP receptor antagonist.
- the patient has been identified or selected to receive a drug or therapy for controlling LDL levels.
- the therapy is administration for controlling LDL levels comprises statins, selective cholesterol absorption inhibitors, resins, bile acid sequestrant, bile acid-binding drugs or lipid lowering therapies.
- the method further comprises monitoring or measuring the level or amount of LDL in said patient before, during, or after administration of the effective amount of CGRP receptor antagonist.
- the patient is already receiving therapy for lowering LDL levels.
- the effective amount of CGRP receptor antagonist is administered with a drug for lowering LDL levels.
- the patient is a male.
- Heterozygous FH is normally treated with statins, bile acid sequestrants, or other lipid lowering agents that lower cholesterol levels. Homozygous FH often does not respond to pharmaceutical therapy and may require other treatments, including LDL apheresis (removal of LDL in a method similar to dialysis) and occasionally liver transplantation.
- LDL apheresis removal of LDL in a method similar to dialysis
- liver transplantation The American Heart Association categorizes the risk of heart disease based on LDL levels. Less that lOOmg/dL is considered to be optimal and up to about 129 mg/dL is considered to be near optimal. Borderline high LDL ranges from about 130 mg/dL to 159 mg/dL and about 160 to about 189 mg/dL is considered high. Any amount above 190 mg/dL is catagorized as very high. As many people with FH have levels of LDL at borderline LDL ranges or higher, new methods are
- Subject or "Patient” as described herein, can refer to any organism upon which the embodiments may be used or administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes.
- subjects can include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.).
- animals e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.
- a patient can also be any subject that is registered or identified for receiving the methods of treatment as described herein.
- Combination therapy refers to a situation in which two or more different pharmaceutical agents are administered in overlapping regimens so that the subject is simultaneously exposed to the two or more different pharmaceutical agents.
- “Therapeutically effective amount,” as described herein, can refer to an amount of a therapeutic agent whose administration, when viewed in a relevant population, correlates with or is reasonably expected to correlate with achievement of a particular therapeutic effect, including for example, amelioration of disease or disorder or delay of progression of disease or disorder.
- the therapeutic effect may be objective (i.e., measurable by some test or marker) or subjective (i.e., subject gives an indication of or feels an effect).
- a therapeutically effective amount is commonly administered in a dosing regimen that may comprise multiple unit doses.
- a therapeutically effective amount and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, or combination with other pharmaceutical agents.
- the specific therapeutically effective amount (and/or unit dose) for any particular patient may depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific pharmaceutical agent employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and/or rate of excretion or metabolism of the specific fusion protein employed; the duration of the treatment; and like factors as is well known in the medical arts.
- prophylactically effective amount refers to an amount that can prevent, delay or reduce the severity of a particular disease or disorder in a patient a risk.
- Herpesvirus belongs to the herpesvirus family, Herpesviridae that infect humans. Without being limiting, symptoms can include watery blisters in the skin or mucous membranes. Lesions heal with a scab characteristic of herpetic disease. Sometimes, the viruses cause very mild or atypical symptoms during outbreaks. However, as neurotropic and neuroinvasive viruses, HSV-1 and -2 persist in the body by becoming latent and hiding from the immune system in the cell bodies of neurons. Herpesviruses can invade the nerves and nervous system. Shingles is due to a reactivation of varicella zoster virus (VZV), a herpesvirus, within a person's body.
- VZV varicella zoster virus
- Chickenpox is due to an initial infection with VZV. Once chickenpox has resolved, the virus may remain inactive in nerve cells. People suffering from outbreaks of shingles may develop ongoing nerve pain which may last for months or years, a condition called postherpetic neuralgia.
- a patient suffering from a herpesvirus is administered a CGRP antagonist.
- Ischemic event refers to inadequate blood supply to an organ or part of the body, and can include the heart muscles, for example. Reduction of circulation can lead to sensitive nerve tissue and muscle tissues.
- antagonists of the calcitonin gene-related peptide (CGRP) receptor can be used to control specific biological responses.
- the peptide antagonists of the CGRP receptor are useful in the treatment of neuritis, glaucoma and other neurodegenerative diseases and useful to provide neuroprotection and/or control of high LDL.
- the methods comprise administration of a peptide CGRP receptor antagonist, also referred to herein, variously, as a
- the peptide CGRP receptor antagonist can have the structure of Formula I: wherein:
- X 1 is an N-terminal fragment (i.e., region) of a modified calcitonin gene- related peptide comprising at least five to seven amino acid residues, where two amino acid residues of the N-terminal fragment are cysteine (Cys), wherein the final residue (i.e. the C-terminal end residue) is Cys, and wherein the residue immediately preceding the final Cys residue is a non-threonine substitution of a threonine (Thr) residue;
- Cys cysteine
- Thr threonine
- Y 1 is a central core region comprising 15 to more than 24, 15 to 24, 15 to 22, 18-22, or 19-20 residues where at least some of the residues of the central core are capable of forming an a-helix under physiological conditions, wherein at least one amino acid of the central core is arginine (Arg) or lysine (Lys) and the central core comprises an a-helix; and
- Z 1 is a modified C-terminal fragment (i.e., region) of modified calcitonin gene- related peptide comprising from five to seven amino acid residues with a C-terminal amide, where at least one amino acid residue of the C-terminal fragment is phenylalanine (Phe) tyrosine (Tyr), proline (Pro) or hydroxyproline (Hyp);
- the CGRP antagonist for administration comprises an amino acid sequence having at least 60%, at least 70% or at least 80% sequence identity to the amino acid sequence of SEQ ID NOS: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 57 or 58 wherein said peptide retains antagonist activity.
- the CGRP antagonist for administration comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NOS: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 57 or 58 wherein said peptide retains antagonist activity.
- the X 1 region of Formula I has the characteristics that a residue which precedes the C-terminal cysteine by four, five or six amino acid positions is also a cysteine, such that the two aforementioned cysteines can form a disulfide bond. Residues between the two Cys residues involved in the disulfide bond are unconstrained in sequence except that the residue preceding the C-terminal Cys residue of the fragment must not be a Thr, as mentioned above, and that there may not be more than two cysteines in the C-terminal 7 residues of the X 1 fragment.
- the aforementioned disulfide bond stabilizes the structure of X 1 , facilitating both formation of the alpha-helix in Y 1 , below, and binding of X 1 to the transmembrane component of a CGRP receptor in competition with CGRP.
- a CGRP peptide antagonist is administrated.
- the antagonist as disclosed herein comprises a central core Y 1 comprising 15 to 22 residues.
- the antagonist as disclosed herein comprises a central core Y 1 comprising more than 24, 15 to 24, 15 to 22, 18- 22, or 19-20 residues where at least some of the residues of the central core are capable of forming an a-helix under physiological conditions.
- the fourth residue from the N-terminus of this central core is frequently a positively charged residue, either Arginine (Arg) or Lysine (Lys).
- the eighteenth residue is frequently Arginine.
- the length of the central core is constrained not by the number of residues per se but by the steric considerations that require X 1 and Z 1 to be positioned so that they may interact with a target receptor at the cell membrane surface and at an extracellular domain, respectively, in competition with CGRP.
- Z 1 is a modified C-terminal fragment (i.e., region) of a modified calcitonin gene-related peptide comprising from five to seven amino acid residues or more, with a C- terminal amide, and wherein at least one amino acid of the Z 1 region is phenylalanine (Phe), proline (Pro), tyrosine (Tyr), or hydroxyproline (Hyp).
- Phe phenylalanine
- Pro proline
- Tyr tyrosine
- Hyp hydroxyproline
- Z 1 is constrained not by its sequence but by a functional requirement.
- Z 1 that requirement is that it interact with a target receptor at a site in its extracellular domain such that when the antagonist binds the CGRP receptor, in competition with CGRP, X 1 is positioned to interact with the receptor at the cell surface and Z 1 interacts with a RAMP portion of the receptor.
- the CGRP peptide antagonist for administration comprises an amino acid sequence having at least 60%, at least 70% or at least 80% sequence identity to the amino acid sequence of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14,15, 57 or 58, wherein said peptide retains antagonist activity.
- the CGRP peptide antagonist for administration comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14,15, 57 or 58, wherein said peptide retains antagonist activity.
- the CGRP peptide antagonist for administration comprises a core region of 18-22 residues.
- the CGRP peptide antagonist for administration comprises the structure of Formula I, wherein the N-terminal fragment (X 1 ) comprises: [0116] X n -X 12 -X 13 -X 14 -X 15 -X 16 -X 17 (SEQ ID NO: 16), where:
- X 11 can be selected from the group consisting of alanine (Ala), cysteine (Cys), glycine (Gly), isoleucine (He), leucine (Leu), methionine (Met), phenylalanine (Phe), proline (Pro), tryptophan (Trp), and valine (Val);
- X 12 can be selected from the group consisting of cysteine (Cys), serine (Ser), and tyrosine (Tyr);
- X 13 can be selected from the group consisting of arginine (Arg), asparagine (Asn), aspartic acid (Asp), cysteine (Cys), glutamic acid (Glu), glutamine (Gin), histidine (His), lysine (Lys), serine (Ser), threonine (Thr), tyrosine (Tyr), and valine (Val);
- X 14 can be selected from the group consisting of arginine (Arg), asparagine (Asn), aspartic acid (Asp), glutamic acid (Glu), glutamine (Gin), histidine (His), leucine (Leu), lysine (Lys), phenylalanine (Phe), serine (Ser), threonine (Thr), tyrosine (Tyr), and valine (Val);
- X 15 can be selected from the group consisting of alanine (Ala), glycine (Gly), isoleucine (He), leucine (Leu), methionine (Met), phenylalanine (Phe), serine (Ser), tryptophan (Typ), and valine (Val);
- X 16 can be selected from the group consisting of alanine (Ala), glycine (Gly), isoleucine (He), leucine (Leu), methionine (Met), phenylalanine (Phe), serine (Ser), tryptophan (Typ), and valine (Val); and
- X 17 is cysteine (Cys), and is capable of forming a disulfide bridge with a cysteine residue in X 11 , X 12 , or X 13 ;
- the CGRP peptide antagonist in the methods of treatment comprises the structure of Formula I
- X 11 is selected from the group consisting of Ala, Cys, and Gly.
- the CGRP peptide antagonist comprising the structure of Formula I, X 12 is selected from the group consisting of Cys and Ser, with the caveat that only one of X 11 and X 12 can be Cys.
- the CGRP peptide antagonist comprising the structure of Formula I, X is selected from the group consisting of Arg, Asn, Asp, and Val.
- the CGRP peptide antagonist comprising the structure of Formula I, X 14 is selected from the group consisting of Leu, Phe, and Thr.
- the CGRP peptide antagonist comprising the structure of Formula I, X 15 is selected from the group consisting of Ala, Gly, and Ser.
- the CGRP peptide antagonist comprising the structure of Formula I, X 15 is selected from the group consisting of Ala, He, Leu, Ser, and Val.
- the CGRP peptide antagonist for administration comprises the structure of Formula I, X -X -X -X -X -X -X -
- X is selected from the group consisting of NH 2 -Ala-Cys-Asp-Thr-Ala-Ala-Cys (SEQ ID NO: 17), NH 2 -Ala-Cys-Asp-Thr-Ala-Ser-Cys (SEQ ID NO: 18), NH 2 -Ala-Cys-Asp-Thr-Ala- Val-Cys (SEQ ID NO: 19), NH 2 -Ala-Cys-Asn-Thr-Ala-Ala-Cys (SEQ ID NO: 20), NH 2 -Ala- Cys-Val-Leu-Gly-Ala-Cys (SEQ ID NO: 21), NH 2 -Ala-Cys-Arg-Phe-Gly-Ala-Cys (SEQ ID NO: 22), NH 2 -Ala-Cys-Asp-Leu-Ser-Ala-Cys (SEQ ID NO: 23), NH
- one or more additional residues are fused N-terminally to X 11 , thereby generating a polypeptide with an N-terminal extension of residues with respect to X 1 .
- this extension affects the stability of the antagonist after administration.
- the CGRP peptide antagonist for administration comprises the structure of Formula I, wherein the central core region (Y 1 ) comprises a central core fragment of human or salmon calcitonin.
- the fragment of human or salmon calcitonin comprises 18 to 21 amino acids.
- the fragment of human or salmon calcitonin comprises 18 to 20 amino acids.
- the CGRP peptide antagonist for administration comprises the structure of Formula I, Y 1 comprises 19 to 20 amino acids.
- the CGRP peptide antagonist comprising the structure of Formula I, Y 1 is -Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln- Thr-Tyr-Pro-Arg-Thr-Asn- (SEQ ID NO: 34) or -Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu- His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn- (SEQ ID NO: 35).
- the CGRP peptide antagonist for administration comprises the structure of Formula I, Y 1 has 95% sequence identity with -Val-Leu-Gly-Arg-Leu-Ser-Gln- Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn- (SEQ ID NO: 34) or -Val-Leu-Gly- Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn- (SEQ ID NO: 35).
- the CGRP peptide antagonist for administration comprises the structure of Formula I
- the central core comprises a fragment of a calcitonin from any of a range of species.
- Y 1 can have a 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% sequence identity with the Y 1 of SEQ ID NO: 34 (Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu- His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-).
- Y 1 can be - Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn- (SEQ ID NO: 35) or -Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg- Thr-Asp- (SEQ ID NO: 36) or - Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln- Thr-Phe-Pro-Arg-Thr-Asn- (SEQ ID NO: 37) or -Val-Leu-Gly-Lys-Leu-Ser
- Some embodiments of the instant method of treatment provide Y 1 polypeptides that have at least about 60% amino acid sequence identity, alternatively at least about 61% amino acid sequence identity, alternatively at least about 62% amino acid sequence identity, alternatively at least about 63% amino acid sequence identity, alternatively at least about 64% amino acid sequence identity, alternatively at least about 65% amino acid sequence identity, alternatively at least about 66% amino acid sequence identity, alternatively at least about 67% amino acid sequence identity, alternatively at least about 68% amino acid sequence identity, alternatively at least about 69% amino acid sequence identity, alternatively at least about 70% amino acid sequence identity, alternatively at least about 71% amino acid sequence identity, alternatively at least about 72% amino acid sequence identity, alternatively at least about 73% amino acid sequence identity, alternatively at least about 74% amino acid sequence identity, alternatively at least about 75% amino acid sequence identity, alternatively at least about 76% amino acid sequence identity, alternatively at least about 77% amino acid sequence identity, alternatively at least about 78% amino acid sequence identity, alternatively at least about 79% amino acid sequence identity
- the CGRP peptide antagonist for administration comprises the structure of Formula I, wherein Z 1 comprises Z n -Z 12 -Z 13 -Z 14 -Z 15 -Z 16 (SEQ ID NO: 45) where:
- Z 11 is selected from the group consisting of Ala, Gly, He, Leu, Met, Phe, Pro, Trp, and Val;
- Z 12 is selected from the group consisting of Ala, Gly, He, Leu, Met, Phe, Pro, Trp, and Val;
- Z is selected from the group consisting of serine (Ser), and tyrosine
- Z 14 is selected from the group consisting of Arg, Asn, Asp, Glu, Gin, His, Lys, Ser, Thr, and Tyr;
- Z 15 is selected from the group consisting of Ala, Gly, He, Leu, Met, Phe, Pro, Trp, and Val;
- Z 16 is selected from the group consisting of Ala, Gly, He, Leu, Met, Phe,
- Z is Val. In some embodiments, Z is Gly. In some embodiments, Z 13 is Ser. In some embodiments, Z 14 is Lys. In some embodiments, Z 15 is Ala. In some embodiments, Z 16 is Phe.
- Z n -Z 12 -Z 13 -Z 14 -Z 15 -Z 16 is - Val-Gly-Ser-Lys-Ala-Phe such that the C-terminus of the polypeptide is a carboxy moiety (SEQ ID NO: 46), or -Val-Gly-Ser-Lys-Ala-Phe-NH 2 , such that the C-terminus of the polypeptide is a carboxamide moiety (SEQ ID NO: 47).
- the C-terminal residue of Z 1 is Phenylalanine, Tyrosine, Proline or Hydroxyproline. In some embodiments the C- terminal residue of Z 1 is Phenylalanine.
- Z 1 comprises at least one Phe residue.
- the CGRP peptide antagonist for administration comprises the structure of Formula I, X 1 is selected from the group consisting of NH 2 -Ala-Cys-Asp-Thr-Ala-Ala-Cys- (SEQ ID NO: 17), NH 2 -Ala-Cys- Asp-Thr-Ala-Ser-Cys- (SEQ ID NO: 18), NH 2 -Ala-Cys-Asp-Thr-Ala-Val-Cys- (SEQ ID NO: 19), NH 2 -Ala-Cys-Asn-Thr-Ala-Ala-Cys- (SEQ ID NO: 20), NH 2 -Ala-Cys-Val-Leu- Gly-Ala-Cys
- the CGRP peptide antagonist for administration comprises the structure of Formula I, the antagonist comprises from 28 to 35 amino acid residues, from 31 to 37 amino acid residues, from 31 to 33 amino acid residues or 32 amino acid residues.
- the CGRP peptide antagonist for administration comprises the structure of Formula I, the antagonist comprises - Ala-Cys-Asp-Thr-Ala-X 16 -Cys- (SEQ ID NO: 49), wherein X 16 is any amino acid residue other than Thr.
- the CGRP peptide antagonist for administration comprises the structure of Formula I, the antagonist comprises a first peptide fragment/region having seven amino acid residues or less, wherein said first peptide fragment has a sequence from modified calcitonin gene-related peptide.
- the CGRP peptide antagonist comprising the structure of Formula I, the antagonist comprises a second peptide fragment having seven amino acid residues or less, wherein said first and second peptide fragments are non- contiguous and each independently have a sequence which may be modified from calcitonin gene-related peptide.
- the CGRP peptide antagonist comprising the structure of Formula I the antagonist comprises a third peptide fragment having 20 amino acid residues or less, wherein said third peptide fragment has a sequence from salmon calcitonin.
- the CGRP peptide antagonist comprising the structure of Formula I, the second peptide fragment and the third peptide fragment are contiguous.
- the CGRP peptide antagonist for administration comprises a structure of NH 2 -Ala-Cys-Asp-Thr-Ala-Ala-Cys- Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val- Gly-Ser-Lys-Ala-Phe-NH 2 (SEQ ID NO: 1), or a pharmaceutical acceptable salt thereof.
- the antagonist has a structure of NH 2 -Ala-Cys-Asp-Thr-Ala-Ser-Cys- Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val- Gly-Ser-Lys-Ala-Phe-NH 2 (SEQ ID NO: 2), or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of NH 2 -Ala-Cys-Asp-Thr-Ala-Val-Cys-Val-Leu-Gly- Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys- Ala-Phe-NH 2 (SEQ ID NO: 3), or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of NH 2 -Ala-Cys-Asn-Thr-Ala-Ala-Cys-Val-Leu-Gly-Arg-Leu-Ser- Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH 2 (SEQ ID NO: 4), or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of NH 2 -Ala-Cys-Val-Leu-Gly-Ala-Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg- Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH 2 (SEQ ID NO: 5), or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of NH 2 -Ala-Cys-Arg- Phe-Gly-Ala-Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro- Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH 2 (SEQ ID NO: 6), or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of NH 2 -Ala-Cys-Asn-Leu-Ser-Ala-Cys- Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val- Gly-Ser-Lys-Ala-Phe-NH 2 (SEQ ID NO: 7), or a pharmaceutical acceptable salt thereof.
- the antagonist has a structure of NH 2 -Cys-Ser-Asn-Thr-Ala-Ala-Cys- Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val- Gly-Ser-Lys-Ala-Phe-NH 2 (SEQ ID NO: 8), or a pharmaceutical acceptable salt thereof.
- the antagonist has a structure of NH 2 -Ala-Cys-Asp-Thr-Ala-Leu-Cys- Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val- Gly-Ser-Lys-Ala-Phe-NH 2 (SEQ ID NO: 9), or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of NH 2 -Ala-Cys-Asp-Thr-Ala-Ile-Cys-Val-Leu-Gly- Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys- Ala-Phe-NH 2 (SEQ ID NO: 10), or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of NH 2 -Ala-Cys-Asn-Leu-Ser-Val-Cys-Val-Leu-Gly-Arg-Leu-Ser- Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH 2 (SEQ ID NO: 11), or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of NH 2 -Cys-Ser-Asn-Thr-Ala-Val-Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg- Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH 2 (SEQ ID NO: 12), or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of or NF ⁇ -Ala-Cys- Asn-Leu-Ser-Ala-Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr- Pro-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH 2 (SEQ ID NO: 13), or a pharmaceutical acceptable salt thereof.
- the antagonist has a structure of Ala-Cys-Val- Leu-Gly-Ala-Cys-Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro- Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH 2 (SEQ ID NO: 14), or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of Ala-Cys-Asp-Thr-Ala-Ala-Cys-Val- Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val- Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH 2 (SEQ ID NO: 15), or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of NH2-Ala-Cys-Asp-Leu-Ser-Ala-Cys- Val-Leu-Gly-Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val- Gly-Ser-Lys-Ala-Phe-NH2 (SEQ ID NO: 57) or a pharmaceutical acceptable salt thereof.
- the CGRP peptide antagonist for administration comprises a structure of NH2-Ala-Cys-Asp-Leu-Ser-Val-Cys-Val-Leu-Gly- Arg-Leu-Ser-Gln-Glu-Leu-His-Arg-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Val-Gly-Ser-Lys- Ala-Phe-NH2 (SEQ ID NO: 58), or a pharmaceutically acceptable salt thereof.
- the CGRP peptide antagonist of the present disclosure can also be administered within a pharmaceutical composition comprising one of the compounds above.
- the pharmaceutical composition can be used in a method of any one of the embodiments provided herein, the method comprising administering to an individual an effective amount of a CGRP peptide antagonist.
- the CGRP peptide antagonist for administration comprises the structure of Formula I, wherein Y 1 includes - Ala- Glu-Ala-Ala-Ala-Lys-Glu-Ala-Ala-Ala-Lys-Glu-Ala-Ala-Lys-Ala- (SEQ ID NO: 50), - Ala-Lys-Ala-Ala-Ala-Glu-Lys-Ala-Ala-Glu-Lys-Ala-Ala-Ala-Glu-Ala- (SEQ ID NO:
- the CGRP antagonist comprises a sequence selected from the group consisting of the sequences set forth in SEQ ID NO: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12 and 13.
- the CGRP peptide antagonist for administration comprises an amino acid sequence having at least 60% sequence identity to the amino acid sequence of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 57 or 58, wherein said peptide retains antagonist activity.
- the CGRP peptide antagonist for administration comprises an amino acid sequence having at least 70% sequence identity to the amino acid sequence of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 57 or 58, wherein said peptide retains antagonist activity. In some embodiments of the methods of treatment, the CGRP peptide antagonist for administration comprises an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 57 or 58, wherein said peptide retains antagonist activity.
- the amino acid sequence can have at least 90% sequence identity to the amino acid sequence of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 57 or 58, wherein said peptide retains antagonist activity. In some embodiments, the amino acid sequence can have at least 95% sequence identity to the amino acid sequence of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 57 or 58, wherein said peptide retains antagonist activity. In some embodiments, the amino acid sequence can have at least 97% sequence identity to the amino acid sequence of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 57 or 58, wherein said peptide retains antagonist activity.
- the CGRP peptide antagonist can be administered to a patient susceptible to or otherwise at risk of a particular neurodegenerative disease and that is sufficient to prevent, delay or lessen the severity of such disease.
- a patient susceptible to or otherwise at risk of a particular neurodegenerative disease and that is sufficient to prevent, delay or lessen the severity of such disease.
- Such an amount is defined to be a "prophylactically effective amount" or
- the antagonist can be administered to a patient in need of neuroprotection.
- a patient in need of neuroprotection has suffered from an assault likely to cause nerve damage such as, for example, an ischemic event, a nerve injury from a drug or a disease, or intraocular pressure affecting the optic nerve.
- Neurodegenerative diseases such as Parkinson's disease, progressive supranuclear palsy, corticobasal degeneration and multisystem atrophy.
- the CGRP antagonists can be administered, in a therapeutically effective amount, to a patient suffering from spontaneous nerve activity resulting, for example, in pain or discomfort and/or contributing to progressive nerve damage.
- spontaneous nerve activity may be the result of acute of chronic stimulation or chronic dysfunction of nerves, especially the C-nociceptors.
- the patient in need of reduction of spontaneous nerve activity is suffering from a Herpesvirus.
- the patient in need of reduction of spontaneous nerve activity is suffering from shingles.
- the CGRP peptide antagonists can be administered to a patient suffering from high LDL levels in a therapeutically effective amount, that is an amount sufficient to reduce said LDL levels.
- a therapeutically effective amount that is an amount sufficient to reduce said LDL levels.
- the precise amounts to be administered depend, for example, on the patient's state of health and weight, and can be readily determined by one of ordinary skill in the art.
- the dosage ranges for the administration of an antagonist for the instant methods described herein, are those sufficient to produce a therapeutic effect.
- the CGRP receptor peptide antagonists are provided in a pharmaceutical composition
- a pharmaceutical composition comprising the CGRP receptor peptide antagonist and inactive ingredients such as a pharmaceutical carrier or diluent.
- the peptide antagonist containing a pharmaceutical composition can be administered by any means, as known to those of skill in the art, and include, without limitation, oral, pulmonary, parenteral (intramuscular, intraperitoneal, intravenous, or subcutaneous injection), inhalational (via a fine powder formulation, or aerosol), transdermal, intranasal, intraocular, buccal or sublingual routes of administration and can be formulated in dosage forms appropriate for each route of administration.
- the peptide antagonist containing pharmaceutical composition is administered is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally, intraocularly, via inhalation, intramuscularly, sublingually or orally.
- the peptide antagonist containing pharmaceutical composition is administered is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally, intraocularly, via inhalation, intramuscularly, sublingually or orally.
- the daily dosage regimen for an adult human patient may be, for example, an intraocular, intravenous, intraperitoneal, subcutaneous, or intramuscular dose of the antagonist at an exemplary range of between 0.001 mg and 100 mg, or an exemplary range of between 0.005 mg and 5 mg.
- Those of skill in the art will appreciate that dosing for topical, transdermal, oral, pulmonary (via inhalation), intransal, buccal, sublingual, or related non-parenteral routes of administration may be higher for parenteral administration.
- Dosing in this case may be, for example, may be greater than 100 mg, for example, may be 200 mg, 300 mg, 400 mg, 600 mg, 500 mg, 1000 mg, or any amount in between any two of the aforementioned amounts.
- the CGRP antagonist may be formulated with one or more ingredients that facilitate administration and/or uptake of the CGRP peptide. In cases of administration of a pharmaceutically acceptable salt, dosages may be calculated as the free base.
- the composition is administered at least once daily, once a week, twice a week or three times a week, or four times a week. In some embodiments of the method of treatment described herein, the composition is administered 1, 2, 3 or 4 times per day or as a single acute dose.
- the CGRP antagonist may be administered as a slow release formulation, for example, via depot injection or via infusion pump.
- the CGRP antagonist may be formulated to allow for once-monthly dosing or for use in slow release micro pump devices that allow for once yearly dosing (ex. an implanted osmotic pump device for delivery)
- Suitable routes of administration for the instant methods of administration are likewise known to those of skill in the art and may include, for example and without limitation, oral, ocularly, transmucosal or topical; parenteral delivery, including intramuscular, subcutaneous, intravenous, intramedullary injections, intrathecal, intraperitoneal, intranasal, or intraocular injections, as well as needle-free subcutaneous delivery.
- the antagonist can be part of any embodiments of the compositions as described herein and may be administered by continuous intravenous infusion, preferably at a dose of each active ingredient up to 1000 mg per day.
- Subjects suffering from chronic nerve pain can benefit from a continuous intravenous infusion or a controlled injection, for example from an infusion pump.
- the dose of the active ingredient is 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 90 ⁇ g, 100 ⁇ g, 200 ⁇ g, 300 ⁇ ⁇ , 400 ⁇ ⁇ , 500 ⁇ ⁇ , 600 ⁇ ⁇ , 700 ⁇ ⁇ , 800 ⁇ ⁇ , 900 ⁇ ⁇ , 1 mg, 5 mg, 10 mg, 40 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg, 50 mg, 100 mg, 200 mg, 300 mg, 400 mg or 500 mg 1000 mg or 2000 mg or any amount in between any two aforementioned values.
- the aforementioned dosage is administered in a single dose.
- the peptides will be administered for a period of continuous therapy, for example for a week or more, or for months or years.
- the dose range of the composition administered to the patient can be from about 0.000001 to about 10 mg/kg of the patient's body weight. In some embodiments of the methods described herein, the dose range of the composition administered to the patient can be from 0.000001, 0.000010, 0.00010, 0.0010, 0.010, 0.10, 1, 5 or 10 mg/kg of the patient's body weight, or any amount in between any two aforementioned values.
- the dosage may be a single one or a series of two or more given in the course of one or more days, as is needed by the patient.
- the present embodiments will use those same dosages, or dosages that are between about 0.1% and 500%, more preferably between about 25% and 250% of the established human dosage.
- the dosage is 0.1%, 1%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 200%, 300%, 400% or 500% of the established human dosage or any amount in between any two aforementioned values.
- a suitable human dosage can be inferred from ED 50 or ID 50 values, or other appropriate values derived from in vitro or in vivo studies, as qualified by toxicity studies and efficacy studies in animals.
- peptide antagonists in any of the methods provided herein will be apparent to the skilled practitioner based on data from initial dose-response curves and other data that can be obtained by routine methods. In cases of administration of a pharmaceutically acceptable salt, dosages may be calculated as the free base.
- the peptide antagonist of any of the methods provided herein is administered 1 time, 2 times, 3 times or up to 4 times per day or as a single acute dose.
- the peptides will be administered for a period of continuous therapy, for example for a week or more, or for months or years. Depending on the severity of a disease, such as chronic nerve pain experienced by a patient, administering is performed at least once daily, once a week, twice a week or three times a week.
- the compounds are administered in sustained or controlled release dosage forms, including without limitation, depot injections, osmotic pumps, transdermal (including electrotransport) patches, and the like, for prolonged and/or timed, pulsed administration at a predetermined rate
- a patient is suffering from chronic nerve pain or a post ischemic event. Ischemic injury can occur due to interruption of circulation and may result in nerve damage.
- a patient suffering from chronic nerve pain or a post ischemic event can be administered the antagonist by continuous intravenous infusion.
- the antagonist is administered by an external infusion pump to allow a patient to self-deliver a controlled amount of antagonist as needed.
- Any of the well-known techniques, carriers, and excipients may be used as suitable and as understood in the art; e.g., in Remington's Pharmaceutical Sciences, above.
- Dosage amount and interval may be adjusted individually to provide plasma levels of the active moiety which are sufficient to maintain the modulating effects, or minimal effective concentration (MEC).
- MEC minimal effective concentration
- the MEC will vary for each compound but can be estimated from in vitro data. Dosages necessary to achieve the MEC will depend on individual characteristics and route of administration. However, HPLC assays or bioassays can be used to determine plasma concentrations.
- a method of reducing spontaneous activity in nerves following nerve injury in a patient in need comprising administering to the patient an effective amount of CGRP receptor antagonist.
- the CGRP receptor antagonist can have the structure of Formula I as described in the embodiments above.
- CGRP peptide antagonist for administration are described above.
- the CGRP peptide antagonist can be delivered alone or as a pharmaceutically acceptable salt thereof.
- the CGRP peptide antagonist comprises a sequence selected from the sequences set forth in SEQ ID NOS: 1-15, 57 or 58.
- the CGRP receptor antagonist of Formula I (X l Y l Z l ) is administered topically, dermally, intradermally, subcutaneously, via dermal infusion, via subcutaneous infusion, intraocularly, buccally, intravenously, nasally, intraocularly, via inhalation, intramuscularly, sublingually or orally.
- the administering is performed daily, once a week, twice a week, or three times a week.
- the administering is performed four times a day, three times a day, twice a day or once a day.
- the nerve injury is from a drug, such as a chemotherapeutic.
- the nerve injury is from a neurovascular disorder or neurodegenerative disease.
- the drug causing a nerve injury is a heart medication (i.e. almitrine), an anti-cancer drug, antibiotic (i.e. chlorampheticol, Cipro), anti-fungal, immunosuppressant drug (i.e. Cyclosporine), muscle relaxant (i.e. Hydrazaline), anti-seizure medications (i.e.
- Phenytoin anti -viral, anti-HIV drug, anti-inflammatory, centrally-acting muscle relaxant, nootropica agent, apoptosis inhibitor, growth factor agonist, smooth muscle relaxantium, chloroquine, isoniazid, metronidazole, nitrofurantoin, thalidomide, etanercept, infliximab, leflunomide, dapsone, phenytoin, disulfiram, didanosine, stavudine, Kenalog-40, triamcinolone, Clinacort or antiparasitic.
- the nerves are C-Nociceptors or Group C nerve fibers.
- nerve injury is from a virus.
- the patient is suffering from a herpesvirus.
- the patient is suffering from shingles.
- the CGRP receptor antagonist is administered within a pharmaceutically acceptable formulation.
- the CGRP peptide antagonist comprises a sequence set forth in SEQ ID NO's: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15.
- the CGRP peptide antagonist comprises a sequence set forth in SEQ ID NO: 1.
- the patient has been identified or selected to receive a drug for neurodegenerative diseases or a virus.
- a method of providing neuroprotection in a patient in need thereof is provided.
- Neuroprotection refers to the preservation of neuronal structure and function. During a neurodegenerative insult, the relative preservation of neuronal integrity implies a reduction in the rate of neuronal loss over time.
- Neuroprotection is a widely explored treatment option for central nervous system (CNS) disorders. These CNS disorders can include but are not limited to neurodegenerative diseases, stroke, traumatic brain injury, spinal cord injury, and acute management of neurotoxin consumption (i.e. methamphetamine overdoses). Neuroprotection can be used to prevent or slow disease progression and secondary injuries by halting or at least slowing the loss of neurons.
- CGRP receptor antagonists likewise can be neuroprotective.
- a patient in need of neuroprotection has suffered from a neurodegenerative disease such as glaucoma, or suffered from an acute event such as stroke or spinal cord injury.
- a neurodegenerative disease such as glaucoma
- an acute event such as stroke or spinal cord injury.
- a method of providing neuroprotection in a patient in need thereof comprises administering to the patient an effective amount of CGRP receptor antagonist.
- the CGRP receptor antagonist can be a peptide antagonist having the structure of Formula I, as described in the embodiments above.
- CGRP peptide antagonist for administration are described above.
- the CGRP peptide antagonist can be delivered alone or as a pharmaceutically acceptable salt thereof.
- the CGRP peptide antagonist comprises a sequence set forth in one of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 57 or 58. In some embodiments, the CGRP peptide antagonist comprises a sequence set forth in one of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or 13.
- the CGRP receptor antagonist is administered parenterally, ocularly, intraocularly, buccally, sublingually, orally, topically, dermally, intradermally, subcutaneously, via dermal infusion, or via subcutaneous infusion.
- the administering is performed daily, once a week, twice a week or three times a week.
- the administering is performed four times a day, three times a day, twice a day, or once a day.
- the CGRP receptor antagonist is formulated to allow for once a month or continuous administration. .
- the method further comprises monitoring or measuring a level of nerve activity function in said patient before, during or after administration of the effective amount of CGRP receptor antagonist.
- the patient is suffering from glaucoma, diabetes, Parkinson's disease, Alzheimer's disease, multiple sclerosis, diabetic neuropathy, cerebrovascular ischemia, motor neuron disease, dementia, seizures, head injury or nerve damage.
- the CGRP peptide antagonist comprises a sequence set forth in SEQ ID NO's: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
- the CGRP peptide antagonist comprises a sequence set forth in one of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or 13.
- Neuritis is a general term for the inflammation of a nerve or inflammation of the peripheral nervous system.
- the causes for neuritis can include but are not limited to physical injury, vascular injury, toxin aging, a genetic disorder, infection (viral or bacterial), diphtheria, herpes zoster (shingles), leprosy, Lyme disease, chemical injury such as chemotherapy, radiation therapy, alcoholism, autoimmune disease, multiple sclerosis, Guillain-Barre syndrome, beriberi (vitamin Bl deficiency), cancer, Celiac disease, diabetes (Diabetic neuropathy), hypothyroidism, porphyria, vitamin B12 deficiency and vitamin B6 excess.
- Types of neuritis can include but are not limited to brachial neuritis, cranial neuritis such as Bell's palsy, optic neuritis, and vestibular neuritis.
- a method of treating neuritis comprises administering to the patient an effective amount of CGRP receptor antagonist or pharmaceutical salt thereof, as previously described.
- the CGRP peptide antagonist can have the structure of Formula I, as described above.
- the CGRP antagonist can comprise an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 15, 57 or 58 wherein said peptide retains antagonist activity in these methods.
- CGRP peptide antagonist for administration are previously described above.
- the CGRP peptide antagonist can be delivered alone or as a pharmaceutically acceptable salt thereof as described above.
- the CGRP receptor antagonist is administered as previously described above.
- the method further comprises monitoring or measuring a level of nerve activity function in said patient before, during or after administration of the effective amount of CGRP receptor antagonist.
- the neuritis is from a physical injury, vascular injury, toxin aging, a genetic disorder, infection (viral or bacterial), diphtheria, herpes zoster (shingles), leprosy, Lyme disease, chemical injury such as chemotherapy, radiation therapy, alcoholism, autoimmune disease, multiple sclerosis, Guillain-Barre syndrome, beriberi (vitamin Bl deficiency), cancer, Celiac disease, diabetes (Diabetic neuropathy), hypothyroidism, porphyria, vitamin B12 deficiency and vitamin B6 excess.
- Types of neuritis can include but is not limited to brachial neuritis, cranial neuritis such as Bell's palsy, optic neuritis or vestibular neuritis.
- the CGRP antagonist comprises a sequence set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 57 or 58.
- a method of treating glaucoma in a patient is provided.
- the method comprises administering to the patient in need an effective amount of CGRP receptor antagonist, as described above.
- the CGRP peptide antagonist can have the structure of Formula I, as described above.
- the patient has diabetes. In some embodiments, the patient has been identified or selected to receive a drug for glaucoma.
- the drug is a beta blocker, a prostaglandin, or an alpha-adrenergic agonist.
- the CGRP receptor antagonist is administered in addition to or in combination with another drug such as a beta blocker, prostaglandin or a-adrenergic agonist.
- the CGRP antagonist comprises a sequence set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 57 or 58.
- the CGRP peptide antagonist is administered within a pharmaceutically acceptable formulation.
- LDL Low-density lipoprotein
- VLDL very low- density lipoprotein
- IDL intermediate-density lipoprotein
- LDL particles can pose as a risk for cardiovascular disease when they invade the endothelium and become oxidized, since the oxidized forms are more easily retained by the proteoglycans.
- LDL particles are strongly associated with increasing rates of accumulation of atherosclerosis within the walls of arteries over time, eventually resulting in sudden plaque ruptures and triggering clots within the artery opening, or a narrowing or closing of the opening, i.e. cardiovascular disease, stroke, and other vascular disease complications.
- Familial hypercholesterolemia is a diagnosis of individuals with very significantly elevated low-density lipoprotein (LDL) cholesterol.
- FH is characterized by very high levels of LDL-C, as well as of total cholesterol.
- the condition greatly increases the risk of hardening of the arteries (atherosclerosis), which can lead to heart attacks, strokes and other vascular conditions.
- Individuals with FH have a 20-fold increased risk for coronary heart disease (CHD). Untreated men have a 50% risk of a nonfatal or fatal coronary event by age 50 years; untreated women have a 30% risk by age 60 years.
- CHD coronary heart disease
- Borderline high LDL ranges from about 130 mg/dL to 159 mg/dL and about 160 to about 189 mg/dL is considered high. Any amount above 190 mg/dL is catagorized as very high.
- the patient has an LDL level of 130 mg/dL, 140 mg/dL, 150 mg/dL, 160 mg/dL, 170 mg dL, 180 mg/dL, 190 mg/dL, 200 mg/dL, or any concentration in between any aforementioned values.
- PCSK9 is responsible for only a small percentage of FH cases.
- the normal PCSK9 gene codes for an enzyme that breaks down the cholesterol receptors after they have done their job.
- a mutation in this gene is unlike most mutations, which cause dysfunction of the affected gene.
- the PCSK9 mutation increases the gene's function, leading to too few remaining LDL receptors and thus an increase in the LDL cholesterol level.
- PCSK9 is responsible for only a small percentage of both FH cases and for high LDL levels, there is need to provide other therapeutics to those suffering from high LDL levels.
- a method of reducing LDL in a patient in need thereof comprises administering to the patient in need an effective amount of CGRP receptor antagonist, as described above.
- the CGRP peptide antagonist can have the structure of Formula I, as described above. [0190] Dosages and routes of administration for the CGRP peptide antagonist are described above.
- the patient is suffering from high LDL concentration in the blood.
- the patient has been identified or selected to receive a drug or therapy for controlling LDL levels.
- the method further comprises monitoring or measuring the level or amount of LDL in said patient before, during, or after administration of the effective amount of CGRP receptor antagonist.
- the therapy is administration for controlling LDL levels comprises statins, selective cholesterol absorption inhibitors, resins, bile acid sequestrant, bile acid-binding drugs or lipid lowering therapies.
- the patient is already receiving therapy for lowering LDL levels.
- the patient is a male.
- the patient has familial hypercholesterolemia.
- the CGRP antagonist is a peptide comprising a sequence set forth in SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 57 or 58.
- the CGRP peptide antagonist for administration is within a pharmaceutically acceptable formulation.
- the patient has an LDL level over 200 mg/dL. In some embodiments, the patient has an LDL level of 200 mg/dL, 220 mg/dL, 240 mg/dL, 260 mg/dL, 280 mg/dL or 300 mg/dL or any concentration in between any two aforementioned values. In some embodiments, the patient has an LDL level over 300 mg/dL.
- Embodiment 1 is a diagrammatic representation of Embodiment 1:
- Dawley rats Spontaneous activity in injured C-nociceptors was then detected with microneurography and the response to CGRP receptor antagonist was assessed under unblind conditions.
- This study aimed to assess the effect of the CGRP receptor antagonist, on electrophysiological measures of spontaneous activity in subpopulations of injured C- nociceptors in a model of neuropathic pain, and to investigate the effects of the CGRP receptor antagonist on pathological spontaneous activity in peripheral C-nociceptors.
- the experiment aimed to assess the effect of CGRP receptor antagonists, such as the antagonist set forth in SEQ ID NO: 1, on electrophysiological measures of spontaneous activity in subpopulations of injured C- nociceptors in a model of neuropathic pain.
- CGRP receptor antagonists such as the antagonist set forth in SEQ ID NO: 1
- Rats were housed in groups of three per cage. Cage cleaning was performed at least twice per week. Animals had rat food and tap water ad libitum. Animals were maintained under a standard light cycle (7:00 a.m. - 7:00 p.m.), in a temperature and humidity controlled environment. Experimental model of crush-induced sciatic neuropathy
- the animals received an analgesic subcutaneous (s.c). dose of buprenorphine and were maintained in a warm environment until full recovery from the anesthetic, and were allowed to recover from the nerve injury for a minimum of 70 days.
- s.c an analgesic subcutaneous
- CGRP receptor antagonist SEQ ID NO: 1
- saline solution aqueous saline solution
- volumes of the intraperitoneal (i.p.) injected bolus ranged from 0.48 to 0.58 ml.
- the neural signals were first amplified with an isolated, high input impedance amplifier, band-pass filtered (maximum range 50-5000 Hz) and passed through a noise eliminator. The signal was then fed to an AM10 audio-monitor with noise clipper (Grass Technologies, Warwick, RI, USA) and to computers running separate software for collecting spontaneous and electrically evoked activity. Electrical stimuli were delivered to the cutaneous receptive field of the units by means of a constant current stimulator (DS7A, Digitimer, Welwyn Garden City, Hertfordshire, UK).
- Trigger pulses were delivered to the stimulator at different frequencies necessary to induce ADS of conduction velocity of the recorded C-fibers.
- the digitized responses were stored on computer as raw data for off-line analysis.
- Digital filtering bandpass 0.3-2 kHz
- clamping of the baseline were performed both on-line and during offline analysis for a better visualization of action potentials.
- Action potentials recorded in the sciatic nerve were displayed as a raster plot of latencies.
- latency raster plots each peak that exceeds a specified level is represented by a dot on a plot with latency as the ordinate and elapsed time as the abscissa.
- the dots could represent action potentials or noise.
- the raster plots presented herein display only selected units with adequate signal-to-noise, and each dot represents an identified single unit.
- An action potential propagated in an unmyelinated axon causes long- lasting (up to a few minutes) activity-dependent slowing (ADS) of conduction velocity.
- ADS activity-dependent slowing
- the ADS of the recorded C-fibers was assessed using a modified protocol described by (Serra et ah, 1999; incorporated by reference in its entirety herein). This consists of a sequence of 5 steps: 1) 3 min baseline stimulation at 0.25 Hz; 2) 3 min pause (OHz); 3) 3 min at 0.25 Hz; 4) 3 min 2 Hz train; and 5) return to 0.25 Hz baseline until the latencies return to their original values.
- This stimulation method allows differentiation of profiles of ADS of conduction velocity in individual C-fibers that correspond to specific functional types of peripheral nerve fibers:
- Type 1 slow progressively (average latency increase of 28.3% at 2Hz) and correspond to nociceptors. Nociceptors were subdivided into:
- Type 1A essentially unaffected by the stimulation pause, correspond to the mechano- sensitive nociceptor.
- Type IB nociceptors show an appreciable reduction in latency at the end of the pause and correspond to the mechano-insensitive nociceptor.
- Type 2 fibers slow to reach a plateau within 1 min of stimulation at 2Hz (average latency increase 5.2%) and are specific cold receptors.
- Type 3 essentially unaffected by the stimulation at 2 Hz (slowing > 3%); their function remains unclear (a recent report suggested that they probably represent the population of low-threshold mechano-sensitive C-fibers).
- Type 4 fibers slow to reach a plateau, partially recover conduction velocity during the 2 Hz period, and correspond to efferent sympathetic fibers.
- Conduction velocity was estimated by dividing the conduction distance by the baseline latency at the stimulation rate of 0.25 Hz.
- SLI Significant Latency Increase
- Total Increase (TI) ⁇ of % increase of all SLI in a given unit of time. ⁇ was expressed as TI/min, and it represents a direct estimate of the total number of extra spikes that have occurred per unit of time.
- Table 1 Description of the 12 rats used in the investigation of the effects of the CGRP receptor antagonist on pathological spontaneous activity in peripheral C- nociceptors.
- Type 1A Mechano-sensitive C-nociceptor
- Type IB Mechano- insensitive C-nociceptor
- Type 1 undetermined class of C-nociceptor
- Type 2 cold C- thermoreceptor
- Type 3 unknown function
- Type 4 sympathetic efferent.
- FIG. 1 Shown in Figure 1 is a raster plot of a spontaneous C-fiber before and after the CGRP receptor antagonist administration. From the 35 nociceptors analyzed, 14 of them displayed spontaneous activity (33.33% from the total fibers), and all of them were of type IB. This selectivity has recently been described in several neuropathic pain conditions, both in humans and animals. As shown in Figure 1, the action potentials recorded in the sciatic nerve had virtually no excitation observed after introduction of the CGRP receptor antagonist. Thus, CGRP antagonist (SEQ ID NO: 1), led to the surprising effect of preventing further spontaneous activity in the C-fibers. [0226] The immediate effect of the CGRP receptor antagonist is shown in
- peripheral neuropathy commonly induces spontaneous activity in type IB C- nociceptors, which is the substrate of the experience of spontaneous burning and deep aching pain in patients with peripheral neuropathy.
- CGRP peptide antagonist As the CGRP peptide antagonist has only been used for vasodilation studies, the function of CGRP peptide antagonist was investigated for its role in nerve function as CGRP receptors can also be located in neurons.
- Embodiment 2 The use of CGRP antagonist in rat experimental glaucoma model
- ganglion cells of the retina and the optic nerve are the major sites of damage in glaucoma.
- the initial insult can be several possibilities such as a gene mutation, increased intraocular pressure, or oxidative insult, in which all can lead to ganglion cell apoptosis, a natural but usually quiescent pathway that, when activated, leads to cell death.
- a purpose of this study was to investigate neuroprotective properties of CGRP antagonist in a rat experimental glaucoma model.
- the neuroprotective properties of compounds were investigated in a rat laser model of glaucoma. Rats were divided into two groups of six rats each. One group served as a placebo control receiving vehicle (NaCl) injections, and the other was treated with a peptide CGRP receptor antagonist (SEQ ID NO: 1). For all 12 rats, the contralateral, untreated eye served as a naive undiseased control.
- the vehicle control and test compound (20mg/kg) were administered systemically (LP) daily for the whole follow-up period of two weeks. The animals were sacrificed using transcardial perfusion.
- the retinal whole-mounts were then immuno-stained against retinal ganglion cell (RGC) marker Brn3a and astrocytic marker GFAP (glial fibrillary acidic protein).
- RRC retinal ganglion cell
- GFAP glial fibrillary acidic protein
- the number of Brn3a positive profiles was manually counted from retinal images taken from central and peripheral parts of retina.
- the total number of GFAP- immunoreactive cells (retinal astrocytes) was estimated using stereology.
- the total number of RGC axons in the optic nerve was estimated using stereology.
- the rat glaucoma model was induced unilaterally by laser photocoagulation of episcleral veins as previously described (Kalesnykas et al, 2007).
- CGRP antagonist SEQ ID NO: 1
- LP intraperitoneally
- Table 3 The weight of animals at the baseline and at the end of the study. Data are expressed as mean ⁇ SD.
- the total number of optic nerve axons were estimated from l- ⁇ - thick sections using Stereolnvestigator software (MicroBrightfield Inc., Williston, Vermont, USA.
- optic nerves were post-fixed in 4% PFA (in 0.1M phosphate buffer, pH 7.4) solution, they were placed in 1% osmium, dehydrated in ascending alcohol concentration and placed in 1% uranyl acetate in 100% ethanol for 1 hour (Cone et al,
- Plan Achro 4 objective (N.A. 0.1 , W.D. 30). Thereafter, a CFI Plan Fluor ⁇ ⁇ oil immersion objective (N.A. 1.30, W.D. 0.20) was used for axon counting.
- DAPI (1 : 1 ,000, D9542, lot no. 034M4031 V; Sigma, St. Louis Missouri, USA) was used as counterstain.
- Quantitative data was graphed, analyzed and presented as mean ⁇ standard deviation (SD) or standard error of mean (SEM).
- Parametric data was analyzed using paired- samples T-test (the contralateral eye of the same animal serves as control).
- Non-parametric data was analyzed using Mann- Whitney U test (comparison of 2 groups) or Wilcoxon paired- samples T-test. For cell counts, assuming a Gaussian distribution of the data, any data point 2 standard deviations from the columnar mean was excluded. The differences are considered to be statistically significant at the P ⁇ 0.05 level.
- Embodiment 3 Assessment of the Effect of CGRP receptor antagonist administration on the levels of LDL in rats
- Familial hypercholesterolemia is a genetic disorder that is characterized by high cholesterol levels, specifically very high levels of low-density lipoprotein (LDL) in the blood, and early cardiovascular disease. Individuals with FH can have high cholesterol levels that are less responsive to standard methods of treatment used to control cholesterol levels. Without being limiting, these types of treatments include statins, selective cholesterol absorption inhibitors, resins (bile acid sequestrants or bile acid-binding drugs) and lipid-lowering therapies. Nevertheless, treatment (including higher statin doses) and lifestyle changes are the standard of treatment employed for patients with FH.
- statins selective cholesterol absorption inhibitors
- resins bile acid sequestrants or bile acid-binding drugs
- lifestyle changes are the standard of treatment employed for patients with FH.
- test compound advantageously lowered LDL concentrations in blood.
- Sprague Dawley rats were administered the CGRP antagonist daily via the subcutaneous route for a period of 14 days, resulting in the surprising effect of LDL lowering. Fifty six animals (36 males and 20 females) were distributed into four groups
- Rats from the treatment groups were dosed subcutaneously with CGRP receptor antagonists (SEQ ID NO: 1) reconstituted with normal saline at different dose levels per treatment group for 14 days. Control animals were dosed with the vehicle alone. [0261] There was no mortality or morbidity and no clinical signs were observed during the entire study period except for four males from the high dose group that showed lethargy on day 10. Out of these four animals, three animals continued showing lethargy on day 11 th but all animals normalized from day 12.
- the weight variation at the time of dosing was about ⁇ 20% of mean body weight of each sex.
- the age at the time of dosing was about 10-12 weeks.
- the male and female rats were nulliparous and non-pregnant.
- the number of animals was 56 rats (36 male plus 20 females). 4 male rats were used as extras for each group (total 16) for randomization and animal replacement during acclimatization. Thus, the number of animals per group was 9 males and 5 females.
- the acclimatization period was, at a minimum, 7 days.
- animals were selected and grouped based on stratified randomization by using body weights one day before dosing (day 0) using an Excel program.
- the route of administration of the antagonist was by a subcutaneous method.
- the frequency of the administration was daily for fourteen days.
- the dose volume was set at 5 ml/ kg of body weight.
- the duration of the treatment was fourteen days with administration occurring approximately at the same time each day.
- the animals were housed at a temperature of 20.1 to 22.7 °C with a relative humidity of 49 to 59 %. The animals were at a photo period or exposure of 12 hours of light and 12 hours of dark. The room air exchanges were at a minimum of 10-15 air exchanges per hour. For caging, the animals were housed in groups in poly propylene rat cages with paddy husk bedding. The bedding material was changed daily. The animals were identified with cage cards and assigned animal identification numbers. The diet of the rats consisted of Amrut rodent feed and RO water, which was provided ad libitum. Preparation and administration of test item
- CGRP antagonist CGRP antagonist
- Blood samples for were collected from all animals on day 15. The animals were fasted overnight before blood sampling but allowed access to water ad libitum for hematology and biochemistry. Blood samples were drawn from the retro-orbital plexus using a micro-hematocrit heparinized glass capillary tube. Blood samples were centrifuged (3500 rpm) and after centrifugation plasma was separated for further analysis.
- any of the features of an embodiment of the first through twelfth aspects is applicable to all aspects and embodiments identified herein. Moreover, any of the features of an embodiment of the first through twelfth aspects is independently combinable, partly or wholly with other embodiments described herein in any way, e.g., one, two, or three or more embodiments may be combinable in whole or in part. Further, any of the features of an embodiment of the first through twelfth aspects may be made optional to other aspects or embodiments. References
- McLatchie LM Fraser NJ, Main MJ, Wise A, Brown J, Thompson N, Solari R, Lee GM and Foord SM.
- RAMPs regulate the transport and ligand specificity of the calcitonin-receptor-like receptor. Nature 393, 333-339 (28 May 1998).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Neurology (AREA)
- Biomedical Technology (AREA)
- Neurosurgery (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Toxicology (AREA)
- Ophthalmology & Optometry (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Pain & Pain Management (AREA)
- Psychology (AREA)
- Marine Sciences & Fisheries (AREA)
- Diabetes (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Endocrinology (AREA)
- Hospice & Palliative Care (AREA)
- Physical Education & Sports Medicine (AREA)
- Vascular Medicine (AREA)
- Cardiology (AREA)
Abstract
Description
Claims
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP23195196.3A EP4316595A3 (en) | 2016-09-02 | 2017-08-30 | Use of cgrp receptor antagonists in treating glaucoma |
| CA3035561A CA3035561A1 (en) | 2016-09-02 | 2017-08-30 | Use of cgrp receptor antagonists in neuroprotection and neurological disorders |
| AU2017319512A AU2017319512A1 (en) | 2016-09-02 | 2017-08-30 | Use of CGRP receptor antagonists in neuroprotection and neurological disorders |
| ES17769144T ES2965087T3 (en) | 2016-09-02 | 2017-08-30 | Use of CGRP receptor antagonists in the treatment of glaucoma |
| EP17769144.1A EP3506925B1 (en) | 2016-09-02 | 2017-08-30 | Use of cgrp receptor antagonists in treating glaucoma |
| US16/329,596 US11390654B2 (en) | 2016-09-02 | 2017-08-30 | Use of CGRP receptor antagonists in neuroprotection and neurological disorders |
| IL265099A IL265099B2 (en) | 2016-09-02 | 2017-08-30 | Medicinal compositions containing an effective amount of a calcitonin gene-related peptide (CGRP) receptor antagonist, or a pharmaceutically acceptable salt thereof, for the treatment of glaucoma |
| JP2019533291A JP7123932B2 (en) | 2016-09-02 | 2017-08-30 | Use of CGRP Receptor Antagonists in Neuroprotection and Neurological Disorders |
| KR1020197009422A KR102657418B1 (en) | 2016-09-02 | 2017-08-30 | Use of CGRP receptor antagonists in neuroprotection and neurological diseases |
| CN201780067192.XA CN109922820A (en) | 2016-09-02 | 2017-08-30 | Application of CGRP receptor antagonists in neuroprotection and neurological diseases |
| US17/806,834 US12103951B2 (en) | 2016-09-02 | 2022-06-14 | Use of CGRP receptor antagonists in neuroprotection and neurological disorders |
| JP2022105144A JP2022126857A (en) | 2016-09-02 | 2022-06-29 | Pharmaceutical composition |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662383334P | 2016-09-02 | 2016-09-02 | |
| US62/383,334 | 2016-09-02 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/329,596 A-371-Of-International US11390654B2 (en) | 2016-09-02 | 2017-08-30 | Use of CGRP receptor antagonists in neuroprotection and neurological disorders |
| US17/806,834 Continuation US12103951B2 (en) | 2016-09-02 | 2022-06-14 | Use of CGRP receptor antagonists in neuroprotection and neurological disorders |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018045083A1 true WO2018045083A1 (en) | 2018-03-08 |
Family
ID=59914517
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/049460 Ceased WO2018045083A1 (en) | 2016-09-02 | 2017-08-30 | Use of cgrp receptor antagonists in neuroprotection and neurological disorders |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US11390654B2 (en) |
| EP (2) | EP3506925B1 (en) |
| JP (2) | JP7123932B2 (en) |
| KR (1) | KR102657418B1 (en) |
| CN (1) | CN109922820A (en) |
| AU (1) | AU2017319512A1 (en) |
| CA (1) | CA3035561A1 (en) |
| ES (1) | ES2965087T3 (en) |
| IL (1) | IL265099B2 (en) |
| WO (1) | WO2018045083A1 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020120480A1 (en) * | 2018-12-10 | 2020-06-18 | University Of Copenhagen | Vasodilators for use in the treatment of a retinal ischemic disorder |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3506925B1 (en) | 2016-09-02 | 2023-09-06 | Christopher J. Soares | Use of cgrp receptor antagonists in treating glaucoma |
| CN118717761A (en) * | 2024-05-27 | 2024-10-01 | 复旦大学 | Application of Remigipam in the preparation of drugs for treating/preventing Alzheimer's disease |
| CN119524110B (en) * | 2024-12-16 | 2026-03-20 | 中国人民解放军军事科学院军事医学研究院 | Application of CGRP in reducing immune rejection of implanted neural electrodes |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4530838A (en) | 1983-07-08 | 1985-07-23 | The Salk Institute For Biological Studies | Synthetic calcitonin-gene-related peptides for lowering blood pressure or gastric acid secretion in mammals |
| WO1993025221A1 (en) | 1992-06-11 | 1993-12-23 | Alkermes Controlled Therapeutics, Inc. | Erythropoietin drug delivery system |
| WO1994017784A1 (en) | 1993-02-04 | 1994-08-18 | Amgen Inc. | Pulmonary administration of erythropoietin |
| WO1997041223A1 (en) * | 1996-04-15 | 1997-11-06 | The University Of Miami | Molecular clone of cgrp receptor component protein and uses thereof |
| WO2013112912A1 (en) | 2012-01-26 | 2013-08-01 | Soares Christopher J | Peptide antagonists of the calcitonin cgrp family of peptide hormones and their use |
| WO2013130402A1 (en) * | 2012-02-27 | 2013-09-06 | Bristol-Myers Squibb Company | N- (5s, 6s, 9r) - 5 -amino- 6 - (2, 3 - difluorophenyl) -6, 7, 8, 9 - tetrahydro - 5h - cyclohepta [b] pyridin-9 -yl- 4 - (2 - oxo-2, 3 - dihydro - 1h- imidazo [4, 5 -b] pyridin - 1 - yl) piperidine - 1 - carboxylate, hemisulfate salt |
Family Cites Families (37)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3940475A (en) | 1970-06-11 | 1976-02-24 | Biological Developments, Inc. | Radioimmune method of assaying quantitatively for a hapten |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| JPS6023084B2 (en) | 1979-07-11 | 1985-06-05 | 味の素株式会社 | blood substitute |
| NO812612L (en) | 1980-08-06 | 1982-02-08 | Ferring Pharma Ltd | ENZYME inhibitor. |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| CH657779A5 (en) | 1982-10-05 | 1986-09-30 | Sandoz Ag | GALENIC COMPOSITIONS CONTAINING CALCITONIN. |
| IT1164225B (en) | 1983-05-13 | 1987-04-08 | Anic Spa | INVERTED ANALOGS OF PENTAPEPTIDE ENHANCING BRADICHINA BPP5A AND METHODS FOR THEIR PREPARATION |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| DE3675588D1 (en) | 1985-06-19 | 1990-12-20 | Ajinomoto Kk | HAEMOGLOBIN TIED TO A POLY (ALKENYLENE OXIDE). |
| JPS62129297A (en) | 1985-08-09 | 1987-06-11 | Toyo Jozo Co Ltd | Calcitonin gene related peptide derivative |
| JPS62231168A (en) | 1986-03-21 | 1987-10-09 | ハイブリテツク・インコ−ポレイテツド | Improvement method for forming internal standard for analyzing analite-receptor |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| US6552170B1 (en) | 1990-04-06 | 2003-04-22 | Amgen Inc. | PEGylation reagents and compounds formed therewith |
| US5206161A (en) | 1991-02-01 | 1993-04-27 | Genentech, Inc. | Human plasma carboxypeptidase B |
| WO1994021665A1 (en) | 1993-03-24 | 1994-09-29 | Amylin Pharmaceuticals, Inc. | Cloned receptors and methods for screening |
| US5698401A (en) | 1995-11-14 | 1997-12-16 | Abbott Laboratories | Use of nuclear magnetic resonance to identify ligands to target biomolecules |
| EP1248643B1 (en) * | 2000-01-20 | 2005-08-17 | YEDA RESEARCH AND DEVELOPMENT Co. LTD. | The use of copolymer 1 and related peptides and polypeptides and t cells treated therewith for neuroprotective therapy |
| US20050054557A1 (en) | 2002-05-09 | 2005-03-10 | Goldberg Michael M. | Compositions for delivering parathyroid hormone and calcitonin |
| CN103143022A (en) * | 2002-07-30 | 2013-06-12 | 奥默罗斯公司 | Ophthalmologic irrigation solutions and method |
| WO2004084859A2 (en) | 2003-03-21 | 2004-10-07 | Nastech Pharmaceutical Company Inc. | Nasal calcitonin formulations containing chlorobutanol |
| US20060286129A1 (en) | 2003-12-19 | 2006-12-21 | Emisphere Technologies, Inc. | Oral GLP-1 formulations |
| US20060094652A1 (en) * | 2004-02-11 | 2006-05-04 | Levy Odile E | Hybrid polypeptides with selectable properties |
| DE602005021858D1 (en) | 2004-02-11 | 2010-07-29 | Amylin Pharmaceuticals Inc | PEPTIDES OF THE AMYLIN FAMILY, PROCESS FOR THEIR PREPARATION AND USE |
| WO2007055728A1 (en) | 2005-11-01 | 2007-05-18 | Amylin Pharmaceuticals, Inc. | Treatment of obesity and related disorders |
| ES2325773T5 (en) | 2004-11-01 | 2014-02-24 | Amylin Pharmaceuticals, Llc. | Treatment of obesity and related disorders |
| BRPI0606992A2 (en) | 2005-02-11 | 2009-07-28 | Amylin Pharmaceuticals Inc | gip analog and polypeptides with selectable properties |
| US8263545B2 (en) | 2005-02-11 | 2012-09-11 | Amylin Pharmaceuticals, Inc. | GIP analog and hybrid polypeptides with selectable properties |
| US7671023B2 (en) | 2005-03-31 | 2010-03-02 | Amylin Pharmaceuticals, Inc. | Amylin agonist for treating depression, anxiety disorder and schizophrenia |
| WO2007055743A2 (en) | 2005-11-01 | 2007-05-18 | Amylin Pharmaceuticals, Inc. | Treatment of obesity and related disorders |
| ES2433251T5 (en) | 2005-11-14 | 2020-03-13 | Teva Pharmaceuticals Int Gmbh | Antagonistic antibodies directed against a peptide related to the calcitonin gene and procedures using them |
| KR20100098628A (en) | 2007-11-14 | 2010-09-08 | 아밀린 파마슈티칼스, 인크. | Methods for treating obesity and obesity related diseases and disorders |
| NZ621196A (en) * | 2008-01-22 | 2015-08-28 | Araim Pharmaceuticals Inc | Tissue protective peptides and peptide analogs for preventing and treating diseases and disorders associated with tissue damage |
| US8748375B2 (en) | 2009-03-17 | 2014-06-10 | Amylin Pharmaceuticals, Llc | Methods for affecting body composition using amylin agonists |
| US20150031623A1 (en) | 2011-09-29 | 2015-01-29 | Mcw Research Foundation, Inc. | Thrombopoietin receptor ligands for neuroprotection |
| WO2013059336A1 (en) | 2011-10-18 | 2013-04-25 | Amylin Pharmaceuticals, Llc | Amylin-calcitonin chimeric peptides conjugated to duration enchancing moieties |
| JP2017515852A (en) * | 2014-05-16 | 2017-06-15 | ソーク インスティテュート フォー バイオロジカル スタディーズ | Compositions and methods for treating metabolic disorders |
| EP3506925B1 (en) | 2016-09-02 | 2023-09-06 | Christopher J. Soares | Use of cgrp receptor antagonists in treating glaucoma |
-
2017
- 2017-08-30 EP EP17769144.1A patent/EP3506925B1/en active Active
- 2017-08-30 WO PCT/US2017/049460 patent/WO2018045083A1/en not_active Ceased
- 2017-08-30 CA CA3035561A patent/CA3035561A1/en active Pending
- 2017-08-30 CN CN201780067192.XA patent/CN109922820A/en active Pending
- 2017-08-30 US US16/329,596 patent/US11390654B2/en active Active
- 2017-08-30 JP JP2019533291A patent/JP7123932B2/en active Active
- 2017-08-30 IL IL265099A patent/IL265099B2/en unknown
- 2017-08-30 EP EP23195196.3A patent/EP4316595A3/en not_active Withdrawn
- 2017-08-30 ES ES17769144T patent/ES2965087T3/en active Active
- 2017-08-30 KR KR1020197009422A patent/KR102657418B1/en active Active
- 2017-08-30 AU AU2017319512A patent/AU2017319512A1/en not_active Abandoned
-
2022
- 2022-06-14 US US17/806,834 patent/US12103951B2/en active Active
- 2022-06-29 JP JP2022105144A patent/JP2022126857A/en active Pending
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4530838A (en) | 1983-07-08 | 1985-07-23 | The Salk Institute For Biological Studies | Synthetic calcitonin-gene-related peptides for lowering blood pressure or gastric acid secretion in mammals |
| WO1993025221A1 (en) | 1992-06-11 | 1993-12-23 | Alkermes Controlled Therapeutics, Inc. | Erythropoietin drug delivery system |
| WO1994017784A1 (en) | 1993-02-04 | 1994-08-18 | Amgen Inc. | Pulmonary administration of erythropoietin |
| EP0613683A1 (en) | 1993-02-04 | 1994-09-07 | Amgen Inc. | Pharmaceutical compositions for systemic administration of erythropoietin via the respiratory system |
| WO1997041223A1 (en) * | 1996-04-15 | 1997-11-06 | The University Of Miami | Molecular clone of cgrp receptor component protein and uses thereof |
| WO2013112912A1 (en) | 2012-01-26 | 2013-08-01 | Soares Christopher J | Peptide antagonists of the calcitonin cgrp family of peptide hormones and their use |
| WO2013130402A1 (en) * | 2012-02-27 | 2013-09-06 | Bristol-Myers Squibb Company | N- (5s, 6s, 9r) - 5 -amino- 6 - (2, 3 - difluorophenyl) -6, 7, 8, 9 - tetrahydro - 5h - cyclohepta [b] pyridin-9 -yl- 4 - (2 - oxo-2, 3 - dihydro - 1h- imidazo [4, 5 -b] pyridin - 1 - yl) piperidine - 1 - carboxylate, hemisulfate salt |
Non-Patent Citations (41)
| Title |
|---|
| "Design of Prodrugs", 1985, ELSEVIER SCIENCE PUBLISHERS |
| ALTSCHUL ET AL., METHODS IN ENZYMOLOGY, vol. 266, 1996, pages 460 - 480 |
| ASHINA M; BENDTSEN L; JENSEN R; SCHIFTER S; OLESEN J, EVIDENCE FOR INCREASED PLASMA LEVELS OF CALCITONIN GENE-RELATED PEPTIDE IN MIGRAINE OUTSIDE OF ATTACKS. PAIN, vol. 86, no. 1-2, May 2000 (2000-05-01), pages 133 - 138 |
| CASTEL D; SABBAG I; BRENNER O; MEILIN S: "Peripheral Neuritis Trauma in Pigs: A Neuropathic Pain Model", J PAIN, vol. 17, no. 1, January 2016 (2016-01-01), pages 36 - 49, XP029383275, DOI: doi:10.1016/j.jpain.2015.09.011 |
| CHADER GJ: "Key needs and opportunities for treating glaucoma", INVEST OPHTHALMOL VIS SCI., vol. 53, no. 5, 4 May 2012 (2012-05-04), pages 2456 - 2460 |
| CHRISTOPOULOS G; PERRY, KJ; MORFIS M; TILAKARATNE, N; GAO Y; FRASER NJ; MAIN MJ; FOORD SM; SEXTON PM: "Multiple Amylin Receptors Arise from Receptor Activity-Modifying Protein Interaction with the Calcitonin Receptor Gene Product", MOL PHARMACOL., vol. 56, no. 1, July 1999 (1999-07-01), pages 235 - 242 |
| CONE FE; STEINHART MR; OGLESBY EN; KALESNYKAS G; PEASE ME; QUIGLEY HA: "The effects of anesthesia, mouse strain and age on intraocular pressure and an improved murine model of experimental glaucoma", EXP EYE RES., vol. 99, June 2012 (2012-06-01), pages 27 - 35, XP028510889, DOI: doi:10.1016/j.exer.2012.04.006 |
| DE PRADO ET AL: "CGRP receptor antagonists: A new frontier of anti-migraine medications", DRUG DISCOVERY TODAY: THERAPEUTIC STRATE, ELSEVIER, AMSTERDAM, NL, vol. 3, no. 4, 16 January 2007 (2007-01-16), pages 593 - 597, XP005831040, ISSN: 1740-6773 * |
| EDVINSSON L., CNS DRUGS, vol. 15, no. 10, 2001, pages 745 - 753 |
| GALLAI VI; SARCHIELLI P; FLORIDI A; FRANCESCHINI M; CODINI M; GLIOTI G; TREQUATTRINI A; PALUMBO R: "Vasoactive peptide levels in the plasma of young migraine patients with and without aura assessed both interictally and ictally", CEPHALALGIA, vol. 15, no. 5, October 1995 (1995-10-01), pages 384 - 390 |
| GOADSBY PJ1; EDVINSSON L; EKMAN R: "Vasoactive peptide release in the extracerebral circulation of humans during migraine headache", ANN NEUROL, vol. 28, no. 2, August 1990 (1990-08-01), pages 183 - 187, XP002996498, DOI: doi:10.1002/ana.410280213 |
| GRANT, AD, BRIT. J PHARMACOL., vol. 135, 2002, pages 356 - 362 |
| GUPTA, N.; YUCEL, Y.H.: "Glaucoma as a neurodegenerative disease", CURRENT OPIN. OPHTHALMOL, vol. 18, 2007, pages 110 - 114 |
| HAY DL; SMITH DM.: "Knockouts and transgenics confirm the importance of adrenomedullin in the vasculature", TRENDS PHARMACOL SCI., vol. 22, no. 2, February 2001 (2001-02-01), pages 57 - 59, XP002904899, DOI: doi:10.1016/S0165-6147(00)01617-5 |
| KALESNYKAS G; OGLESBY EN; ZACK DJ; CONE FE; STEINHART MR; TIAN J; PEASE ME; QUIGLEY HA: "Retinal ganglion cell morphology after optic nerve crush and experimental glaucoma", INVEST OPHTHALMOL VIS SCI, vol. 53, no. 7, 2012, pages 3847 - 3857 |
| KALESNYKAS G; TUULOS T; UUSITALO H; JOLKKONEN J: "Neurodegeneration and cellular stress in the retina and optic nerve in rat cerebral ischemia and hypo perfusion models", NEUROSCIENCE, vol. 155, no. 3, 2008, pages 937 - 947 |
| KALESNYKAS G; UUSITALO H: "Comparison of simultaneous readings of intraocular pressure in rabbits using Perkins handheld, Tono-Pen XL, and TonoVet tonometers", GREAFES ARCH CLIN EXP OPHTHALMOL, vol. 245, 2007, pages 761 - 762, XP019517116, DOI: doi:10.1007/s00417-006-0470-8 |
| LASSEN LH; ADERSLEV PA; JACOBSEN VB; IVERSEN HK; SPERLING B; OLESEN J: "CGRP may play a causative role in migraine", CEPHALALGIA, vol. 22, no. 1, February 2002 (2002-02-01), pages 54 - 61, XP009083987, DOI: doi:10.1046/j.1468-2982.2002.00310.x |
| M. J. M. FISCHER ET AL: "The Nonpeptide Calcitonin Gene-Related Peptide Receptor Antagonist BIBN4096BS Lowers the Activity of Neurons with Meningeal Input in the Rat Spinal Trigeminal Nucleus", JOURNAL OF NEUROSCIENCE, vol. 25, no. 25, 22 June 2005 (2005-06-22), US, pages 5877 - 5883, XP055428958, ISSN: 0270-6474, DOI: 10.1523/JNEUROSCI.0869-05.2005 * |
| MARQUEST DE PRADO B; RUSSO AF: "CGRP receptor antagonists: A new frontier of anti-migraine medications", DRUG DISCOV TODAY THER STRATEG, vol. 3, no. 4, 2006, pages 593 - 597, XP005831040 |
| MCLATCHIE LM; FRASER NJ; MAIN MJ; WISE A; BROWN J; THOMPSON N; SOLARI R; LEE GM; FOORD SM: "RAMPs regulate the transport and ligand specificity of the calcitonin-receptor-like receptor", NATURE, vol. 393, 28 May 1998 (1998-05-28), pages 333 - 339, XP002922193, DOI: doi:10.1038/30666 |
| MIMEAULT ML; QUIRION R; DUMONT Y; ST-PIERRE S; FOURNIER A: "Structure-activity study of hCGRP8-37, a calcitonin gene-related peptide receptor antagonist", J MED CHEM., vol. 35, no. 12, 12 June 1992 (1992-06-12), pages 2163 - 2168 |
| MIRET JJ; RAKHILINA L; SILVERMAN L; OEHLEN B: "Functional Expression of Heteromeric Calcitonin Gene-related Peptide and Adrenomedullin Receptors in Yeast", J BIOL CHEM., vol. 277, no. 9, 1 March 2002 (2002-03-01), pages 6881 - 6887 |
| MOSKOWITZ MA: "Neurogenic versus vascular mechanisms of sumatriptan and ergot alkaloids in migraine", TRENDS PHARMACOL SCI., vol. l3, no. 8, August 1992 (1992-08-01), pages 307 - 311, XP025955095, DOI: doi:10.1016/0165-6147(92)90097-P |
| MUFSON EJ; COUNTS SE; CHE S; GINSBERG SD: "Neuronal gene expression profiling: uncovering the molecular biology of neurodegenerative disease", PROGRESS IN BRAIN RESEARCH, vol. 158, 2006, pages 197 - 222 |
| MULDER H; GEBRE-MEDHIN S; BETSHOLTZ C; SUNDLER F; AHREN B: "Islet amyloid polypeptide (amylin)-deficient mice develop a more severe form of alloxan-induced diabetes", AM J PHYSIOL ENDOCRINOL METAB, vol. 278, no. 4, April 2000 (2000-04-01), pages E684 - E691 |
| NAFISSI N; FOLDVARI M: "Neuroprotective therapies in glaucoma: II", GENETIC NANOTECHNOLOGY TOOLS, FRONT NEUROSCI, vol. 9, 2015, pages 355 |
| POYNER DR: "Calcitonin gene-related peptide: multiple actions, multiple receptors", PHARMACOL THER., vol. 56, no. 1, 1992, pages 23 - 51, XP025557258, DOI: doi:10.1016/0163-7258(92)90036-Y |
| POYNER DR; SEXTON PM; MARSHALL I; SMITH DM; QUIRION R ET AL.: "International Union of Pharmacology. XXXII. The mammalian calcitonin gene-related peptides, adrenomedullin, amylin, and calcitonin receptors", PHARMACOL. REV., vol. 54, 2002, pages 233 - 246 |
| RAGAUSKAS S; LEINONEN H; PURANEN J; RONKKO S; NYMARK S; GUREVICIUS K; LIPPONEN A; KONTKANEN O; PUOLIVALI J; TANILA H: "Early retinal function deficit without prominent morphological changes in the R6/2 mouse model of Huntington's disease", PLOS ONE, vol. 9, no. 12, 2014, pages e113317 |
| ROH J; CHANG CL; BHALLA A; KLEIN C; TEDDY HSU SYT: "Intermedin Is a Calcitonin/Calcitonin Gene-related Peptide Family Peptide Acting through the Calcitonin Receptor-like Receptor/Receptor Activity-modifying Protein Receptor Complexes", J BIOL CHEM., vol. 279, no. 8, 20 February 2004 (2004-02-20), pages 7264 - 7274, XP002391149, DOI: doi:10.1074/jbc.M305332200 |
| ROVERO PI; GULIANI S; MAGGI CA: "CGRP antagonist activity of short C-terminal fragments of human alpha CGRP, CGRP(23-37) and CGRP(19-37", PEPTIDES, vol. 13, no. 5, September 1992 (1992-09-01), pages 1025 - 1027 |
| RUSSO AF: "CALCITONIN GENE-RELATED PEPTIDE (CGRP): A New Target for Migraine", ANNU REV PHARMACOL TOXICOL, vol. 55, 2015, pages 533 - 552 |
| SALMON AM; DAMAJ I; SEKINE S; PICCIOTTO MR; MARUBIO L; CHANGEUX JP: "Modulation of morphine analgesia in alpha CGRP mutant mice", NEUROREPORT, vol. 10, no. 4, 17 March 1999 (1999-03-17), pages 849 - 854 |
| SALMON AM; DAMAJ MI; MARUBIO LM; EPPING-JORDAN MP; MERLO-PICH E; CHANGEUX JP: "Altered neuroadaptation in opiate dependence and neurogenic inflammatory nociception in alpha CGRP-deficient mice", NAT NEUROSCI, vol. 4, no. 4, April 2001 (2001-04-01), pages 357 - 358 |
| SHINDO T; KURIHARA Y; NISHIMATSU H; MORIYAMA N; KAKOKI M; WANG Y; IMAI Y; EBIHARA A; KUWAKI T; JU KH: "Vascular abnormalities and elevated blood pressure in mice lacking adrenomedullin gene", CIRCULATION, vol. 104, 2001, pages 1964 - 1971 |
| SONG J; KIM J: "Degeneration of Dopaminergic Neurons Due to Metabolic Alterations and Parkinson's Disease", FRONT AGING NEUROSCI, vol. 8, 30 March 2016 (2016-03-30), pages 65 |
| TILAKARATNE N; CHRISTOPOULOS G; ZUMPE ET; FOORD SM; SEXTON PM: "Amylin Receptor Phenotypes Derived from Human Calcitonin Receptor/RAMP Coexpression Exhibit Pharmacological Differences Dependent on Receptor Isoform and Host Cell Environment", J PHARMACOL EXP THER, vol. 294, no. l, July 2000 (2000-07-01), pages 61 - 72, XP008002521 |
| WILLIAMSON, D. J., MICROSC. RES. TECH., vol. 53, 2001, pages 167 - 178 |
| ZHANG L; HOFF AO; WIMALAWANSA SJ; COTE GJ; GAGEL RF; WESTLUND KN: "Arthritic calcitonin/alpha calcitonin gene-related peptide knockout mice have reduced nociceptive hypersensitivity", PAIN, vol. 89, no. 2-3, January 2001 (2001-01-01), pages 265 - 273 |
| ZHANG Z; WINBORN CS; MARQUEZ DE PRADO B; RUSSO AF: "Sensitization of Calcitonin Gene-Related Peptide Receptors by Receptor Activity-Modifying Protein-1 in the Trigeminal Ganglion", THE JOURNAL OF NEUROSCIENCE, vol. 27, no. 10, 7 March 2007 (2007-03-07), pages 2693 - 2703 |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020120480A1 (en) * | 2018-12-10 | 2020-06-18 | University Of Copenhagen | Vasodilators for use in the treatment of a retinal ischemic disorder |
Also Published As
| Publication number | Publication date |
|---|---|
| IL265099B2 (en) | 2024-09-01 |
| CN109922820A (en) | 2019-06-21 |
| JP2022126857A (en) | 2022-08-30 |
| IL265099B1 (en) | 2024-05-01 |
| AU2017319512A1 (en) | 2019-03-21 |
| US12103951B2 (en) | 2024-10-01 |
| KR20190044665A (en) | 2019-04-30 |
| US20230212248A1 (en) | 2023-07-06 |
| CA3035561A1 (en) | 2018-03-08 |
| IL265099A (en) | 2019-04-30 |
| EP3506925A1 (en) | 2019-07-10 |
| JP7123932B2 (en) | 2022-08-23 |
| EP3506925B1 (en) | 2023-09-06 |
| US11390654B2 (en) | 2022-07-19 |
| AU2017319512A2 (en) | 2019-07-11 |
| EP4316595A3 (en) | 2024-04-17 |
| KR102657418B1 (en) | 2024-04-15 |
| US20200165305A1 (en) | 2020-05-28 |
| EP3506925C0 (en) | 2023-09-06 |
| EP4316595A2 (en) | 2024-02-07 |
| JP2019530741A (en) | 2019-10-24 |
| ES2965087T3 (en) | 2024-04-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12103951B2 (en) | Use of CGRP receptor antagonists in neuroprotection and neurological disorders | |
| US12503501B2 (en) | Treatment of central nervous system disorders by intranasal administration of immunoglobulin G | |
| WO2009039310A2 (en) | Light inhibitors for asthma, lung and airway inflammation, respiratory, interstitial, pulmonary and fibrotic disease treatment | |
| US12329756B2 (en) | Regulation of eIF4E activity for migraine therapy | |
| Ruan et al. | Adrenoceptors in the eye–physiological and pathophysiological relevance | |
| JP6681387B2 (en) | SOCS1-derived peptides for use in chronic complications of diabetes | |
| JP6262661B2 (en) | A therapeutic agent for amyotrophic lateral sclerosis | |
| KR20210025704A (en) | Use of a neuregulin to treat peripheral nerve injury | |
| US10017554B2 (en) | Neuropeptide Y-derived peptides | |
| HK40008689A (en) | Use of cgrp receptor antagonists in neuroprotection and neurological disorders | |
| WO2019048854A1 (en) | Treatment of neurodegenerative diseases | |
| Samsam et al. | Role of neuropeptides in migraine: where do they stand in the latest expert recommendations in migraine treatment? | |
| CN107241901B (en) | BLT2 agonists for pain treatment | |
| CN121941705A (en) | Soluble Bone Morphogenetic Protein (BMP) Receptor Type 1B Protein and Its Uses | |
| Class et al. | Patent application title: NEUROPEPTIDE Y-DERIVED PEPTIDES Inventors: David Paul D. Woldbye (CopenhagenØ, DK) Casper Rene Gøtzsche (Copenhagen Ø, DK) Kristian Klemp (Charlottenlund, DK) Vladimir Berezin (Copenhagen N, DK) Vladimir Berezin (Copenhagen N, DK) Elisabeth Bock (Charlottenlund, DK) | |
| Ferrer et al. | Ophthalmic therapeutics: new basic research and clinical studies | |
| CN116802208A (en) | Parkinson's disease treatment | |
| Dave | Angiotensin II Type 2 Receptor: A Target for Protection Against Various Disease conditions |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17769144 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3035561 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019533291 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2017319512 Country of ref document: AU Date of ref document: 20170830 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20197009422 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017769144 Country of ref document: EP Effective date: 20190402 |



