WO2018023115A1 - Compositions and methods for detection of beta n methylamino l alanine in cu zn superoxide dismutase 1 - Google Patents
Compositions and methods for detection of beta n methylamino l alanine in cu zn superoxide dismutase 1 Download PDFInfo
- Publication number
- WO2018023115A1 WO2018023115A1 PCT/US2017/044693 US2017044693W WO2018023115A1 WO 2018023115 A1 WO2018023115 A1 WO 2018023115A1 US 2017044693 W US2017044693 W US 2017044693W WO 2018023115 A1 WO2018023115 A1 WO 2018023115A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- bmaa
- seq
- isotopically labeled
- enrichment factor
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CC(C)(C(C(*)N*)=O)N*CC* Chemical compound CC(C)(C(C(*)N*)=O)N*CC* 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/13—Labelling of peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07B—GENERAL METHODS OF ORGANIC CHEMISTRY; APPARATUS THEREFOR
- C07B59/00—Introduction of isotopes of elements into organic compounds ; Labelled organic compounds per se
- C07B59/008—Peptides; Proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C229/00—Compounds containing amino and carboxyl groups bound to the same carbon skeleton
- C07C229/02—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton
- C07C229/04—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated
- C07C229/26—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated having more than one amino group bound to the carbon skeleton, e.g. lysine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0089—Oxidoreductases (1.) acting on superoxide as acceptor (1.15)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/52—Use of compounds or compositions for colorimetric, spectrophotometric or fluorometric investigation, e.g. use of reagent paper and including single- and multilayer analytical elements
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/573—Immunoassay; Biospecific binding assay; Materials therefor for enzymes or isoenzymes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6803—General methods of protein analysis not limited to specific proteins or families of proteins
- G01N33/6806—Determination of free amino acids
- G01N33/6812—Assays for specific amino acids
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6803—General methods of protein analysis not limited to specific proteins or families of proteins
- G01N33/6848—Methods of protein analysis involving mass spectrometry
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y115/00—Oxidoreductases acting on superoxide as acceptor (1.15)
- C12Y115/01—Oxidoreductases acting on superoxide as acceptor (1.15) with NAD or NADP as acceptor (1.15.1)
- C12Y115/01001—Superoxide dismutase (1.15.1.1)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2835—Movement disorders, e.g. Parkinson, Huntington, Tourette
Definitions
- BMAA non-protein amino acid ⁇ - ⁇ -Methylamino-L- Alanine
- BMAA neurofibrillary tangles
- ⁇ -amyloid plaques hallmark signs of neuropathological disease.
- cell culture studies have shown that exogenous exposure to BMAA can result in incorporation of this non-protein amino acid in place of L- serine. Supplemental treatment with L-serine has been shown to reduce the rate of BMAA incorporation and regression of neuropathological symptoms.
- isotopically labeled reagents including isotopically labeled small molecules and peptides, that can be used to detect and/or quantify ⁇ - ⁇ -methylamino- L-alanine (BMAA) in the Cu/Zn Superoxide Dismutase 1 (SODl) protein.
- BMAA ⁇ - ⁇ -methylamino- L-alanine
- SODl Cu/Zn Superoxide Dismutase 1
- the reagents can be used as stable isotope labeled standards in analytical methods, including in conjunction with mass spectrometry, to detect and/or quantify BMAA in a sample, such as a protein sample from a subject.
- the inventors have developed isotopically labeled reagents that can detect the incorporation of BMAA into several additional proteins in patient samples.
- polypeptide comprising a sequence that is at least 85% identical to SEQ ID NO: 1, wherein amino acid position 107 comprises a BMAA residue which is isotopically labeled and is defined by the formula below
- polypeptide comprising a sequence that is at least 85%) identical to SEQ ID NO: 2, wherein amino acid position 107 comprises a BMAA residue which is isotopically labeled and is defined by the formula below
- BMAA P-N-methylamino-L- alanine
- R represents hydrogen or an amine protecting group, and at least two of a C, C, C C, d C, f N " , g O, and h O are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis.
- a method for detecting ⁇ - ⁇ -methylamino-L-alanine (BMAA) in a SOD1 protein comprising: (a) purifying SOD1 protein from a biological specimen to provide a purified SOD1 protein sample; (b) spiking the purified SOD1 protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled ⁇ - ⁇ -methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes; to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis.
- BMAA ⁇ - ⁇ -methylamino-L-alanine
- a method of detecting or predicting amyotrophic lateral sclerosis in a subject comprising (a) purifying SOD1 protein from a biological specimen from a subject to provide a purified SOD1 protein sample; (b) spiking the purified SOD1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below 9 0
- R represents hydrogen or an amine protecting group, and at least two of a C, C, C C, d C, f N " , g O, and h O are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA level in the SODl protein sample by isotope dilution analysis; and (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA level in the SODl protein is greater than a normal reference value.
- provided herein is a method of detecting or predicting
- amyotrophic lateral sclerosis in a subject comprising (a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample; (b) spiking the purified SODl protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled ⁇ - ⁇ -methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA level in the SODl protein sample by isotope dilution analysis; and (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA level in the SODl protein is greater than a normal reference value.
- a method of preventing or treating amyotrophic lateral sclerosis in a subject comprising (a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample; (b) spiking the purified SODl protein sample with a defined amount of an isotopically labeled compound defined by the formula below 9 0
- R represents hydrogen or an amine protecting group, and at least two of a C, C, C C, d C, f N " , g O, and h O are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the SODl protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the SODl protein is greater than a normal reference value; and (f) administering to the subject L-serine in an amount sufficient to prevent or treat the amyotrophic lateral sclerosis.
- provided herein is a method of preventing or treating
- amyotrophic lateral sclerosis in a subject comprising (a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample; (b) spiking the purified SODl protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled ⁇ - ⁇ -methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the SODl protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the SODl protein is greater than a normal reference value; and
- FIG. 1 is an illustration of an example procedure used to convert a phosphoserine- containing peptide to BMAA-containing peptide.
- the peptide sequence shown in FIG. 1 is unique to superoxide dismutase 1 (SODl).
- FIGS. 2A-2B illustrate the intact mass of stable isotope-labeled (SIL)
- FIG. 3 illustrates the tandem mass spectrum of the phosphorylated serine-containing stable isotope-labeled peptide.
- FIG. 4 illustrates the tandem mass spectrum of a BMAA-containing stable isotope- labeled peptide, confirming localization of modification.
- FIG. 5 demonstrates that co-eluting fragments confirm identity of the BMAA- containing peptide.
- BMAA- and phosphoserine-containing peptides have distinct retention times.
- the BMAA-containing peptide appears to have two peaks which suggests L and D isomers of the BMAA peptide have been produced.
- FIG. 6 illustrates the conserved peak area of fragments specific to SIL BMAA peptide that allow for confident identification of endogenous peptide.
- FIG. 7 is a plot showing that the elution time of SIL BMAA peptide is necessary for correct identification of endogenous peptide. Without this, the incorrect peak which is also within 5ppm mass accuracy of the BMAA peptide of interest might be selected.
- FIG. 8 demonstrates the ability of mass spectrometry to accurately identify endogenous BMAA-containing peptide in SOD1 protein digest obtained from ALS erythrocytes.
- FIG. 9 is a plot illustrating the co-elution of endogenous and stable isotope-labeled BMAA containing peptides. Co-elution aids in confident identification.
- FIG. 10 is a schematic showing the method of filter aided sample preparation for bottom-up protein characterization.
- FIG. 11 is a schematic showing the post-translational modifications identified with high confidence in SOD1.
- the amino acid numbering shown in the figure does not include the starting methionine.
- FIG. 12 is a schematic showing the post-translational modifications identified with medium confidence in SOD1.
- the amino acid numbering shown in the figure does not include the starting methionine.
- FIG. 13 illustrates the tandem mass spectrum of a BMAA-containing stable isotope- labeled peptide. Fragment ions corresponding to the endogenous peptide with BMAA were found at the expected location, confirming localization of modification.
- FIG. 14 illustrates the tandem mass spectrum of BMAA containing stable isotope- label ( 13 C 4 15 N2 ⁇ - ⁇ -Methylamino-L-Alanine, or Compound 3).
- isotopically labeled reagents including isotopically labeled small molecules and peptides, that can be used to detect and/or quantify ⁇ - ⁇ -methylamino- L-alanine (BMAA) in the Cu/Zn Superoxide Dismutase 1 (SOD1) protein.
- BMAA ⁇ - ⁇ -methylamino- L-alanine
- SOD1 Cu/Zn Superoxide Dismutase 1
- the reagents can be used as stable isotope labeled standards in analytical methods, including in conjunction with mass spectrometry, to detect and/or quantify BMAA in a sample, such as a protein sample from a subject.
- the inventors have developed isotopically labeled reagents that can detect the incorporation of BMAA into several additional proteins in patient samples.
- protein and “polypeptide” are used synonymously to mean any peptide-linked chain of amino acids, regardless of length or post-translational modification, e.g., glycosylation or phosphorylation.
- Amino acids include Alanine (Ala, A), Asparagine (Asn, N), Cysteine (Cys, C), Glutamine (Gin, Q), Glycine (Gly, G), Isoleucine (He, I), Leucine (Leu, L), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V), Histidine (His, H), Arginine (Arg, R), Lysine (Lys, K), Aspartic acid (Asp, D), and
- BMAA Glutamic acid
- Glu E
- BMAA ⁇ - ⁇ -methylamino-L-alanine
- a "normal reference value” refers to a numerical value that is determined experimentally from an unaffected individual, or a population of unaffected individuals, for comparison to the value from an affected individual, or population of affected individuals (for example, individuals affected by ALS).
- the "normal reference value" being measured is from a healthy control subject that is not affected by ALS, or from a population of healthy control subjects that are not affected by ALS.
- polypeptide comprising a sequence that is at least 85% identical to SEQ ID NO: 1, wherein amino acid position 107 comprises a BMAA residue which is isotopically labeled and is defined by the formula below dC ' H ⁇ ,3
- the 13 C isotopic enrichment factor for d C is at least 80 and the 15 N isotopic enrichment factor for * ⁇ is at least 200. In one embodiment, the 13 C isotopic enrichment factor for a C, C, and C C is at least 25. In one embodiment, 13 C isotopic enrichment factor for a C, C, and C C is at least 80. In one embodiment, 15 N isotopic enrichment factor for e N is at least 100. In one embodiment, 15 N isotopic enrichment factor for 3 ⁇ 4 is at least 200.
- the sequence is at least 90% identical to SEQ ID NO: 1. In one embodiment, the sequence is at least 95% identical to SEQ ID NO: 1. In one embodiment, the sequence is at least 99% identical to SEQ ID NO: 1. In one embodiment, the sequence is identical to SEQ ID NO: 1.
- polypeptide comprising a sequence that is at least
- amino acid position 107 comprises a BMAA residue which is isotopically labeled and is defined by the formula below
- the 13 C isotopic enrichment factor for d C is at least 80 and the 15 N isotopic enrichment factor for * ⁇ is at least 200. In one embodiment, the 13 C isotopic enrichment factor for a C, C, and C C is at least 25. In one embodiment, the 13 C isotopic enrichment factor for a C, C, and C C is at least 80. In one embodiment, the 15 N isotopic enrichment factor for e N is at least 100. In one embodiment, the 15 N isotopic enrichment factor for e N is at least 200.
- the sequence is at least 90% identical to SEQ ID NO: 2. In one embodiment, the sequence is at least 95% identical to SEQ ID NO: 2. In one embodiment, the sequence is at least 99% identical to SEQ ID NO: 2. In one embodiment, the sequence is identical to SEQ ID NO: 2.
- the sequence is at least 90% identical to SEQ ID NO: 3. In one embodiment, the sequence is at least 95% identical to SEQ ID NO: 3. In one embodiment, the sequence is at least 99% identical to SEQ ID NO: 3. In one embodiment, the sequence is identical to SEQ ID NO: 3.
- SEQ ID NO: 1 Human SOD1 protein sequence with BMAA at position 107
- BMAA sequence at position 107 replaces the serine that is normally present in the wild type SOD1 sequence in SEQ ID NO: 1.
- the BMAA occurs at position 107 when the initial methionine is not included in the peptide sequence, but occurs at position 108 when the initial methionine is included in the sequence.
- SEQ ID NO: 2 DGVAD VSIED S VISLBGDHCIIGR
- SEQ ID NO: 3 HVGDLGNVTADKDGVADVSIEDSVISLBGDHCIIGR (1 missed cleavage)
- C is Carb ami dom ethyl ated Cysteine (alkylated during sample preparation)
- SEQ ID NO: 4 Human SOD1 wild-type protein sequence.
- BMAA sequence at position 108 replaces the serine that is normally present in the wild type SOD1 sequence in SEQ ID NO: 5.
- the BMAA occurs at position 108 when the initial methionine is included in the peptide sequence, but occurs at position 107 when the initial methionine is not included in the sequence.
- the sequence is at least 90% identical to SEQ ID NO: 5. In one embodiment, the sequence is at least 95% identical to SEQ ID NO: 5. In one embodiment, the sequence is at least 99% identical to SEQ ID NO: 5. In one embodiment, the sequence is identical to SEQ ID NO: 5.
- SEQ ID NO: 6 Human SOD1 wild-type protein sequence (with initial methionine)
- the sequence is at least 90% identical to SEQ ID NO: 6. In one embodiment, the sequence is at least 95% identical to SEQ ID NO: 6. In one embodiment, the sequence is at least 99% identical to SEQ ID NO: 6. In one embodiment, the sequence is identical to SEQ ID NO: 6.
- At least two (e.g., at least three, at least four, at least five, or all six) of a C, C, C C, d C, and * ⁇ are isotopically labeled with a stable isotope.
- all of a C, C, C, d C, e N, and * ⁇ are isotopically labeled with a stable isotope.
- isotopic enrichment factor refers to the ratio between the isotopic abundance (e.g.., 13 C, 15 N, or 18 0) at a specified position in a compound and the naturally occurring abundance of that isotope.
- the naturally occurring abundance of 13 C is 1.1%.
- the naturally occurring abundance of 15 N is 0.37%.
- the naturally occurring abundance of 18 0 is 0.204%.
- the 13 C isotopic enrichment factor for a C, C, C C, and d C is at least 25 (27.5% 13 C incorporation at each position), at least 30 (33% 13 C incorporation at each position), at least 35 (38.5% 13 C incorporation at each position), at least 40 (44% 13 C incorporation at each position), at least 45 (49.5% 13 C incorporation at each position), at least 50 (55% 13 C incorporation at each position), at least 55 (60.5% 13 C incorporation at each position), at least 60 (66% 13 C incorporation at each position), at least 65 (71.5% 13 C incorporation at each position), at least 70 (77% 13 C incorporation at each position), at least 75 (82.5%) 13 C incorporation at each position), at least 80 (88% 13 C incorporation at each position), at least 85 (93.5% 13 C incorporation at each position), or at least 90 (99% 13 C incorporation at each position).
- the 15 N isotopic enrichment factor for e N and * ⁇ is at least 100 (37%) 15 N incorporation at each position), at least 110 (40.7% 15 N incorporation at each position), at least 120 (44.4% 15 N incorporation at each position), at least 130 (48.1% 15 N incorporation at each position), at least 140 (51.8% 15 N incorporation at each position), at least 150 (55.5% 15 N incorporation at each position), at least 160 (59.2% 15 N incorporation at each position), at least 170 (62.9% 15 N incorporation at each position), at least 180 (66.6%) 15 N incorporation at each position), at least 190 (70.3% 15 N incorporation at each position), at least 200 (74% 15 N incorporation at each position), at least 210 (77.7% 15 N incorporation at each position), at least 220 (81.4% 15 N incorporation at each position), at least 230 (85.1% 15 N incorporation at each position), at least 240 (88.8% 15 N incorporation at each position), at least 250 (92.
- the polypeptides can be comprised in a composition.
- the composition can be, for example, a solution of the isotopically labeled compound in a solvent.
- solvents include aliphatic solvents (e.g., pentane, hexanes, cyclohexane); aromatic and/or alkylated aromatic solvents such as benzene, toluene, xylene; hydrocarbon solvents; dichloromethane, chloroform, alcohols (e.g., methanol, ethanol, isopropanol); esters (e.g., ethyl acetate); ketones (e.g., acetone); diethyl ether; dioxane; glycol ethers and glycol ether esters; tetrahydrofuran; dimethylformamide; acetonitrile; dimethyl sulfoxide; water, saline, aqueous buffers (e.g., PBS), aliphatic
- the isotopically labeled compound can comprise at least 0.5% by weight (e.g., at least 1% by weight, at least 1.5% by weight, at least 2% by weight, at least 2.5% by weight, at least 3% by weight, at least 3.5% by weight, at least 4% by weight, at least 4.5% by weight, or at least 1% by weight of the composition.
- at least 0.5% by weight e.g., at least 1% by weight, at least 1.5% by weight, at least 2% by weight, at least 2.5% by weight, at least 3% by weight, at least 3.5% by weight, at least 4% by weight, at least 4.5% by weight, or at least 1% by weight of the composition.
- the isotopically labeled compounds described above can be prepared using methods known in the art. Representative methodologies for the preparation of certain active agents are described below. The appropriate route for synthesis of a given compound agent can be selected in view of the structure of the compound as a whole as it relates to compatibility of functional groups, protecting group strategies, and the presence of labile bonds. In addition to the synthetic methodologies discussed below, alternative reactions and strategies useful for the preparation of the compounds disclosed herein are known in the art. See, for example, March, "Advanced Organic Chemistry," 5 th Edition, 2001, Wiley-Interscience Publication, New York).
- Scheme 1 illustrates an example method for the preparation of BMAA from asparagine.
- Compounds having a desired isotopic labeling e.g., incorporating stable isotopes at particular positions within the compound
- the BMAA amino acid residue is isotopically labeled. In some embodiments, the BMAA amino acid residue is unlabeled and the peptide is isotopically labeled at an amino acid other than at the BMAA residue.
- a polypeptide comprising a sequence that is at least 85% identical to SEQ ID NO: 1, wherein amino acid position 107 comprises a BMAA residue, wherein the polypeptide is isotopically labeled. In some embodiments, provided herein is a polypeptide comprising a sequence that is at least 85% identical to SEQ ID NO: 1, wherein amino acid position 107 comprises a BMAA residue, wherein the polypeptide is isotopically labeled and the isotopic label is enriched in comparison to the corresponding naturally occurring polypeptide.
- Scheme 1 Example method for the preparation of BMAA.
- compositions that include one or more isotopically labeled SODl polypeptides of SODl peptide fragments.
- compositions comprising a SODl polypeptide that includes one or more isotopically labeled ⁇ - ⁇ -methylamino-L-alanine (BMAA) residues are provided herein.
- the isotopically labeled SODl polypeptide can comprise at least 0.5% by weight of the composition.
- Each of the one or more isotopically labeled BMAA residues can be isotopically labeled with one or more (e.g., two or more) stable isotopes.
- each of the one or more isotopically labeled BMAA residues can be defined by the formula belo
- the 13 C isotopic enrichment factor for d C is at least 25 (27.5% 13 C incorporation at each position), at least 30 (33% 13 C incorporation at each position), at least 35 (38.5% 13 C incorporation at each position), at least 40 (44% 13 C incorporation at each position), at least 45 (49.5% 13 C incorporation at each position), at least 50 (55% 13 C incorporation at each position), at least 55 (60.5% 13 C incorporation at each position), at least 60 (66% 13 C incorporation at each position), at least 65 (71.5% 13 C incorporation at each position), at least 70 (77% 13 C incorporation at each position), at least 75 (82.5% 13 C incorporation at each position), at least 80 (88% 13 C incorporation at each position), at least 85 (93.5%) 13 C incorporation at each position), or at least 90 (99% 13 C incorporation at each position).
- the 15 N isotopic enrichment factor for * ⁇ is at least 100 (37% 15 N incorporation at each position), at least 1 10 (40.7% 15 N incorporation at each position), at least 120 (44.4% 15 N incorporation at each position), at least 130 (48.1% 15 N
- incorporation at each position at least 140 (51.8% 15 N incorporation at each position), at least 150 (55.5% 15 N incorporation at each position), at least 160 (59.2% 15 N incorporation at each position), at least 170 (62.9% 15 N incorporation at each position), at least 180 (66.6%) 15 N incorporation at each position), at least 190 (70.3% 15 N incorporation at each position), at least 200 (74% 15 N incorporation at each position), at least 210 (77.7% 15 N incorporation at each position), at least 220 (81.4% 15 N incorporation at each position), at least 230 (85.1% 15 N incorporation at each position), at least 240 (88.8% 15 N incorporation at each position), at least 250 (92.5% 15 N incorporation at each position), at least 260 (96.2%) 15 N incorporation at each position), or at least 265 (98.05%) 15 N incorporation at each position).
- a C, C, and/or C C can also be labeled with a stable isotope.
- the 13 C isotopic enrichment factor for a C, C, and C C can be at least 25 (27.5% 13 C incorporation at each position), at least 30 (33% 13 C incorporation at each position), at least 35 (38.5%) 13 C incorporation at each position), at least 40 (44% 13 C incorporation at each position), at least 45 (49.5% 13 C incorporation at each position), at least 50 (55% 13 C incorporation at each position), at least 55 (60.5% 13 C incorporation at each position), at least 60 (66% 13 C incorporation at each position), at least 65 (71.5% 13 C incorporation at each position), at least 70 (77% 13 C incorporation at each position), at least 75 (82.5% 13 C incorporation at each position), at least 80 (88% 13 C incorporation at each position), at least 85 (93.5%) 13 C incorporation at each position), or at least 90 (99% 13 C incorporation at each position).
- e N can also be labeled with a stable isotope.
- the 15 N isotopic enrichment factor for e N is at least 100 (37% 15 N incorporation at each position), at least 1 10 (40.7% 15 N incorporation at each position), at least 120 (44.4% 15 N incorporation at each position), at least 130 (48.1% 15 N incorporation at each position), at least 140 (51.8%) 15 N incorporation at each position), at least 150 (55.5% 15 N incorporation at each position), at least 160 (59.2% 15 N incorporation at each position), at least 170 (62.9% 15 N incorporation at each position), at least 180 (66.6% N incorporation at each position), at least 190 (70.3% 15 N incorporation at each position), at least 200 (74% 15 N incorporation at each position), at least 210 (77.7% 15 N incorporation at each position), at least 220 (81.4% 15 N incorporation at each position), at least 230 (85.1%> 15 N incorporation at each position), at least 240 (
- incorporation at each position at least 260 (96.2% 15 N incorporation at each position), or at least 265 (98.05%) 15 N incorporation at each position).
- the polypeptide can include a single isotopically labeled BMAA residue. In other embodiments, the polypeptide can include two or more isotopically labeled BMAA residues (e.g., three or more isotopically labeled BMAA residues, four or more isotopically labeled BMAA residues, five or more isotopically labeled BMAA residues, or ten or more isotopically labeled BMAA residues). In some embodiments, the BMAA residue is substituted for Serl07 (numbering does not include the starting methionine.
- polypeptide can be defined by the formula below
- m is an integer from 0 to 8384 and n is an integer from 0 to 8384, with the proviso that at least one of m and n is not 0; the 13 C isotopic enrichment factor for d C is at least 25; the 15 N isotopic enrichment factor for * ⁇ is at least 100; and independently for each occurrence in the polypeptide, Ri is H and R 2 is selected from one of the following
- the polypep P tide can be defined by the formula below
- m is an integer from 0 to 108 and n is an integer from 0 to 46, with the proviso that at least one of m and n is not 0; the 13 C isotopic enrichment factor for d C is at least 25; the 15 N isotopic enrichment factor for * ⁇ is at least 100; and independently for each occurrence in the polypeptide, Ri is H and R 2 is selected from one of the following
- the 13 C isotopic enrichment factor for d C is at least 25 (27.5% 13 C incorporation at each position), at least 30 (33% 13 C incorporation at each position), at least 35 (38.5% 13 C incorporation at each position), at least 40 (44% 13 C incorporation at each position), at least 45 (49.5% 13 C incorporation at each position), at least 50 (55% 13 C incorporation at each position), at least 55 (60.5% 13 C incorporation at each position), at least 60 (66% 13 C incorporation at each position), at least 65 (71.5% 13 C incorporation at each position), at least 70 (77% 13 C incorporation at each position), at least 75 (82.5% 13 C incorporation at each position), at least 80 (88% 13 C incorporation at each position), at least 85 (93.5%) 13 C incorporation at each position), or at least 90 (99% 13 C incorporation at each position).
- the 15 N isotopic enrichment factor for * ⁇ is at least 100 (37% 15 N incorporation at each position), at least 1 10 (40.7% 15 N incorporation at each position), at least 120 (44.4% 15 N incorporation at each position), at least 130 (48.1% 15 N
- incorporation at each position at least 140 (51.8% 15 N incorporation at each position), at least 150 (55.5% 15 N incorporation at each position), at least 160 (59.2% 15 N incorporation at each position), at least 170 (62.9% 15 N incorporation at each position), at least 180 (66.6%) 15 N incorporation at each position), at least 190 (70.3% 15 N incorporation at each position), at least 200 (74% 15 N incorporation at each position), at least 210 (77.7% 15 N incorporation at each position), at least 220 (81.4% 15 N incorporation at each position), at least 230 (85.1% 15 N incorporation at each position), at least 240 (88.8% 15 N incorporation at each position), at least 250 (92.5% 15 N incorporation at each position), at least 260 (96.2%) 15 N incorporation at each position), or at least 265 (98.05%) 15 N incorporation at each position).
- a C, C, and/or C C can also be labeled with a stable isotope.
- the 13 C isotopic enrichment factor for a C, C, and C C can be at least 25 (27.5% 13 C incorporation at each position), at least 30 (33%> 13 C incorporation at each position), at least 35 (38.5%) 13 C incorporation at each position), at least 40 (44% 13 C incorporation at each position), at least 45 (49.5%> 13 C incorporation at each position), at least 50 (55% 13 C incorporation at each position), at least 55 (60.5%> 13 C incorporation at each position), at least 60 (66%> 13 C incorporation at each position), at least 65 (71.5% 13 C incorporation at each position), at least 70 (77% 13 C incorporation at each position), at least 75 (82.5% 13 C incorporation at each position), at least 80 (88% 13 C incorporation at each position), at least 85 (93.5%) 13 C incorporation at each position), or at least 90 (99% 13 C incorporation at each position).
- e N can also be labeled with a stable isotope.
- the 15 N isotopic enrichment factor for e N is at least 100 (37% 15 N incorporation at each position), at least 1 10 (40.7% 15 N incorporation at each position), at least 120 (44.4% 15 N incorporation at each position), at least 130 (48.1% 15 N incorporation at each position), at least 140 (51.8%) 15 N incorporation at each position), at least 150 (55.5% 15 N incorporation at each position), at least 160 (59.2% 15 N incorporation at each position), at least 170 (62.9% 15 N incorporation at each position), at least 180 (66.6% 15 N incorporation at each position), at least 190 (70.3% 15 N incorporation at each position), at least 200 (74% 15 N incorporation at each position), at least 210 (77.7% 15 N incorporation at each position), at least 220 (81.4% 15 N incorporation at each position), at least 230 (85.1%> 15 N incorporation at each position), at least 240
- incorporation at each position at least 260 (96.2% 15 N incorporation at each position), or at least 265 (98.05%) 15 N incorporation at each position).
- m can be at least 1 (e.g., at least 5, at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100).
- m can be 108 or less (e.g., 100 or less, 90 or less, 80 or less, 70 or less, 60 or less, 50 or less, 40 or less, 30 or less, 20 or less, 10 or less, or 5 or less), m can be an integer ranging from any of the minimum values described above to any of the maximum values described above.
- m can be an integer from 1 to 108 (e.g., from 1 to 100, from 1 to 50, from 1 to 30, or from 1 to 10).
- n can be at least 1 (e.g., at least 5, at least 10, at least 20, at least 30, at least 40). In some embodiments, n can be 46 or less (e.g., 40 or less, 30 or less, 20 or less, 10 or less, or 5 or less), n can be an integer ranging from any of the minimum values described above to any of the maximum values described above. For example, in some embodiments, n can be an integer from 1 to 46 (e.g., from 1 to 40, from 1 to 30, from 1 to 20, or from 1 to 10).
- the sum of m and n can be at least 1 (e.g., at least 5, at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150).
- the sum of m and n can be 154 or less (e.g., 150 or less, 140 or less, 130 or less, 120 or less, 110 or less, 100 or less, 90 or less, 80 or less, 70 or less, 60 or less, 50 or less, 40 or less, 30 or less, 20 or less, 10 or less, or 5 or less).
- the sum of m and n can range from any of the minimum values described above to any of the maximum values described above.
- the sum of m and n can be from 1 to 154 (e.g., from 1 to 150, from 1 to 100, from 1 to 50, from 1 to 30, from 1 to 10, from 5 to 150, from 5 to 100, from 5 to 50, from 5 to 30, or from 5 to 10).
- the composition can be, for example, a solution of the isotopically labeled peptide in a solvent.
- solvents include alcohols (e.g., methanol, ethanol, isopropanol); esters (e.g., ethyl acetate); ketones (e.g., acetone); diethyl ether; dioxane; glycol ethers and glycol ether esters; tetrahydrofuran; dimethylformamide; acetonitrile; dimethyl sulfoxide; water, saline, aqueous buffers (e.g., PBS buffer), and combinations thereof.
- the composition can comprise an aqueous solution of the peptide.
- the isotopically labeled peptide can comprise at least 0.5% by weight (e.g., at least 1% by weight, at least 1.5% by weight, at least 2% by weight, at least 2.5%) by weight, at least 3% by weight, at least 3.5% by weight, at least 4% by weight, at least 4.5%) by weight, or at least 1% by weight of the composition.
- compositions comprising an isotopically labeled polypeptide that includes one or more ⁇ - ⁇ -methylamino-L-alanine (BMAA) residues (e.g., one or more BMAA residues that are not isotopically labeled) and one or more additional amino acid residues that are labeled with one or more stable isotopes ( 13 C, 15 N, and/or 18 0).
- BMAA ⁇ - ⁇ -methylamino-L-alanine
- each residue labeled with one or more stable isotopes in the polypeptide includes at least two (e.g., at least four, at least five, at least six, or more) stable isotopes.
- At least two (e.g., at least four, at least five, at least six, or more) of the carbon, nitrogen, and/or oxygen atoms in the residue can be isotopically labeled with a stable isotope.
- at least two (e.g., at least four, at least five, at least six, or more) of the carbon and/or nitrogen atoms in the residue can be isotopically labeled with a stable isotope.
- the isotopically labeled polypeptide can comprise at least 0.5% by weight of the composition.
- the polypeptide can include a single isotopically labeled residue. In other embodiments, the polypeptide can include two or more isotopically labeled residues (e.g., three or more isotopically labeled residues, four or more isotopically labeled residues, five or more isotopically labeled residues, or ten or more isotopically labeled residues). In some embodiments, the polypeptide can include a single BMAA residue. In other embodiments, the polypeptide can include two or more BMAA residues (e.g., three or more BMAA residues, four or more BMAA residues, five or more BMAA residues, or ten or more BMAA residues).
- the isotopically labeled polypeptide can be a peptide that includes one or more BMAA residues and a terminal amino acid residue (e.g., a terminal arginine residue) labeled with one or more stable isotopes ( 13 C, 15 N, and/or 18 0).
- a terminal amino acid residue e.g., a terminal arginine residue
- the composition can be, for example, a solution of the isotopically labeled peptide in a solvent.
- solvents include alcohols (e.g., methanol, ethanol, isopropanol); esters (e.g., ethyl acetate); ketones (e.g., acetone); diethyl ether; dioxane; glycol ethers and glycol ether esters; tetrahydrofuran; dimethylformamide; acetonitrile; dimethyl sulfoxide; water, saline, aqueous buffers (e.g., PBS buffer), and combinations thereof.
- the composition can comprise an aqueous solution of the peptide.
- the isotopically labeled peptide can comprise at least 0.5% by weight (e.g., at least 1% by weight, at least 1.5% by weight, at least 2% by weight, at least 2.5%) by weight, at least 3% by weight, at least 3.5% by weight, at least 4% by weight, at least 4.5%) by weight, or at least 1% by weight of the composition.
- the peptides described above can be above can be prepared using a variety of methods known in the art. For example, peptides can be prepared using the isotopically labeled compounds described herein via solid phase peptide synthesis.
- the proteins and peptides described above can also be prepared by chemical derivatization of one or more residues within the protein and peptide.
- a protein or peptide having a isotopically labeled ⁇ - ⁇ -methylamino-L-alanine (BMAA) residue can be prepared from a protein or peptide that includes a phosphoserine residue.
- the protein or peptide can be reacted to convert the phosphoserine residue to an ⁇ , ⁇ -unsaturated amino acid residue.
- the ⁇ , ⁇ -unsaturated amino acid residue can be reacted with methylamine (e.g., methylamine that is isotopically enriched with one or more stable isotopes), which undergoes a Michael -type addition to afford an isotopically labeled BMAA residue.
- This can involve, for example, reaction of the protein or peptide with methylamine-HCl (e.g., 1.0 M 13 C/ 15 N-labeled methylamine) and Ba(OH) 2 (e.g., 0.1 M Ba(OH) 2 ) in water/DMSO/EtOH (2:2: 1) at basic pH (pH 12.5) and elevated temperature (e.g., 37 °C). Once complete, the reaction can be quenched with acid (e.g., acetic acid).
- methylamine-HCl e.g., 1.0 M 13 C/ 15 N-labeled methylamine
- Ba(OH) 2 e.g., 0.1 M Ba(OH) 2
- acid e.g., acetic acid
- Full length natural or stable isotope labeled proteins comprising stable isotope labeled BMAA residues (e.g., incorporated at one or more specific sites within the protein) can be prepared by first preparing a phosphoserine-containing protein using an amber stop codon and a tRNA synthetase engineered to incorporate phosphoserine within the desired protein. See, for example, Rogerson, D. T. et al. "Efficient genetic encoding of
- isotopically labeled reagents including isotopically labeled small molecules and peptides, that can be used to detect and/or quantify ⁇ - ⁇ - methylamino-L-alanine (BMAA) in a protein selected from the validated targets in Table 6.
- BMAA ⁇ - ⁇ - methylamino-L-alanine
- the reagents can be used as stable isotope labeled standards in analytical methods, including in conjunction with mass spectrometry, to detect and/or quantify BMAA in a sample, such as a protein sample from a subject.
- polypeptide comprising a sequence that is at least 85% identical a sequence selected from SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID N0:31, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID N0:31, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID N0:31, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID N0:31, SEQ ID NO:24
- a polypeptide comprising a sequence selected from SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, SEQ ID NO:33, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, or SEQ ID NO:49, wherein at least one amino acid comprises a BMAA residue which is isotopically labeled and is defined by the formula below
- polypeptide comprising a sequence that is at least 85% identical a sequence selected from SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID N0:61, SEQ ID NO:62, SEQ ID NO:63,
- a polypeptide comprising a sequence selected from SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:71, SEQ ID NO:72, SEQ ID NO:73, SEQ ID NO:74, or SEQ ID NO:75, wherein at least one amino acid comprises a BMAA residue which is isotopically labeled and is defined by the formula below
- the compounds, peptides, proteins, and compositions described herein can be used detect and/or quantify BMAA in a SOD1 protein from a biological specimen (e.g., a sample from a patient suffering from neurodegenerative disease such as ALS), to accurately monitor BMAA exposure, to direct therapies, and in clinical diagnosis and prognosis.
- a biological specimen e.g., a sample from a patient suffering from neurodegenerative disease such as ALS
- the isotopically labeled reagents and compositions described herein can be used in a variety of analytical methods to detect and/or quantify BMAA, such as to detect and/or quantify BMAA in a biological specimen or sample such as a protein sample.
- the isotopically labeled compounds described herein can be used to quantify free BMAA (e.g., quantify free BMAA in an environmental sample or biological sample), quantify total levels of BMAA in a protein sample (for example, a SOD1 protein sample), and/or to quantify protein-specific BMAA incorporation (e.g., by upstream purification of the protein of interest prior to analysis).
- the isotopically labeled compounds described herein can also be utilized in a stable isotope labeling by amino acids in cell culture (SILAC) alone or in combination with other stable isotope labeled amino acids.
- SILAC amino acids in cell culture
- the isotopically labeled compounds described herein provide many analytical advantages over potential alternatives, such as deuterated BMAA, which does not co-elute and can undergo hydrogen-deuterium exchange in-solution or in the gas phase, significantly impacting identification and quantitation.
- a method for detecting ⁇ - ⁇ -methylamino-L-alanine (BMAA) in a SOD1 protein comprising (a) purifying SOD1 protein from a biological specimen to provide a purified SOD1 protein sample, (b) spiking the purified SOD1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below
- R represents hydrogen or an amine protecting group, and at least two of a C, C, C C, d C, f N " , g O, and h O are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis.
- At least three of a C, C, C C, d C, % g O, and h O are
- a C, C, C C, d C, e N, f N " , g O, and h O are isotopically labeled with a stable isotope.
- at least three of a C, C, C C, d C, and * ⁇ are isotopically labeled with a stable isotope.
- at least four of a C, C, C C, d C, and * ⁇ are isotopically labeled with a stable isotope.
- a C, C, C, d C, and * ⁇ are isotopically labeled with a stable isotope.
- the isotopically labeled compound is defined by the formula below
- R represents hydrogen or an amine protecting group; wherein the C isotopic enrichment factor for a C, C, C C, and d C is at least 25; and wherein the 15 N isotopic enrichment factor for e N and * ⁇ is at least 100.
- the 13 C isotopic enrichment factor for a C, C, C C, and d C is at least 80 and the 15 N isotopic enrichment factor for e N and * ⁇ is at least 200.
- R is hydrogen.
- R represents a 9- fluorenylmethyloxycarbonyl group.
- the purified SOD1 protein sample is hydrolyzed into amino acids for free BMAA analysis of SOD1.
- a method for detecting ⁇ - ⁇ -methylamino-L-alanine (BMAA) in a SOD1 protein comprising: (a) purifying SOD1 protein from a biological specimen to provide a purified SOD1 protein sample; (b) spiking the purified SOD1 protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled ⁇ - ⁇ -methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes; to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis.
- BMAA ⁇ - ⁇ -methylamino-L-alanine
- each of the one or more isotopically labeled BMAA residues is isotopically labeled with two or more stable isotopes. In one embodiment, each of the one or more isotopically labeled BMAA residues is defined by the formula below
- the 13 C isotopic enrichment factor for d C is at least 80 and the 15 N isotopic enrichment factor for * ⁇ is at least 200. In one embodiment, the 13 C isotopic enrichment factor for a C, C, and C C is at least 25. In one embodiment, the 13 C isotopic enrichment factor for a C, C, and C C is at least 80. In one embodiment, the 15 N isotopic enrichment factor for e N is at least 100. In one embodiment, the 15 N isotopic enrichment factor for e N is at least 200.
- the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 90%) identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 2.
- the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 2. In one embodiment, the purified SOD1 protein sample is digested with trypsin.
- a method of detecting or predicting amyotrophic lateral sclerosis in a subject comprising (a) purifying SOD1 protein from a biological specimen from a subject to provide a purified SOD1 protein sample; (b) spiking the purified SOD1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below
- R represents hydrogen or an amine protecting group, and at least two of a C, C, C C, d C, f N " , g O, and h O are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA level in the SOD1 protein sample by isotope dilution analysis; and (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA level in the SOD1 protein is greater than a normal reference value.
- At least three of a C, C, C C, d C, % g O, and h O are
- isotopically labeled with a stable isotope In one embodiment, at least four of a C, C, C C, d C, e N, f N " , g O, and h O are isotopically labeled with a stable isotope. In one embodiment, at least three of a C, C, C C, d C, e N, and * ⁇ are isotopically labeled with a stable isotope. In one embodiment, at least four of a C, C, C, d C, and * ⁇ are isotopically labeled with a stable isotope. In one embodiment, a C, C, C, d C, and * ⁇ are isotopically labeled with a stable isotope. In one embodiment, the isotopically labeled compound is defined by the formula below
- R represents hydrogen or an amine protecting group; wherein the C isotopic enrichment factor for a C, C, C C, and d C is at least 25; and wherein the 15 N isotopic enrichment factor for e N and * ⁇ is at least 100.
- the 13 C isotopic enrichment factor for a C, C, C C, and d C is at least 80 and the 15 N isotopic enrichment factor for 3 ⁇ 4 and * ⁇ is at least 200.
- R is hydrogen.
- R represents a 9-fluorenylmethyloxycarbonyl group.
- the SODl protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP-lysine, 4-hydroxynonenal sulfonation and nitrosylation.
- the SODl protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, and crotonaldehyde.
- the subject being identified for the presence or risk of amyotrophic lateral sclerosis comprises a BMAA level in the SODl protein that is at least 10% greater (e.g. at least 10% greater, at least 20% greater, at least 50% greater, at least 100% greater, or more) than the normal reference value.
- a method of detecting or predicting amyotrophic lateral sclerosis in a subject comprising (a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample; (b) spiking the purified SODl protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled ⁇ - ⁇ -methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA level in the SODl protein sample by isotope dilution analysis; and (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA-spiked sample.
- each of the one or more isotopically labeled BMAA residues is isotopically labeled with two or more stable isotopes. In one embodiment, each of the one or more isotopically labeled BMAA residues is defined by the formula below
- the 13 C isotopic enrichment factor for d C is at least 25; and wherein the 15 N isotopic enrichment factor for * ⁇ is at least 100.
- the 13 C isotopic enrichment factor for d C is at least 80 and the 15 N isotopic enrichment factor for * ⁇ is at least 200.
- the 13 C isotopic enrichment factor for a C, C, and C C is at least 25.
- the 13 C isotopic enrichment factor for a C, C, and C C is at least 80.
- the 15 N isotopic enrichment factor for e N is at least 100. In one embodiment, the 15 N isotopic enrichment factor for e N is at least 200.
- the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 90%) identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 2.
- the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 2.
- the SOD1 protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP-lysine, 4-hydroxynonenal sulfonation and nitrosylation.
- the SOD1 protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, and crotonaldehyde.
- a method of preventing or treating amyotrophic lateral sclerosis in a subject comprising (a) purifying SOD1 protein from a biological specimen from a subject to provide a purified SOD1 protein sample; (b) spiking the purified SOD1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below
- R represents hydrogen or an amine protecting group, and at least two of a C, C, C C, d C, f N " , g O, and h O are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the SOD1 protein is greater than a normal reference value; and (f) administering to the subject L-serine in an amount sufficient to prevent or treat the amyotrophic lateral sclerosis.
- At least three of a C, C, C C, d C, % g O, and h O are
- isotopically labeled with a stable isotope In one embodiment, at least four of a C, C, C C, d C, e N, f N " , g O, and h O are isotopically labeled with a stable isotope. In one embodiment, at least three of a C, C, C C, d C, e N, and * ⁇ are isotopically labeled with a stable isotope. In one embodiment, at least four of a C, C, C, d C, and * ⁇ are isotopically labeled with a stable isotope. In one embodiment, a C, C, C, d C, and * ⁇ are isotopically labeled with a stable isotope. In one embodiment, the isotopically labeled compound is defined by the formula below
- R represents hydrogen or an amine protecting group; wherein the C isotopic enrichment factor for a C, C, C C, and d C is at least 25; and wherein the 15 N isotopic enrichment factor for e N and * ⁇ is at least 100.
- the 13 C isotopic enrichment factor for a C, C, C C, and d C is at least 80 and the 15 N isotopic enrichment factor for 3 ⁇ 4 and * ⁇ is at least 200.
- R is hydrogen.
- R represents a 9-fluorenylmethyloxycarbonyl group.
- the SODl protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP-lysine, 4-hydroxynonenal sulfonation and nitrosylation.
- the SODl protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, and crotonaldehyde.
- a method of preventing or treating amyotrophic lateral sclerosis in a subject comprising (a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample; (b) spiking the purified SODl protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled ⁇ - ⁇ -methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the SODl protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels
- each of the one or more isotopically labeled BMAA residues is isotopically labeled with two or more stable isotopes. In one embodiment, each of the one or more isotopically labeled BMAA residues is defined by the formula below
- the 13 C isotopic enrichment factor for d C is at least 25; and wherein the 15 N isotopic enrichment factor for * ⁇ is at least 100. In one embodiment, at least 80 and the 15 N isotopic enrichment factor for * ⁇ is at least 200. In one embodiment, the 13 C isotopic enrichment factor for a C, C, and C C is at least 25. In one embodiment, the 13 C isotopic enrichment factor for a C, C, and C C is at least 80. In one embodiment, the 15 N isotopic enrichment factor for e N is at least 100. In one embodiment, the 15 N isotopic enrichment factor for e N is at least 200. In one embodiment, the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 1.
- the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 2.
- the SOD1 protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP-lysine, 4-hydroxynonenal sulfonation and nitrosylation.
- the SOD1 protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, and crotonaldehyde.
- the patient may be treated with L-serine. In some embodiments, after the detection of BMAA in SOD1, the patient may be treated with L-serine, or a precursor, derivative or conjugate of L-serine.
- riluzole an anti-glutamate agent
- riluzole an anti-glutamate agent
- riluzole is believed to reduce damage to motor neurons by decreasing the release of glutamate.
- Clinical trials with ALS patients showed that riluzole prolongs survival by several months, mainly in those with difficulty swallowing. The drug can also extend the time before an individual needs ventilation support.
- Other anti-glutamate agents such as Talampanel and Memantine, have also been proposed as potential treatments for ALS.
- physicians can also prescribe medications to help reduce symptoms of ALS, such as fatigue, ease muscle cramps, control spasticity, and reduce excess saliva and phlegm.
- the patient may be treated with riluzole.
- talampanel or memantine after the detection of BMAA in SOD1
- the ALS is sporadic ALS. In one embodiment, the ALS is familial ALS.
- the SOD1 protein, the BMAA-spiked sample, or a combination thereof can be prepared for analysis by mass spectrometry by a method comprising chemical reactions with flight enhancers, chemical fragmentation, enzymatic digestion, purification, or a combination thereof.
- the isotopically labeled compounds described herein can be used to detect and quantify BMAA obtained from the hydrolytic cleavage of amino acids from a target protein as well as for identification and quantification of BMAA incorporated into proteins at the peptide and protein level utilizing isotope dilution mass spectrometry.
- proteins and peptides described herein can be used as diagnostic markers, to monitor exposure to BMAA, and/or to identify disease relevant and functionally important proteins in which BMAA has been incorporated in specific sequence locations.
- the proteins and peptides described herein can be utilized in a protein-cleavage-isotope dilution workflow to confirm the primary structure, and to accurately and precisely quantify BMAA incorporated into peptides produced via chemical or enzymatic digestion of specific proteins.
- proteins and peptides can also be employed in separation schemes, followed by intact mass spectrometry or peptide level detection and quantification through chemical or proteolytic digestion. These proteins and peptides can also be used to produce antibodies, aptamers and/or other affinity reagents which can be utilized for other diagnostic tools and applications. These proteins and peptides can also be used in biophysical studies, providing a method for studying the effect of this non-protein amino acid incorporation in proteins.
- antibodies can be produced that have affinity for the SODl protein, or fragment of the SODl protein, containing a BMAA residue. In one embodiment, the BMAA residue is substituted at the Serl07 position in SODl .
- antibodies can be produced that have affinity for the SODl protein, or fragment of the SODl protein, containing a BMAA residue, wherein the antibodies do not have significant affinity for the corresponding SODl protein lacking the BMAA residue.
- the antibody recognizes an epitope of SODl comprising BMAA at the Serl07 position. In some embodiments, the antibody recognizes an epitope of SODl that does not comprise BMAA at the Serl07 position.
- BMAA ⁇ - ⁇ -methylamino-L-alanine
- a method for detecting ⁇ - ⁇ -methylamino-L-alanine (BMAA) in a protein comprising (a) purifying the protein from a biological specimen to provide a purified protein sample, (b) spiking the purified protein sample with a defined amount of an isotopically labeled compound defined by the formula below
- R represents hydrogen or an amine protecting group, and at least two of a C, C, C C, d C, f N " , g O, and h O are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the protein sample by isotope dilution analysis.
- provided herein is a method for detecting ⁇ - ⁇ -methylamino-L-alanine
- BMAA in a protein, comprising: (a) purifying the protein from a biological specimen to provide a purified protein sample; (b) spiking the purified protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled ⁇ - ⁇ -methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes; to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the protein sample by isotope dilution analysis.
- BMAA isotopically labeled ⁇ - ⁇ -methylamino-L-alanine
- provided herein is a method of detecting or predicting
- amyotrophic lateral sclerosis in a subject comprising (a) purifying a protein from a biological specimen from a subject to provide a purified protein sample; (b) spiking the purified protein sample with a defined amount of an isotopically labeled compound defined by the formula below
- R represents hydrogen or an amine protecting group, and at least two of a C, C, C C, d C, f N " , g O, and h O are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA level in the protein sample by isotope dilution analysis; and (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA level in the protein is greater than a normal reference value.
- a method of preventing or treating amyotrophic lateral sclerosis in a subject comprising (a) purifying a protein from a biological specimen from a subject to provide a purified protein sample; (b) spiking the purified protein sample with a defined amount of an isotopically labeled compound defined by the formula below
- R represents hydrogen or an amine protecting group, and at least two of a C, C, C C, d C, f N " , g O, and h O are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the protein is greater than a normal reference value; and (f) administering to the subject L- serine in an amount sufficient to prevent or treat the amyotrophic lateral sclerosis.
- a method of preventing or treating amyotrophic lateral sclerosis in a subject comprising (a) purifying a protein from a biological specimen from a subject to provide a purified protein sample; (b) spiking the purified protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled ⁇ - ⁇ -methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the protein is greater than
- proteins or polypeptides used in the methods described herein can comprise any of the proteins or protein fragments described in Table 6 or Table 7 below.
- the aqueous layer was then acidified with an aqueous solution of 10%) hydrochloric acid, and the resultant white precipitate was filtered to afford 27.2 mg of the product.
- the white solid was dissolved in methanol (0.27 mL), and a solution of 35% aqueous solution of formaldehyde (18.2 (jL, 0.244 mmol) was added. The reaction was stirred for an additional 15 min, and cooled to 0 °C. NaBH 4 (9.32 mg, 0.244 mmol) was then added, and the mixture was stirred for 15 min.
- Beta-Casein A well-characterized, highly phosphorylated protein, Beta-Casein, was utilized as a positive control.
- the intact protein was reacted with methylamine under the same conditions for peptide synthesis, converting phosphoserines to BMAA.
- Purified SOD1 from 3 patients with sporadic ALS and 3 healthy controls were washed on a lOkDa FASP filter (Millipore) and concentrated to 50 20 ⁇ g of protein was hydrolyzed using 50 ⁇ . of 6N HC1 and incubating at 110°C for 18 hours. 5 ⁇ ⁇ 60.9mM SIL BMAA was spiked into the samples post-hydrolysis. Samples were then dried and resuspended in 100 ⁇ .
- the peptide sequence DGVADVSIEDSVISLSGDHCIIGR (SEQ ID NO: 17) with highlighted (bold and underlined) Serine phosphorylated, carbamidomethylated Cysteine and 13 C 6 15 N4 isotopically labeled Arginine was obtained from New England Peptide. This sequence was validated by accurate intact mass ( Figure 2) and MS/MS ( Figure 3) which allowed for site specific confirmation of phosphorylation. A solution of water, DMSO, EtOH solution in 2:2: 1 mixture containing 0.1M Barium Hydroxide and 1M Methylamine pH 12.5 was used for derivatization of the SIL peptide.
- Each sample was diluted 2-fold in a denaturing solution of 100 mM DTT (15.43 mg/mL) and 8 M urea. Then the samples were incubated at 56°C for 30 minutes. After incubation enough alkylation solution, made from 1 M iodoacetamide (184.96 mg/mL) and 8 M urea, was added to give each sample a final iodoacetamide concentration of 200 mM. Then the samples were incubated at 37°C for an hour. The appropriate amount for each sample was pipetted into an Amicon Ultra-0.1 MWCO-filter unit (10 kDa, Millipore).
- Samples were frozen at -80°C and lyosphilized in a speedvac. Immediately prior to analysis samples were reconstituted in 90 uL of Zwittergent 3-16. A BMAA peptide dry aliquot of 5ug was resuspended in 500 uL of Zwittergent. A 45 uL aliquot of the protein digest was then spiked with 5 uL of BMAA peptide standard for LC-MS analysis.
- LC-MS/MS by parallel reaction monitoring was used to isolate, fragment and perform accurate mass measurements of our target endogenous BMAA peptide and SIL BMAA peptides.
- Direct inject column configuration on a Thermo Easy nano-LC 1000 system coupled to a QExactive High Field mass spectrometer was used.
- Analytical columns were made using 75 um x 15 cm PicoFrit columns (New Objective, Woburn, MA) which were self-packed with Kinetex CI 8 2.6-um particles (phenomenex, Torrance, CA, USA). The samples were loaded with a 10 uL injection volume of mobile phase A (98% water, 2% acetonitrile, and 0.2% formic acid) with a max pressure of 500 Bar.
- the analysis had the following parameters: a spray voltage of +1750.00, capillary temperature of 325°C, a S-lens RF level of 65.00, a MS/MS resolving power of 15,000, a le6 AGC target, a 1,000ms fill time, a 2.5 m/z isolation window with an isolation offset of 1.0 m/z, a fixed first mass of 125.0 m/z, and a 20, 30 stepped normalized collision energy. There was an inclusion list containing 846.4228 m/z and 843.0867 m/z.
- the SODl protein was purified from plasma in each of these patient samples.
- the SODl protein can be purified by one of skill in the art (for example, purification using an antibody directed to SODl or using a protein that has binding affinity for SODl).
- the intact SODl protein was analyzed, while in other experiments, the SODl protein was digested with trypsin before further analysis (See Figure 10).
- the Thermo Easy nanoLC setup included: 75 ⁇ inner diameter 15 cm column utilizing CI 8 stationary phase for reversed- phase separation of peptides base on hydrophobicity.
- the flow rate was 300 nL/min.
- 2 ⁇ ⁇ of digested (trypsin) SODl containing -200 ng was injected directly onto the column using a Mobile phase A (98% water, 2% Acetonitrile (ACN), 0.2% formic acid) and a Mobile phase B (98% ACN, 2% water, 0.2% formic acid).
- a gradient elution was performed from 5%-40%B over 30 min.
- Protein DB is digested in silico using rules for tryptic digestion (Cleaves C-terminal to R/K except when preceded by P) and allowing for potential missed cleavages (up to 3).
- the search tolerance allowed for 5 ppm MMA (mass measurement accuracy) for peptide, 0.02 Da for fragment ions.
- SNPs single nucleotide polymorphisms
- SNPs single nucleotide polymorphisms in Table 5 include: G12(Gly->Arg). The additional SNPs identified in Table 5 are novel.
- the consequences of BMAA incorporation could include, for example, a decrease in the stability of the homodimer, an increase in the likelihood of SODl to aggregate (e.g., trimers which are very toxic), a decrease in the ability of SODl to bind metals, SODl misfolding, a decrease or alteration of enzymatic activity, and/or tRNA synthetases have sequence variation altering their specificity.
- Brain tissue samples of 12 matched ALS/healthy control samples were obtained from Emory University.
- l OOx Halt protease/phosphatase inhibitor was diluted to 1 x in a lysis buffer which comprised 8 M urea and 100 mM ammonium bicarbonate at a pH of 7.0.
- Samples were blended in a Bullet Blender with 500 ⁇ _, of lysis buffer and 750 ⁇ g of stainless steel beads for 15 minutes at a setting of 3 while refrigerated.
- a Dismembranator Sonicator was used three times for 5 seconds with 15 second breaks.
- Each sample was diluted 4-fold with water such that the concentration of Urea was 2M.
- the protein concentration of each sample was then determined using a Bradford Assay.
- the retained volume was diluted three times with 400 ⁇ _, of a digesting buffer of 100 mM ammonium bicarbonate at pH 7.0 and spun for 15 minutes at 14,000 x g and 20 °C between each buffer addition. Filters were then transferred to a clean tube. 2 ⁇ g SIL SOD1 surrogate peptide containing BMAA was reconstituted in 500 ⁇ . of 0.001% Zwittergent 3- 16, then 5 ⁇ _, was spiked into each sample. The samples were digested using 45 ⁇ _, of an enzyme solution containing 100 ⁇ g/ml modified trypsin and 100 mM ammonium
- Analytical columns were made using 75 um x 15 cm PicoFrit columns (New Objective, Woburn, MA) which were self-packed with Kinetex C18 2.6-um particles (phenomenex, Torrance, CA, USA).
- the samples were loaded with a 8 uL injection volume of mobile phase A (98% water, 2% acetonitrile, and 0.2% formic acid) with a max pressure of 600 Bar.
- a 4 hour gradient was performed at 300nL/min, going from 2% mobile phase B (80% Acetonitrile, 20% water, 0.2% formic acid), to 40%.
- a top 20 data dependent acquisition was performed with the following MS parameters: a spray voltage of +2kV, capillary temperature of 325°C, a S-lens RF level of 65.00, an MS resolving power of 120k and an MS/MS resolving power of 15,000, a 3e6 MS AGC target with a max fill time of 50ms and 1E5 MS/MS AGC with a max fill time of 30ms and an intensity threshold of 3.3E4.
- the data was processed through proteome discoverer 2.0 and searched using the Uniprot human proteome FASTA database.
- Protein DB was digested in silico using rules for tryptic digestion (Cleaves C-terminal to R/K except when preceded by P) and allowing for potential missed cleavages (up to 3).
- the search tolerance allowed for 5 ppm MMA (mass measurement accuracy) for peptide, 0.02 Da for fragment ions.
- the following variable modifications were searched:
- MSDILRELLCV*S*EK (SEQ phosphatase protein
- compositions and methods of the appended claims are not limited in scope by the specific compositions and methods described herein, which are intended as illustrations of a few aspects of the claims. Any compositions and methods that are functionally equivalent are intended to fall within the scope of the claims. Various modifications of the compositions and methods in addition to those shown and described herein are intended to fall within the scope of the appended claims. Further, while only certain representative compositions and method steps disclosed herein are specifically described, other
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Urology & Nephrology (AREA)
- Physics & Mathematics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Pathology (AREA)
- Cell Biology (AREA)
- Bioinformatics & Computational Biology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Spectroscopy & Molecular Physics (AREA)
- General Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Peptides Or Proteins (AREA)
- Other Investigation Or Analysis Of Materials By Electrical Means (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Provided herein are isotopically labeled reagents, including isotopically labeled small molecules and peptides, that can be used to detect and/or quantify β-N-methylamino-L-alanine (BMAA) in the Cu/Zn Superoxide Dismutase 1 (SOD1) protein. Further provided are methods for detecting, preventing, or treating amyotrophic lateral sclerosis in a subject using isotopically labeled reagents to detect and/or quantify β-N-methylamino-L-alanine (BMAA) in the Cu/Zn Superoxide Dismutase 1 (SOD1) protein. Further provided are isotopically labeled reagents and methods for detecting BMAA in additional proteins from patient samples.
Description
Compositions and Methods for Detection of Beta N Methylamino L Alanine in Cu Zn Superoxide Dismutase 1
CROSS REFERENCE TO RELATED APPLICATIONS
This application claims the benefit of U.S. Provisional Patent Application Serial No. 62/368,437, filed July 29, 2016, and U.S. Provisional Patent Application Serial No.
62/368,562, filed July 29, 2016, each of which are expressly incorporated herein by reference.
BACKGROUND
The non-protein amino acid β-Ν-Methylamino-L- Alanine (BMAA) is
biosynthetically produced in cyanobacteria. Human exposure to this unnatural amino acid has been linked to neurological disorders, including amyotrophic lateral sclerosis (ALS) and parkinsonism dementia complex (PDC) like symptoms. Dietary exposure of BMAA in primates has shown neurofibrillary tangles (NFT) and β-amyloid plaques, hallmark signs of neuropathological disease. Additionally, cell culture studies have shown that exogenous exposure to BMAA can result in incorporation of this non-protein amino acid in place of L- serine. Supplemental treatment with L-serine has been shown to reduce the rate of BMAA incorporation and regression of neuropathological symptoms.
While these findings suggest that BMAA can be incorporated into proteins, efforts to further study the role of BMAA in biological systems has been hampered by the limited availability of suitable analytical probes and methods. Improved analytical tools and methods are needed to fully understand the qualitative and quantitative nature of incorporation of BMAA in proteins, particularly human proteins, as well as the mechanism and functional consequences of this process.
Because of the lack of appropriate reagents and methods, the identification of endogenous BMAA incorporation in patients suffering from neurological disorders, including amyotrophic lateral sclerosis (ALS), has not yet been shown. Thus, improved compositions and methods are needed for the detection of BMAA incorporation into proteins implicated in neurological disorders.
SUMMARY
Provided herein are isotopically labeled reagents, including isotopically labeled small molecules and peptides, that can be used to detect and/or quantify β-Ν-methylamino- L-alanine (BMAA) in the Cu/Zn Superoxide Dismutase 1 (SODl) protein. Using these novel reagents, the inventors have identified the incorporation of BMAA into the SODl protein in samples from patients suffering from amyotrophic lateral sclerosis (ALS). The reagents can be used as stable isotope labeled standards in analytical methods, including in conjunction with mass spectrometry, to detect and/or quantify BMAA in a sample, such as a protein sample from a subject. In addition, the inventors have developed isotopically labeled reagents that can detect the incorporation of BMAA into several additional proteins in patient samples.
In one aspect, provided herein is a polypeptide comprising a sequence that is at least 85% identical to SEQ ID NO: 1, wherein amino acid position 107 comprises a BMAA residue which is isotopically labeled and is defined by the formula below
dCH3
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100.
In one aspect, provided herein is a polypeptide comprising a sequence that is at least 85%) identical to SEQ ID NO: 2, wherein amino acid position 107 comprises a BMAA residue which is isotopically labeled and is defined by the formula below
dCH3
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100.
In another aspect, provided herein is a method for detecting P-N-methylamino-L- alanine (BMAA) in a SOD1 protein, comprising (a) purifying SOD1 protein from a biological specimen to provide a purified SOD1 protein sample, (b) spiking the purified SOD1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below
wherein R represents hydrogen or an amine protecting group, and at least two of aC, C, CC, dC, fN", gO, and hO are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis.
In one aspect, provided herein is a method for detecting β-Ν-methylamino-L-alanine (BMAA) in a SOD1 protein, comprising: (a) purifying SOD1 protein from a biological specimen to provide a purified SOD1 protein sample; (b) spiking the purified SOD1 protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled β-Ν-methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes; to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis.
In a further aspect, provided herein is a method of detecting or predicting amyotrophic lateral sclerosis in a subject, comprising (a) purifying SOD1 protein from a biological specimen from a subject to provide a purified SOD1 protein sample; (b) spiking the purified SOD1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below
90
\
FNH
DCH3
wherein R represents hydrogen or an amine protecting group, and at least two of aC, C, CC, dC, fN", gO, and hO are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA level in the SODl protein sample by isotope dilution analysis; and (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA level in the SODl protein is greater than a normal reference value.
In another aspect, provided herein is a method of detecting or predicting
amyotrophic lateral sclerosis in a subject, comprising (a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample; (b) spiking the purified SODl protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled β-Ν-methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA level in the SODl protein sample by isotope dilution analysis; and (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA level in the SODl protein is greater than a normal reference value.
In one aspect, provided herein is a method of preventing or treating amyotrophic lateral sclerosis in a subject, comprising (a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample; (b) spiking the purified SODl protein sample with a defined amount of an isotopically labeled compound defined by the formula below
90
\
FNH
DCH3
wherein R represents hydrogen or an amine protecting group, and at least two of aC, C, CC, dC, fN", gO, and hO are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the SODl protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the SODl protein is greater than a normal reference value; and (f) administering to the subject L-serine in an amount sufficient to prevent or treat the amyotrophic lateral sclerosis.
In one final aspect, provided herein is a method of preventing or treating
amyotrophic lateral sclerosis in a subject, comprising (a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample; (b) spiking the purified SODl protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled β-Ν-methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the SODl protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the SODl protein is greater than a normal reference value; and (f) administering to the subject L-serine in an amount sufficient to prevent or treat the amyotrophic lateral sclerosis.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 is an illustration of an example procedure used to convert a phosphoserine- containing peptide to BMAA-containing peptide. The peptide sequence shown in FIG. 1 is unique to superoxide dismutase 1 (SODl).
FIGS. 2A-2B illustrate the intact mass of stable isotope-labeled (SIL)
phosphopeptide substrate and BMAA peptide product.
FIG. 3 illustrates the tandem mass spectrum of the phosphorylated serine-containing stable isotope-labeled peptide.
FIG. 4 illustrates the tandem mass spectrum of a BMAA-containing stable isotope- labeled peptide, confirming localization of modification.
FIG. 5 demonstrates that co-eluting fragments confirm identity of the BMAA- containing peptide. BMAA- and phosphoserine-containing peptides have distinct retention times. The BMAA-containing peptide appears to have two peaks which suggests L and D isomers of the BMAA peptide have been produced.
FIG. 6 illustrates the conserved peak area of fragments specific to SIL BMAA peptide that allow for confident identification of endogenous peptide.
FIG. 7 is a plot showing that the elution time of SIL BMAA peptide is necessary for correct identification of endogenous peptide. Without this, the incorrect peak which is also within 5ppm mass accuracy of the BMAA peptide of interest might be selected.
FIG. 8 demonstrates the ability of mass spectrometry to accurately identify endogenous BMAA-containing peptide in SOD1 protein digest obtained from ALS erythrocytes.
FIG. 9 is a plot illustrating the co-elution of endogenous and stable isotope-labeled BMAA containing peptides. Co-elution aids in confident identification.
FIG. 10 is a schematic showing the method of filter aided sample preparation for bottom-up protein characterization.
FIG. 11 is a schematic showing the post-translational modifications identified with high confidence in SOD1. The amino acid numbering shown in the figure does not include the starting methionine.
FIG. 12 is a schematic showing the post-translational modifications identified with medium confidence in SOD1. The amino acid numbering shown in the figure does not include the starting methionine.
FIG. 13 illustrates the tandem mass spectrum of a BMAA-containing stable isotope- labeled peptide. Fragment ions corresponding to the endogenous peptide with BMAA were found at the expected location, confirming localization of modification.
FIG. 14 illustrates the tandem mass spectrum of BMAA containing stable isotope- label (13C4 15N2 β-Ν-Methylamino-L-Alanine, or Compound 3).
DETAILED DESCRIPTION
Provided herein are isotopically labeled reagents, including isotopically labeled small molecules and peptides, that can be used to detect and/or quantify β-Ν-methylamino- L-alanine (BMAA) in the Cu/Zn Superoxide Dismutase 1 (SOD1) protein. Using these novel reagents, the inventors have identified the incorporation of endogenous BMAA into the SOD1 protein in samples from patients suffering from amyotrophic lateral sclerosis (ALS). The reagents can be used as stable isotope labeled standards in analytical methods, including in conjunction with mass spectrometry, to detect and/or quantify BMAA in a sample, such as a protein sample from a subject. In addition, the inventors have developed isotopically labeled reagents that can detect the incorporation of BMAA into several additional proteins in patient samples.
As used herein, "protein" and "polypeptide" are used synonymously to mean any peptide-linked chain of amino acids, regardless of length or post-translational modification, e.g., glycosylation or phosphorylation. Amino acids include Alanine (Ala, A), Asparagine (Asn, N), Cysteine (Cys, C), Glutamine (Gin, Q), Glycine (Gly, G), Isoleucine (He, I), Leucine (Leu, L), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V), Histidine (His, H), Arginine (Arg, R), Lysine (Lys, K), Aspartic acid (Asp, D), and
Glutamic acid (Glu, E). β-Ν-methylamino-L-alanine (BMAA) is represented using the letter B in a peptide sequence, unless otherwise indicated in the text.
As used herein, a "normal reference value" refers to a numerical value that is determined experimentally from an unaffected individual, or a population of unaffected individuals, for comparison to the value from an affected individual, or population of affected individuals (for example, individuals affected by ALS). In some embodiments, the "normal reference value" being measured is from a healthy control subject that is not affected by ALS, or from a population of healthy control subjects that are not affected by ALS.
Compounds and Compositions
Provided herein is a polypeptide comprising a sequence that is at least 85% identical to SEQ ID NO: 1, wherein amino acid position 107 comprises a BMAA residue which is isotopically labeled and is defined by the formula below
dC'H Ί,3
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100.
In one embodiment, the 13C isotopic enrichment factor for dC is at least 80 and the 15N isotopic enrichment factor for *Ν is at least 200. In one embodiment, the 13C isotopic enrichment factor for aC, C, and CC is at least 25. In one embodiment, 13C isotopic enrichment factor for aC, C, and CC is at least 80. In one embodiment, 15N isotopic enrichment factor for eN is at least 100. In one embodiment, 15N isotopic enrichment factor for ¾ is at least 200.
In one embodiment, the sequence is at least 90% identical to SEQ ID NO: 1. In one embodiment, the sequence is at least 95% identical to SEQ ID NO: 1. In one embodiment, the sequence is at least 99% identical to SEQ ID NO: 1. In one embodiment, the sequence is identical to SEQ ID NO: 1.
In one aspect, provided herein is a polypeptide comprising a sequence that is at least
85%) identical to SEQ ID NO: 2, wherein amino acid position 107 comprises a BMAA residue which is isotopically labeled and is defined by the formula below
\
fNH dC'H Ί,3
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100.
In one embodiment, the 13C isotopic enrichment factor for dC is at least 80 and the 15N isotopic enrichment factor for *Ν is at least 200. In one embodiment, the 13C isotopic enrichment factor for aC, C, and CC is at least 25. In one embodiment, the 13C isotopic enrichment factor for aC, C, and CC is at least 80. In one embodiment, the 15N isotopic
enrichment factor for eN is at least 100. In one embodiment, the 15N isotopic enrichment factor for eN is at least 200.
In one embodiment, the sequence is at least 90% identical to SEQ ID NO: 2. In one embodiment, the sequence is at least 95% identical to SEQ ID NO: 2. In one embodiment, the sequence is at least 99% identical to SEQ ID NO: 2. In one embodiment, the sequence is identical to SEQ ID NO: 2.
In one embodiment, the sequence is at least 90% identical to SEQ ID NO: 3. In one embodiment, the sequence is at least 95% identical to SEQ ID NO: 3. In one embodiment, the sequence is at least 99% identical to SEQ ID NO: 3. In one embodiment, the sequence is identical to SEQ ID NO: 3.
SEQ ID NO: 1 = Human SOD1 protein sequence with BMAA at position 107
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFG DNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLB GDHCIIGRTL V VHEK ADDLGKGGNEE S TKTGN AGSRL AC GVIGI AQ
Note that the BMAA sequence at position 107 (in bold) replaces the serine that is normally present in the wild type SOD1 sequence in SEQ ID NO: 1. The BMAA occurs at position 107 when the initial methionine is not included in the peptide sequence, but occurs at position 108 when the initial methionine is included in the sequence.
Additional sequences for polypeptides that can be used as reagents in methods for detection of BMAA incorporation into the SOD1 protein include:
SEQ ID NO: 2 = DGVAD VSIED S VISLBGDHCIIGR
SEQ ID NO: 3 = HVGDLGNVTADKDGVADVSIEDSVISLBGDHCIIGR (1 missed cleavage)
Where C is Carb ami dom ethyl ated Cysteine (alkylated during sample preparation)
SEQ ID NO: 4 = Human SOD1 wild-type protein sequence.
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFG DNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLS GDHCIIGRTL V VHEK ADDLGKGGNEE S TKTGN AGSRL AC GVIGI AQ
SEQ ID NO: 5 = Human SOD1 protein sequence with BMAA at position 108 (with initial methionine)
MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEF GDNT AGCT S AGPHFNPLSRKHGGPKDEERHVGDLGNVT ADKDGV AD VSIED S VISL BGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Note that the BMAA sequence at position 108 (in bold) replaces the serine that is normally present in the wild type SOD1 sequence in SEQ ID NO: 5. The BMAA occurs at position 108 when the initial methionine is included in the peptide sequence, but occurs at position 107 when the initial methionine is not included in the sequence.
In one embodiment, the sequence is at least 90% identical to SEQ ID NO: 5. In one embodiment, the sequence is at least 95% identical to SEQ ID NO: 5. In one embodiment, the sequence is at least 99% identical to SEQ ID NO: 5. In one embodiment, the sequence is identical to SEQ ID NO: 5.
SEQ ID NO: 6 = Human SOD1 wild-type protein sequence (with initial methionine)
MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEF GDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISL S GDHCIIGRTL VVHEK ADDLGKGGNEE S TKTGN AGSRL AC GVIGI AQ
In one embodiment, the sequence is at least 90% identical to SEQ ID NO: 6. In one embodiment, the sequence is at least 95% identical to SEQ ID NO: 6. In one embodiment, the sequence is at least 99% identical to SEQ ID NO: 6. In one embodiment, the sequence is identical to SEQ ID NO: 6.
In certain embodiments, at least two (e.g., at least three, at least four, at least five, or all six) of aC, C, CC, dC, and *Ν are isotopically labeled with a stable isotope. In particular embodiments, all of aC, C, CC, dC, eN, and *Ν are isotopically labeled with a stable isotope.
The term "isotopic enrichment factor," as used herein, refers to the ratio between the isotopic abundance (e.g.., 13C, 15N, or 180) at a specified position in a compound and the naturally occurring abundance of that isotope. The naturally occurring abundance of 13C is
1.1%. The naturally occurring abundance of 15N is 0.37%. The naturally occurring abundance of 180 is 0.204%.
In some embodiments, the 13C isotopic enrichment factor for aC, C, CC, and dC is at least 25 (27.5% 13C incorporation at each position), at least 30 (33% 13C incorporation at each position), at least 35 (38.5% 13C incorporation at each position), at least 40 (44% 13C incorporation at each position), at least 45 (49.5% 13C incorporation at each position), at least 50 (55% 13C incorporation at each position), at least 55 (60.5% 13C incorporation at each position), at least 60 (66% 13C incorporation at each position), at least 65 (71.5% 13C incorporation at each position), at least 70 (77% 13C incorporation at each position), at least 75 (82.5%) 13C incorporation at each position), at least 80 (88% 13C incorporation at each position), at least 85 (93.5% 13C incorporation at each position), or at least 90 (99% 13C incorporation at each position).
In some embodiments, the 15N isotopic enrichment factor for eN and *Ν is at least 100 (37%) 15N incorporation at each position), at least 110 (40.7% 15N incorporation at each position), at least 120 (44.4% 15N incorporation at each position), at least 130 (48.1% 15N incorporation at each position), at least 140 (51.8% 15N incorporation at each position), at least 150 (55.5% 15N incorporation at each position), at least 160 (59.2% 15N incorporation at each position), at least 170 (62.9% 15N incorporation at each position), at least 180 (66.6%) 15N incorporation at each position), at least 190 (70.3% 15N incorporation at each position), at least 200 (74% 15N incorporation at each position), at least 210 (77.7% 15N incorporation at each position), at least 220 (81.4% 15N incorporation at each position), at least 230 (85.1% 15N incorporation at each position), at least 240 (88.8% 15N incorporation at each position), at least 250 (92.5% 15N incorporation at each position), at least 260 (96.2%) 15N incorporation at each position), or at least 265 (98.05%) 15N incorporation at each position).
In some embodiments, the polypeptides can be comprised in a composition. The composition can be, for example, a solution of the isotopically labeled compound in a solvent. Non-limiting examples of solvents include aliphatic solvents (e.g., pentane, hexanes, cyclohexane); aromatic and/or alkylated aromatic solvents such as benzene, toluene, xylene; hydrocarbon solvents; dichloromethane, chloroform, alcohols (e.g., methanol, ethanol, isopropanol); esters (e.g., ethyl acetate); ketones (e.g., acetone); diethyl ether; dioxane; glycol ethers and glycol ether esters; tetrahydrofuran; dimethylformamide; acetonitrile; dimethyl sulfoxide; water, saline, aqueous buffers (e.g., PBS buffer), and
combinations thereof. In certain examples, the composition can comprise an aqueous solution of the compound.
In some embodiments, the isotopically labeled compound can comprise at least 0.5% by weight (e.g., at least 1% by weight, at least 1.5% by weight, at least 2% by weight, at least 2.5% by weight, at least 3% by weight, at least 3.5% by weight, at least 4% by weight, at least 4.5% by weight, or at least 1% by weight of the composition.
The isotopically labeled compounds described above can be prepared using methods known in the art. Representative methodologies for the preparation of certain active agents are described below. The appropriate route for synthesis of a given compound agent can be selected in view of the structure of the compound as a whole as it relates to compatibility of functional groups, protecting group strategies, and the presence of labile bonds. In addition to the synthetic methodologies discussed below, alternative reactions and strategies useful for the preparation of the compounds disclosed herein are known in the art. See, for example, March, "Advanced Organic Chemistry," 5th Edition, 2001, Wiley-Interscience Publication, New York).
Isotopically labeled amino acids, such as 13C/15N-labeled asparagine, are
commercially available, and can serve as convenient starting materials for the isotopically labeled compounds described herein. Scheme 1 below illustrates an example method for the preparation of BMAA from asparagine. Compounds having a desired isotopic labeling (e.g., incorporating stable isotopes at particular positions within the compound) can be prepared by selecting reagents that include stable isotope labels at the appropriate positions with their framework (e.g., 13C/15N-labeled asparagine).
In some embodiments, the BMAA amino acid residue is isotopically labeled. In some embodiments, the BMAA amino acid residue is unlabeled and the peptide is isotopically labeled at an amino acid other than at the BMAA residue.
In some embodiments, provided herein is a polypeptide comprising a sequence that is at least 85% identical to SEQ ID NO: 1, wherein amino acid position 107 comprises a BMAA residue, wherein the polypeptide is isotopically labeled. In some embodiments, provided herein is a polypeptide comprising a sequence that is at least 85% identical to SEQ ID NO: 1, wherein amino acid position 107 comprises a BMAA residue, wherein the polypeptide is isotopically labeled and the isotopic label is enriched in comparison to the corresponding naturally occurring polypeptide.
Scheme 1. Example method for the preparation of BMAA.
Also provided are compositions that include one or more isotopically labeled SODl polypeptides of SODl peptide fragments. For example, compositions comprising a SODl polypeptide that includes one or more isotopically labeled β-Ν-methylamino-L-alanine (BMAA) residues are provided herein. The isotopically labeled SODl polypeptide can comprise at least 0.5% by weight of the composition. Each of the one or more isotopically labeled BMAA residues can be isotopically labeled with one or more (e.g., two or more) stable isotopes. For example, each of the one or more isotopically labeled BMAA residues can be defined by the formula belo
\
fNH dCH3
where the 13C isotopic enrichment factor for dC is at least 25; and the 15N isotopic enrichment factor for *Ν is at least 100.
In some embodiments, the 13C isotopic enrichment factor for dC is at least 25 (27.5% 13C incorporation at each position), at least 30 (33% 13C incorporation at each position), at least 35 (38.5% 13C incorporation at each position), at least 40 (44% 13C incorporation at each position), at least 45 (49.5% 13C incorporation at each position), at least 50 (55% 13C incorporation at each position), at least 55 (60.5% 13C incorporation at each position), at least 60 (66% 13C incorporation at each position), at least 65 (71.5% 13C incorporation at each position), at least 70 (77% 13C incorporation at each position), at least 75 (82.5% 13C
incorporation at each position), at least 80 (88% 13C incorporation at each position), at least 85 (93.5%) 13C incorporation at each position), or at least 90 (99% 13C incorporation at each position).
In some embodiments, the 15N isotopic enrichment factor for *Ν is at least 100 (37% 15N incorporation at each position), at least 1 10 (40.7% 15N incorporation at each position), at least 120 (44.4% 15N incorporation at each position), at least 130 (48.1% 15N
incorporation at each position), at least 140 (51.8% 15N incorporation at each position), at least 150 (55.5% 15N incorporation at each position), at least 160 (59.2% 15N incorporation at each position), at least 170 (62.9% 15N incorporation at each position), at least 180 (66.6%) 15N incorporation at each position), at least 190 (70.3% 15N incorporation at each position), at least 200 (74% 15N incorporation at each position), at least 210 (77.7% 15N incorporation at each position), at least 220 (81.4% 15N incorporation at each position), at least 230 (85.1% 15N incorporation at each position), at least 240 (88.8% 15N incorporation at each position), at least 250 (92.5% 15N incorporation at each position), at least 260 (96.2%) 15N incorporation at each position), or at least 265 (98.05%) 15N incorporation at each position).
Optionally, aC, C, and/or CC can also be labeled with a stable isotope. In some cases, the 13C isotopic enrichment factor for aC, C, and CC can be at least 25 (27.5% 13C incorporation at each position), at least 30 (33% 13C incorporation at each position), at least 35 (38.5%) 13C incorporation at each position), at least 40 (44% 13C incorporation at each position), at least 45 (49.5% 13C incorporation at each position), at least 50 (55% 13C incorporation at each position), at least 55 (60.5% 13C incorporation at each position), at least 60 (66% 13C incorporation at each position), at least 65 (71.5% 13C incorporation at each position), at least 70 (77% 13C incorporation at each position), at least 75 (82.5% 13C incorporation at each position), at least 80 (88% 13C incorporation at each position), at least 85 (93.5%) 13C incorporation at each position), or at least 90 (99% 13C incorporation at each position).
Optionally, eN can also be labeled with a stable isotope. In some cases, the 15N isotopic enrichment factor for eN is at least 100 (37% 15N incorporation at each position), at least 1 10 (40.7% 15N incorporation at each position), at least 120 (44.4% 15N incorporation at each position), at least 130 (48.1% 15N incorporation at each position), at least 140 (51.8%) 15N incorporation at each position), at least 150 (55.5% 15N incorporation at each position), at least 160 (59.2% 15N incorporation at each position), at least 170 (62.9% 15N
incorporation at each position), at least 180 (66.6% N incorporation at each position), at least 190 (70.3% 15N incorporation at each position), at least 200 (74% 15N incorporation at each position), at least 210 (77.7% 15N incorporation at each position), at least 220 (81.4% 15N incorporation at each position), at least 230 (85.1%> 15N incorporation at each position), at least 240 (88.8% 15N incorporation at each position), at least 250 (92.5% 15N
incorporation at each position), at least 260 (96.2% 15N incorporation at each position), or at least 265 (98.05%) 15N incorporation at each position).
In some embodiments, the polypeptide can include a single isotopically labeled BMAA residue. In other embodiments, the polypeptide can include two or more isotopically labeled BMAA residues (e.g., three or more isotopically labeled BMAA residues, four or more isotopically labeled BMAA residues, five or more isotopically labeled BMAA residues, or ten or more isotopically labeled BMAA residues). In some embodiments, the BMAA residue is substituted for Serl07 (numbering does not include the starting methionine.
In some embodiments, the polypeptide can be defined by the formula below
dc'H3
where m is an integer from 0 to 8384 and n is an integer from 0 to 8384, with the proviso that at least one of m and n is not 0; the 13C isotopic enrichment factor for dC is at least 25; the 15N isotopic enrichment factor for *Ν is at least 100; and independently for each occurrence in the polypeptide, Ri is H and R2 is selected from one of the following
or Ri and R2, together with the atoms to which they are attached, form a five-membered heterocycle defined by the structure below
In some embodiments, the polypep Ptide can be defined by the formula below
where m is an integer from 0 to 108 and n is an integer from 0 to 46, with the proviso that at least one of m and n is not 0; the 13C isotopic enrichment factor for dC is at least 25; the 15N isotopic enrichment factor for *Ν is at least 100; and independently for each occurrence in the polypeptide, Ri is H and R2 is selected from one of the following
or Ri and R2, together with the atoms to which they are attached, form a five-membered heterocycle defined by the structure bel
In some embodiments, the 13C isotopic enrichment factor for dC is at least 25 (27.5% 13C incorporation at each position), at least 30 (33% 13C incorporation at each position), at least 35 (38.5% 13C incorporation at each position), at least 40 (44% 13C incorporation at each position), at least 45 (49.5% 13C incorporation at each position), at least 50 (55% 13C incorporation at each position), at least 55 (60.5% 13C incorporation at each position), at least 60 (66% 13C incorporation at each position), at least 65 (71.5% 13C incorporation at each position), at least 70 (77% 13C incorporation at each position), at least 75 (82.5% 13C incorporation at each position), at least 80 (88% 13C incorporation at each position), at least 85 (93.5%) 13C incorporation at each position), or at least 90 (99% 13C incorporation at each position).
In some embodiments, the 15N isotopic enrichment factor for *Ν is at least 100 (37% 15N incorporation at each position), at least 1 10 (40.7% 15N incorporation at each position), at least 120 (44.4% 15N incorporation at each position), at least 130 (48.1% 15N
incorporation at each position), at least 140 (51.8% 15N incorporation at each position), at least 150 (55.5% 15N incorporation at each position), at least 160 (59.2% 15N incorporation at each position), at least 170 (62.9% 15N incorporation at each position), at least 180 (66.6%) 15N incorporation at each position), at least 190 (70.3% 15N incorporation at each
position), at least 200 (74% 15N incorporation at each position), at least 210 (77.7% 15N incorporation at each position), at least 220 (81.4% 15N incorporation at each position), at least 230 (85.1% 15N incorporation at each position), at least 240 (88.8% 15N incorporation at each position), at least 250 (92.5% 15N incorporation at each position), at least 260 (96.2%) 15N incorporation at each position), or at least 265 (98.05%) 15N incorporation at each position).
Optionally, aC, C, and/or CC can also be labeled with a stable isotope. In some cases, the 13C isotopic enrichment factor for aC, C, and CC can be at least 25 (27.5% 13C incorporation at each position), at least 30 (33%> 13C incorporation at each position), at least 35 (38.5%) 13C incorporation at each position), at least 40 (44% 13C incorporation at each position), at least 45 (49.5%> 13C incorporation at each position), at least 50 (55% 13C incorporation at each position), at least 55 (60.5%> 13C incorporation at each position), at least 60 (66%> 13C incorporation at each position), at least 65 (71.5% 13C incorporation at each position), at least 70 (77% 13C incorporation at each position), at least 75 (82.5% 13C incorporation at each position), at least 80 (88% 13C incorporation at each position), at least 85 (93.5%) 13C incorporation at each position), or at least 90 (99% 13C incorporation at each position).
Optionally, eN can also be labeled with a stable isotope. In some cases, the 15N isotopic enrichment factor for eN is at least 100 (37% 15N incorporation at each position), at least 1 10 (40.7% 15N incorporation at each position), at least 120 (44.4% 15N incorporation at each position), at least 130 (48.1% 15N incorporation at each position), at least 140 (51.8%) 15N incorporation at each position), at least 150 (55.5% 15N incorporation at each position), at least 160 (59.2% 15N incorporation at each position), at least 170 (62.9% 15N incorporation at each position), at least 180 (66.6% 15N incorporation at each position), at least 190 (70.3% 15N incorporation at each position), at least 200 (74% 15N incorporation at each position), at least 210 (77.7% 15N incorporation at each position), at least 220 (81.4% 15N incorporation at each position), at least 230 (85.1%> 15N incorporation at each position), at least 240 (88.8% 15N incorporation at each position), at least 250 (92.5% 15N
incorporation at each position), at least 260 (96.2% 15N incorporation at each position), or at least 265 (98.05%) 15N incorporation at each position).
In some embodiments, m can be at least 1 (e.g., at least 5, at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100). In some embodiments, m can be 108 or less (e.g., 100 or less, 90 or less, 80 or less, 70 or
less, 60 or less, 50 or less, 40 or less, 30 or less, 20 or less, 10 or less, or 5 or less), m can be an integer ranging from any of the minimum values described above to any of the maximum values described above. For example, in some embodiments, m can be an integer from 1 to 108 (e.g., from 1 to 100, from 1 to 50, from 1 to 30, or from 1 to 10).
In some embodiments, n can be at least 1 (e.g., at least 5, at least 10, at least 20, at least 30, at least 40). In some embodiments, n can be 46 or less (e.g., 40 or less, 30 or less, 20 or less, 10 or less, or 5 or less), n can be an integer ranging from any of the minimum values described above to any of the maximum values described above. For example, in some embodiments, n can be an integer from 1 to 46 (e.g., from 1 to 40, from 1 to 30, from 1 to 20, or from 1 to 10).
In some embodiments, the sum of m and n can be at least 1 (e.g., at least 5, at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150). In some embodiments, the sum of m and n can be 154 or less (e.g., 150 or less, 140 or less, 130 or less, 120 or less, 110 or less, 100 or less, 90 or less, 80 or less, 70 or less, 60 or less, 50 or less, 40 or less, 30 or less, 20 or less, 10 or less, or 5 or less). The sum of m and n can range from any of the minimum values described above to any of the maximum values described above. For example, in some embodiments, the sum of m and n can be from 1 to 154 (e.g., from 1 to 150, from 1 to 100, from 1 to 50, from 1 to 30, from 1 to 10, from 5 to 150, from 5 to 100, from 5 to 50, from 5 to 30, or from 5 to 10).
The composition can be, for example, a solution of the isotopically labeled peptide in a solvent. Non-limiting examples of solvents include alcohols (e.g., methanol, ethanol, isopropanol); esters (e.g., ethyl acetate); ketones (e.g., acetone); diethyl ether; dioxane; glycol ethers and glycol ether esters; tetrahydrofuran; dimethylformamide; acetonitrile; dimethyl sulfoxide; water, saline, aqueous buffers (e.g., PBS buffer), and combinations thereof. In certain examples, the composition can comprise an aqueous solution of the peptide.
In some embodiments, the isotopically labeled peptide can comprise at least 0.5% by weight (e.g., at least 1% by weight, at least 1.5% by weight, at least 2% by weight, at least 2.5%) by weight, at least 3% by weight, at least 3.5% by weight, at least 4% by weight, at least 4.5%) by weight, or at least 1% by weight of the composition.
Also provided are compositions comprising an isotopically labeled polypeptide that includes one or more β-Ν-methylamino-L-alanine (BMAA) residues (e.g., one or more
BMAA residues that are not isotopically labeled) and one or more additional amino acid residues that are labeled with one or more stable isotopes (13C, 15N, and/or 180). In some embodiments, each residue labeled with one or more stable isotopes in the polypeptide includes at least two (e.g., at least four, at least five, at least six, or more) stable isotopes. For example, at least two (e.g., at least four, at least five, at least six, or more) of the carbon, nitrogen, and/or oxygen atoms in the residue can be isotopically labeled with a stable isotope. In some cases, at least two (e.g., at least four, at least five, at least six, or more) of the carbon and/or nitrogen atoms in the residue can be isotopically labeled with a stable isotope. The isotopically labeled polypeptide can comprise at least 0.5% by weight of the composition.
In some embodiments, the polypeptide can include a single isotopically labeled residue. In other embodiments, the polypeptide can include two or more isotopically labeled residues (e.g., three or more isotopically labeled residues, four or more isotopically labeled residues, five or more isotopically labeled residues, or ten or more isotopically labeled residues). In some embodiments, the polypeptide can include a single BMAA residue. In other embodiments, the polypeptide can include two or more BMAA residues (e.g., three or more BMAA residues, four or more BMAA residues, five or more BMAA residues, or ten or more BMAA residues).
In certain embodiments, the isotopically labeled polypeptide can be a peptide that includes one or more BMAA residues and a terminal amino acid residue (e.g., a terminal arginine residue) labeled with one or more stable isotopes (13C, 15N, and/or 180).
The composition can be, for example, a solution of the isotopically labeled peptide in a solvent. Non-limiting examples of solvents include alcohols (e.g., methanol, ethanol, isopropanol); esters (e.g., ethyl acetate); ketones (e.g., acetone); diethyl ether; dioxane; glycol ethers and glycol ether esters; tetrahydrofuran; dimethylformamide; acetonitrile; dimethyl sulfoxide; water, saline, aqueous buffers (e.g., PBS buffer), and combinations thereof. In certain examples, the composition can comprise an aqueous solution of the peptide.
In some embodiments, the isotopically labeled peptide can comprise at least 0.5% by weight (e.g., at least 1% by weight, at least 1.5% by weight, at least 2% by weight, at least 2.5%) by weight, at least 3% by weight, at least 3.5% by weight, at least 4% by weight, at least 4.5%) by weight, or at least 1% by weight of the composition.
The peptides described above can be above can be prepared using a variety of methods known in the art. For example, peptides can be prepared using the isotopically labeled compounds described herein via solid phase peptide synthesis. The proteins and peptides described above can also be prepared by chemical derivatization of one or more residues within the protein and peptide. For example, a protein or peptide having a isotopically labeled β-Ν-methylamino-L-alanine (BMAA) residue can be prepared from a protein or peptide that includes a phosphoserine residue. The protein or peptide can be reacted to convert the phosphoserine residue to an α,β-unsaturated amino acid residue. Once activated, the α,β-unsaturated amino acid residue can be reacted with methylamine (e.g., methylamine that is isotopically enriched with one or more stable isotopes), which undergoes a Michael -type addition to afford an isotopically labeled BMAA residue. This can involve, for example, reaction of the protein or peptide with methylamine-HCl (e.g., 1.0 M 13C/15N-labeled methylamine) and Ba(OH)2 (e.g., 0.1 M Ba(OH)2) in water/DMSO/EtOH (2:2: 1) at basic pH (pH 12.5) and elevated temperature (e.g., 37 °C). Once complete, the reaction can be quenched with acid (e.g., acetic acid).
Full length natural or stable isotope labeled proteins comprising stable isotope labeled BMAA residues (e.g., incorporated at one or more specific sites within the protein) can be prepared by first preparing a phosphoserine-containing protein using an amber stop codon and a tRNA synthetase engineered to incorporate phosphoserine within the desired protein. See, for example, Rogerson, D. T. et al. "Efficient genetic encoding of
phosphoserine and its nonhydrolyzable analog." Nat. Chem. Biol., 2015, 7: 496-503. The protein can then be isolated, and the phosphoserine can be chemically converted into BMAA using the strategy described above.
Further provided herein are isotopically labeled reagents, including isotopically labeled small molecules and peptides, that can be used to detect and/or quantify β-Ν- methylamino-L-alanine (BMAA) in a protein selected from the validated targets in Table 6. Using these novel reagents, the inventors have identified the incorporation of BMAA into numerous proteins in samples from patients suffering from amyotrophic lateral sclerosis (ALS) and from control samples. The reagents can be used as stable isotope labeled standards in analytical methods, including in conjunction with mass spectrometry, to detect and/or quantify BMAA in a sample, such as a protein sample from a subject.
In one aspect, provided herein is a polypeptide comprising a sequence that is at least 85% identical a sequence selected from SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26,
SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID N0:31, SEQ ID
NO:32, SEQ ID NO:33, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37,
SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID N0:41, SEQ ID NO:42, SEQ ID
NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, or SEQ ID NO:49, wherein at least one amino acid comprises a BMAA residue which is isotopically labeled and is defined by the formula below
dCH Ί,3
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100.
In one aspect, provided herein is a polypeptide comprising a sequence selected from SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, SEQ ID NO:33, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, or SEQ ID NO:49, wherein at least one amino acid comprises a BMAA residue which is isotopically labeled and is defined by the formula below
dC'H Ί,3
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100.
In one aspect, provided herein is a polypeptide comprising a sequence that is at least 85% identical a sequence selected from SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID
NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID N0:61, SEQ ID NO:62, SEQ ID NO:63,
SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID
NO:69, SEQ ID NO:70, SEQ ID N0:71, SEQ ID NO:72, SEQ ID NO:73, SEQ ID NO:74, or SEQ ID NO:75, wherein at least one amino acid comprises a BMAA residue which is isotopically labeled and is defined by the formula below
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100.
In one aspect, provided herein is a polypeptide comprising a sequence selected from SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:71, SEQ ID NO:72, SEQ ID NO:73, SEQ ID NO:74, or SEQ ID NO:75, wherein at least one amino acid comprises a BMAA residue which is isotopically labeled and is defined by the formula below
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100.
Methods
The compounds, peptides, proteins, and compositions described herein can be used detect and/or quantify BMAA in a SOD1 protein from a biological specimen (e.g., a sample
from a patient suffering from neurodegenerative disease such as ALS), to accurately monitor BMAA exposure, to direct therapies, and in clinical diagnosis and prognosis.
For example, the isotopically labeled reagents and compositions described herein can be used in a variety of analytical methods to detect and/or quantify BMAA, such as to detect and/or quantify BMAA in a biological specimen or sample such as a protein sample. The isotopically labeled compounds described herein can be used to quantify free BMAA (e.g., quantify free BMAA in an environmental sample or biological sample), quantify total levels of BMAA in a protein sample (for example, a SOD1 protein sample), and/or to quantify protein-specific BMAA incorporation (e.g., by upstream purification of the protein of interest prior to analysis). The isotopically labeled compounds described herein can also be utilized in a stable isotope labeling by amino acids in cell culture (SILAC) alone or in combination with other stable isotope labeled amino acids. The isotopically labeled compounds described herein provide many analytical advantages over potential alternatives, such as deuterated BMAA, which does not co-elute and can undergo hydrogen-deuterium exchange in-solution or in the gas phase, significantly impacting identification and quantitation.
In one aspect, provided herein is a method for detecting β-Ν-methylamino-L-alanine (BMAA) in a SOD1 protein, comprising (a) purifying SOD1 protein from a biological specimen to provide a purified SOD1 protein sample, (b) spiking the purified SOD1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below
90
wherein R represents hydrogen or an amine protecting group, and at least two of aC, C, CC, dC, fN", gO, and hO are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis.
In one embodiment, at least three of aC, C, CC, dC, % gO, and hO are
isotopically labeled with a stable isotope. In one embodiment, at least four of aC, C, CC, dC,
eN, fN", gO, and hO are isotopically labeled with a stable isotope. In one embodiment, at least three of aC, C, CC, dC, and *Ν are isotopically labeled with a stable isotope. In one embodiment, at least four of aC, C, CC, dC, and *Ν are isotopically labeled with a stable isotope. In one embodiment, aC, C, CC, dC, and *Ν are isotopically labeled with a stable isotope.
In one embodiment, the isotopically labeled compound is defined by the formula below
wherein R represents hydrogen or an amine protecting group; wherein the C isotopic enrichment factor for aC, C, CC, and dC is at least 25; and wherein the 15N isotopic enrichment factor for eN and *Ν is at least 100.
In one embodiment, the 13C isotopic enrichment factor for aC, C, CC, and dC is at least 80 and the 15N isotopic enrichment factor for eN and *Ν is at least 200. In one embodiment, R is hydrogen. In one embodiment, R represents a 9- fluorenylmethyloxycarbonyl group.
On one embodiment, the purified SOD1 protein sample is hydrolyzed into amino acids for free BMAA analysis of SOD1.
In one aspect, provided herein is a method for detecting β-Ν-methylamino-L-alanine (BMAA) in a SOD1 protein, comprising: (a) purifying SOD1 protein from a biological specimen to provide a purified SOD1 protein sample; (b) spiking the purified SOD1 protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled β-Ν-methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes; to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis.
In one embodiment, each of the one or more isotopically labeled BMAA residues is isotopically labeled with two or more stable isotopes. In one embodiment, each of the one or more isotopically labeled BMAA residues is defined by the formula below
dCH3
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100.
In one embodiment, the 13C isotopic enrichment factor for dC is at least 80 and the 15N isotopic enrichment factor for *Ν is at least 200. In one embodiment, the 13C isotopic enrichment factor for aC, C, and CC is at least 25. In one embodiment, the 13C isotopic enrichment factor for aC, C, and CC is at least 80. In one embodiment, the 15N isotopic enrichment factor for eN is at least 100. In one embodiment, the 15N isotopic enrichment factor for eN is at least 200.
In one embodiment, the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 90%) identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 2. In one embodiment, the purified SOD1 protein sample is digested with trypsin.
In one aspect, provided herein is a method of detecting or predicting amyotrophic lateral sclerosis in a subject, comprising (a) purifying SOD1 protein from a biological specimen from a subject to provide a purified SOD1 protein sample; (b) spiking the purified
SOD1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below
wherein R represents hydrogen or an amine protecting group, and at least two of aC, C, CC, dC, fN", gO, and hO are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA level in the SOD1 protein sample by isotope dilution analysis; and (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA level in the SOD1 protein is greater than a normal reference value.
In one embodiment, at least three of aC, C, CC, dC, % gO, and hO are
isotopically labeled with a stable isotope. In one embodiment, at least four of aC, C, CC, dC, eN, fN", gO, and hO are isotopically labeled with a stable isotope. In one embodiment, at least three of aC, C, CC, dC, eN, and *Ν are isotopically labeled with a stable isotope. In one embodiment, at least four of aC, C, CC, dC, and *Ν are isotopically labeled with a stable isotope. In one embodiment, aC, C, CC, dC, and *Ν are isotopically labeled with a stable isotope. In one embodiment, the isotopically labeled compound is defined by the formula below
dcl3
wherein R represents hydrogen or an amine protecting group; wherein the C isotopic enrichment factor for aC, C, CC, and dC is at least 25; and wherein the 15N isotopic enrichment factor for eN and *Ν is at least 100. In one embodiment, the 13C isotopic enrichment factor for aC, C, CC, and dC is at least 80 and the 15N isotopic enrichment factor
for ¾ and *Ν is at least 200. In one embodiment, R is hydrogen. In one embodiment, R represents a 9-fluorenylmethyloxycarbonyl group.
In one embodiment, the SODl protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP-lysine, 4-hydroxynonenal sulfonation and nitrosylation. In one embodiment, the SODl protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, and crotonaldehyde.
In one embodiment, the subject being identified for the presence or risk of amyotrophic lateral sclerosis comprises a BMAA level in the SODl protein that is at least 10% greater (e.g. at least 10% greater, at least 20% greater, at least 50% greater, at least 100% greater, or more) than the normal reference value.
In one aspect, provided herein is a method of detecting or predicting amyotrophic lateral sclerosis in a subject, comprising (a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample; (b) spiking the purified SODl protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled β-Ν-methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA level in the SODl protein sample by isotope dilution analysis; and (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA level in the SODl protein is greater than a normal reference value.
In one embodiment, each of the one or more isotopically labeled BMAA residues is isotopically labeled with two or more stable isotopes. In one embodiment, each of the one or more isotopically labeled BMAA residues is defined by the formula below
\
fNH dCH3
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100. In one embodiment, the 13C isotopic enrichment factor for dC is at least 80 and the 15N isotopic enrichment factor for *Ν is at least 200. In one embodiment, the 13C isotopic enrichment factor for aC, C, and CC is at least 25. In one embodiment, the 13C isotopic enrichment factor for aC, C, and CC is at least 80. In one embodiment, the 15N isotopic enrichment factor for eN is at least 100. In one embodiment, the 15N isotopic enrichment factor for eN is at least 200.
In one embodiment, the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 90%) identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 2.
In one embodiment, the SOD1 protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP-lysine, 4-hydroxynonenal sulfonation and nitrosylation. In one embodiment, the SOD1 protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, and crotonaldehyde.
In one aspect, provided herein is a method of preventing or treating amyotrophic lateral sclerosis in a subject, comprising (a) purifying SOD1 protein from a biological specimen from a subject to provide a purified SOD1 protein sample; (b) spiking the purified SOD1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below
wherein R represents hydrogen or an amine protecting group, and at least two of aC, C, CC, dC, fN", gO, and hO are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the SOD1 protein is greater than a normal reference value; and (f) administering to the subject L-serine in an amount sufficient to prevent or treat the amyotrophic lateral sclerosis.
In one embodiment, at least three of aC, C, CC, dC, % gO, and hO are
isotopically labeled with a stable isotope. In one embodiment, at least four of aC, C, CC, dC, eN, fN", gO, and hO are isotopically labeled with a stable isotope. In one embodiment, at least three of aC, C, CC, dC, eN, and *Ν are isotopically labeled with a stable isotope. In one embodiment, at least four of aC, C, CC, dC, and *Ν are isotopically labeled with a stable isotope. In one embodiment, aC, C, CC, dC, and *Ν are isotopically labeled with a stable isotope. In one embodiment, the isotopically labeled compound is defined by the formula below
wherein R represents hydrogen or an amine protecting group; wherein the C isotopic enrichment factor for aC, C, CC, and dC is at least 25; and wherein the 15N isotopic enrichment factor for eN and *Ν is at least 100. In one embodiment, the 13C isotopic enrichment factor for aC, C, CC, and dC is at least 80 and the 15N isotopic enrichment factor
for ¾ and *Ν is at least 200. In one embodiment, R is hydrogen. In one embodiment, R represents a 9-fluorenylmethyloxycarbonyl group.
In one embodiment, the SODl protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP-lysine, 4-hydroxynonenal sulfonation and nitrosylation. In one embodiment, the SODl protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, and crotonaldehyde.
In one aspect, provided herein is a method of preventing or treating amyotrophic lateral sclerosis in a subject, comprising (a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample; (b) spiking the purified SODl protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled β-Ν-methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the SODl protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the SODl protein is greater than a normal reference value; and (f) administering to the subject L-serine in an amount sufficient to prevent or treat the amyotrophic lateral sclerosis.
In one embodiment, each of the one or more isotopically labeled BMAA residues is isotopically labeled with two or more stable isotopes. In one embodiment, each of the one or more isotopically labeled BMAA residues is defined by the formula below
\
fNH dCH3
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100. In one embodiment, at least 80 and the 15N isotopic enrichment factor for *Ν is at least 200. In one embodiment, the 13C isotopic
enrichment factor for aC, C, and CC is at least 25. In one embodiment, the 13C isotopic enrichment factor for aC, C, and CC is at least 80. In one embodiment, the 15N isotopic enrichment factor for eN is at least 100. In one embodiment, the 15N isotopic enrichment factor for eN is at least 200. In one embodiment, the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 1. In one embodiment, the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 2. In one embodiment, the polypeptide comprises a sequence is identical to SEQ ID NO: 2.
In one embodiment, the SOD1 protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP-lysine, 4-hydroxynonenal sulfonation and nitrosylation. In one embodiment, the SOD1 protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, and crotonaldehyde.
In some embodiments, after the detection of BMAA in SOD1, the patient may be treated with L-serine. In some embodiments, after the detection of BMAA in SOD1, the patient may be treated with L-serine, or a precursor, derivative or conjugate of L-serine.
While there is no known cure for ALS, the FDA approved the use of riluzole, an anti-glutamate agent, to help slow down the progression of the disease (See U.S. Patent no. 4,826,860). Riluzole is believed to reduce damage to motor neurons by decreasing the release of glutamate. Clinical trials with ALS patients showed that riluzole prolongs survival by several months, mainly in those with difficulty swallowing. The drug can also extend the time before an individual needs ventilation support. Other anti-glutamate agents, such as Talampanel and Memantine, have also been proposed as potential treatments for ALS. Currently, physicians can also prescribe medications to help reduce symptoms of
ALS, such as fatigue, ease muscle cramps, control spasticity, and reduce excess saliva and phlegm. In some embodiments, after the detection of BMAA in SOD1, the patient may be treated with riluzole. In some embodiments, after the detection of BMAA in SOD1, the patient may be treated with talampanel or memantine.
Recently, it has been proposed to treat ALS with stem cells (See U.S. Patent Nos. 5,968,829 and 8,765, 119). It is thought that stem cells injected into the spinal cord of patients with ALS can not only mature into new nerve and spinal cells, but also release chemicals to protect existing nerve cells and their connections. Other proposed treatments include anti-apoptosis agents, such as Minocyclin, and anti-oxidative agents, such as Tamoxifen. Minocycline (see U.S. Patent App. Pub. No. 20150190415) is currently in a large Phase III clinical trial. In some embodiments, after the detection of BMAA in SOD1, the patient may be treated with stem cell therapy. In some embodiments, after the detection of BMAA in SOD1, the patient may be treated with tamoxifen or minocycline.
In one embodiment, the ALS is sporadic ALS. In one embodiment, the ALS is familial ALS.
The SOD1 protein, the BMAA-spiked sample, or a combination thereof can be prepared for analysis by mass spectrometry by a method comprising chemical reactions with flight enhancers, chemical fragmentation, enzymatic digestion, purification, or a combination thereof. In some embodiments, the isotopically labeled compounds described herein can be used to detect and quantify BMAA obtained from the hydrolytic cleavage of amino acids from a target protein as well as for identification and quantification of BMAA incorporated into proteins at the peptide and protein level utilizing isotope dilution mass spectrometry.
The proteins and peptides described herein can be used as diagnostic markers, to monitor exposure to BMAA, and/or to identify disease relevant and functionally important proteins in which BMAA has been incorporated in specific sequence locations. The proteins and peptides described herein can be utilized in a protein-cleavage-isotope dilution workflow to confirm the primary structure, and to accurately and precisely quantify BMAA incorporated into peptides produced via chemical or enzymatic digestion of specific proteins.
These proteins and peptides can also be employed in separation schemes, followed by intact mass spectrometry or peptide level detection and quantification through chemical or proteolytic digestion. These proteins and peptides can also be used to produce
antibodies, aptamers and/or other affinity reagents which can be utilized for other diagnostic tools and applications. These proteins and peptides can also be used in biophysical studies, providing a method for studying the effect of this non-protein amino acid incorporation in proteins. In some embodiments, antibodies can be produced that have affinity for the SODl protein, or fragment of the SODl protein, containing a BMAA residue. In one embodiment, the BMAA residue is substituted at the Serl07 position in SODl . In one embodiment, antibodies can be produced that have affinity for the SODl protein, or fragment of the SODl protein, containing a BMAA residue, wherein the antibodies do not have significant affinity for the corresponding SODl protein lacking the BMAA residue. In some embodiments, the antibody recognizes an epitope of SODl comprising BMAA at the Serl07 position. In some embodiments, the antibody recognizes an epitope of SODl that does not comprise BMAA at the Serl07 position.
The methods herein can also be used to detect β-Ν-methylamino-L-alanine (BMAA) in additional proteins in a patient sample. In one aspect, provided herein is a method for detecting β-Ν-methylamino-L-alanine (BMAA) in a protein, comprising (a) purifying the protein from a biological specimen to provide a purified protein sample, (b) spiking the purified protein sample with a defined amount of an isotopically labeled compound defined by the formula below
wherein R represents hydrogen or an amine protecting group, and at least two of aC, C, CC, dC, fN", gO, and hO are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the protein sample by isotope dilution analysis.
In one aspect, provided herein is a method for detecting β-Ν-methylamino-L-alanine
(BMAA) in a protein, comprising: (a) purifying the protein from a biological specimen to provide a purified protein sample; (b) spiking the purified protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled β-Ν-methylamino-L-alanine (BMAA) residues, wherein each of the one or more
isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes; to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; and (d) measuring BMAA levels in the protein sample by isotope dilution analysis.
In another aspect, provided herein is a method of detecting or predicting
amyotrophic lateral sclerosis in a subject, comprising (a) purifying a protein from a biological specimen from a subject to provide a purified protein sample; (b) spiking the purified protein sample with a defined amount of an isotopically labeled compound defined by the formula below
90
wherein R represents hydrogen or an amine protecting group, and at least two of aC, C, CC, dC, fN", gO, and hO are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA level in the protein sample by isotope dilution analysis; and (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA level in the protein is greater than a normal reference value.
In one aspect, provided herein is a method of preventing or treating amyotrophic lateral sclerosis in a subject, comprising (a) purifying a protein from a biological specimen from a subject to provide a purified protein sample; (b) spiking the purified protein sample with a defined amount of an isotopically labeled compound defined by the formula below
90
wherein R represents hydrogen or an amine protecting group, and at least two of aC, C, CC, dC, fN", gO, and hO are isotopically labeled with a stable isotope, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the protein is greater than a normal reference value; and (f) administering to the subject L- serine in an amount sufficient to prevent or treat the amyotrophic lateral sclerosis.
In still a further aspect, provided herein is a method of preventing or treating amyotrophic lateral sclerosis in a subject, comprising (a) purifying a protein from a biological specimen from a subject to provide a purified protein sample; (b) spiking the purified protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled β-Ν-methylamino-L-alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes, to provide a BMAA-spiked sample; (c) analyzing the BMAA-spiked sample by mass spectrometry; (d) measuring BMAA levels in the protein sample by isotope dilution analysis; (e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the protein is greater than a normal reference value; and (f) administering to the subject L-serine in an amount sufficient to prevent or treat the amyotrophic lateral sclerosis.
The proteins or polypeptides used in the methods described herein can comprise any of the proteins or protein fragments described in Table 6 or Table 7 below.
By way of non-limiting illustration, examples of certain embodiments of the present disclosure are given below.
EXAMPLES
Example 1: Preparation of 13C4 15N2 β-Ν-Methylamino-L- Alanine
Preparation of Compound 1. To a solution of 13C-15N labeled L-asparagine monohydrate (95.8 mg, 0.614 mmol) in 10% aqueous Na2C03 (1.6 mL) was added 1,4- dioxane (0.9 mL) and the mixture was cooled to 0 °C. Benzyl chloroformate (130 mg, 0.737 mmol) was then added and the mixture was allowed to warm to rt overnight. The reaction mixture was poured into water (4.0 mL), and the mixture was extracted with diethyl ether (x3). The aqueous layer was then acidified with an aqueous solution of 2N HC1 (pH = 2), and the white solid was filtered to afford 98.5 mg (59%) of the product: ¾ MR (400
MHz, CDCh) δ 7.37 (m, 5 H), 5.10 (m, 2 H), 4.25 (bd, 1 H, J= 132.1 Hz), 2.81 (bd, 1 H, J = 44.1 Hz), 2.46 (bd, 1 H, J= 64.6 Hz); ESIMS m/z 273 [M+H]+; HRMS m/z calculated for 13C4C8Hi4 15N205 [M+Na]+ 295.0870, found 295. 0867.
(1)
Preparation of Compound 2. To a slurry of N2-benzyloxycarbonylasparagine (98.5 mg, 0.362 mmol) in ethyl acetate (0.89 mL), acetonitrile (0.96 mL), and water (0.46 mL) was added iodosobenzene diacetate (0.166 g, 0.507 mmol) at 15 °C and the mixture was stirred for 30 min at 15 °C. The reaction mixture was then allowed to warm to rt and stirred until completion (4 h). The mixture was cooled to 5 °C, and the product was collected, washed with ethyl acetate, and dried in vacuo to afford 33.9 mg (39%) of the product as a white solid: ESIMS m/z 244 [M+H]+. ¾ NMR (400 MHz, CDCh) δ 8.03 (brs, 1 H), 7.85 (brs, 2 H), 7.40 (s, 5 H), 5.07 (s, 2 H), 4.30 (bd, 1 H, J= 139.2 Hz), 3.31 (bd, 1 H, J= 83.9 Hz), 3.31 (bd, 1 H, J= 83.9 Hz), 2.95 (bd, 1 H, J= 87.9 Hz); ESIMS m/z 244 [M+H]+; HRMS m/z calculated for 13C3C8Hi4 15N204 [M+H]+ 244.1068, found 244.1066.
(2)
Preparation of Compound 3. To a suspension of compound 3 (33.9 mg, 0.139 mmol) in methanol (0.60 mL) was added Et3N (42.3 mg, 0.416 mmol) and benzaldehyde (29.6 mg, 0.278 mmol) at rt, and the mixture was stirred for 30 min. The reaction mixture was cooled to 0 °C, followed by the addition of NaBH4 (16.0 mg, 0.416 mmol). The mixture was then stirred for an additional 15 min at 0 °C, and concentrated under reduced pressure. The residue was then dissolved in 0.1 M aqueous solution of NaOH, and extracted with diethyl ether (x3). The aqueous layer was then acidified with an aqueous solution of 10%) hydrochloric acid, and the resultant white precipitate was filtered to afford 27.2 mg of the product. The white solid was dissolved in methanol (0.27 mL), and a
solution of 35% aqueous solution of formaldehyde (18.2 (jL, 0.244 mmol) was added. The reaction was stirred for an additional 15 min, and cooled to 0 °C. NaBH4 (9.32 mg, 0.244 mmol) was then added, and the mixture was stirred for 15 min. Upon completion, the mixture was concentrated under reduced pressure, and the crude residue was dissolved in water, acidified (pH = 6) with a 1 M aqueous solution of HC1, extracted with CHCb, dried (MgS04), and concentrated under reduced pressure to afford the crude product. The crude product was triturated with diethyl ether to afford 28.3 mg (100%) of the product as a white solid: : ¾ MR (400 MHz, CDCb) δ 7.18 (s, 10 H), 6.38 (d, 1 H, J = 92.5 Hz), 5.09 (d, 1 H, J= 16.5 Hz), 4.88 (d, 1 H, J= 15.4 Hz), 4.19 (d, 1 H, J= 83.9 Hz), 3.58 (d, 1 H, J= 13.2 Hz), 3.48 (d, 1 H, J= 16.1 Hz), 3.01 (s, 1 H), 2.67 (s, 1 H), 2.12 (s, 3 H); ESIMS m/z 348 [M+H]+; HRMS m/z calculated for 13C3Ci6H22 15N204 [M+H]+ 348.1694, found 348.1690.
(3)
Preparation of Compound 13C4 15N2 β-Ν-Methylamino-L-Alanine. To a degassed solution of compound 3 (28.3 mg, 0.0814 mmol) in methanol (0.8 mL) was added Pd/C (8.66 mg, 0.00813 mmol), and the mixture was further degassed for an additional 5 min. The mixture was then saturated with H2 gas and stirred under a H2 atmosphere overnight. The Pd/C was filtered through Celite®, and washed with methanol. The filtrated was concentrated under reduced pressure and the crude product was triturated with diethyl ether to afford 7.7 mg (77%) of the product as a white solid: ESEVIS m/z 146 [M+Na]+; HRMS m/z calculated for 13C3CHio15N202 [M+H]+ 124.0856, found 124.0856. This final product was further characterized by MS/MS to confirm the exact structure (Figure 14).
13C4 15N2 β-Ν-methylamino-L-alanine
A well-characterized, highly phosphorylated protein, Beta-Casein, was utilized as a positive control. The intact protein was reacted with methylamine under the same conditions for peptide synthesis, converting phosphoserines to BMAA. Purified SOD1
from 3 patients with sporadic ALS and 3 healthy controls were washed on a lOkDa FASP filter (Millipore) and concentrated to 50 20 μg of protein was hydrolyzed using 50 μΐ. of 6N HC1 and incubating at 110°C for 18 hours. 5 μί οί 60.9mM SIL BMAA was spiked into the samples post-hydrolysis. Samples were then dried and resuspended in 100 μΐ. of 0.001% Zwittergent 3-16. Direct infusion ESI MS/MS of SIL BMAA confirmed the location of isotope incorporation. A ZipChip (908 Devices) capillary electrophoresis was utilized to separate BMAA prior to electrospray ionization mass spectrometry. Accurate intact mass and migration time of the SIL reagent was used to identify BMAA.
The peptide sequence DGVADVSIEDSVISLSGDHCIIGR (SEQ ID NO: 17) with highlighted (bold and underlined) Serine phosphorylated, carbamidomethylated Cysteine and 13C6 15N4 isotopically labeled Arginine was obtained from New England Peptide. This sequence was validated by accurate intact mass (Figure 2) and MS/MS (Figure 3) which allowed for site specific confirmation of phosphorylation. A solution of water, DMSO, EtOH solution in 2:2: 1 mixture containing 0.1M Barium Hydroxide and 1M Methylamine pH 12.5 was used for derivatization of the SIL peptide. 5 μΕ ^g) of peptide was added to 20 μΕ of derivatization solution and incubated at 37°C for two hours. The reaction was quenched with 2 μΕ of Acetic Acid. See Figure 1 for synthesis reference. The formation of BMAA at the phosphorylated Serine residue was confirmed by accurate intact mass (Figure 2) and MS/MS (Figure 4). Further, the R.T of the BMAA peptide was distinctly different from that of the phosphorylated peptide (Figure 5), along with co-elution of fragment ions to confirm the identity of this species. The conserved relative abundance of the fragments belonging to the SIL BMAA peptide act as a standard for further confirmation.
Each sample was diluted 2-fold in a denaturing solution of 100 mM DTT (15.43 mg/mL) and 8 M urea. Then the samples were incubated at 56°C for 30 minutes. After incubation enough alkylation solution, made from 1 M iodoacetamide (184.96 mg/mL) and 8 M urea, was added to give each sample a final iodoacetamide concentration of 200 mM. Then the samples were incubated at 37°C for an hour. The appropriate amount for each sample was pipetted into an Amicon Ultra-0.1 MWCO-filter unit (10 kDa, Millipore).
These were centrifuged for 15 minutes at 14,000 x g and 20°C; when finished the eluent was discarded. The remaining volume was diluted with 400 uL of a digestion buffer made of 2 M urea (102.12 mg/mL) and lO mM CaCl_2 (1.11 mg/mL). The samples were centrifuged again for 15 minutes at 14,000 x g and 20°C. This was repeated two more times, making sure to discard the eluent after each run. After the final centrifugation the collection
tubes were changed and 45 uL of modified porcine trypsin reconstituted in 2 M urea and 10 mM CaCl_2 was added and the samples were incubated at 37°C overnight. Then the samples were quenched with 50 uL of 1% formic acid (v/v) and 0.001% Zwittergent 3-16 and centrifuged for 15 minutes at 14,000 x g and 20°C. 400 uL of quench buffer was added to the retained volume and centrifuged again for 15 minutes at 14,000 x g and 20°C.
Samples were frozen at -80°C and lyosphilized in a speedvac. Immediately prior to analysis samples were reconstituted in 90 uL of Zwittergent 3-16. A BMAA peptide dry aliquot of 5ug was resuspended in 500 uL of Zwittergent. A 45 uL aliquot of the protein digest was then spiked with 5 uL of BMAA peptide standard for LC-MS analysis.
LC-MS/MS by parallel reaction monitoring was used to isolate, fragment and perform accurate mass measurements of our target endogenous BMAA peptide and SIL BMAA peptides. Direct inject column configuration on a Thermo Easy nano-LC 1000 system coupled to a QExactive High Field mass spectrometer was used. Analytical columns were made using 75 um x 15 cm PicoFrit columns (New Objective, Woburn, MA) which were self-packed with Kinetex CI 8 2.6-um particles (phenomenex, Torrance, CA, USA). The samples were loaded with a 10 uL injection volume of mobile phase A (98% water, 2% acetonitrile, and 0.2% formic acid) with a max pressure of 500 Bar. A 45 minute run from 2% to 30%) mobile phase B (98%> acetonitrile, 2% water, and 0.2% formic acid) was performed at a flow rate of 300 nL/min. The analysis had the following parameters: a spray voltage of +1750.00, capillary temperature of 325°C, a S-lens RF level of 65.00, a MS/MS resolving power of 15,000, a le6 AGC target, a 1,000ms fill time, a 2.5 m/z isolation window with an isolation offset of 1.0 m/z, a fixed first mass of 125.0 m/z, and a 20, 30 stepped normalized collision energy. There was an inclusion list containing 846.4228 m/z and 843.0867 m/z.
Without the SIL BMAA peptide, correct identification of this peak becomes very difficult as other mass conflicts are present within 5 ppm of the endogenous BMAA peptide as shown in Figure 7 where the most abundant peak is the same sequence does not co-elute with the SIL peptide. When examining the correct retention time, the intact mass appears to be present within 1.2 ppm mass accuracy and the correct charge state (+3) is also identified (Figure 8). Moreover, this peak co-elutes with our SIL peptide as shown in Figure 9.
Fragment ions corresponding to the endogenous peptide with BMAA at the expected location could be identified at the same retention time (Figure 13).
Example 2. NanoLC MS and MS/MS characterization of SODl in Human Clinical
ALS
Samples for analysis were obtained from control patients (n=10) and ALS patients (n=7). The SODl protein was purified from plasma in each of these patient samples. The SODl protein can be purified by one of skill in the art (for example, purification using an antibody directed to SODl or using a protein that has binding affinity for SODl). In some experiments, the intact SODl protein was analyzed, while in other experiments, the SODl protein was digested with trypsin before further analysis (See Figure 10).
For the liquid chromatography experiments, the Thermo Easy nanoLC setup included: 75 μπι inner diameter 15 cm column utilizing CI 8 stationary phase for reversed- phase separation of peptides base on hydrophobicity. The flow rate was 300 nL/min. 2 μΐ^ of digested (trypsin) SODl containing -200 ng was injected directly onto the column using a Mobile phase A (98% water, 2% Acetonitrile (ACN), 0.2% formic acid) and a Mobile phase B (98% ACN, 2% water, 0.2% formic acid). A gradient elution was performed from 5%-40%B over 30 min.
Data was collected by Full-MS data dependent MS/MS using a top 20 experiment on Q Exactive HF.
For intact protein analysis, 200 ng of undigested protein was injected directly on a 10 cm column using an isocratic (50%A/50%B) elution. Accurate Mass can be obtained by deconvolution with Xtract algorithm.
For the initial SODl proteomics search parameters, 69 protein sequences including SODl wild-type sequence as well as commonly found sample contaminants such as keratin and trypsin were identified in protein databases. Protein DB is digested in silico using rules for tryptic digestion (Cleaves C-terminal to R/K except when preceded by P) and allowing for potential missed cleavages (up to 3). The search tolerance allowed for 5 ppm MMA (mass measurement accuracy) for peptide, 0.02 Da for fragment ions. There were two bioinformatics workflows allowing for:
1) Dynamic Modifications: Ser- BMAA, Glutathionylation (Cys), Deamidation (Q,N), Phospho (S,T,Y), Carbamidomethylation (Cys). Carboxyethyl (MDA), Crotonaldehyde (C,H), 4-HNE (K), Acrolein/proprionyl (K, T, S), Acetylation (K), Nitrotryptophan (W), Sulfonylation (C, T, S), Glyoxal derived carboxymethyllysine CML (K),
Crotonaldehyde derived dimethyl-FDP -lysine (K)
2) SNP Dynamic Modifications: Val^Met, Ala^Val, His^Arg, Thr^Arg, Gly^Arg, Ser- BMAA (Also searched all other amino acids to BMAA)
Fixed: Carbamidomethylation
Peptides were filtered at 1% False Discovery Rate (FDR).
The total glutathionylation and phosphorylation from 17 patient samples (10 healthy controls and 7 ALS patient samples) were analyzed and results are shown in Table 1.
Table 1
*HC = Healthy Control sample
*ALS= Amyotrophic Lateral Sclerosis sample
The post-translational modifications identified from the 17 patient samples were analyzed and results are shown in Table 2.
Table 2
*HC = Healthy Control sample
*ALS= Amyotrophic Lateral Sclerosis sample
* The amino acid numbering shown in the table does not include the starting methionine.
Known modifications in Table 2 include: CI 11 (Glutathione), S107(Phospho), T2(Phospho), K3(Acetyl), and K122(Acetyl). The other modifications identified in Table 2 are novel modifications that have not previously been identified. Modifications identified with high confidence are shown in Figure 11, and summarized in Table 3.
Table 3
* The amino acid numbering shown in the table does not include the starting methionine.
Modifications identified with medium confidence are shown in Figure 12 and summarized in Table 4.
Table 4
* The amino acid numbering shown in the table does not include the starting methionine.
The single nucleotide polymorphisms (SNPs) identified from the 17 patient samples were analyzed and results are shown in Table 5.
Table 5
* The amino acid numbering shown in the table does not include the starting methionine.
Known single nucleotide polymorphisms (SNPs) in Table 5 include: G12(Gly->Arg). The additional SNPs identified in Table 5 are novel.
Using the novel reagents and methods disclosed herein, the inventors have identified the incorporation of endogenous BMAA into the SODl protein in human ALS samples for the first time. Incorporation of BMAA at Serine 107 may act alone, or in combination with other BMAA substitutions, SNP(s) and/or post translational modifications (PTMs) on SODl, other SOD proteins, or in combination with SODl binding partners. Additionally, other proteins within the oxidative stress pathway could incorporate this non-natural amino acid. In the case of SODl, incorporation of this non-natural amino acid could also reflect tRNA synthetase mutations or promiscuity.
In some embodiments, the consequences of BMAA incorporation could include, for example, a decrease in the stability of the homodimer, an increase in the likelihood of SODl to aggregate (e.g., trimers which are very toxic), a decrease in the ability of SODl to bind metals, SODl misfolding, a decrease or alteration of enzymatic activity, and/or tRNA synthetases have sequence variation altering their specificity.
Example 3. NanoLC MS and MS/MS characterization of BMAA incorporation sites in Human Clinical ALS Brain Tissue
Brain tissue samples of 12 matched ALS/healthy control samples were obtained from Emory University. l OOx Halt protease/phosphatase inhibitor was diluted to 1 x in a
lysis buffer which comprised 8 M urea and 100 mM ammonium bicarbonate at a pH of 7.0. Samples were blended in a Bullet Blender with 500 μΙ_, of lysis buffer and 750 μg of stainless steel beads for 15 minutes at a setting of 3 while refrigerated. A Dismembranator Sonicator was used three times for 5 seconds with 15 second breaks. Each sample was diluted 4-fold with water such that the concentration of Urea was 2M. The protein concentration of each sample was then determined using a Bradford Assay. An appropriate volume of the sample containing 250 μg was transferred to a lOkDa MWCO-filter unit and diluted 2-fold in a denaturing solution made from 100 mM DTT and 8 M urea and heated at 56 °C for 30 minutes. The samples were alkylated using 1 M iodoacetamide and 8 M urea to give a final iodoacetamide concentration of 200 mM and heated at 37 °C for 60 minutes. To concentrate the samples, they were spun for 15 minutes at 14,000 x g and 20 °C. The retained volume was diluted three times with 400 μΙ_, of a digesting buffer of 100 mM ammonium bicarbonate at pH 7.0 and spun for 15 minutes at 14,000 x g and 20 °C between each buffer addition. Filters were then transferred to a clean tube. 2 μg SIL SOD1 surrogate peptide containing BMAA was reconstituted in 500μΙ. of 0.001% Zwittergent 3- 16, then 5 μΙ_, was spiked into each sample. The samples were digested using 45 μΙ_, of an enzyme solution containing 100μg/ml modified trypsin and 100 mM ammonium
bicarbonate to give a 1 :50 enzyme: protein ratio and incubated overnight at 37 °C. 50 μΙ_, of a quench buffer made from 1% formic acid and 0.001% Zwittergent 3-16 was added to the filter units which were then spun for 15 minutes at 14,000 x g to elute the peptides. 400 μΙ_, of the quench buffer was added to the retained volume and spun for 15 minutes at 14,000 x g using the same collection tube. The samples were lyophilized and kept at -80°C until analysis. Samples were reconstituted in ΙΟΟμΙ. of 0.001% Zwittergent 3-16. 4μΙ_,
(approximately 0^g) was injected via direct inject column configuration onto a Thermo Easy nano-LC 1200 system coupled to a QExactive High Field mass spectrometer.
Analytical columns were made using 75 um x 15 cm PicoFrit columns (New Objective, Woburn, MA) which were self-packed with Kinetex C18 2.6-um particles (phenomenex, Torrance, CA, USA). The samples were loaded with a 8 uL injection volume of mobile phase A (98% water, 2% acetonitrile, and 0.2% formic acid) with a max pressure of 600 Bar. A 4 hour gradient was performed at 300nL/min, going from 2% mobile phase B (80% Acetonitrile, 20% water, 0.2% formic acid), to 40%. A top 20 data dependent acquisition was performed with the following MS parameters: a spray voltage of +2kV, capillary temperature of 325°C, a S-lens RF level of 65.00, an MS resolving power of 120k and an
MS/MS resolving power of 15,000, a 3e6 MS AGC target with a max fill time of 50ms and 1E5 MS/MS AGC with a max fill time of 30ms and an intensity threshold of 3.3E4. The data was processed through proteome discoverer 2.0 and searched using the Uniprot human proteome FASTA database. Protein DB was digested in silico using rules for tryptic digestion (Cleaves C-terminal to R/K except when preceded by P) and allowing for potential missed cleavages (up to 3). The search tolerance allowed for 5 ppm MMA (mass measurement accuracy) for peptide, 0.02 Da for fragment ions. The following variable modifications were searched:
Serine- BMAA, Carbamidomethylation (Cys), Crotonaldehyde (C,H), and Aspartic acid - Glutamine
Peptides were validated at a 1% False Discovery Rate and manually validated to ensure high sequence coverage and exclude alternative hypotheses (Aspartic acid -> Glutamine or Crotonaldehyde Cys/His + Carbamidomethylation). All peptides containing a Ser- BMAA which could be validated by site specific mass fragmentation are listed below in Table 6, and the corresponding wild-type sequence fragments (without BMAA incorporation) are listed below in Table 7.
Table 6. Validated Peptides Containing BMAA
(Accessio ol LS mods n No.)
Human Peptidyl-
HTGPGLLSMANSGPNTNG* prolyl cis-trans
S*QFFLTCDK (SEQ ID isomerase E peptide
NO:29) Q9UNP9 sequence fragment 4 2 0
Human Protein
K AT Y V YE T * S * GPNL SD K FAM186A protein
SGQK (SEQ ID NO: 30) A6NE01 sequence fragment 1 0 0
Human
Staphylococcal
nuclease domain- containing protein 1
KGMW*S*EGNGSHTIR protein sequence
(SEQ ID NO:31) Q7KZF4 fragment 0 1 0
Human Ankyrin-2
KT*S*TDFSEVIK (SEQ ID protein sequence
NO:32) Q01484 fragment 0 1 0
Human EF-hand
calcium-binding
domain-containing
LGQG*S*GQGPK (SEQ ID protein 4B protein
NO:33) Q9BSW3 sequence fragment 1 0 0
Human Malignant
fibrous histiocytoma- amplified sequence 1
LLLGT * S * GEGK (SEQ ID protein sequence
NO:34) Q9Y4C4 fragment 0 1 0
Human Heat shock
factor protein 4
LSLMLDEG* S * SCPTPAK protein sequence
(SEQ ID NO:35) Q9ULV5 fragment 0 1 0
Human Inositol
polyphosphate 1-
MSDILRELLCV*S*EK (SEQ phosphatase protein
ID NO:36) P49441 sequence fragment 1 0 0
Human Solute carrier
family 12 member 7
NT A* S *HT AAAAR (SEQ ID protein sequence
NO:37) Q9Y666 fragment 0 1 0
Human Coiled-coil
domain-containing
Q*S*ELSAEESPEK (SEQ ID protein 93 protein
NO:38) Q567U6 sequence fragment 1 2 0
Human HLA class I
histocompatibility
antigen, Cw-16 alpha
*S**C*TAADTAAQITQR chain protein sequence
(SEQ ID NO:39) Q29960 fragment 2 1 1
(crotona Idehyde)
Human Peroxisomal
carnitine 0- octanoyltransferase
S GGGG F VL * S * T SL VG YL protein sequence
R (SEQ ID NO:40) Q9UKG9 fragment 1 0 0
Human Mucin- 19
*S*GTSIPSAGK (SEQ ID protein sequence
NO:41) Q7Z5P9 fragment 1 0 0
Human B eta- 1 , 3 -N- acetylglucosaminyltra
* S *L AGP AGAAP APGLGAA nsferase lunatic fringe
AAAPGALVR (SEQ ID protein sequence
NO:42) Q8 ES3 fragment 1 0 0
Human coiled-coil
domain-containing
SLFPPWTFQFQ * S * GDLEEK protein 168 protein
(SEQ ID NO:43) Q8 DH2 sequence fragment 0 1 0
Human E3 ubiquitin- protein ligase Z RF2
SLGGAVGS VA* S * GAR protein sequence
(SEQ ID NO:44) Q8 HG8 fragment 1 0 0
CCR4-NOT
transcription complex
*S*PVTFLSDLR (SEQ ID subunit 1 protein
NO:45) A5YKK6 sequence fragment 1 0 0
Human Septin-5
*S*TLVHSLFLTDLYK (SEQ protein sequence
ID NO:46) Q99719 fragment 3 0 0
Human
Uncharacterized
protein C18orf25
VEELIE*S*EAPPK (SEQ ID protein sequence
NO:47) Q96B23 fragment 1 0 0
Human Clathrin heavy
V* S *ELEDFINGPNNAHIQQ chain 2 protein
VGDR (SEQ ID NO:48) P53675 sequence fragment 5 3 0
Human C-C motif
chemokine 18 protein
YI*S*DLK (SEQ ID NO:49) P55774 sequence fragment 0 1 0
*S* = Ser~>BMAA
Carbamidomethylation or Crotonaldehyde
Table 7. Wild Type Sequences for Peptides Identified in Table 6
sequence ragment
The compositions and methods of the appended claims are not limited in scope by the specific compositions and methods described herein, which are intended as illustrations
of a few aspects of the claims. Any compositions and methods that are functionally equivalent are intended to fall within the scope of the claims. Various modifications of the compositions and methods in addition to those shown and described herein are intended to fall within the scope of the appended claims. Further, while only certain representative compositions and method steps disclosed herein are specifically described, other
combinations of the compositions and method steps also are intended to fall within the scope of the appended claims, even if not specifically recited. Thus, a combination of steps, elements, components, or constituents may be explicitly mentioned herein or less, however, other combinations of steps, elements, components, and constituents are included, even though not explicitly stated.
The term "comprising" and variations thereof as used herein is used synonymously with the term "including" and variations thereof and are open, non-limiting terms. Although the terms "comprising" and "including" have been used herein to describe various embodiments, the terms "consisting essentially of and "consisting of can be used in place of "comprising" and "including" to provide for more specific embodiments of the invention and are also disclosed. Other than where noted, all numbers expressing geometries, dimensions, and so forth used in the specification and claims are to be understood at the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, to be construed in light of the number of significant digits and ordinary rounding approaches.
Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed invention belongs. Publications cited herein and the materials for which they are cited are specifically incorporated by reference.
Claims
1. A polypeptide comprising a sequence that is at least 85% identical to SEQ ID NO: 1, wherein amino acid position 107 comprises a BMAA residue which is isotopically labeled and is defined by the formula below
\
fNH dc'H3
wherein the 13C isotopic enrichment factor for dC is at least 25; and
wherein the 15N isotopic enrichment factor for *Ν is at least 100.
2. The polypeptide of claim 1, wherein the 13C isotopic enrichment factor for dC is at least 80 and the 15N isotopic enrichment factor for *Ν is at least 200.
3. The polypeptide of claim 1 or 2, wherein the 13C isotopic enrichment factor for aC, C, and CC is at least 25.
4. The polypeptide of any one of claims 1-3, wherein the 13C isotopic enrichment factor for aC, C, and CC is at least 80.
5. The polypeptide of any one of claims 1-4, wherein the 15N isotopic enrichment factor for ¾ is at least 100.
6. The polypeptide of any one of claims 1-5, wherein the 15N isotopic enrichment factor for ¾ is at least 200.
7. The polypeptide of any one of claims 1-6, wherein the sequence is at least 90% identical to SEQ ID NO: 1.
8. The polypeptide of any one of claims 1-6, wherein the sequence is at least 95% identical to SEQ ID NO: 1.
9. The polypeptide of any one of claims 1-6, wherein the sequence is at least 99% identical to SEQ ID NO: 1.
10. The polypeptide of any one of claims 1-6, wherein the sequence is identical to SEQ ID
NO: 1.
11. A polypeptide comprising a sequence that is at least 85% identical to SEQ ID NO: 2, wherein amino acid position 107 comprises a BMAA residue which is isotopically labeled and is defined by the formula below
dC'H Ί,3
wherein the 13C isotopic enrichment factor for dC is at least 25; and
wherein the 15N isotopic enrichment factor for *Ν is at least 100.
12. The polypeptide of claim 11, wherein the 13C isotopic enrichment factor for dC is at least 80 and the 15N isotopic enrichment factor for *Ν is at least 200.
13. The polypeptide of claim 11 or 12, wherein the 13C isotopic enrichment factor for aC, C, and CC is at least 25.
14. The polypeptide of any one of claims 11-13, wherein the 13C isotopic enrichment factor for aC, C, and CC is at least 80.
15. The polypeptide of any one of claims 11-14, wherein the 15N isotopic enrichment factor for ¾ is at least 100.
16. The polypeptide of any one of claims 11-15, wherein the 15N isotopic enrichment factor for ¾ is at least 200.
17. The polypeptide of any one of claims 11-16, wherein the sequence is at least 90%
identical to SEQ ID NO: 2.
18. The polypeptide of any one of claims 11-16, wherein the sequence is at least 95%
identical to SEQ ID NO: 2.
19. The polypeptide of any one of claims 11-16, wherein the sequence is at least 99%
identical to SEQ ID NO: 2.
20. The polypeptide of any one of claims 11-16, wherein the sequence is identical to SEQ ID NO: 2.
21. A method for detecting β-Ν-methylamino-L-alanine (BMAA) in a SOD1 protein,
comprising:
(a) purifying SOD1 protein from a biological specimen to provide a purified SOD1 protein sample;
(b) spiking the purified S0D1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below
wherein R represents hydrogen or an amine protecting group, and at least two of aC, C, CC, dC, eN, *Ν, gO, and hO are isotopically labeled with a stable isotope,
to provide a BMAA-spiked sample;
(c) analyzing the BMAA-spiked sample by mass spectrometry; and
(d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis.
22. The method of claim 21, wherein at least three of aC, C, CC, dC, eN, % gO, and hO are isotopically labeled with a stable isotope.
23. The method of claim 21 or 22, wherein at least four of aC, C, CC, dC, eN, % gO, and hO are isotopically labeled with a stable isotope.
24. The method of any one of claims 21-23, wherein at least three of aC, C, CC, dC, eN, and *Ν are isotopically labeled with a stable isotope.
25. The method of any one of claims 21-24, wherein at least four of aC, C, CC, dC, and *Ν are isotopically labeled with a stable isotope.
26. The method of any one of claims 21-25, wherein aC, C, CC, dC, and ^ are
isotopically labeled with a stable isotope.
27. The method of any one of claims 21-26, wherein the isotopically labeled compound is defined by the formula below
wherein the 13C isotopic enrichment factor for aC, C, CC, and dC is at least 25; and
wherein the 15N isotopic enrichment factor for eN and *Ν is at least 100.
28. The method of claim 27, wherein the 13C isotopic enrichment factor for aC, C, CC, and dC is at least 80 and the 15N isotopic enrichment factor for ¾ and *Ν is at least 200.
29. The method of any one of claims 21-28, wherein R is hydrogen.
30. The method of any one of claims 21-28, wherein R represents a 9- fluorenylmethyloxycarbonyl group.
31. A method for detecting β-Ν-methylamino-L-alanine (BMAA) in a SOD1 protein, comprising:
(a) purifying SOD1 protein from a biological specimen to provide a purified SOD1 protein sample;
(b) spiking the purified SOD1 protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled β-Ν-methylamino-L- alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes;
to provide a BMAA-spiked sample;
(c) analyzing the BMAA-spiked sample by mass spectrometry; and
(d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis.
32. The method of claim 31, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with two or more stable isotopes.
33. The method of claim 31 or 32, wherein each of the one or more isotopically labeled BMAA residues is defined by the formula below
dc'H3
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100.
34. The method of claim 33, wherein the 13C isotopic enrichment factor for dC is at least 80 and the 15N isotopic enrichment factor for *Ν is at least 200.
35. The method of claim 33 or 34, wherein the 13C isotopic enrichment factor for aC, C, and CC is at least 25.
36. The method of any one of claims 33-35, wherein the 13C isotopic enrichment factor for aC, C, and CC is at least 80.
37. The method of any one of claims 33-36, wherein the 15N isotopic enrichment factor for eN is at least 100.
38. The method of any one of claims 33-37, wherein the 15N isotopic enrichment factor for eN is at least 200.
39. The method of any one of claims 31-38, wherein the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 1.
40. The method of any one of claims 31-38, wherein the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 1.
41. The method of any one of claims 31-38, wherein the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 1.
42. The method of any one of claims 31-38, wherein the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 1.
43. The method of any one of claims 31-38, wherein the polypeptide comprises a sequence is identical to SEQ ID NO: 1.
44. The method of any one of claims 31-38, wherein the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 2.
45. The method any one of claims 31-38, wherein the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 2.
46. The method any one of claims 31-38, wherein the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 2.
47. The method any one of claims 31-38, wherein the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 2.
48. The method any one of claims 31-38, wherein the polypeptide comprises a sequence is identical to SEQ ID NO: 2.
49. The method of any one of claims 31-48, wherein the purified SOD1 protein sample is digested with trypsin.
50. A method of detecting or predicting amyotrophic lateral sclerosis in a subject, comprising:
(a) purifying SOD1 protein from a biological specimen from a subject to provide a purified SOD1 protein sample;
(b) spiking the purified SOD1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below
wherein R represents hydrogen or an amine protecting group, and at least two of aC, C, CC, dC, eN, *Ν, gO, and hO are isotopically labeled with a stable isotope,
to provide a BMAA-spiked sample;
(c) analyzing the BMAA-spiked sample by mass spectrometry;
(d) measuring BMAA level in the SOD1 protein sample by isotope dilution analysis; and
(e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA level in the SOD1 protein is greater than a normal reference value.
51. The method of claim 50, wherein at least three of aC, C, CC, dC, eN, % gO, and hO are isotopically labeled with a stable isotope.
52. The method of claims 50 or 51, wherein at least four of aC, C, CC, dC, % gO, and hO are isotopically labeled with a stable isotope.
53. The method of any one of claims 50-52, wherein at least three of aC, C, CC, dC, eN, and *Ν are isotopically labeled with a stable isotope.
54. The method of any one of claims 50-53, wherein at least four of aC, C, CC, dC, and *Ν are isotopically labeled with a stable isotope.
55. The method of any one of claims 50-54, wherein aC, C, CC, dC, and *N are
isotopically labeled with a stable isotope.
56. The method of any one of claims 50-55, wherein the isotopically labeled compound is defined by the formula below
wherein R represents hydrogen or an amine protecting group;
wherein the 13C isotopic enrichment factor for aC, C, CC, and dC is at least 25; and
wherein the 15N isotopic enrichment factor for eN and *Ν is at least 100.
57. The method of claim 56, wherein the 13C isotopic enrichment factor for aC, C, CC, and dC is at least 80 and the 15N isotopic enrichment factor for ¾ and *Ν is at least 200.
58. The method of any one of claims 50-57, wherein R is hydrogen.
59. The method of any one of claims 50-57, wherein R represents a 9- fluorenylmethyloxycarbonyl group.
60. The method of any one of claims 50-59, wherein the SODl protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP-lysine, 4- hydroxynonenal sulfonation and nitrosylation.
61. A method of detecting or predicting amyotrophic lateral sclerosis in a subject,
comprising:
(a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample;
(b) spiking the purified SODl protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled β-Ν-methylamino-L- alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes;
to provide a BMAA-spiked sample;
(c) analyzing the BMAA-spiked sample by mass spectrometry;
(d) measuring BMAA level in the SODl protein sample by isotope dilution analysis; and
(e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA level in the SODl protein is greater than a normal reference value.
62. The method of claim 61, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with two or more stable isotopes.
63. The method of claim 61 or 62, wherein each of the one or more isotopically labeled BMAA residues is defined by the formula below
\
fNH dc'H3
wherein the 13C isotopic enrichment factor for dC is at least 25; and wherein the 15N isotopic enrichment factor for *Ν is at least 100.
64. The method of claim 63, wherein the 13C isotopic enrichment factor for dC is at least 80 and the 15N isotopic enrichment factor for *Ν is at least 200.
65. The method of claim 63 or 64, wherein the 13C isotopic enrichment factor for aC, C, and CC is at least 25.
66. The method of any one of claims 63-65, wherein the 13C isotopic enrichment factor for aC, C, and CC is at least 80.
67. The method of any one of claims 63-66, wherein the 15N isotopic enrichment factor for eN is at least 100.
68. The method of any one of claims 63-67, wherein the 15N isotopic enrichment factor for eN is at least 200.
69. The method of any one of claims 61-68, wherein the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 1.
70. The method of any one of claims 61-68, wherein the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 1.
71. The method of any one of claims 61-68, wherein the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 1.
72. The method of any one of claims 61-68, wherein the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 1.
73. The method of any one of claims 61-68, wherein the polypeptide comprises a sequence is identical to SEQ ID NO: 1.
74. The method of any one of claims 61-68, wherein the polypeptide comprises a sequence is at least 85% identical to SEQ ID NO: 2.
75. The method of any one of claims 61-68, wherein the polypeptide comprises a sequence is at least 90% identical to SEQ ID NO: 2.
76. The method of any one of claims 61-68, wherein the polypeptide comprises a sequence is at least 95% identical to SEQ ID NO: 2.
77. The method of any one of claims 61-68, wherein the polypeptide comprises a sequence is at least 99% identical to SEQ ID NO: 2.
78. The method of any one of claims 61-68, wherein the polypeptide comprises a sequence is identical to SEQ ID NO: 2.
79. The method of any one of claims 61-78, wherein the purified SOD1 protein sample is digested with trypsin.
80. The method of any one of claims 61-79 wherein the SOD1 protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP-lysine, 4- hydroxynonenal sulfonation and nitrosylation.
81. A method of preventing or treating amyotrophic lateral sclerosis in a subject,
comprising:
(a) purifying SOD1 protein from a biological specimen from a subject to provide a purified SOD1 protein sample;
(b) spiking the purified SOD1 protein sample with a defined amount of an isotopically labeled compound defined by the formula below
90
wherein R represents hydrogen or an amine protecting group, and at least two of C, C, CC, dC, eN, *Ν, gO, and hO are isotopically labeled with a stable isotope,
to provide a BMAA-spiked sample;
(c) analyzing the BMAA-spiked sample by mass spectrometry;
(d) measuring BMAA levels in the SOD1 protein sample by isotope dilution analysis; and
(e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the SOD1 protein is greater than a normal reference value; and
(f) administering to the subject L-serine in an amount sufficient to prevent or treat the amyotrophic lateral sclerosis.
82. The method of claim 81, wherein at least three of aC, C, CC, dC, eN, % O, and HO are isotopically labeled with a stable isotope.
83. The method of claims 81 or 82, wherein at least four of aC, C, CC, dC, % GO, and HO are isotopically labeled with a stable isotope.
84. The method of any one of claims 81-83, wherein at least three of aC, C, CC, dC, eN, and *Ν are isotopically labeled with a stable isotope.
85. The method of any one of claims 81-84, wherein at least four of aC, C, CC, dC, and *Ν are isotopically labeled with a stable isotope.
86. The method of any one of claims 81-85, wherein aC, C, CC, dC, and *Ν are
isotopically labeled with a stable isotope.
87. The method of any one of claims 81-86, wherein the isotopically labeled compound is defined by the formula below
wherein R represents hydrogen or an amine protecting group;
wherein the 13C isotopic enrichment factor for aC, C, CC, and dC is at least 25; and
wherein the 15N isotopic enrichment factor for eN and *Ν is at least 100.
88. The method of claim 87, wherein the 13C isotopic enrichment factor for aC, C, CC, and dC is at least 80 and the 15N isotopic enrichment factor for ¾ and *Ν is at least 200.
89. The method of any one of claims 81-88, wherein R is hydrogen.
90. The method of any one of claims 81-88, wherein R represents a 9- fluorenylmethyloxycarbonyl group.
91. The method of any one of claims 81-90 wherein the SODl protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP-lysine, 4- hydroxynonenal sulfonation and nitrosylation.
92. A method of preventing or treating amyotrophic lateral sclerosis in a subject,
comprising:
(a) purifying SODl protein from a biological specimen from a subject to provide a purified SODl protein sample;
(b) spiking the purified SODl protein sample with a defined amount of a polypeptide, wherein the polypeptide includes one or more isotopically labeled β-Ν-methylamino-L- alanine (BMAA) residues, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with one or more stable isotopes;
to provide a BMAA-spiked sample;
(c) analyzing the BMAA-spiked sample by mass spectrometry;
(d) measuring BMAA levels in the SODl protein sample by isotope dilution analysis; and
(e) identifying the subject for the presence or risk of amyotrophic lateral sclerosis if the BMAA levels in the SODl protein is greater than a normal reference value; and
(f) administering to the subject L-serine in an amount sufficient to prevent or treat the amyotrophic lateral sclerosis.
93. The method of claim 92, wherein each of the one or more isotopically labeled BMAA residues is isotopically labeled with two or more stable isotopes.
94. The method of claim 92 or 93, wherein each of the one or more isotopically labeled BMAA residues is defined by the formula below
\
fNH dc'H3
wherein the 13C isotopic enrichment factor for dC is at least 25; and
wherein the 15N isotopic enrichment factor for *Ν is at least 100.
95. The method of claim 94, wherein the 13C isotopic enrichment factor for dC is at least 80 and the 15N isotopic enrichment factor for *Ν is at least 200.
96. The method of claim 94 or 95, wherein the 13C isotopic enrichment factor for aC, C, and CC is at least 25.
97. The method of any one of claims 94-96, wherein the 13C isotopic enrichment factor for aC, C, and CC is at least 80.
98. The method of any one of claims 94-97, wherein the 15N isotopic enrichment factor for eN is at least 100.
99. The method of any one of claims 94-98, wherein the 15N isotopic enrichment factor for eN is at least 200.
100. The method of any one of claims 92-99, wherein the polypeptide comprises a
sequence is at least 85% identical to SEQ ID NO: 1.
101. The method of any one of claims 92-99, wherein the polypeptide comprises a
sequence is at least 90% identical to SEQ ID NO: 1.
102. The method of any one of claims 92-99, wherein the polypeptide comprises a
sequence is at least 95% identical to SEQ ID NO: 1.
103. The method of any one of claims 92-99, wherein the polypeptide comprises a
sequence is at least 99% identical to SEQ ID NO: 1.
104. The method of any one of claims 92-99, wherein the polypeptide comprises a
sequence is identical to SEQ ID NO: 1.
105. The method of any one of claims 92-99, wherein the polypeptide comprises a
sequence is at least 85% identical to SEQ ID NO: 2.
106. The method of any one of claims 92-99, wherein the polypeptide comprises a
sequence is at least 90% identical to SEQ ID NO: 2.
107. The method of any one of claims 92-99, wherein the polypeptide comprises a
sequence is at least 95% identical to SEQ ID NO: 2.
108. The method of any one of claims 92-99, wherein the polypeptide comprises a
sequence is at least 99% identical to SEQ ID NO: 2.
109. The method of any one of claims 92-99, wherein the polypeptide comprises a
sequence is identical to SEQ ID NO: 2.
110. The method of any one of claims 92-109, wherein the purified SOD1 protein
sample is digested with trypsin.
. The method of any one of claims 92-110 wherein the SODl protein further comprises a post-translational modification selected from the group consisting of a phospho group, acetyl group, glutathione, crotonaldehyde, glyoxal derived
carboxymethyllysine, carboxyethyl, propionyl, crotonaldehyde derived dimethyl-FDP- lysine, 4-hydroxynonenal sulfonation and nitrosylation.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/320,570 US20190241607A1 (en) | 2016-07-29 | 2017-07-31 | Compositions and methods for detection of beta n methylamino l alanine in cu zn superoxide dismutase 1 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662368437P | 2016-07-29 | 2016-07-29 | |
| US201662368562P | 2016-07-29 | 2016-07-29 | |
| US62/368,437 | 2016-07-29 | ||
| US62/368,562 | 2016-07-29 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018023115A1 true WO2018023115A1 (en) | 2018-02-01 |
Family
ID=61016713
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/044702 Ceased WO2018023116A1 (en) | 2016-07-29 | 2017-07-31 | Materials and methods for detection and quantification of beta-n-methylamino-l-alanine |
| PCT/US2017/044693 Ceased WO2018023115A1 (en) | 2016-07-29 | 2017-07-31 | Compositions and methods for detection of beta n methylamino l alanine in cu zn superoxide dismutase 1 |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/044702 Ceased WO2018023116A1 (en) | 2016-07-29 | 2017-07-31 | Materials and methods for detection and quantification of beta-n-methylamino-l-alanine |
Country Status (2)
| Country | Link |
|---|---|
| US (2) | US11370812B2 (en) |
| WO (2) | WO2018023116A1 (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10939365B1 (en) | 2020-02-25 | 2021-03-02 | Sprint Spectrum L.P. | Dynamic establishment and maintenance of secondary-coverage scan list for dual-connectivity |
| US11013046B1 (en) | 2020-01-09 | 2021-05-18 | Sprint Spectrum L.P. | Dynamic control of secondary-connection addition threshold based on secondary-connection addition failures |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN118758883B (en) * | 2024-07-08 | 2025-02-18 | 中国海洋大学 | Method for rapidly detecting marine diatom synthetic protein binding state BMAA |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9678083B2 (en) * | 2009-10-14 | 2017-06-13 | Dana-Farber Cancer Institute, Inc. | Protected amine labels and use in detecting analytes |
-
2017
- 2017-07-31 US US16/321,091 patent/US11370812B2/en active Active
- 2017-07-31 WO PCT/US2017/044702 patent/WO2018023116A1/en not_active Ceased
- 2017-07-31 WO PCT/US2017/044693 patent/WO2018023115A1/en not_active Ceased
- 2017-07-31 US US16/320,570 patent/US20190241607A1/en not_active Abandoned
Non-Patent Citations (2)
| Title |
|---|
| HU , YULIN ET AL.: "Synthesis and optical resolution of the neurotoxin 2-amino-3- ([i5N]-methylamino)propanoic acid (BMAA", JOURNAL OF LABELLED COMPOUNDS AND RADIOPHARMACEUTICALS, vol. XXVIII, no. 5, 1990, pages 581 - 586, XP055459950 * |
| REECE, DEBORAH M. ET AL.: "Synthesis of 14C-L-alpha-amino-beta- methylaminopropionic acid and its metabolism in the rat", BIOCHEMICAL SOCIETY TRANSACTIONS, vol. 17, no. 1, 1989, pages 203 - 204, XP055459852 * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11013046B1 (en) | 2020-01-09 | 2021-05-18 | Sprint Spectrum L.P. | Dynamic control of secondary-connection addition threshold based on secondary-connection addition failures |
| US10939365B1 (en) | 2020-02-25 | 2021-03-02 | Sprint Spectrum L.P. | Dynamic establishment and maintenance of secondary-coverage scan list for dual-connectivity |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2018023116A1 (en) | 2018-02-01 |
| US11370812B2 (en) | 2022-06-28 |
| US20190241607A1 (en) | 2019-08-08 |
| US20190161515A1 (en) | 2019-05-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Rose et al. | Industrial‐scale proteomics: from liters of plasma to chemically synthesized proteins | |
| US20190060483A1 (en) | Preparation of therapeutic exosomes using membrane proteins | |
| Messana et al. | Chrono-proteomics of human saliva: variations of the salivary proteome during human development | |
| JP4405919B2 (en) | Biomarkers for the diagnosis of Alzheimer's disease | |
| CA2467073A1 (en) | Peptides and method for detecting alzheimer's disease and differentiating alzheimer's disease from other demential diseases | |
| US20190241607A1 (en) | Compositions and methods for detection of beta n methylamino l alanine in cu zn superoxide dismutase 1 | |
| Halgand et al. | Defining intact protein primary structures from saliva: a step toward the human proteome project | |
| Terashima et al. | Identification of deamidation and isomerization sites on pharmaceutical recombinant antibody using H218O | |
| EP4040153A1 (en) | Method for detecting tau protein using blood sample as specimen | |
| CN110790819B (en) | Donkey-hide gelatin polypeptide and preparation method thereof | |
| Orlando et al. | Covalent modification of Alzheimer's amyloid β-peptide in formic acid solutions | |
| EP2488492B1 (en) | Protected amine labels and use in detecting analytes | |
| Peterson et al. | Probing alpha-crystallin structure using chemical cross-linkers and mass spectrometry | |
| Biberoglu et al. | Polyproline tetramer organizing peptides in fetal bovine serum acetylcholinesterase | |
| Schmidt et al. | Quantitative proteome analysis of cisplatin‐induced apoptotic Jurkat T cells by stable isotope labeling with amino acids in cell culture, SDS‐PAGE, and LC‐MALDI‐TOF/TOF MS | |
| Bieber et al. | Structural, biological and biochemical studies of myotoxin a and homologous myotoxins | |
| US8895697B2 (en) | Isolated monophosphorylated peptide derived from human alpha-enolase useful for diagnosis and treatment of pancreatic adenocarcinoma, antibodies directed against the said monophosphorylated peptide, and uses thereof | |
| Rose et al. | Robust and highly efficient extractions of proteins from bones enable deep, high-throughput proteomic quantification to gain insights into bone biology | |
| Halgand et al. | Micro-heterogeneity of human saliva Peptide PC characterized by high-resolution top-down Fourier-transform mass spectrometry | |
| EP1522856A1 (en) | Method for the detection of a neurological or psychiatric, demential disease, especially Alzheimer's disease by use of cholecystokinin (CCK)-molecules, corresponding substances and detection reagents | |
| Ahn et al. | Mining of serum glycoproteins by an indirect approach using cell line secretome | |
| CN114008072A (en) | Apolipoprotein E fragments | |
| KR100630658B1 (en) | Mutated SMWO-1 Protein | |
| US20240190937A1 (en) | Human insulin c-alpha-peptides and methods of use | |
| WO2011029946A1 (en) | A proteolytic product of histone h2a as a marker for cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17835415 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 17835415 Country of ref document: EP Kind code of ref document: A1 |
























































