WO2017197347A1 - METHODS FOR SELECTIVE EXPANSION OF γδ T-CELL POPULATIONS AND COMPOSITIONS THEREOF - Google Patents

METHODS FOR SELECTIVE EXPANSION OF γδ T-CELL POPULATIONS AND COMPOSITIONS THEREOF Download PDF

Info

Publication number
WO2017197347A1
WO2017197347A1 PCT/US2017/032530 US2017032530W WO2017197347A1 WO 2017197347 A1 WO2017197347 A1 WO 2017197347A1 US 2017032530 W US2017032530 W US 2017032530W WO 2017197347 A1 WO2017197347 A1 WO 2017197347A1
Authority
WO
WIPO (PCT)
Prior art keywords
cells
cell
epitope
cell population
tcr
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/032530
Other languages
English (en)
French (fr)
Inventor
Aya Jakobovits
Orit Foord
Andy An-Deh Lin
Marianne Theresa Santaguida
Radhika Chetan DESAI
Yifeng Frank JING
Daulet Kadyl SATPAYEV
Yan Li
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Adicet Bio Inc
Original Assignee
Adicet Bio Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202410184013.2A priority Critical patent/CN118421557A/zh
Priority to EP17796994.6A priority patent/EP3454870A4/en
Priority to JP2018559834A priority patent/JP7210286B2/ja
Priority to IL301527A priority patent/IL301527B2/en
Priority to KR1020187035576A priority patent/KR102519861B1/ko
Priority to CA3023993A priority patent/CA3023993A1/en
Priority to MX2018013864A priority patent/MX2018013864A/es
Priority to CN201780042797.3A priority patent/CN110072533B/zh
Priority to US15/563,830 priority patent/US11299708B2/en
Priority to AU2017261804A priority patent/AU2017261804A1/en
Application filed by Adicet Bio Inc filed Critical Adicet Bio Inc
Publication of WO2017197347A1 publication Critical patent/WO2017197347A1/en
Priority to IL262919A priority patent/IL262919B2/en
Anticipated expiration legal-status Critical
Priority to ZA2018/08140A priority patent/ZA201808140B/en
Priority to US17/718,152 priority patent/US12364714B2/en
Priority to JP2022133983A priority patent/JP7791789B2/ja
Priority to AU2023278051A priority patent/AU2023278051A1/en
Priority to JP2025123803A priority patent/JP2025170245A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/20Cellular immunotherapy characterised by the effect or the function of the cells
    • A61K40/24Antigen-presenting cells [APC]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/32T-cell receptors [TCR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2121/00Preparations for use in therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/74Inducing cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/998Proteins not provided for elsewhere

Definitions

  • T lymphocytes may be achieved by highly diverse heterodimeric receptors, the T-cell receptors (TCRs). Approximately 95% of human T-cells in blood and lymphoid organs express a heterodimeric ⁇ TCR receptor ( ⁇ T-cell lineage). Approximately 5% of human T-cells in the blood and lymphoid organs express heterodimeric ⁇ TCR receptor ( ⁇ T-cell lineage). These T-cell subsets may be referred to as ' ⁇ ' and ' ⁇ ' T-cells, respectively, ⁇ and ⁇ T-cells are different in function. Activation of ⁇ T-cells then occurs when an antigen presenting cell (APC) presents an antigen in the context of class I/II MHC. In contrast to ⁇ T-cells, ⁇ T-cells can recognize an antigen independent of MHC restriction. In addition, ⁇ T-cells combine both innate and adoptive immune recognition and responses.
  • APC antigen presenting cell
  • ⁇ T cells utilize a distinct set of somatically rearranged variable (V), diversity (D), joining (J), and constant (C) genes, ⁇ T cells contain fewer V, D, and J segments than ⁇ T cells.
  • V variable
  • D diversity
  • J joining
  • C constant
  • Human ⁇ T-cells use 3 main ⁇ ( ⁇ 1, ⁇ 2, ⁇ 3) and at most six Vy region genes to make their TCRs (Hayday AC, Annu Rev Immunol. 2000; 18, 975-1026).
  • Two main ⁇ subsets are V ⁇ 1 and ⁇ 2 ⁇ T cells, ⁇ 1 T cells with different Vy predominate in the intraepithelial subset of mucosal ⁇ T cells where the TCRs appear to recognize stress molecules on epithelial cells (Beagley KW, Husband AJ. Crit Rev Immunol. 1998; 18(3):237-254).
  • ⁇ 2 T cells that generally coexpress Vy9 are abundant in the peripheral blood and lymphatic system.
  • ⁇ T-cells The ability of ⁇ T-cells to recognize an antigen on diseased cells directly and to exhibit inherent ability to kill tumor cells renders ⁇ T-cells an attractive therapeutic tool.
  • Adoptive transfer of Vy9V ⁇ 2 T cells has yielded limited objective clinical responses for investigational treatment of cancer (Kondo et al, Cytotherapy, 10:842- 856, 2008; Lang et al, Cancer Immunology,
  • the present invention in one aspect, provides ex vivo methods for producing enriched ⁇ T- cell populations.
  • the enriched ⁇ T-cell populations can be produced from isolated mixed cell populations by a method comprising contacting the mixed cell population, or a purified fraction thereof, with one or more agents:
  • the enriched ⁇ T cell population comprises a clinically-relevant level of ⁇ T cells.
  • the invention provides ex vivo methods for producing an enriched ⁇ T-cell population from an isolated mixed cell population, comprising directly contacting the mixed cell population with one or more agents:
  • the clinically-relevant level comprises more than about, or at least about, 10 8 ⁇ T cells, 10 9 ⁇ T cells, 10 10 ⁇ T cells, 10 11 ⁇ T cells, or 10 12 ⁇ T cells (e.g., from about 10 8 to about 10 12 ).
  • the isolated mixed cell population is derived from a single donor and the method provides a clinical relevant level of an enriched ⁇ T cell population expanded from a single donor, e.g., from a single sample from the single donor or 2 or more samples from the single donor.
  • the isolated mixed cell population is derived from more than one or multiple donors.
  • the enriched ⁇ T-cell population comprises clinically-relevant levels of ⁇ T-cell subsets of >10 8 .
  • the enriched ⁇ T-cell population comprises clinically-relevant levels of ⁇ T-cell subsets of >10 8 .
  • the agent which selectively expands ⁇ 1 T-cells is selected from an agent which binds to the same epitope as an antibody selected from TS-1 and TS8.2. In some embodiments, the agent which selectively expands ⁇ 1 T-cells is an agent that binds a different epitope than the epitope bound by TS-1 and/or TS8.2 antibody. In some embodiments, the agent which selectively expands ⁇ 1 T-cells is an agent that binds an epitope that does not overlap with the epitope bound by, or does not compete with, TS-1 or TS8.2 antibody.
  • the agent which selectively expands ⁇ 1 T-cells is selected from an agent which specifically binds to an epitope comprising a ⁇ 1 variable region.
  • the agent binds to a ⁇ 1 TCR variable region comprising an amino acid sequence of a consensus sequence of FIG. 24.
  • the agent binds to an epitope comprising residues Arg71 or Asp72 of the ⁇ 1 variable region, and/or Lysl20 of a Jl or J2 region.
  • the agent has reduced binding to a mutant ⁇ 1 TCR polypeptide comprising a mutation at K120 of ⁇ 1 Jl or ⁇ 1 J2, e.g.
  • the agent which selectively expands ⁇ 1 T-cells is selected from an agent which binds to the same epitope as antibody R9.12. In some embodiments, the agent which selectively expands ⁇ 1 T-cells is an agent that binds a different epitope than the epitope bound by antibody R9.12. In some embodiments, the agent which selectively expands ⁇ 1 T-cells is an agent that binds an epitope that does not overlap with the epitope bound by, or does not compete with, antibody R9.12.
  • the agent that selectively expands ⁇ 1 T-cells is an agent that selectively binds to and/or expands ⁇ 1 and ⁇ 4 T-cells, or ⁇ 1, 53, 54 and ⁇ 5 T cells. In certain embodiments, the agent that selectively expands ⁇ 1 T-cells is an agent that comprises the
  • CDRs complementarity determining regions of an antibody selected from the group consisting of ⁇ 1-05, ⁇ 1-08, ⁇ 1-18, ⁇ 1-22, ⁇ 1-23, ⁇ 1-26, ⁇ 1-35, ⁇ 1-37, ⁇ 1-39, ⁇ 1-1 13, ⁇ 1-143, ⁇ 1-149, ⁇ 1-155, ⁇ 1- 182, ⁇ 1-183, ⁇ 1-191, ⁇ 1-192, ⁇ 1-195, ⁇ 1-197, ⁇ 1-199, ⁇ 1-201, ⁇ 1-203, ⁇ 1-239, ⁇ 1-253, ⁇ 1-257, ⁇ 1- 278, ⁇ 1-282, and ⁇ 1-285.
  • CDRs complementarity determining regions
  • the agent that selectively expands ⁇ 1 T-cells is an agent that comprises the variable regions of an antibody selected from the group consisting of ⁇ 1-05, ⁇ 1-08, ⁇ 1-18, ⁇ 1-22, ⁇ 1-23, ⁇ 1-26, ⁇ 1-35, ⁇ 1-37, ⁇ 1-39, ⁇ 1-1 13, ⁇ 1-143, ⁇ 1-149, ⁇ 1-155, ⁇ 1-182, ⁇ 1-183, ⁇ 1-191, ⁇ 1-192, ⁇ 1-195, ⁇ 1-197, ⁇ 1-199, ⁇ 1-201, ⁇ 1-203, ⁇ 1-239, ⁇ 1-253, ⁇ 1-257, ⁇ 1-278, ⁇ 1-282, and ⁇ 1-285.
  • the agent that selectively expands ⁇ 1 T-cells is an agent that binds the same epitope, or essentially the same epitope, as, or competes with, an antibody selected from the group consisting of ⁇ 1-05, ⁇ 1-08, ⁇ 1-18, ⁇ 1-22, ⁇ 1-23, ⁇ 1-26, ⁇ 1-35, ⁇ 1-37, ⁇ 1-39, ⁇ 1-1 13, ⁇ 1-143, ⁇ 1-149, ⁇ 1-155, ⁇ 1-182, ⁇ 1-183, ⁇ 1-191, ⁇ 1-192, ⁇ 1-195, ⁇ 1-197, ⁇ 1-199, ⁇ 1-201, ⁇ 1-203, ⁇ 1-239, ⁇ 1-253, ⁇ 1-257, ⁇ 1-278, ⁇ 1-282, and ⁇ 1-285.
  • the agent that selectively expands ⁇ 1 T-cells is an antibody selected from the group consisting of ⁇ 1-05, ⁇ 1-08, ⁇ 1-18, ⁇ 1-22, ⁇ 1-23, ⁇ 1-26, ⁇ 1-35, ⁇ 1-37, ⁇ 1-39, ⁇ 1-1 13, ⁇ 1-143, ⁇ 1-149, ⁇ 1-155, ⁇ 1-182, ⁇ 1-183, ⁇ 1-191, ⁇ 1-192, ⁇ 1-195, ⁇ 1-197, ⁇ 1-197, ⁇ 1-199, ⁇ 1-201, ⁇ 1-203, ⁇ 1-239, ⁇ 1-253, ⁇ 1-257, ⁇ 1-278, ⁇ 1-282, and ⁇ 1-285.
  • the agent that selectively expands ⁇ 1 T-cells is an antibody that binds a Bin 1 ⁇ 1 epitope, a Bin lb ⁇ 1 epitope, a Bin 2 ⁇ 1 epitope, a Bin 2b ⁇ 1 epitope, a Bin 2c ⁇ 1 epitope, a Bin 3 ⁇ 1 epitope, a Bin 4 ⁇ 1 epitope, a Bin 5 ⁇ 1 epitope, a Bin 6 ⁇ 1 epitope, a Bin 7 ⁇ 1 epitope, a Bin 8 ⁇ 1 epitope, or a Bin 9 ⁇ 1 epitope.
  • the methods of the invention provide enriched ⁇ T-cell population(s) comprising greater than 60%, 70%, 80% or 90% ⁇ 1 cells from an isolated mixed cell population comprising T lymphocytes. In some embodiments, the methods of the invention provide enriched ⁇ T-cell population(s) comprising greater than 60%, 70%, 80% or 90% ⁇ 1 cells from an isolated, e.g., mixed, cell population comprising T lymphocytes, before a step of purifying an expanded ⁇ T-cell population, e.g., by positive selection of ⁇ T-cells (e.g., positive selection of ⁇ 1 T cells, ⁇ 1 and ⁇ 3 ⁇ T cells; ⁇ 1 and ⁇ 4 ⁇ T cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T cells (e.g., ⁇ T cells of the indicated ⁇ - subtype(s)); and/or positive selection of ⁇ 2 T cells) from the enriched ⁇ T-cell population(s), or by depletion of non- ⁇ T
  • the methods of the present invention provide a ⁇ T-cell population comprising ⁇ 1 ⁇ T cells and ⁇ 2 ⁇ T cells, wherein the population is greater than 60%, 70%, 80% or 90% ⁇ 1 ⁇ T cells.
  • the methods of the present invention provide a ⁇ T-cell population comprising ⁇ 1 ⁇ T cells; 62 ⁇ T cells; ⁇ 1 and ⁇ 4 ⁇ T cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 ⁇ T cells, wherein (i) the population is greater than 60%, 70%, 80% or 90% ⁇ 1 ⁇ T cells; (ii) the population is greater than 60%, 70%, 80% or 90% ⁇ 1 and ⁇ 3 ⁇ T cells; (iii) the population is greater than 60%, 70%, 80% or 90% ⁇ 1 and ⁇ 4 ⁇ T cells; or (iv) the population is greater than 60%, 70%, 80%) or 90%) ⁇ 1, 63, 54, and ⁇ 5 ⁇ T cells.
  • the methods of the present invention provide a composition comprising a population of ⁇ T cells (e.g., ⁇ 1 ⁇ T cells) that is free of, or contains less than about 2%, 1%, 0.5%, 0.4%, 0.1%, 0.05%, or 0.01%, ⁇ T cells.
  • ⁇ T cells e.g., ⁇ 1 ⁇ T cells
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises about or less than about 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1.5%, 1.2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4% 0.3%, 0.2%, or 0.1% ⁇ T cells (e.g., ⁇ 1, 52, ⁇ 1 and ⁇ 2, ⁇ 1 and ⁇ 3, or ⁇ 1 and ⁇ 4 ⁇ T cells, or a combination thereof).
  • ⁇ T cells e.g., ⁇ 1, 52, ⁇ 1 and ⁇ 2, ⁇ 1 and ⁇ 3, or ⁇ 1 and ⁇ 4 ⁇ T cells, or a combination thereof.
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises from about 0.5% to about 5% ⁇ T cells (e.g., ⁇ 1, 52, ⁇ 3, 54, or ⁇ 8 ⁇ T cells, or a combination thereof).
  • the isolated mixed cell population is from a donor or multiple donors having a larger than median level of circulating or sample- (e.g., tumor- or epithelial sample-) infiltrating ⁇ T-cells.
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises from about 0.5% to about 10%) ⁇ T cells (e.g., ⁇ 1, 52, ⁇ 3, 54, or 58 ⁇ T cells, or a combination thereof).
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises about from about 10% to about 30% ⁇ T cells (e.g., ⁇ 1, 52, ⁇ 3, 54, or 58 ⁇ T cells, or a combination thereof).
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises about or less than about 1.5% ⁇ T cells, preferably less than about 1.2% ⁇ T cells, more preferably less than about 1% ⁇ T cells, yet more preferably less than about 0.5% ⁇ T cells, e.g., from about 0.1% to about 0.4% ⁇ T cells.
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises about 80%, 70%, 60%, 50%, 40%, 30%, or 20% T lymphocytes and less than about 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1.5%, 1.2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4% 0.3%, 0.2%, or 0.1% ⁇ T cells (e.g., ⁇ 1, 62, ⁇ 1 and ⁇ 2, ⁇ 1 and 63, or ⁇ 1 and ⁇ 4 ⁇ T cells, or a combination thereof).
  • ⁇ T cells e.g., ⁇ 1, 62, ⁇ 1 and ⁇ 2, ⁇ 1 and 63, or ⁇ 1 and ⁇ 4 ⁇ T cells, or a combination thereof.
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises about 80%, 70%, 60%, 50%, 40%, 30%, or 20% T lymphocytes and from about 0.5% to about 5% ⁇ T cells (e.g., ⁇ 1, 52, 63, 54, or 68 ⁇ T cells, or a combination thereof).
  • the isolated mixed cell population is from a donor or multiple donors having a larger than median level of circulating or sample- (e.g., tumor- or epithelial sample-) infiltrating ⁇ T-cells.
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises about 80%, 70%, 60%, 50%, 40%, 30%, or 20% T lymphocytes and from about 0.5% to about 10% ⁇ T cells (e.g., ⁇ 1, 62, 63, 54, or 68 ⁇ T cells, or a combination thereof).
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises about 80%, 70%, 60%, 50%, 40%, 30%, or 20% T lymphocytes and from about 10%) to about 30%) ⁇ T cells (e.g. , ⁇ 1, 52, ⁇ 3, 54, or 58 ⁇ T cells, or a combination thereof).
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises about 80%, 70%, 60%, 50%, 40%, 30%, or 20% T lymphocytes and about or less than about 1.5% ⁇ T cells, preferably less than about 1.2% ⁇ T cells, more preferably less than about 1%> ⁇ T cells, yet more preferably less than about 0.5% ⁇ T cells, e.g., from about 0.1% to about 0.4% ⁇ T cells.
  • the isolated mixed cell population is selected from a peripheral blood sample (e.g., whole blood, PBMCs, or PBLs), a leukapheresis sample, a cord blood sample, a tumor sample, or a tissue sample (e.g., an epithelial sample).
  • a peripheral blood sample e.g., whole blood, PBMCs, or PBLs
  • a leukapheresis sample e.g., a cord blood sample, a tumor sample, or a tissue sample (e.g., an epithelial sample).
  • the isolated mixed cell population is derived from a single donor.
  • the isolated mixed cell population is derived from more than one or multiple donors.
  • the methods of the invention provide enriched ⁇ T-cell population(s) comprising polyclonal ⁇ TCR diversity.
  • the agent which selectively expands ⁇ 2 T -cells is selected from an agent which binds to the same epitope as an antibody selected from B6 and 15D. In yet other embodiments, the agent which selectively expands ⁇ 2 T -cells is selected from an agent which binds to a different epitope than an antibody selected from B6 and 15D. In still other embodiments, the agent which selectively expands ⁇ 2 T -cells is selected from an agent which binds to an epitope that does not overlap with an epitope bound by, or compete with, a B6 or 15D antibody.
  • the agent which selectively expands ⁇ 2 T -cells is selected from an agent which specifically binds to an epitope comprising a ⁇ 2 variable region.
  • the agent has reduced binding to a mutant ⁇ 2 TCR polypeptide comprising a mutation at G35 of the 52 variable region.
  • the agent that selectively expands ⁇ 2 T -cells is an agent that comprises the complementarity determining regions (CDRs) of an antibody selected from the group consisting of 62-14, 62-17, 62-22, 62-30, 62-31, 62-32, 62-33, 62-35, 62-36, and ⁇ 2-37 (or 62-14, 62-17, 62-30, 62-31, 62-32, 62-33, 62-35, 62-36, and ⁇ 2-37).
  • CDRs complementarity determining regions
  • the agent that selectively expands ⁇ 2 T -cells is an agent that comprises the variable regions of an antibody selected from the group consisting of 62-14, 62-17, 62-22, 62-30, 62-31, 62-32, 62-33, 62-35, 62-36, and ⁇ 2- 37 (or 62-14, 62-17, 62-30, 62-31, 62-32, 62-33, 62-35, 62-36, and ⁇ 2-37).
  • the agent that selectively expands ⁇ 2 T -cells is an agent that binds the same, or essentially the same, epitope as, or competes with, an antibody selected from the group consisting of 62-14, 62-17, 62-22, 62-30, 62-31, 62-32, 62-33, 62-35, 62-36, and ⁇ 2-37 (or 62-14, 62-17, 62-30, 62-31, 62-32, 62-33, 62-35, 62-36, and ⁇ 2-37).
  • the agent that selectively expands ⁇ 2 T -cells is an antibody selected from the group consisting of 62-14, 62-17, 62- 22, 62-30, 62-31, 62-32, 62-33, 62-35, 62-36, and ⁇ 2-37 (or 62-14, 62-17, 62-30, 62-31, 62-32, 62- 33, 62-35, 62-36, and ⁇ 2-37).
  • the agent that selectively expands ⁇ 2 T -cells is an antibody that binds a Bin 1 52 epitope, a Bin 2 52 epitope, a Bin 3 52 epitope, or a Bin 4 52 epitope.
  • the methods of the invention provide enriched ⁇ T-cell population(s) comprising greater than 60%, 70%, 80% or 90% 52 cells from an isolated mixed cell population comprising T lymphocytes. In some embodiments, the methods of the invention provide enriched ⁇ T-cell population(s) comprising greater than 60%, 70%, 80% or 90% 52 cells from an isolated, e.g., mixed, cell population comprising T lymphocytes, before a step of purifying an expanded ⁇ T-cell population, e.g., by positive selection of ⁇ T-cells (e.g., positive selection of ⁇ 2 T cells) from the enriched ⁇ T-cell population(s), or by depletion of non- ⁇ T-cells (e.g., depletion of non- ⁇ 2 T cells or depletion of ⁇ T cells) from the enriched ⁇ T-cell population(s).
  • positive selection of ⁇ T-cells e.g., positive selection of ⁇ 2 T cells
  • non- ⁇ T-cells e.g.
  • the methods of the present invention provide a ⁇ T-cell population comprising 62 ⁇ T cells and ⁇ 1 ⁇ T cells, wherein the population is greater than 60%, 70%, 80% or 90% ⁇ 2 ⁇ T cells.
  • the methods of the present invention provide a composition comprising a population of 52 ⁇ T cells that is free of, or contains less than about 2%, 1%, 0.5%, 0.4%, 0.1%, 0.05%, or 0.01%, ⁇ T cells.
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises about 80%, 70%, 60%, 50%, 40%, 30%, or 20% T lymphocytes and less than about 60%, 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4% 0.3%, 0.2%, 0.1%, 0.05%, or 0.02% 62 cells.
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein is selected from a peripheral blood sample (e.g., PBMC or PBL), a leukapheresis sample, a cord blood sample, a tumor, or a tissue.
  • a peripheral blood sample e.g., PBMC or PBL
  • a leukapheresis sample e.g., a cord blood sample, a tumor, or a tissue.
  • the methods of the invention provide an enriched ⁇ T-cell population(s) comprising polyclonal TCR diversity.
  • the enriched ⁇ T-cell population is not expanded by, or not expanded in the presence of, an antigen presenting cell (APC), an artificial antigen presenting cell (aAPC), an irradiated population of antigen presenting cells (e.g., irradiated PBMCs, an irradiated immortalized cell line, or irradiated aAPCs), an aminophosphonate, an aminophosphate, a
  • the enriched ⁇ T-cell bisphosphonate, or a combination thereof.
  • the enriched ⁇ T-cell bisphosphonate, or a combination thereof.
  • the enriched ⁇ T-cell population is not expanded by, or not expanded in the presence of, irradiated PBMCs.
  • the enriched ⁇ T-cell population is not expanded by, or not expanded in the presence of, irradiated aAPCs (e.g., engineered K562, RPMI8226, T2, or JVM-3).
  • the enriched ⁇ T-cell population is not expanded by, or not expanded in the presence of, an irradiated population of cells of an immortalized cell line.
  • said one or more agents which selectively expand ⁇ 1 T-cells, ⁇ 2 T-cells, ⁇ 1 T-cells and ⁇ 4 T-cells, or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T cells are antibodies.
  • said one or more agents which selectively expand ⁇ 1 T-cells, ⁇ 2 T- cells, ⁇ 1 T-cells and ⁇ 4 T-cells, or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T cells are immobilized on a surface.
  • said one or more agents which selectively expand ⁇ 1 T-cells, ⁇ 2 T-cells, ⁇ 1 T-cells and ⁇ 4 T-cells, or ⁇ 1, ⁇ 3, 54, and ⁇ 5 T cells are immobilized on a surface of an antigen presenting cell (e.g., an aAPC) in a first and/or second or subsequent expansion.
  • an antigen presenting cell e.g., an aAPC
  • the agents immobilized on the surface of an antigen presenting cell can, e.g., be bound to an Fc receptor expressed on the surface of the APC or expressed on the surface of the APC.
  • the methods of the present invention are performed using a culture medium supplemented with IL-2, IL-4, IL-7, IL-9, IL-12, IL-15, IL-18, IL-19, IL-21, IL-23, IL-33, , IFNy, granulocyte-macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), a lectin (e.g., PHA-E, PHA-L, or ConA), or a combination of two or more, or all thereof.
  • the methods of the present invention are performed using a culture medium that is not supplemented with IL-21.
  • the methods of the present invention are performed with a first ⁇ T-cell expansion using a culture medium supplemented with IL-2, IL-4, IL-7, IL-9, IL-12, IL-15, IL-18, IL-19, IL-21, IL-23, IL-33, IFN ⁇ , granulocyte- macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), a lectin (e.g., PHA-E, PHA-L, or ConA), or a combination of two or more, or all thereof.
  • the methods of the present invention are performed with a first ⁇ T-cell expansion using a culture medium that is not supplemented with IL-21.
  • the methods of the present invention are performed with a second ⁇ T-cell expansion using a culture medium supplemented with IL-2, IL-4, IL-7, IL-9, IL-12, IL-15, IL-18, IL-19, IL-21, IL-23, IL-33, IFN ⁇ , granulocyte-macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), a lectin (e.g., PHA-E, PHA-L, or ConA), or a combination of two or more, or all thereof.
  • the methods of the present invention are performed with a second ⁇ T-cell expansion using a culture medium that is not supplemented with IL-21.
  • the methods of the present invention are performed with a first ⁇ T- cell expansion comprising any of the ⁇ T-cell expansion methods or compositions described herein, and then a second ⁇ T-cell expansion using a culture medium that is free of the one or more agents which selectively expand ⁇ 1 T-cells; ⁇ 2 T -cells; ⁇ 1 T-cells and ⁇ 3 T-cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T cells (e.g., ⁇ T cells of the indicated ⁇ -subtype(s)).
  • the methods of the present invention are performed with a first ⁇ T-cell expansion comprising any of the ⁇ T-cell expansion methods or compositions (e.g., activation agents) described herein, which method includes contacting an engineered or non-engineered ⁇ T-cell, a population of engineered or non-engineered ⁇ T-cells, and/or an isolated mixed population of cells with an immobilized agent that selectively expands ⁇ 1 T-cells; ⁇ 2 T-cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T cells (e.g., ⁇ T cells of the indicated ⁇ -subtype(s)), and then a second ⁇ T-cell expansion using a culture medium that: i) is free of the one or more agents which selectively expand ⁇ 1 T-cells; ⁇ 2 T- cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and
  • the agent that expands T cells is an agent that binds CD3, such as an anti-CD3 antibody (e.g., OKT3).
  • the agent that selectively expands ⁇ T cells is an agent that binds a ⁇ -chain constant region or a ⁇ -chain constant region, or an agent that binds ⁇ TCR, such as an antibody that binds ⁇ TCR (e.g., IMMU ⁇ 10).
  • the ⁇ T-cell population is enriched by positive selection between the first cell expansion and the second cell expansion, and/or after the second cell expansion.
  • the ⁇ T-cell population is enriched by depletion of ⁇ T cells between the first cell expansion and the second cell expansion, and/or after the second cell expansion.
  • an, e.g. enriched, ⁇ T-cell population is expanded in a first, second, or subsequent expansion in a culture medium containing an antigen presenting cell (APC).
  • the culture medium contains one or more agents that expand T cells, expand ⁇ T-cells, selectively expand ⁇ T-cells, or selectively expands ⁇ 1 T-cells, ⁇ 2 T-cells, ⁇ 1 T-cells and ⁇ 3 T-cells, or ⁇ 1 T-cells and ⁇ 4 T-cells (e.g., an antibody that binds a constant or variable region of a ⁇ TCR, an antibody that binds CD3, and/or an
  • the enriched ⁇ T-cell population is expanded in a culture medium containing irradiated PBMCs. In certain embodiments, the enriched ⁇ T-cell population is expanded in a culture medium containing irradiated artificial APCs (aAPCs). In certain embodiments, the enriched ⁇ T-cell population is expanded in a culture medium containing irradiated population of cells of an immortalized cell line (e.g., K562 APCs). In some cases, the APCs do not express, or exhibit reduced expression of, HLA class I, HLA class II, HLA class II invariant chain, and/or HLA-DM.
  • aAPCs irradiated artificial APCs
  • the enriched ⁇ T-cell population is expanded in a culture medium containing irradiated population of cells of an immortalized cell line (e.g., K562 APCs). In some cases, the APCs do not express, or exhibit reduced expression of, HLA class I, HLA class II, HLA
  • the APCs express adhesion or co-stimulatory molecules such as intercellular adhesion molecule-1, CDl la, CD18, CD54, CD80, CD86, 4-1BBL, OX-40L, CD70, or one or more ⁇ T cell activating agents anchored in the membrane, and/or leukocyte function-associated antigen-3.
  • the APCs express an Fc receptor, such as an Fc receptor that is specific for an isotype of an activation agent used in a ⁇ T-cell expansion method described herein.
  • the APCs express one or more Fc receptors selected from the group consisting of CD64, CD32A, CD32B, CD32C, CD 16 A, CD16B, FcRn, TREVI21, or CD307, or an engineered variant thereof having a higher affinity or altered specificity.
  • the culture medium containing an antigen presenting cell (APC), an artificial antigen presenting cell (aAPC), or an irradiated population of antigen presenting cells further contains one or more agents that selectively expand ⁇ 1 T-cells; ⁇ 2 T-cells; ⁇ 1 T-cells and ⁇ 3 T-cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and 65 T cells.
  • the, e.g., irradiated, PBMCs, APCs, aAPCs, or population of cells of an immortalized cell line express on their cell surface the one or more agents that selectively expand ⁇ 1 T-cells; ⁇ 2 T-cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T cells.
  • said one or more agents which selectively expand ⁇ 1 T-cells; ⁇ 2 T-cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T cells are antibodies.
  • said one or more agents that selectively expand ⁇ 1 T-cells; ⁇ -2ce Tlls; ⁇ 1 T-cells and ⁇ 4; or ⁇ 1, ⁇ 3, ⁇ 4, and 65 T-cells are antibodies expressed on the surface of the APC or bound to an Fc-receptor (e.g., Fey receptor) expressed on the surface of the APC.
  • Fc-receptor e.g., Fey receptor
  • the invention provides ex vivo methods for producing an enriched ⁇
  • T-cell population from an isolated, e.g., mixed, cell population, comprising (i) directly contacting the, e.g., mixed, cell population with one or more agents which (a) expand ⁇ T-cells (e.g., by binding to a ⁇ TCR), or (b) selectively expand:
  • ⁇ T-cell expansion by binding to an activating epitope specific of a ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 TCR in a first ⁇ T-cell expansion, thereby producing a first enriched ⁇ T-cell population, and then (ii) directly contacting at least a portion of the first enriched ⁇ T-cell population with antigen presenting cells (APCs), optionally in the presence of one or more soluble or immobilized agents that (a) expand T cells, (b) expand ⁇ T-cells (e.g., by binding to a ⁇ TCR), or (c) selectively expands:
  • APCs antigen presenting cells
  • the second enriched ⁇ T-cell population comprises a clinically relevant number (e.g., > 10 ) of ⁇ 1 T-cells; ⁇ 2 T-cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T cells.
  • the clinically relevant number (e.g., > 10 8 ) of the ⁇ T-cells is obtained from a single donor, e.g., from a single sample or 2 or more samples from the donor. In some cases, the clinically relevant number (e.g., > 10 8 ) of the ⁇ T-cells is obtained from a single donor, e.g., from a single sample or 2 or more samples from the donor, within less than 30 days of expansion, preferably less than 21 days of expansion, more preferably within 19 days of expansion.
  • the ⁇ T-cell population is enriched by positive selection between (i) and (ii), or after (ii). In some cases, the ⁇ T-cell population is enriched by depletion of ⁇ T cells between (i) and (ii), or after (ii).
  • the agent that expands T cells is an agent that binds CD3, such as an anti-CD3 antibody.
  • the agent that selectively expands ⁇ T cells is an agent that binds a ⁇ -chain constant region or a ⁇ -chain constant region, or an agent that binds ⁇ TCR, such as an antibody that binds ⁇ TCR (e.g., EVEVIU ⁇ 10).
  • an enriched ⁇ T-cell population is produced by (i) contacting an isolated, e.g., mixed, cell population with one or more first agents which (a) expand ⁇ T-cells (e.g., by binding to a ⁇ TCR) or (b) selectively expands:
  • the one or more second agents are structurally different from the one or more first agents, thereby providing a second enriched ⁇ T cell population.
  • the one or more second agents bind a different ⁇ TCR epitope as compared to the one or more first agents.
  • the ⁇ T-cell population is enriched by positive selection between (i) and (ii), or after (ii). In some cases, the ⁇ T-cell population is enriched by depletion of ⁇ T cells between (i) and (ii), or after (ii).
  • the agent that expands T cells is an agent that binds CD3, such as an anti-CD3 antibody.
  • the agent that selectively expands ⁇ T cells is an agent that binds a ⁇ -chain constant region or a ⁇ -chain constant region, or an agent that binds ⁇ TCR, such as an antibody that binds ⁇ TCR (e.g. , EVEVIU ⁇ 10).
  • the first ⁇ T-cell expansion is performed in a culture medium that contains an antigen presenting cell (APC).
  • the second ⁇ T-cell expansion is performed in a culture medium that contains an antigen presenting cell (APC).
  • the first ⁇ T-cell expansion is performed in a culture medium that does not contain an antigen presenting cell (APC).
  • the first ⁇ T-cell expansion is performed in a culture medium that does not contain an antigen presenting cell (APC)
  • the second ⁇ T-cell expansion is performed in a culture medium that does contain an antigen presenting cell (APC).
  • the first and second ⁇ T-cell expansion is performed in a culture medium that does contain an antigen presenting cell (APC).
  • the first and second ⁇ T-cell expansion is performed in a culture medium that does contain an aminophosphate, an aminophosphonate, a bisphosphonate, or a combination thereof.
  • the enriched ⁇ T-cell population(s) of the invention may be further formulated for administration to a subject.
  • the enriched ⁇ T-cell population(s) of the invention includes a therapeutically effective amount of ⁇ T-cells.
  • the ⁇ T-cell population(s) are engineered to stably express one or more structurally distinct tumor recognition moieties.
  • the engineered ⁇ T-cell(s) are expanded and/or further expanded as described herein.
  • the one or more agents stimulates an expansion of the ⁇ T-cell at a mean rate of 1 cell division in less than 30 hours, e.g., from greater than about 17 to less than about 30 hours.
  • said mean rate of division is for 0-4, 0-5, 0-7 contiguous days of ⁇ T-cell expansion, 0-13 contiguous days of ⁇ T- cell expansion, 0-19 contiguous days of ⁇ T-cell expansion, 0-21 contiguous days of ⁇ T-cell expansion, or for at least 3, 4, 5, 6, 7, 10, 13, 19, or 21 contiguous days of ⁇ T-cell expansion.
  • the one or more agents stimulates an expansion of the ⁇ -cell at a mean rate of 1 cell division in less than 24 hours, e.g., from greater than about 17 to less than about 24 hours. In other embodiments, the one or more agents stimulates an expansion of the ⁇ -cell at a mean rate of 1 cell division in less than 18 hours or about 18 hours.
  • ⁇ T-cell expansion e.g., selective ⁇ T-cell expansion
  • a substantially homogenous population of cells such as after establishing a ⁇ T-cell engineered clone or cell line, population containing one or more (e.g., structurally different) engineered ⁇ T-cells, or after one or more steps of negative or positive selection of a population of cells containing ⁇ T-cells.
  • one or more of the foregoing methods, or a combination thereof can be used to expand engineered ⁇ T-cells by contacting an engineered ⁇ T-cell or population thereof with any one or more of the activation agents described herein, including one or more of the antibodies described herein in soluble or immobilized form (e.g., immobilized on the surface of an APC).
  • the isolated mixed cell population is substituted in a method or composition provided herein, with a ⁇ T-cell engineered clone or cell line, or a population containing one or more (e.g., structurally different) engineered ⁇ T-cells.
  • the invention provides selectively expanded ⁇ T-cell population(s), wherein greater than 60%, 70%, 80%, or 90% of the expanded ⁇ T-cells are ⁇ 1 T-cells; ⁇ 1 T-cells and ⁇ 4 T- cells; or ⁇ 1 T-cells, ⁇ 3 T-cells, ⁇ 4 T-cells, and ⁇ 5 T-cells.
  • the selectively expanded ⁇ T-cell population(s) comprise ⁇ 1 T-cells and ⁇ 2 T-cells, wherein greater than 60%, 70%, 80%), or 90% of the expanded ⁇ T-cells are 51 T-cells ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1 T-cells, ⁇ 3 T- cells, ⁇ 4 T-cells, and ⁇ 5 T-cells.
  • the selectively expanded ⁇ T-cell population(s) have not been purified by positive selection of ⁇ T-cells (e.g., positive selection of ⁇ 1 T cells, ⁇ 1 T-cells and ⁇ 3 T-cells, or ⁇ 1 T-cells and ⁇ 4 T-cells) from an enriched ⁇ T-cell population, or by depletion of non- ⁇ T-cells (e.g., depletion of ⁇ - ⁇ 1 T cells such as ⁇ T cells) from the enriched ⁇ T-cell population.
  • positive selection of ⁇ T-cells e.g., positive selection of ⁇ 1 T cells, ⁇ 1 T-cells and ⁇ 3 T-cells, or ⁇ 1 T-cells and ⁇ 4 T-cells
  • depletion of non- ⁇ T-cells e.g., depletion of ⁇ - ⁇ 1 T cells such as ⁇ T cells
  • the selectively expanded ⁇ T-cell population(s) are expanded directly from an isolated mixed cell population comprising T lymphocytes.
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises about 80%, 70%, 60%, 50%, 40%, 30%, 20% T lymphocytes and less than about 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1.5%, 1.2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%) 0.3%), 0.2%), or 0.1% ⁇ 1 cells.
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises less than about 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1.5%, 1.2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4% 0.3%, 0.2%), or 0.1%) ⁇ 1 cells.
  • the isolated mixed cell population is selected from a peripheral blood sample, a cord blood sample, a tumor, epithelial tissue, or a biopsy of skin, liver, or other tissue.
  • the isolated mixed cell population is derived from a single donor. In other embodiments, the isolated mixed cell population is derived from more than one or multiple donors.
  • the expanded ⁇ T-cell population(s) are derived from tumor
  • infiltrating lymphocytes which may be isolated, for example, from cancers of colon adenocarcinoma metastasis, liver, ovary, head and neck, or kidney.
  • the selectively expanded ⁇ T-cell population(s) of the invention comprise greater than 60% or 70% the ⁇ 1 T-cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1 T-cells, ⁇ 3 T-cells, ⁇ 4 T-cells, and ⁇ 5 T-cells which express the naive or T central memory (TCM) phenotype
  • the expanded ⁇ T-cell population comprises polyclonal ⁇ TCR diversity.
  • the invention provides selectively expanded ⁇ T-cell population(s), wherein greater than 80% or 90% of the expanded ⁇ T-cells are ⁇ 2 T-cells.
  • the selectively expanded ⁇ T-cell population(s) have not been purified by positive selection of ⁇ T- cells (e.g., positive selection of ⁇ 2 T cells) from an enriched ⁇ T-cell population, or by depletion of non- ⁇ T-cells (e.g., depletion of ⁇ - ⁇ 2 T cells such as depletion of ⁇ T cells) from the enriched ⁇ T-cell population.
  • the selectively expanded ⁇ T-cell population(s) are expanded directly from an isolated mixed cell population comprising T lymphocytes.
  • the isolated mixed cell population from which the ⁇ T-cell population(s) are expanded comprises about 80%, 70%, 60%, 50%, 40%, 30%, or 20% T lymphocytes and less than about 60%, 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1.5%, 1.2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4% 0.3%, 0.2%, or 0.1% 52 cells.
  • the isolated mixed cell population from which the ⁇ T-cells are expanded in a method described herein comprises less than about 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1.5%, 1.2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%), 0.4% 0.3%), 0.2%), or 0.1% 52 cells.
  • the isolated mixed cell population is selected from a peripheral blood sample, a cord blood sample or a tumor.
  • the expanded ⁇ T-cell population(s) are derived from tumor infiltrating lymphocytes, which may be isolated, for example, from cancers of colon adenocarcinoma metastasis, liver, ovary, head and neck, or kidney.
  • the invention provides selectively expanded ⁇ T-cell population(s), wherein 10-90%) of the expanded ⁇ T-cells are 51 T-cells and 90-10% of the expanded ⁇ T-cells are ⁇ 2 T- cells.
  • said populations are expanded together, e.g., by contacting a mixed cell population with an agent which selectively expands ⁇ 1 cells; ⁇ 1 T-cells and ⁇ 3 T-cells; ⁇ 1 T- cells and ⁇ 4 T-cells; or ⁇ 1 T-cells, ⁇ 3 T-cells, ⁇ 4 T-cells, and ⁇ 5 T-cells, and with an agent that selectively expands ⁇ 2 cells, either simultaneously or in separate contacting steps.
  • the populations are admixtures of ⁇ 1 and ⁇ 2 T-cell populations which have been separately and selectively expanded from an isolated mixed cell population.
  • the expanded ⁇ T-cell population(s) or admixtures thereof of the invention may further be formulated for administration to a subject.
  • a ⁇ T-cell or ⁇ T-cell population(s) of the invention are engineered to stably express one or more structurally distinct tumor recognition moieties encoded by expression cassettes.
  • the ⁇ T-cell is engineered to stably express two or more structurally distinct tumor recognition moieties encoded by expression cassettes.
  • the two or more structurally distinct tumor recognition moieties recognize different epitopes of the same antigen or different epitopes of different antigens.
  • the tumor recognition moiety may be selected from the group consisting of ⁇ TCR, ⁇ TCR, a fragment of an ⁇ TCR or ⁇ TCR, a chimeric antigen receptor (CAR), whole antibody or their antigen-binding fragment, single-chain variable fragment (scFv), a heavy chain or a light chain single domain antibody (sdAb), a Fab, a F(ab) 2 , or any combination thereof that binds to: (i) a cell surface tumor antigen or (ii) a peptide derived from a tumor antigen expressed on the cell surface as a complex with MHC (peptide-MHC complex).
  • the tumor recognition moiety is a ⁇ TCR of a tumor infiltrating lymphocyte that recognizes a tumor-specific antigen in a non-MHC restricted manner.
  • the invention provides expanded ⁇ T-cell population(s) obtained according to the methods of the invention.
  • the ⁇ T-cell population is expanded ex vivo without antigen stimulation by an antigen presenting cell or an aminophosphonate.
  • ⁇ T-cell population is activated ex vivo with a monoclonal antibody, antibody fragment, or a fusion protein.
  • the ⁇ T-cell population(s) of the invention may also be formulated for administration to a subject without co-administration with IL-2.
  • the ⁇ T-cell population(s) of the invention may also be formulated for administration to a subject with coadministration with IL-2.
  • the invention provides methods for treating a cancer in a subject in need thereof, comprising administering a therapeutically effective amount of an expanded ⁇ T-cell population according to the invention.
  • the expanded ⁇ T-cell population is allogeneic with respect to the MHC loci of the subject.
  • the expanded ⁇ T- cell population is engineered to stably express one or more, or two or more, tumor recognition moieties encoded by one or more expression cassettes.
  • the expanded ⁇ T- cell population stably expresses at least two structurally different recognition moieties and each structurally different recognition moiety recognizes (i) different epitopes of the same antigen, or (ii) different epitopes of different antigens.
  • the tumor recognition moiety may be selected from the group consisting of ⁇ TCR, ⁇ TCR, a chimeric antigen receptor (CAR), including whole antibody or their antigen-binding fragment, single-chain variable fragment (scFv), a heavy chain or a light chain single domain antibody (sdAb), a Fab, a F(ab) 2 , or any combination thereof that binds to : (i) a cell surface tumor antigen or (ii) a peptide derived from a tumor antigen expressed on the cell surface as a complex with MHC (peptide-MHC complex).
  • CAR chimeric antigen receptor
  • the invention provides engineered ⁇ T-cells, wherein the engineered ⁇ T- cell is engineered to express a tumor recognition moiety, wherein the tumor recognition moiety recognizes a tumor antigen, and/or wherein the engineered ⁇ T-cell expands in vitro in the presence of ⁇ e.g., is in contact with in vitro) one or more agents which bind the same epitope as TS-1, TS8.2, B6, or 15D antibodies.
  • the invention provides engineered ⁇ T-cells, wherein the engineered ⁇ T-cell is engineered to express a tumor recognition moiety, wherein the tumor recognition moiety recognizes a tumor antigen, and/or wherein the engineered ⁇ T-cell expands in vitro in the presence of ⁇ e.g., is in contact with in vitro) one or more agents which bind a different epitope than, or an epitope that does not overlap with, the epitope bound by TS-1, TS8.2, B6, or 15D antibodies.
  • the engineered ⁇ T-cell expands in vitro in the presence of ⁇ e.g., is in contact with in vitro) one or more agents that do not compete with binding of TS-1, TS8.2, B6, or 15D to a ⁇ T-cell.
  • the agent is any one or more of the soluble or immobilized activation agents described herein.
  • the engineered ⁇ T-cell is a ⁇ 1, 52, ⁇ 3, or 54 engineered T-cell.
  • the engineered ⁇ T-cell is further engineered to lack gene expression from at least one HLA loci.
  • the one or more agents stimulates an expansion of the engineered ⁇ T-cell at a mean rate of 1 cell division in less than 30 hours, e.g., from greater than about 17 to less than about 30 hours.
  • said mean rate of division is for 0-4, 0-5, 0-7 contiguous days of ⁇ T-cell expansion, 0-13 contiguous days of ⁇ T- cell expansion, 0-19 contiguous days of ⁇ T-cell expansion, 0-21 contiguous days of ⁇ T-cell expansion, or for at least 3, 4, 5, 6, 7, 10, 13, 19, or 21 contiguous days of ⁇ T-cell expansion.
  • the one or more agents stimulates an expansion of the engineered ⁇ -cell at a mean rate of 1 cell division in less than 24 hours, e.g., from greater than about 17 to less than about 24 hours. In other embodiments, the one or more agents stimulates an expansion of the engineered ⁇ -cell at a mean rate of 1 cell division in less than 18 hours or about 18 hours.
  • the tumor recognition moiety is derived from a tumor infiltrating lymphocyte.
  • the present invention provides an expanded population of ⁇ T-cells, wherein the ⁇ T-cell population comprises anti-tumor cytotoxicity.
  • the ⁇ T-cell population comprises anti-tumor cytotoxicity that is independent of Kp30 activity, Kp44 activity, and/or Kp46 activity.
  • the ⁇ T-cell population comprises anti-tumor cytotoxicity, wherein the anti-tumor cytotoxicity consists of, or consists essentially of, anti-tumor activity that is independent of Kp30 activity, Kp44 activity, and/or Kp46 activity.
  • the ⁇ T-cell population comprises anti-tumor cytotoxicity, wherein at least 50%, 60%>, 75%, 80%>, 90%, or 99% of the anti-tumor cytotoxicity is independent of Kp30 activity, Kp44 activity, and/or Kp46 activity.
  • the ⁇ T-cell population is a population of engineered ⁇ T-cells. In some cases, the ⁇ T-cell population is a population of non-engineered ⁇ T-cells. In some cases, the ⁇ T- cell population does not comprise Kp30 activity-dependent anti-tumor cytotoxicity, Kp44 activity-dependent anti-tumor cytotoxicity, and/or Kp46 activity-dependent anti-tumor cytotoxicity. In some cases, the ⁇ T-cell population does not comprise Kp30 activity-dependent anti-tumor cytotoxicity. In some cases, the ⁇ T-cell population does not comprise Kp44 activity-dependent anti-tumor cytotoxicity.
  • the ⁇ T-cell population is an engineered population of ⁇ T- cells that comprise an anti-CD20 chimeric antigen receptor (CAR).
  • CAR chimeric antigen receptor
  • less than 90%, 80%, 75%, 70%, 60%, 50%, 40%, 30%, 20%, or 10% of the ⁇ T-cell cells in the population express a detectable level of Kp30, Kp44, and/or Kp46.
  • FIG. 1 schematically illustrates engineered ⁇ T-cells.
  • Panel A illustrates an engineered ⁇
  • Panel B illustrates an engineered ⁇ T-cell expressing two structurally distinct tumor recognition moieties.
  • FIG. 2 schematically illustrates a method for treating a subject.
  • FIG. 3 schematically illustrates a method for administrating a population of engineered ⁇ T- cells to a subject.
  • FIG. 4 depicts a graph illustrating growth of ⁇ 1 and ⁇ 2 lymphocytes isolated from colon adenocarcinoma metastasis to liver (TIL 1) and renal tumors (TIL 2) and have been shown to express CCR4 and CCR7.
  • FIG. 5 depicts a graph illustrating ⁇ T-cells growth in serum-containing and serum-free media.
  • FIG. 6 depicts a graph illustrating anti- ⁇ TCR antibody blocking experiments with 5A6.E9, Bl, TS8.2, 15D, B3, B6, TS-1, ⁇ 3.20, IMMU510, or 11F2.
  • FIG. 7 depicts a graph illustrating anti- ⁇ TCR antibody blocking experiments with 5A6.E9, Bl, TS8.2, 15D, B3, B6, TS-1, ⁇ 3.20, IMMU510, or 11F2.
  • FIG. 8 depicts a competition experiment with anti-TCR V ⁇ 1 TS-1 antibody.
  • FIG. 9 depicts a competition experiment with anti-TCR V ⁇ 1 TS8.2 antibody.
  • FIG. 10 depicts a graph illustrating activation and expansion of ⁇ 1 T-cells from PBMC.
  • FIG. 11 depicts a graph illustrating activation and expansion of ⁇ 2 T-cells from PBMC.
  • FIG. 12 depicts a graph illustrating fold expansion of ⁇ 1 T-cells from PBMC.
  • FIG. 13 depicts a graph illustrating fold expansion of ⁇ 2 T-cells from PBMC.
  • FIG. 14 depicts the human V ⁇ 1 amino acid sequence. CDR1, CDR3, and CDR3 regions are underlined.
  • FIG. 15 depicts the human V ⁇ 2 amino acid sequence. CDR1, CDR3, and CDR3 regions are underlined.
  • FIG. 16 depicts activation of PBMCs with TS-1 or TS8.2 antibodies resulting in significant and specific expansion of V ⁇ 1 + T cells.
  • MAbs were directly coated (1 ⁇ g/mL) (TSl, TS8.2, B6, and 15D) or captured (O. ⁇ g/mL) with goat-anti-mouse Fc (5 ⁇ g/mL) (TSlFc, TS8.2Fc, B6Fc and 15DFc) in 24-well plates.
  • PBMCs were plated at 10 6 cells/mL in RPMI with 10% FBS and 100 R7/mL IL-2. On day 7, cells were transferred to new plates without antibodies and further expanded until day 14. Culture media was replenished every 2-3 days.
  • V ⁇ 1 + cells were expanded from isolated PBMCs from a different donor as follows.
  • MAbs were directly coated (1 ⁇ g/mL) (TSl, TS8.2, B6 and 15D) or captured (0.1 ⁇ g/mL) with goat-anti-mouse Fc (5 ⁇ g/mL) (TSlFc, TS8.2Fc, B6Fc and 15DFc) in 24-well plates.
  • PBMCs f were plated at 10 6 cells/mL in RPMI with 10% FBS and 100 IU/mL IL-2.
  • PBMCs were plated at 10 6 cells/mL in RPMI with 10% FBS and 100 IU/mL IL-2. On day 7, cells were transferred to a new plate without antibodies, adjusted to 10 6 cells/mL and further expanded until day 23. Culture media was replenished every 2-3 days.
  • FIG. 17 depicts activation of PBMCs with B6 and 15D antibodies result in significant specific activation and expansion of V ⁇ 2+ T cells.
  • MAbs were directly coated (1 ⁇ g/mL) (TS1, TS8.2, B6, and 15D) or captured (0.1 ⁇ g/mL) with goat-anti-mouse Fc (5 ⁇ g/mL) (TSlFc, TS8.2Fc, B6Fc and 15DFc) in 24-well plates.
  • PBMCs were plated at 10 6 cells/mL in RPMI with 10% FBS and 100 RJ/mL IL-2. On day 7, cells were transferred to new plates without antibodies and further expanded until day 14. Culture media was replenished every 2-3 days.
  • FIG. 18 depicts significant reduction in percentage of ⁇ T cells in PBMC cultured with ⁇ - specific antibodies TS1, TS8.2, B6, and 15D.
  • MAbs were directly coated (1 ⁇ g/mL) (TS1,
  • TS8.2 B6 and 15D or captured (0. ⁇ g/mL) with goat-anti-mouse Fc (5 ⁇ g/mL) (TSlFc, TS8.2Fc, B6Fc and 15DFc) in 24-well plates.
  • PBMCs were plated at 10 6 cells/mL in RPMI with 10% FBS and 100 RJ/mL IL-2. On day 7, cells were transferred to new plates without antibodies and further expanded until day 14. Culture media was replenished every 2-3 days. Data depicts ⁇ T-cells expansion over 14 days; (B) Same culture as A, showing percentage of ⁇ T-cells on day 14 and day 0 (dO).
  • FIG. 19 depicts activation of ⁇ TCR results in reduction of ⁇ T-cell doubling time
  • MAbs were directly coated (1 ⁇ g/mL) (TS1, TS8.2, B6 and 15D) or captured (0.1 ⁇ g/mL) with goat-anti-mouse Fc (5 ⁇ g/mL) (TSlFc, TS8.2Fc, B6Fc and 15DFc) in 24-well plates.
  • PBMCs were plated at 10 6 cells/mL in RPMI with 10% FBS and 100 IU/mL IL-2. Cells were transferred to new plate without antibodies on day 7, adjusted to 10 6 cells/mL with fresh media. Culture was replenished every 2-3 days and adjusted to 10 6 cells/mL with fresh media. Doubling times for ⁇ 1, ⁇ 2 and ⁇ T-cells are shown in (A), (B) and (C), respectively.
  • FIG. 20 depicts activation of ⁇ 1 by antibodies TS8.2 and TS1 results in predominantly naive and central memory phenotypes.
  • Antibodies were directly coated at 1 ⁇ g/mL in 24 well plates (TS8.2, R9.12 and pan- ⁇ Immu510).
  • PBMCs were plated at 10 6 /mL in RPMI with 10% FBS and 100 R7/mL IL-2. Media was replenished every 2-3 days until day 23, except on dayl5 when cultures were diluted 1 :2 in fresh media.
  • Cells phenotypes on days 14 and 23 are determined by CD45RA and CD27 expression using flow cytometry analysis.
  • FIG. 21 depicts activation of PBMC by TS8.2 and MICA results in enhanced expansion of ⁇ 1 T-cells but not ⁇ T-cells.
  • Antibody TS8.2 (1 ⁇ g/mL) or TS8.2 with MICA-Fc (1 and 5 ⁇ g/mL) were directly coated in 24 well plates.
  • PBMCs were plated at 10 6 /mL in RPMI with 10% FBS and 100 R7/mL IL-2. Media is replenished every 2-3 days.
  • A ⁇ 1 T-cells expansion
  • B ⁇ -cells expansion.
  • FIG. 22 depicts activation of umbilical cord blood mononuclear cells with ⁇ 1 and ⁇ 2 specific antibodies result in significant and specific expansion of ⁇ 1 + and ⁇ 2 + T-cells.
  • MAbs TS8.2, R9.12, B6 and 15D were directly coated at 1 ⁇ g/mL in 24 well plates.
  • Umbilical cord blood mononuclear cells were activated at 10 6 /mL in RPMI with 10% FBS and 100 IU/mL IL-2. ⁇ 1 and ⁇ 2 T-cells expansion are shown in (A) and (B), respectively.
  • FIG. 23 depicts binding to soluble TCR generated from pairing of V ⁇ 1J1, V ⁇ 1J2 and V ⁇ 1J3 chain with ⁇ 8 chain.
  • Data show that TS1 and TS8.2 recognize the soluble TCR generated from V ⁇ 1 Jl and V ⁇ 1 J2 chains but failed to bind to the V ⁇ 1 J3 chain, indicating that the Jl and J2 gene segments are critical for TS1 and TS8.2 binding.
  • R9.12 that bind to V ⁇ 1, and the pan antibody Immuno510, which binds to ⁇ constant region, are not affected by the specific J region.
  • FIG. 24 depicts sequence alignment of human V ⁇ 1J1, J2 and J3 regions and mutations made to the V ⁇ 1 Jl chain at the selected positions.
  • BE-13 refers to ⁇ 1 J region from a T cell leukemia cell line expressing ⁇ 1 ⁇ 8 TCR (DSMZ accession #ACC 396).
  • DSMZ accession #ACC 396 DSMZ accession #ACC 396.
  • Replacement of a single amino acid residue at position Lysl20 by Thr or Ala in the ⁇ 1 Jl and ⁇ 1 J2 region completely abolished binding of TS-1 and TS8.2 MAbs indicating that this amino acid in the V ⁇ 1J1 and V ⁇ 1J2 region is contributes to the binding of TS-1 and TS8.2.
  • FIG. 25 depicts that point mutation in V ⁇ 1 Jl from Lys 120 to Thr or Ala resulted in the loss of binding by TS-1 and TS8.2 MAbs.
  • FIG. 26 depicts of human V ⁇ 1 protein sequence and the six mutated human V ⁇ 1 sequences based on the differences between human V ⁇ 1 and the bovine V ⁇ 1 amino acid sequence
  • FIG. 27 depicts loss of binding of TS-1 and TS8.2 antibodies to the human V ⁇ 1 mutated chains.
  • FIG. 28 depicts binding of the B6 MAb to different ⁇ 2/ ⁇ chain pairings ( ⁇ 3, ⁇ 8, ⁇ 9).
  • FIG. 29 depicts the protein sequence alignment of human (JJVIGT Human TRDV2) and Rhesus monkey (GenBank: AY190028.1) V ⁇ 2 variable regions and the changes made in V ⁇ 2 CDRl (G35S), CDR2 (D65G) and CDR3 (C104S).
  • FIG. 30 depicts loss of binding of 15D to V ⁇ 2 (G35S) mutated at CDRl .
  • FIG. 31 depicts characterization of highly enriched V ⁇ 1+, V ⁇ 2+ and ⁇ T cell cultures using TS8.2, B6 and IP26 antibodies for ⁇ 1, 62 and ⁇ , respectively.
  • the populations derived from PBMC were expanded with a combination of TS-1 and TS8.2 to expand ⁇ 1 cells, or 15D and B6 to expand 62 cells.
  • the expanded culture was depleted of ⁇ cells using IP26 MicroBeads. Positively selected ⁇ T cells were also collected ( ⁇ enriched).
  • FIG. 32 depicts cytotoxicity of V ⁇ 1+, V ⁇ 2+ populations toward solid tumor (BxPC3, SKMEL5) and plasmacytoma (RPMI8226) cell lines.
  • FIG. 33 depicts heavy-chain framework and complementarity determining region amino acid sequences of ⁇ 1 -specific MAbs.
  • FIG. 34 depicts light-chain framework and complementarity determining region amino acid sequences of the ⁇ 1-specific MAbs described in FIG. 33.
  • FIG. 35 depicts heavy-chain framework and complementarity determining region amino acid sequences of 52-specific MAbs.
  • FIG. 36 depicts light-chain framework and complementarity determining region amino acid sequences of 52-specific MAbs.
  • FIG. 37 depicts cross-reactivity of the indicated ⁇ 1 -specific antibodies with other ⁇ TCRs as determined by ELISA.
  • FIG. 38 depicts an alignment of V ⁇ 1 deduced amino acid sequence between human and dolphin.
  • FIG. 39 depicts the percentage of proliferating V ⁇ 1 cells (A) or V ⁇ 2 cells (B) obtained by a ⁇ T cell expansion method described herein.
  • FIG. 40 depicts the fold expansion of V ⁇ 1 cells (A) or V ⁇ 2 cells (B) from an isolated mixed cell population obtained by a ⁇ T cell expansion method described herein.
  • FIG. 41 depicts phenotype data from an isolated mixed cell population obtained by a ⁇ T cell expansion method described herein. Cell phenotypes are determined by CD45RA and CD27 expression using flow cytometry analysis.
  • FIG. 42 illustrates ⁇ 1 T cells activated and expanded according to ⁇ T cell expansion methods described herein can show robust cytotoxicity against tumor cell lines.
  • FIG. 43 illustrates ⁇ 1 fold expansion and purity on day 19 achieved by a method of the present invention.
  • FIG. 44 illustrates ⁇ 1 fold expansion and accumulative doubling time on day 19 achieved by a method of the present invention.
  • FIG. 45 illustrates ⁇ 1 fold expansion and accumulative doubling time from day 14 to day 19 achieved by a method of the present invention.
  • FIG. 46 illustrates expression of an anti-CD20 chimeric antigen receptor (CAR) on ⁇ 1 T cells. Expanded cells were stained with ⁇ 1 specific antibody (R9.12) and anti-Rituximab FITC conjugate on Day 7 post-transduction with CAR retroviral construct. Up to 35% of ⁇ 1 cells were CD20 CAR+.
  • CAR chimeric antigen receptor
  • FIG. 47A-B depicts epitope binding specificity data for ⁇ -l specific ⁇ T cell activators.
  • FIG. 48 depicts epitope binding specificity data for ⁇ -2 specific ⁇ T cell activators.
  • ⁇ T-cells gamma delta T-cells
  • TCR T-cell receptor
  • ⁇ T-cells specifically includes all subsets of ⁇ T-cells, including, without limitation, ⁇ 1 and ⁇ 2, ⁇ 3 ⁇ T cells, as well as naive, effector memory, central memory, and terminally differentiated ⁇ T-cells.
  • ⁇ T-cells includes ⁇ 4, ⁇ 5, ⁇ 7, and ⁇ 8 ⁇ ⁇ cells, as well as Vy2, Vy3, Vy5, Vy8, Vy9, Vy10, and Vy11 ⁇ T cells.
  • T lymphocyte or "T cell” refers to an immune cell expressing CD3 (CD3+) and a T Cell Receptor (TCR+). T cells play a central role in cell-mediated immunity.
  • TCR or "T cell receptor” refers to a dimeric heterologous cell surface signaling protein forming an alpha-beta or gamma-delta receptor.
  • ⁇ TCR recognize an antigen presented by an MHC molecule
  • y ⁇ TCR recognize an antigen independently of MHC presentation.
  • MHC major histocompatibility complex
  • HLA human leukocyte antigen
  • peripheral blood lymphocyte(s) or "PBL(s)” is used in the broadest sense and refers to white blood cell(s) comprising T cells and B cells of a range of differentiation and functional stages, plasma cells, monocytes, macrophages, natural killer cells, basocytes, eosinophils, etc.
  • the range of T lymphocytes in peripheral blood is about 20-80%.
  • cell population refers to a number of cells obtained by isolation directly from a suitable source, usually from a mammal. The isolated cell population may be subsequently cultured in vitro.
  • a cell population may be, for example, a mixed heterogeneous cell population derived from a peripheral blood sample, a cord blood sample, a tumor, a stem cell precursor, a tumor biopsy, a tissue, a lymph, or from epithelial sites of a subject directly contacting the external milieu, or derived from stem precursor cells.
  • the mixed cell population may be derived from in vitro cultures of mammalian cells, established from a peripheral blood sample, a cord blood sample, a tumor, a stem cell precursor, a tumor biopsy, a tissue, a lymph, or from epithelial sites of a subject directly contacting the external milieu, or derived from stem precursor cells.
  • An "enriched" cell population or preparation refers to a cell population derived from a starting mixed cell population that contains a greater percentage of a specific cell type than the percentage of that cell type in the starting population.
  • a starting mixed cell population can be enriched for a specific ⁇ T-cell population.
  • the enriched ⁇ T-cell population contains a greater percentage of ⁇ 1 cells than the percentage of that cell type in the starting population.
  • an enriched ⁇ T-cell population can contain a greater percentage of both ⁇ 1 cells and a greater percentage of ⁇ 3 cells than the percentage of that cell type in the starting population.
  • an enriched ⁇ T-cell population can contain a greater percentage of both ⁇ 1 cells and a greater percentage of ⁇ 4 cells than the percentage of that cell type in the starting population.
  • an enriched ⁇ T-cell population can contain a greater percentage of ⁇ 1 T cells, ⁇ 3 T cells, ⁇ 4 T cells, and ⁇ 5 T cells than the percentage of that cell type in the starting population.
  • the enriched ⁇ T-cell population contains a greater percentage of ⁇ 2 cells than the percentage of that cell type in the starting population.
  • the enriched ⁇ T-cell population contains a greater percentage of both ⁇ 1 cells and ⁇ 2 cells than the percentage of that cell type in the starting population.
  • the enriched ⁇ T-cell population contains a lesser percentage of ⁇ T-cell populations.
  • the desired or target cell type e.g., ⁇ 1 and/or ⁇ 2 T-cells
  • the target cell type e.g., ⁇ 1 or - ⁇ c2ell Ts
  • the activating agents of the invention selectively expand, e.g., engineered or non- engineered, ⁇ 1 T-cells without significant expansion of ⁇ -2ce Tlls.
  • the activating agents of the invention selectively expand, e.g., engineered or non-engineered, -ce ⁇ l2ls T without significant expansion of ⁇ 1 T-cells. In certain embodiments, the activating agents of the invention selectively expand, e.g., engineered or non-engineered, ⁇ 1 and ⁇ 3 T-cells without significant expansion of ⁇ 2 T-cells. In certain embodiments, the activating agents of the invention selectively expand, e.g., engineered or non-engineered, ⁇ 1 and ⁇ 4 T-cells without significant expansion of ⁇ 2 T-cells.
  • the activating agents of the invention selectively expand, e.g., engineered or non-engineered, ⁇ 1, 53, 54 and ⁇ 5 T-cells without significant expansion of ⁇ 2 T -cells.
  • the term "without significant expansion of means that the
  • preferentially expanded cell population are expanded at least 10-fold, preferably 100-fold, and more preferably 1,000-fold more than the reference cell population.
  • the term "admixture” as used herein refers to a combination of two or more isolated, enriched cell populations derived from a mixed, heterogeneous cell population.
  • the cell populations of the present invention are isolated ⁇ T cell populations.
  • isolated refers to a cell population, isolated from the human or animal body, which is substantially free of one or more cell populations that are associated with said cell population in vivo or in vitro.
  • contacting in the context of a cell population, as used here refers to incubation of an isolated cell population with a reagent, such as, for example, an antibody, cytokine, ligand, mitogen, or co-stimulatory molecule that can be linked either to beads or to cells.
  • a reagent such as, for example, an antibody, cytokine, ligand, mitogen, or co-stimulatory molecule that can be linked either to beads or to cells.
  • the antibody or cytokine can be in a soluble form, or it can be immobilized. In one embodiment, the immobilized antibody or cytokine is tightly bound or covalently linked to a bead or plate. In one embodiment, the antibody is immobilized on Fc-coated wells. In desirable embodiments, the contact occurs ex vivo (e.g., in vitro), or in vivo.
  • antibody refers to immunoglobulin molecules
  • immunoglobulin (Ig) molecules i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
  • immunoglobulin (Ig) molecules i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
  • specifically bind or “immunoreacts with” or “directed against” is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react with other polypeptides or binds at much lower affinity (K D > 10 -6 molar).
  • Antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, sdAb (heavy or light single domain antibody), single chain, F ab , F ab ' and F (ab') 2 fragments, scFvs, diabodies, minibodes, nanobodies, and F ab expression library.
  • CARs chimeric antigen receptors
  • T-bodies single-chain immunoreceptors
  • chimeric T-cell receptors or chimeric immunoreceptors, for example, and encompass engineered receptors that graft an artificial specificity onto a particular immune effector cell.
  • CARs may be employed to impart the specificity of a monoclonal antibody onto a T cell, thereby allowing a large number of specific T cells to be generated, for example, for use in adoptive cell therapy.
  • CARs direct specificity of the cell to a tumor associated antigen, for example.
  • CARs comprise an intracellular activation domain (allowing the T cell to activate upon engagement of targeting moiety with target cell, such as a target tumor cell), a transmembrane domain, and an extracellular domain that may vary in length and comprises a disease- or disorder-associated, e.g., a tumor-antigen binding region.
  • CARs comprise fusions of single-chain variable fragments (scFv) derived from monoclonal antibodies, fused to CD3-zeta a transmembrane domain and endodomain.
  • the specificity of other CAR designs may be derived from ligands of receptors (e.g., peptides) or from pattern-recognition receptors, such as Dectins.
  • the spacing of the antigen-recognition domain can be modified to reduce activation-induced cell death.
  • CARs comprise domains for additional co-stimulatory signaling, such as CD3-zeta, FcR,
  • molecules can be co-expressed with the CAR, including co-stimulatory molecules, reporter genes for imaging (e.g., for positron emission tomography), gene products that conditionally ablate the T cells upon addition of a pro-drug, homing receptors, chemokines, chemokine receptors, cytokines, and cytokine receptors.
  • the basic antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light" (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
  • the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen
  • each chain defines a constant region primarily responsible for effector function.
  • antibody molecules obtained from humans relate to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgGi, IgG 2 , and others.
  • the light chain may be a kappa chain or a lambda chain.
  • Fab refers to an antibody fragment that consists of an entire L chain (V L and C L ) along with the variable region domain of the H chain (V H ), and the first constant domain of one heavy chain (CHI).
  • Papain digestion of an intact antibody can be used to produce two Fab fragments, each of which contains a single antigen-binding site.
  • the L chain and H chain fragment of the Fab produced by papain digestion are linked by an interchain disulfide bond.
  • Fc refers to an antibody fragment that comprises the carboxy-terminal portions of both H chains (CH2 and CH3) and a portion of the hinge region held together by disulfide bonds.
  • the effector functions of antibodies are determined by sequences in the Fc region; this region is also the part recognized by Fc receptors (FcR) found on certain types of cells.
  • FcR Fc receptors
  • F(ab') 2 refers to an antibody fragment produced by pepsin digestion of an intact antibody. F(ab') 2 fragments contain two Fab fragments and a portion of the hinge region held together by disulfide bonds. F(ab') 2 fragments have divalent antigen-binding activity and are capable of cross-linking antigen.
  • Fab' refers to an antibody fragment that is the product of reduction of an F(ab') 2 fragment.
  • Fab' fragments differ from Fab fragments by having a few additional residues at the carboxy terminus of the CHI domain including one or more cysteines from the antibody hinge region.
  • Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
  • Fv refers to an antibody fragment that consists of a dimer of one heavy-chain variable region and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although often at a lower affinity than the entire binding site.
  • single-chain Fv also abbreviated as "sFv " or "scFv” refer to antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain.
  • the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the scFv to form the desired structure for antigen binding.
  • scFv see, e.g., Pluckthun, The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds.
  • linear antibody is used to refer to a polypeptide comprising a pair of tandem V H -C H 1 segments (V H -C H 1-V H -C H 1) which form a pair of antigen binding regions.
  • Linear antibodies can be bispecific or monospecific and are described, for example, by Zapata et al., Protein Eng. 8(10): 1057-1062 (1995).
  • variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called
  • variable domains both in the light chain and the heavy chain variable domains.
  • the more highly conserved portions of variable domains are called the framework regions (FRs).
  • the variable domains of native heavy and light chains each comprise four FRs, largely adopting a beta-sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
  • the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al (1991)
  • antigen binding site refers to the part of the immunoglobulin molecule that participates in antigen binding.
  • the antigen binding site is formed by amino acid residues of the N-terminal variable ("V") regions of the heavy (“H”) and light (“L”) chains. Three highly divergent stretches within the V regions of the heavy and light chains, referred to as
  • FR frame regions
  • FR refers to amino acid sequences which are naturally found between, and adjacent to, hypervariable regions in immunoglobulins.
  • the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen- binding surface.
  • the antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as "complementarity-determining regions," or "CDRs.”
  • CDRs complementarity-determining regions
  • hypervariable region refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
  • H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies.
  • H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies.
  • H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies.
  • Xu et al Immunity 13 :37-45 (2000)
  • Johnson and Wu in Methods in Molecular Biology 248: 1-25 (Lo, ed., Human Press, Totowa, N.J., 2003).
  • camelid antibodies consisting of a heavy chain only are functional and stable in the absence of light chain. See, e.g., Hamers-Casterman e
  • Framework regions are those variable domain residues other than the CDR residues. Each variable domain typically has four FRs identified as FR1, FR2, FR3, and FR4. If the CDRs are defined according to Kabat, the light chain FR residues are positioned at about residues 1-23
  • LCFR1 LCFR1
  • LCFR2 35-49
  • LCFR3 57-88
  • LCFR4 98-107
  • LCFR4 and the heavy chain FR residues are positioned about at residues 1-30 (HCFR1), 36-49 (HCFR2), 66-94 (HCFR3), and 103-113 (HCFR4) in the heavy chain residues.
  • the light chain FR residues are positioned about at residues 1-25 (LCFR1), 33-49 (LCFR2), 53-90 (LCFR3), and 97-107 (LCFR4) in the light chain and the heavy chain FR residues are positioned about at residues 1-25 (HCFRl), 33-52 (HCFR2), 56-95 (HCFR3), and 102-113 (HCFR4) in the heavy chain residues.
  • the FR residues will be adjusted accordingly.
  • CDRHl includes amino acids H26-H35
  • the heavy chain FR1 residues are at positions 1-25 and the FR2 residues are at positions 36-49.
  • a "human consensus framework" is a framework that represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
  • the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroup of sequences is a subgroup as in Kabat. In certain instances, for the VL, the subgroup is subgroup kappa I as in Kabat. In certain instances, for the VH, the subgroup is subgroup III as in Kabat.
  • the "Kd” or "Kd value” refers to a dissociation constant measured by using surface plasmon resonance assays, for example, using a BIAcore. TM. -2000 or a BIAcore. TM.-3000 (BIAcore, Inc., Piscataway, N.J.) at 25 °C. with CM5 chips immobilized with antigen or antibody at about 10 response units (RU).
  • a BIAcore. TM. -2000 or a BIAcore. TM.-3000 BIAcore, Inc., Piscataway, N.J.
  • CM5 chips immobilized with antigen or antibody at about 10 response units (RU).
  • RU response units
  • the antibody is immobilized to avoid avidity-induced interference with measurement of the dissociation constant.
  • epitope includes any protein determinant, lipid or carbohydrate determinant capable of specific binding to an immunoglobulin or T-cell receptor.
  • Epitopic determinants usually consist of active surface groupings of molecules such as amino acids, lipids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
  • An antibody is said to specifically bind an antigen when the equilibrium dissociation constant (K D ) is range 10 "6 - 10 "12 M.
  • K D equilibrium dissociation constant
  • An “activating epitope” is capable of activation of the specific ⁇ T-cell population upon binding.
  • an antibody binds "essentially the same epitope " as a reference antibody, when the two antibodies recognize identical or sterically overlapping epitopes.
  • the most widely used and rapid methods for determining whether two epitopes bind to identical or sterically overlapping epitopes are competition assays, which can be configured in a number of different formats, using either labeled antigen or labeled antibody.
  • the antigen is immobilized on a 96-well plate, and the ability of unlabeled antibodies to block the binding of labeled antibodies is measured using radioactive or enzyme labels.
  • the competition studies, using labelled and unlabeled antibodies are performed using flow cytometry on antigen-expressing cells.
  • Epitope mapping is the process of identifying the binding sites, or epitopes, of antibodies on their target antigens.
  • Antibody epitopes may be linear epitopes or conformational epitopes.
  • Linear epitopes are formed by a continuous sequence of amino acids in a protein.
  • Conformational epitopes are formed of amino acids that are discontinuous in the protein sequence, but which are brought together upon folding of the protein into its three-dimensional structure.
  • Epitope binning is the process of grouping antibodies based on the epitopes they recognize. More particularly, epitope binning comprises methods and systems for discriminating the epitope recognition properties of different antibodies, combined with
  • An “agent” or “compound” according to the present invention comprises small molecules, polypeptides, proteins, antibodies or antibody fragments.
  • Small molecules in the context of the present invention, mean in one embodiment chemicals with molecular weight smaller than 1000 Daltons, particularly smaller than 800 Daltons, more particularly smaller than 500 Daltons.
  • therapeutic agent refers to an agent that has biological activity.
  • anti-cancer agent refers to an agent that has biological activity against cancer cells.
  • cell culture refers to any in vitro culture of cells. Included within this term are continuous cell lines (e.g., with an immortal phenotype), primary cell cultures, finite cell lines (e.g., non-transformed cells), and any other cell population maintained in vitro, including stem cells, blood cells, embryonic cord blood cells, tumor cells, transduced cells, etc.
  • treat or “treatment” refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder.
  • beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease ⁇ e.g., decrease of tumor size, tumor burden, or tumor distribution), stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
  • Treatment can also mean prolonging survival, as compared to expected survival if not receiving treatment.
  • Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
  • Administration in combination with " one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
  • sequences or subsequences refers to two or more sequences or subsequences that are the same.
  • substantially identical refers to two or more sequences which have a percentage of sequential units which are the same when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using comparison algorithms or by manual alignment and visual inspection.
  • two or more sequences may be “substantially identical” if the sequential units are about 60% identical, about 65% identical, about 70%> identical, about 75%> identical, about 80%> identical, about 85%o identical, about 90%> identical, or about 95%> identical over a specified region.
  • the identity of a sequence can exist over a region that is at least about 75-100 sequential units in length, over a region that is about 50 sequential units in length, or, where not specified, across the entire sequence. This definition also refers to the complement of a test sequence.
  • two or more polynucleotide sequences are identical when the nucleic acid residues are the same, while two or more polynucleotide sequences are "substantially identical " if the nucleic acid residues are about 60%) identical, about 65%> identical, about 70%> identical, about 75%> identical, about 80%> identical, about 85%o identical, about 90%> identical, or about 95%> identical over a specified region.
  • the identity can exist over a region that is at least about 75 to about 100 nucleic acids in length, over a region that is about 50 nucleic acids in length, or, where not specified, across the entire sequence of a polynucleotide sequence.
  • pharmaceutically acceptable refers to a material, including but not limited, to a salt, carrier or diluent, which does not abrogate the biological activity or properties of the compound, and is relatively nontoxic, i.e., the material may be administered to an individual without causing undesirable biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.
  • subject or “patient”
  • patient refers to a vertebrate.
  • the vertebrate is a mammal.
  • Mammals include, but are not limited to, humans, non- human primates, farm animals (such as cows), sport animals, and pets (such as cats, dogs, and horses).
  • a mammal is a human.
  • terapéuticaally effective amount refers to the amount of a composition containing the expanded cell populations and/or admixtures of the present invention administered to a subject, e.g., a human patient, already suffering from a disease, condition or disorder, sufficient to cure or at least partially arrest, or relieve to some extent one or more of the symptoms of the disease, disorder or condition being treated.
  • a subject e.g., a human patient
  • the effectiveness of such compositions depend conditions including, but not limited to, the severity and course of the disease, disorder or condition, previous therapy, the patient's health status and response to the drugs, and the judgment of the treating physician.
  • therapeutically effective amounts may be determined by routine experimentation, including but not limited to a dose escalation clinical trial.
  • antigen presenting cell refers to a wild-type APC, or an engineered or artificial antigen presenting cell (aAPC).
  • APCs can be provided as an irradiated population of APCs.
  • APCs can be provided from a immortalized cell line (e.g., K562 or an engineered aAPC derived from an immortalized cell line) or as a fraction of cells from a donor (e.g., PBMCs).
  • a donor e.g., PBMCs
  • structurally different and “structurally distinct,” in reference to a protein or polypeptide fragment thereof, or an epitope refer to a covalent (i.e., structural) difference between at least two different proteins, polypeptide fragments thereof, or epitopes.
  • structurally different proteins e.g., antibodies
  • structurally different activating agents bind
  • epitopes having a different primary amino acid sequence.
  • anti-tumor cytotoxicity that is "independent of a specified receptor activity (e.g., Kp30 activity, NKp44 activity, and/or Kp46 activity), refers to anti-tumor cytotoxicity that is exhibited whether or not the specified receptor or specified combination of receptors is expressed by the cell or functional.
  • a ⁇ T-cell that exhibits anti-tumor cytotoxicity that is independent of Kp30 activity, Kp44 activity, and/or Kp46 activity can also exhibit Kp30 activity-dependent anti-tumor cytotoxicity, Kp44 activity -dependent anti-tumor cytotoxicity, and/or NKp46 activity-dependent anti-tumor cytotoxicity.
  • Kp30 activity-dependent anti-tumor cytotoxicity refers to anti-tumor cytotoxicity that requires functional expression of the specified receptor.
  • the presence or absence of such receptor dependent anti-tumor cytotoxicity can be determined by performing standard in vitro cytotoxicity assays, such as performed in Example 48, in the presence or absence of an antagonist to the specified receptor.
  • presence or absence of NKp30 activity-dependent anti-tumor cytotoxicity can be determined by comparing the results of an in vitro cytotoxicity assays as described in Example 48 in the presence of an anti- Kp30 antagonist to the results obtained in the absence of an anti-NKp30 antagonist.
  • a ⁇ T-cell population that comprises anti-tumor cytotoxicity wherein at least a specified "%" of the anti-tumor cytotoxicity is "independent of a specified receptor activity ⁇ e.g., Kp30 activity, Kp44 activity, and/or Kp46 activity), refers to a cell where blocking specified receptor reduces measured anti-tumor cytotoxicity by no more than the numerical % value.
  • a ⁇ T-cell population that comprises anti -tumor cytotoxicity, wherein at least 50% of the antitumor cytotoxicity is independent of NKp30 activity would exhibit a reduction of 50% or less of in vitro anti-tumor cytotoxicity in the presence of an Kp30 antagonist as compared to in the absence of the NKp30 antagonist.
  • ⁇ T-cell(s) are a subset of T-cells that provide a link between the innate and adaptive immune responses. These cells undergo V-(D)-J segment rearrangement to generate antigen-specific ⁇ T-cell receptors ( ⁇ TCRs), and ⁇ T-cell(s) and can be directly activated via the recognition of an antigen by either the ⁇ TCR or other, non-TCR proteins, acting independently or together to activate ⁇ T-cell effector functions, ⁇ T-cells represent a small fraction of the overall T- cell population in mammals, approximately 1-5% of the T-cells in peripheral blood and lymphoid organs, and they appear to reside primarily in epithelial cell-rich compartments like skin, liver, digestive, respiratory, and reproductive tracks.
  • ⁇ TCRs which recognize antigens bound to major histocompatibility complex molecules (MHC)
  • MHC major histocompatibility complex molecules
  • ⁇ TCRs can directly recognize bacterial antigens, viral antigens, stress antigens expressed by diseased cells, and tumor antigens in the form of intact proteins or non-peptide compounds.
  • TS-1, TS8.2, B6, and 15D can activate ⁇ T cells.
  • different levels of activation and expansion of cultures originating from different donors may be due to the donor ⁇ variable TCR repertoire and the specificity of the antibody binding epitope.
  • agent which binds to specific ⁇ T-cell subsets is capable of activating the specific ⁇ T-cell and particularly activating the specific ⁇ T-cell population to clinically-relevant levels, i.e., >10 8 target ⁇ T cells in an enriched culture.
  • binding epitope of a ⁇ T-cell population is an activating epitope, i.e., capable of activation of the specific ⁇ T-cell population upon binding.
  • the inventors of the present invention have identified specific ⁇ variable TCR binding regions associated with potent activation of specific ⁇ T cell subtypes thus enabling the specific activation of ⁇ T cell subtypes which produces clinically relevant levels of highly enriched ⁇ T-cell populations with increased purity, and admixtures thereof, that can be administered to patients.
  • Novel activating ligands including antibodies, which specifically bind the activating epitopes capable of inducing enhanced activation and expansion of ⁇ T cell subtypes are also contemplated and further described herein.
  • the production of clinically relevant levels (i.e., >10 8 ) of ⁇ T cells using the methods of the present invention can be obtained with relatively small volumes of culture medium.
  • the clinically relevant levels of ⁇ T cells can be obtained from expansion of a population of cells (e.g., an isolated mixed population of cells), in a final culture volume of approximately 25 L; 20 L; 10 L; 5 L; 3 L; 2 L; 1,5000 mL; 1,000 mL; 500 mL; 200 mL; 150 mL; 100 mL, or less (e.g., from about 10 mL to about 100 mL, from about 100 mL to about 500 mL, from about 500 mL to about 5,000 mL, or from about 5 L to about 25 L).
  • the clinically relevant levels of ⁇ T cells can be obtained under conditions such that the total volume of culture media used in expanding an isolated mixed population of cells obtained from a donor, or multiple donors, is less than about 50 L, 25L , 20L, 10 L, 5L, 1 L, or 750 mL ⁇ e.g., from about 750 mL to less than about 50 L, from about 100 mL to about 750 mL, from about 750 mL to about 5 L, from about 1 L to about 10 L, from about 10L to about 50 L, or from about 10 L to about 25 L).
  • Described herein are methods for the selective activation and expansion of ⁇ T-cell subtypes directly from isolated mixed cell populations, e.g., without prior depletion of non-target cell types, providing clinically-relevant levels of enriched ⁇ T cell population(s) having cytotoxic properties. Activating ⁇ variable TCR epitopes of specific ⁇ cell population(s) are also described.
  • the present invention also provides methods of treatment with compositions comprising the enriched ⁇ T-cell population(s) of the invention.
  • Described herein are methods of producing or providing clinically relevant levels (>10 8 ) of engineered or non-engineered ⁇ T-cells, including one or more specific subsets of ⁇ T-cells. Such methods can be used to produce such clinically relevant levels from a single donor, including from a single sample of a single donor. Moreover, such methods can be used to produce significantly greater than 10 8 engineered or non-engineered ⁇ T-cells. For example, in some embodiments about, or at least about, 10 9 , 10 10 , 10 11 , or 10 12 engineered or non-engineered ⁇ T-cells, including one or more specific subsets of ⁇ T-cells, can be produced in the methods described herein. In some cases, such population sizes can be achieved in as few as 19-30 days and/or with a total volume of culture media used of less than about 1L.
  • the instant invention provides ex vivo methods for expansion of engineered or non-engineered ⁇ T-cells.
  • the method employ one or more (e.g., first and/or second) expansion steps that do not include a cytokine that favors expansion of a specific population of ⁇ T-cells, such as IL-4, IL-2, or IL-15, or a combination thereof.
  • the instant invention provides ex vivo methods for producing enriched ⁇ T-cell populations from isolated mixed cell populations, comprising contacting the mixed cell population with one or more agents which selectively expand ⁇ 1 T-cells; ⁇ 1 T-cells and ⁇ 3 T-cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T cells by binding to an epitope specific of a ⁇ 1 TCR; a ⁇ 1 and ⁇ 4 TCR; or a ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 TCR respectively to provide an enriched ⁇ T cell population.
  • the instant invention provides ex vivo methods for producing enriched ⁇ T-cell populations from isolated mixed cell populations, comprising contacting the mixed cell population with one or more agents which selectively expand ⁇ 2 T-cells by binding to an epitope specific of a ⁇ 2 TCR to provide an enriched ⁇ T cell population.
  • the present disclosure provides methods for the genetic engineering of ⁇ T- cells that have been isolated from a subject. Methods of enrichment, activation, expansion, or genetic engineering can be performed singly or in combination, in any order.
  • ⁇ T-cells can be isolated, genetically engineered, and then activated and expanded.
  • ⁇ T-cells can be isolated, activated and expanded, and then optionally genetically engineered. In some embodiments, such activated and expanded and then genetically engineered ⁇ T-cells can be further activated and/or expanded.
  • An, e.g., non-engineered, ⁇ T-cell population can be expanded from a complex sample of a subject.
  • a complex sample can be a peripheral blood sample (e.g., PBLs or PBMCs), a
  • the present disclosure provides methods for selective expansion of ⁇ 1 + cells, ⁇ 2 + cells, ⁇ 1 + cells and ⁇ 3 + cells, ⁇ 1 + cells and ⁇ 4 + cells, ⁇ 1 + cells, ⁇ 3 + cells, ⁇ 4 + cells, and V ⁇ 5 + cells, or any combination thereof.
  • Peripheral blood mononuclear cells can be collected from a subject, for example, with an apheresis machine, including the Ficoll-PaqueTM PLUS (GE Healthcare) system, or another suitable device/system, ⁇ T-cell(s), or a desired subpopulation of ⁇ T-cell(s), can be purified from the collected sample with, for example, flow cytometry techniques.
  • Cord blood cells can also be obtained from cord blood during the birth of a subject. See WO 2016/081518, incorporated by reference herein in its entirety for all purposes including but not limited to methods and
  • compositions for PBMC isolation, ⁇ T cell activation, and making and using ⁇ T cell activation agents are provided.
  • a ⁇ T-cell may be expanded from an isolated complex sample or mixed cell population that is cultured in vitro by contacting the mixed cell population with one or more agents which expand ⁇ T-cell by specifically binding to an epitope of a ⁇ TCR to provide an enriched ⁇ T-cell population, e.g., in a first enrichment step.
  • ⁇ T cells comprised in a whole PBMC population, without prior depletion of one or more specific cell populations such as one or more or all of the following non- ⁇ T cell monocytes: ⁇ T-cells, B-cells, and K cells, can be activated and expanded, resulting in an enriched ⁇ T-cell population.
  • activation and expansion of ⁇ T-cell are performed without the presence of native or engineered APCs.
  • isolation and expansion of ⁇ T cells from tumor specimens can be performed using immobilized ⁇ T cell mitogens, including antibodies specific to activating epitopes of a ⁇ TCR, and other activating agents, including lectins, which bind the activating epitopes of a ⁇ TCR provided herein.
  • the isolated mixed cell population is contacted with one or more agents which expand ⁇ T-cells for about, or at least about, 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, about 10 days, about 11 days, about 12 days, about 13 days, about 14 days, about 15 days, about 17 days, about 19 days, about 21 days, about 25 days, about 29 days, about 30 days, or any range therein.
  • the isolated mixed cell population is contacted with one or more agents which expand ⁇ T-cells for about 1 to about 4 days, about 2 to about 4 days, about 2 to about 5 days, about 3 to about 5 days, about 5 to about 21 days, about 5 to about 19 days, about 5 to about 15 days, about 5 to about 10 days, or about 5 to about 7 days, to provide a first enriched ⁇ T-cell population.
  • the isolated mixed cell population is contacted with one or more agents which expand ⁇ T-cells for about 7 to about 21 days, about 7 to about 19 days, about 7 to about 23 days, or about 7 to about 15 days to provide a first enriched ⁇ T-cell population.
  • a purification or isolation step is performed between the first and second expansion steps.
  • the isolation step includes removal of one or more activating agents.
  • the isolation step includes specific isolation of ⁇ T-cells, or a subtype thereof.
  • one or more activating agents e.g., all activating agents that are not common components of cell culture media such as serum components and/or IL-2) are removed between first and second expansion steps, but ⁇ T-cells are not specifically isolated from other cell types ( ⁇ T- cells).
  • the, e.g., first, enriched ⁇ T cell population(s) of the invention may be further enriched or purified using techniques known in the art to obtain a second or further enriched ⁇ T cell population(s) in a second, third, fourth, fifth, etc. enrichment step.
  • the, e.g., first, enriched ⁇ T cell population(s) may be depleted of ⁇ T-cells, B-cells and K cells.
  • Positive and/or negative selection of cell surface markers expressed on the collected ⁇ T-cell(s) can be used to directly isolate a ⁇ T-cell, or a population of ⁇ T-cell(s) expressing similar cell surface markers from the, e.g., first, enriched ⁇ T-cell population(s).
  • a ⁇ T-cell can be isolated from an enriched ⁇ T-cell population (e.g., after a first and/or second step of expansion) based on positive or negative expression of markers such as CD2, CD3, CD4, CD8, CD24, CD25, CD44, Kit, TCR a, TCR ⁇ , TCR ⁇ (including one or more TCR ⁇ sub-types), TCR ⁇ (including one or more TCR ⁇ subtypes), KG2D, CD70, CD27, CD28, CD30, CD 16, OX40, CD46, CD1 ⁇ 1, CCR7, CCR4, Kp30, Kp44, Kp46, DNAM-1, CD242, JAML, and other suitable cell surface markers.
  • markers such as CD2, CD3, CD4, CD8, CD24, CD25, CD44, Kit, TCR a, TCR ⁇ , TCR ⁇ (including one or more TCR ⁇ sub-types), TCR ⁇ (including one or more TCR ⁇ subtypes), KG2D,
  • the expanded cells are, optionally diluted, and cultured in a second step of expansion.
  • the second step of expansion is performed under conditions in which culture media is replenished about every 1-2, 1-3, 1-4, 1-5, 2-5, 2-4, or 2- 3 days in a second expansion step.
  • the second step of expansion is performed under conditions in which the cells are diluted or adjusted to a density that supports further ⁇ T-cell expansion 1, 2, 3, 4, 5, 6, or more times.
  • the cell density adjustment is performed contemporaneously with (i.e., on the same day as, or at the same time as) replenishment of culture media.
  • cell density can be adjusted every 1-2, 1-3, 1-4, 1-5, 2-5, 2-4, or 2-3 days in a second expansion step.
  • Typical cell densities that support further ⁇ T-cell expansion include, but are not limited to, about 1 x 10 5 , 2 x 10 5 , 3 x 10 5 , 4 x 10 5 , 5 x 10 5 , 6 x 10 5 , 7 x 10 5 , 8 x 10 5 , 9 x 10 5 , 1 x 10 6 , 2 x 10 6 , 3 x 10 6 , 4 x 10 6 , 5 x 10 6 cells/mL, 10 x 10 6 cells/mL, 15 x 10 6 cells/mL, 20 x 10 6 cells/mL, or 30 x 10 6 cells/mL of culture.
  • cell density is adjusted to a density of from about 0.5 x 10 6 to about 1 x 10 6 cells/mL, from about 0.5 x 10 6 to about 1.5 x 10 6 cells/mL, from about 0.5 x 10 6 to about 2 x 10 6 cells/mL, from about 0.75 x 10 6 to about 1 x 10 6 cells/mL, from about 0.75 x 10 6 to about 1.5 x 10 6 cells/mL, from about 0.75 x 10 6 to about 2 x 10 6 cells/mL, from about 1 x 10 6 to about 2 x 10 6 cells/mL, or from about 1 x 10 6 to about 1.5 x 10 6 cells/mL, from about 1 x 10 6 to about 2 x 10 6 cells/mL, from about 1 x 10 6 to about 3 x 10 6 cells/mL, from about 1 x 10 6 to about 4 x 10 6 cells/mL, from about 1 x 10 6 to about 5 x 10 6 cells/mL, from about 1 x 10
  • the second step of expansion is performed under conditions in which the cells are monitored and maintained at a predetermined cell density (or density interval) and/or maintained in culture medium having a predetermined glucose content.
  • the cells can be maintained at a viable cell density of from about 0.5 x 10 6 to about 1 x 10 6 cells/mL, from about 0.5 x 10 6 to about 1.5 x 10 6 cells/mL, from about 0.5 x 10 6 to about 2 x 10 6 cells/mL, from about 0.75 x 10 6 to about 1 x 10 6 cells/mL, from about 0.75 x 10 6 to about 1.5 x 10 6 cells/mL, from about 0.75 x 10 6 to about 2 x 10 6 cells/mL, from about 1 x 10 6 to about 2 x 10 6 cells/mL, or from about 1 x 10 6 to about 1.5 x 10 6 cells/mL, from about 1 x 10 6 to about 3 x 10 6 cells/mL, from about 1 x 10 6 to about 4 x 10
  • the cells can be maintained at a higher concentration for at least a portion of the expansion. For example, for a first portion of a first or second expansion, cells viability may be enhanced at a higher cell concentration. As another example, for a final portion of a first or second expansion culture volume may be most efficiently utilized at a higher cell concentration. Thus, in some embodiments, cells can be maintained at a viable cell density of from about 1 x 10 6 cells/mL to about 20 x 10 6 cells/mL for at least a portion of a first or second expansion culture or all of a first or second expansion culture.
  • the cells can be maintained in culture medium having a glucose content of from about 0.5 g/L to about 1 g/L, from about 0.5 g/L to about 1.5 g/L, from about 0.5 g/L to about 2 g/L, from about 0.75 g/L to about 1 g/L, from about 0.75 g/L to about 1.5 g/L, from about 0.75 g/L to about 2 g/L, from about 1 g/L to about 1.5 g/L, from about 1 g/L to about 2 g/L, from 1 g/L to 3 g/L, or from 1 g/L to 4 g/L..
  • the cells can be maintained in culture medium having a glucose content of about 1.25 g/L.
  • cells can be maintained in culture medium having a glucose content of about 1 g/L to about 5 g/L, from about 1 g/L to about 4 g/L, from about 2 g/L to about 5 g/L, or from about 2 g/L to about 4 g/L.
  • glucose content is maintained by addition of fresh serum containing or serum free culture medium to the culture.
  • the cells can be maintained at a predetermined viable cell density interval and in a culture medium having a predetermined glucose content interval, e.g., by monitoring each parameter and adding fresh media to maintain the parameters within the predetermined limits.
  • glucose content is maintained by adding fresh serum containing or serum free culture medium in the culture while removing spent medium in a perfusion bioreactor while retaining the cells inside.
  • additional parameters including, without limitation, one or more of: pH, partial pressure of O 2 , O 2 saturation, partial pressure of CO 2 , CO 2 saturation, lactate, glutamine, glutamate, ammonium, sodium, potassium, and calcium, are monitored and/or maintained during a ⁇ T-cell expansion (e.g., selective ⁇ T-cell expansion) or during a first or second step of ⁇ T-cell expansion (e.g., selective ⁇ T-cell expansion) described herein.
  • a ⁇ T-cell expansion e.g., selective ⁇ T-cell expansion
  • first or second step of ⁇ T-cell expansion e.g., selective ⁇ T-cell expansion
  • a ⁇ T-cell subtype may be selectively expanded from an isolated complex sample or mixed cell population that is cultured in vitro by contacting the mixed cell population with one or more agents which:
  • ⁇ 1, ⁇ 3, 54, and ⁇ 5 T cells selectively expand ⁇ 1, ⁇ 3, 54, and ⁇ 5 T cells by specifically binding to an epitope of a ⁇ 1, ⁇ 3, 54, and a 55 TCR
  • ⁇ T-cell population e.g., in a first enrichment step.
  • the one or more agents specifically bind to a ⁇ 1 Jl, ⁇ 1 J2, or ⁇ 1 J3 TCR, or two thereof, or all thereof.
  • ⁇ cells in a whole PBMC population without prior depletion of specific cell populations such as monocytes, ⁇ T-cells, B-cells, and K cells, can be activated and expanded, resulting in an enriched ⁇ T-cell population.
  • activation and expansion of ⁇ T-cell are performed without the presence of native or engineered APCs.
  • isolation and expansion of ⁇ T cells from tumor specimens can be performed using immobilized ⁇ T cell mitogens, including antibodies specific to activating epitopes specific of a ⁇ 1 TCR; a ⁇ 1, ⁇ 3, 54, and 55 TCR, a ⁇ 1 and ⁇ 4 TCR; or a ⁇ 2 TCR, and other activating agents, including lectins, which bind the activating epitopes specific of a ⁇ 1 TCR; a ⁇ 1, ⁇ 3, ⁇ 4 and ⁇ 5 TCR; a ⁇ 1 and ⁇ 4 TCR; or a ⁇ 2 TCR provided herein.
  • immobilized ⁇ T cell mitogens including antibodies specific to activating epitopes specific of a ⁇ 1 TCR; a ⁇ 1, ⁇ 3, 54, and 55 TCR, a ⁇ 1 and ⁇ 4 TCR; or a ⁇ 2 TCR, and other activating agents, including lectins, which bind the activating epitopes specific of a ⁇ 1
  • the isolated mixed cell population is contacted with one or more agents which selectively expand ⁇ 1, ⁇ 1 and ⁇ 4, 52, or ⁇ 1 and - ⁇ c2el Tls for about 5 days, ⁇ days, about 7 days, about 8 days, about 9 days, about 10 days, about 11 days, about 12 days, about 13 days, about 14 days, about 15 days, or any range therein.
  • the isolated mixed cell population is contacted with one or more agents which selectively expand ⁇ 1 or -c ⁇ e2ll Ts for about 1 to about 3 days, about 1 to about 4 days, about 1 to about 5 days, about 2 to about 3 days, about 2 to about 4 days, about 2 to about 5 days, about 3 to about 4 days, about 3 to about 5 days, about 4 to about 5 days, about 5 to about 15 days, or about 5 to about 7 days, to provide a first enriched ⁇ T-cell population.
  • selectively expanded ⁇ 1, ⁇ 1 and ⁇ 3, ⁇ 1 and ⁇ 4, 52, or ⁇ 1 and ⁇ 2 T-cells are further expanded in a second step of expansion as described herein.
  • the starting isolated mixed cell population e.g., peripheral blood sample, comprises T lymphocytes in the range of about 20-80%.
  • the percent of residual ⁇ T cells and NK cells in enriched ⁇ T-cell population(s) of the invention is about, or less than about, 2.5% and 1 %, respectively.
  • the percent of residual ⁇ T cells or NK cells in enriched ⁇ T-cell population(s) of the invention is about, or less than about, 1%, 0.5%, 0.4%, 0.2%, 0.1%, or 0.01%.
  • the percent of residual ⁇ T cells in enriched ⁇ T-cell population(s) of the invention is about, or less than about, 0.4%, 0.2%), 0.1%), or 0.01%) (e.g., after a step of positive selection for ⁇ T-cells or a sub-type thereof or after depletion of ⁇ T cells).
  • ⁇ T cells are depleted, but K cells are not depleted before or after a first and/or second ⁇ T-cell expansion.
  • the isolated mixed cell population is derived from a single donor. In other aspects, the isolated mixed cell population is derived from more than one donor or multiple donors (e.g., 2, 3, 4, 5, or from 2-5, 2-10, or 5-10 donors, or more).
  • the methods of the present invention can provide a clinically relevant number (>10 8 , >10 9 , >10 10 , >10 11 , or >10 12 , or from about 10 8 to about 10 12 ) of expanded ⁇ T-cells from as few as one donor.
  • the methods of the present invention can provide a clinically relevant number (>10 8 , >10 9 , >10 10 , >10 11 , or >10 12 , or from about 10 8 to about 10 12 ) of expanded ⁇ T-cells within less than 19 or 21 days from the time of obtaining a donor sample.
  • the first enriched ⁇ T cell population(s) of the invention may be further enriched or purified using techniques known in the art to obtain a second or further enriched ⁇ T cell population(s) in a second, third, fourth, fifth, etc. enrichment step.
  • the first enriched ⁇ T cell population(s) may be depleted of ⁇ T-cells, B-cells and NK cells.
  • Positive and/or negative selection of cell surface markers expressed on the collected ⁇ T- cell(s) can be used to directly isolate a ⁇ T-cell, or a population of ⁇ T-cell(s) expressing similar cell surface markers from the first enriched ⁇ T-cell population(s).
  • a ⁇ T-cell can be isolated from a first enriched ⁇ T-cell population based on positive or negative expression of markers such as CD2, CD3, CD4, CD8, CD24, CD25, CD44, Kit, TCR a, TCR ⁇ , TCR ⁇ (or one or more subtypes thereof), TCR ⁇ (or one or more subtypes thereof), KG2D, CD70, CD27, CD28, CD30, CD 16, OX40, CD46, CD1 ⁇ 1, CCR7, CCR4, DNAM-1, JAML, and other suitable cell surface markers.
  • markers such as CD2, CD3, CD4, CD8, CD24, CD25, CD44, Kit, TCR a, TCR ⁇ , TCR ⁇ (or one or more subtypes thereof), TCR ⁇ (or one or more subtypes thereof), KG2D, CD70, CD27, CD28, CD30, CD 16, OX40, CD46, CD1 ⁇ 1, CCR7, CCR4, DNAM-1, JAML, and other suitable cell surface
  • the enriched ⁇ T-cell population comprises clinically-relevant levels of ⁇ T-cell subsets of >10 8 cells, e.g., in a culture volume of less than 10 mL, 25 mL, 50 mL, 100 mL, 150 mL, 200 mL, 500 mL, 750 mL, 1 L, 2 L, 3 L, 4 L, 5 L, 10 L, 20 L, or 25 L..
  • the methods of the present invention can provide clinically-relevant levels of ⁇ T-cell subsets of >10 8 cells in a expansion culture having a volume of from 10-100 mL; from 25-100 mL; from 50-100 mL; from 75-100mL; from 10-150 mL; from 25- 150 mL; from 50-150 mL; from 75-150 mL; from 100-150 mL; from 10-200 mL; from 25-200 mL; from 50-200 mL; from 75-200 mL, from 100-200 mL; from 10-250 mL; from 25-250 mL; from 50- 250 mL; from 75-250 mL, from 100-250 mL; from 150-250 mL; from 5-1,000 mL; from 10-1,000 mL, or from 100-1,000 mL; from 150-1,000 mL; from 200-1,000 mL; from 250-1,000 mL, 400 mL to 1L, 1 L to 2 L
  • ⁇ T-cell(s) can rapidly expand in response to contact with one or more antigens.
  • Some ⁇ T-cell(s), such as Vy9V ⁇ 2 + ⁇ T-cell(s) rapidly expand in vitro in response to contact with some antigens, like prenyl-pyrophosphates, alkyl amines, and metabolites or microbial extracts during tissue culture.
  • some wild-type ⁇ T-cell(s) such as Vy2V ⁇ 2 + ⁇ T-cell(s) rapidly expand in vivo in humans in response to certain types of vaccination(s).
  • Stimulated ⁇ T-cells can exhibit numerous antigen-presentation, co-stimulation, and adhesion molecules that can facilitate the isolation of a ⁇ T-cell(s) from a complex sample.
  • a ⁇ T-cell(s) within a complex sample can be stimulated in vitro with at least one antigen for 1 day, 2 days, 3 days, 4 days, 5 days, ⁇ days, 7 days, about 5-15 days, 5-10 days, or 5-7 days, or another suitable period of time, e.g., in combination with, before, or after expansion with a selective ⁇ T-cell expansion agent described herein such as an antibody or an immobilized antibody. Stimulation of the ⁇ T-cell with a suitable antigen can expand the ⁇ T-cell population in vitro.
  • Non-limiting examples of antigens that may be used to stimulate the expansion of ⁇ T-cell(s) from a complex sample in vitro include, prenyl-pyrophosphates, such as isopentenyl pyrophosphate (IPP), alkyl-amines, metabolites of human microbial pathogens, metabolites of commensal bacteria, -methyl-3-butenyl-l -pyrophosphate (2M3B1PP), (E)-4-hydroxy-3 -methyl -but-2-enyl pyrophosphate (HMB-PP), ethyl pyrophosphate (EPP), farnesyl pyrophosphate (FPP), dimethylallyl phosphate (DMAP), dimethylallyl pyrophosphate (DMAPP), ethyl-adenosine triphosphate (EPPPA), geranyl pyrophosphate (GPP), geranyl geranyl pyrophosphate (GGPP), isopentenyl-adenos
  • Activation and expansion of ⁇ T-cells can be performed using activation and co-stimulatory agents described herein to trigger specific ⁇ T-cell proliferation and persistent populations.
  • activation and expansion of ⁇ T-cells from different cultures can achieve distinct clonal or mixed polyclonal population subsets.
  • different agonist agents can be used to identify agents that provide specific ⁇ activating signals.
  • agents that provide specific ⁇ activating signals can be different monoclonal antibodies (MAbs) directed against the ⁇ TCRs.
  • the MAbs can bind to different epitopes on the constant or variable regions of ⁇ TCR and/or ⁇ TCR.
  • the MAbs can include ⁇ TCR pan MAbs.
  • the ⁇ TCR pan MAbs may recognize domains shared by different ⁇ and ⁇ TCRs on either the ⁇ or ⁇ chain or both, including ⁇ 1 and ⁇ 2 cell populations.
  • the antibodies may be 5A6.E9 (Thermo scientific), Bl (Biolegend), IMMU510 and/or 11F2 (11F2) (Beckman Coulter).
  • the MAbs can be directed to specific domains unique to the variable regions of the ⁇ chain (7A5 Mab, directed to like Vy9 TCR (Thermo Scientific #TCR1720)), or domains on ⁇ 1 variable region (Mab TS8.2 (Thermo scientific #TCR1730; MAb TS-1 (ThermoFisher #TCR 1055), MAb R9.12
  • ⁇ T-cells activators can include ⁇ TCR-binding agents such as MICA, an agonist antibody to KG2D, an, e.g., Fc tag, fusion protein of MICA, ULBPl, or ULBP3 (R&D systems Minneapolis, MN) ULBP2, or ULBP6 (Sino Biological Beijing, China).
  • ⁇ TCR-binding agents such as MICA, an agonist antibody to KG2D, an, e.g., Fc tag, fusion protein of MICA, ULBPl, or ULBP3 (R&D systems Minneapolis, MN) ULBP2, or ULBP6 (Sino Biological Beijing, China).
  • companion co-stimulatory agents to assist in triggering specific ⁇ T cell proliferation without induction of cell anergy and apoptosis can be identified.
  • co-stimulatory agents can include ligands to receptors expressed on ⁇ cells, such as ligand(s) to one or more of the following: NKG2D , CD 1 ⁇ 1, CD70, JAML, DNAX, CD81 accessory molecule-1 (DNAM-1) ICOS, CD27, CD196, CD137, CD30, HVEM, SLAM, CD 122, DAP, and CD28.
  • co-stimulatory agents can be antibodies specific to unique epitopes on CD2 and CD3 molecules.
  • CD2 and CD3 can have different conformation structures when expressed on ⁇ or ⁇ T-cells (s), and in some cases, specific antibodies to CD3 and CD2 can lead to selective activation of ⁇ T-cells.
  • a population of ⁇ T-cell(s) may be expanded ex vivo prior to engineering of the ⁇ T-cell(s).
  • reagents that can be used to facilitate the expansion of a ⁇ T-cell population in vitro include anti-CD3 or anti-CD2, anti-CD27, anti-CD30, anti-CD70, anti-OX40 antibodies, IL-2, IL-4, IL-7, IL-9, IL-12, IL-15, IL-18, IL-19, IL-21, IL 23, IL-33, IFN ⁇ ,
  • GM-CSF granulocyte-macrophage colony stimulating factor
  • G-CSF granulocyte colony stimulating factor
  • CD70 CD27 ligand
  • ConA concavalin A
  • PWM pokeweed
  • PNA protein peanut agglutinin
  • SBA soybean agglutinin
  • LCA protein peanut agglutinin
  • PSA Pisum Sativum Agglutinin
  • HP A Helix pomatia agglutinin
  • VGA Phaseolus Vulgaris
  • PHA-E Erythroagglutinin
  • PHA-L Phaseolus Vulgaris Leucoagglutinin
  • SNA Sambucus Nigra Lectin
  • MAL II Maackia Amurensis
  • SJA Sophora Japonica Agglutinin
  • DBA Dolichos Biflorus Agglutinin
  • LCA Lens Culinaris Agglutinin
  • WFA Wisteria Floribunda Lectin
  • WFA WFL
  • Genetic engineering of the ⁇ T-cell(s) may comprise stably integrating a construct expressing a tumor recognition moiety, such as an ⁇ TCR, a ⁇ TCR, a CAR encoding an antibody, an antigen binding fragment thereof, or a lymphocyte activation domain into the genome of the isolated ⁇ T-cell(s), a cytokine (e.g., IL-15, IL-12, IL-2, IL-7, IL-21, IL-18, IL-19, IL-33, IL-4, IL- 9, IL-23, or IL1 ) to enhance T-cell proliferation, survival, and function ex vivo and in vivo. Genetic engineering of the isolated ⁇ T-cell may also comprise deleting or disrupting gene expression from one or more endogenous genes in the genome the isolated ⁇ T-cell, such as the MHC locus (loci).
  • a tumor recognition moiety such as an ⁇ TCR, a ⁇ TCR, a CAR encoding an antibody, an
  • the present disclosure provides methods for the ex vivo expansion of a population of non-engineered and engineered ⁇ T-cells for adoptive transfer therapy.
  • a non-engineered or engineered ⁇ T-cell of the disclosure may be expanded ex vivo.
  • a non-engineered or engineered ⁇ T-cell of the disclosure can be expanded in vitro without activation by APCs, or without co-culture with APCs and/or aminophosphonates.
  • a non- engineered or engineered ⁇ T-cell of the disclosure can be expanded in vitro with at least one expansion step that includes activation by or co-culture with APCs and/or with one or more aminophosphonates.
  • a non-engineered or engineered ⁇ T-cell of the disclosure can be expanded in vitro without activation by APC in a first ⁇ T-cell expansion, and then expanded in vitro with activation by APC in a second ⁇ T-cell expansion.
  • the first ⁇ T-cell expansion includes contacting the ⁇ T-cells with one or more agents which (a) expand ⁇ T-cells, or (b) selectively expand ⁇ 1 T-cells; ⁇ 2 T-cells; ⁇ 1 T-cells and ⁇ 3 T-cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T-cells by binding to an activating epitope specific of a ⁇ 1 TCR; a ⁇ 2 TCR; a ⁇ 1 and ⁇ 4 TCR; or a ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 TCR respectively.
  • the second ⁇ T-cell expansion is performed in a culture medium that is free of the one or more agents used in the first ⁇ T-cell expansion. In some cases, the second ⁇ T-cell expansion is performed in a culture medium that contains one or more second agents that (a) expand T cells, (b) expand ⁇ T-cells, or (c) selectively expand ⁇ 1 T-cells; ⁇ 2 T-cells; ⁇ 1 T-cells and ⁇ 3 T- cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T-cells by binding to an activating epitope specific of a ⁇ 1 TCR; a ⁇ 2 TCR; a ⁇ 1 and ⁇ 4 TCR; or a ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 TCR respectively.
  • the second agents are different (e.g., have a different primary amino acid sequence and/or bind a structurally different ⁇ TCR epitope) as compared to the agents used in the first ⁇ T-cell expansion.
  • the second agents bind an overlapping ⁇ TCR epitope, the same ⁇ TCR epitope, or can compete for binding to ⁇ TCR with the agents used in the first ⁇ T- cell expansion.
  • the second agents are expressed on the cell surface of an APC.
  • the second agents are bound to the surface of an APC, e.g., by a binding interaction between a constant region of the second agent and an Fc-receptor on the surface of the APC.
  • the second agents are soluble.
  • the second ⁇ T-cell expansion is performed in a culture medium containing soluble second agents and APCs, optionally wherein the APC express on their cell surface or bind to their cell surface an agent that expands or selectively expands a ⁇ T cell population.
  • the first ⁇ T-cell expansion is performed without an APC
  • the second ⁇ T-cell expansion is performed with an APC.
  • the second ⁇ T-cell expansion is performed with an APC and one or more second agents that (a) expand T cells, (b) expand ⁇ T-cells, or (c) selectively expand ⁇ 1 T-cells; ⁇ 2 T-cells; ⁇ 1 T-cells and ⁇ 3 T-cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T-cells by binding to an activating epitope specific of a ⁇ 1 TCR; a CR ⁇ ;2 a T ⁇ 1 and ⁇ 4 TCR; or a ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 TCR respectively.
  • a mixed population of cells e.g., PBMC
  • PBMC PBMC
  • a mixed population of cells can be expanded by contacting with an APC in a first step, and then expanded in the absence of an APC, e.g., by contacting the expanded population from the first expansion step with an immobilized agent that selectively expands ⁇ 1 T-cells; ⁇ 2 - Tcells; ⁇ 1 T-cells and ⁇ 3 T-cells; ⁇ 1 T-cells and ⁇ 4 T-cells; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T-cells by binding to an activating epitope specific of a ⁇ 1 TCR; a C ⁇ R2; T a ⁇ 1 and ⁇ 4 TCR; or a ⁇ 1, ⁇ 3, ⁇ 4,
  • a method of the invention can expand various ⁇ T-cell(s) populations, such as a Vyl + , a Vy2 + , or ⁇ 3 + ⁇ T-cell population.
  • a method of the invention can expand a V ⁇ 1 + T- cell population; a V ⁇ 1 + and a V ⁇ 3 + T-cell population; a V ⁇ 1 + and a ⁇ 4 + T-cell population; a V ⁇ 1 + and a V ⁇ 2 T-cell population; or a ⁇ 1 + , V ⁇ 3 + , V ⁇ 4 + , and a V ⁇ 5 + T-cell population.
  • a ⁇ T-cell population can be expanded in vitro in fewer than 36 days, fewer than 35 days, fewer than 34 days, fewer than 33 days, fewer than 32 days, fewer than 31 days, fewer than 30 days, fewer than 29 days, fewer than 28 days, fewer than 27 days, fewer than 26 days, fewer than 25 days, fewer than 24 days, fewer than 23 days, fewer than 22 days, fewer than 21 days, fewer than 20 days, fewer than 19 days, fewer than 18 days, fewer than 17 days, fewer than 16 days, fewer than 15 days, fewer than 14 days, fewer than 13 days, fewer than 12 days, fewer than 11 days, fewer than 10 days, fewer than 9 days, fewer than 8 days, fewer than 7 days, fewer than 6 days, fewer than 5 days, fewer than 4 days, or fewer than 3 days.
  • ⁇ T-cells including engineered and non-engineered ⁇ T-cells by contacting the ⁇ T-cells from the mixed cell population with an activation agent.
  • the activation or activating agent binds to a specific epitope on a cell-surface receptor of a ⁇ T-cell.
  • the activation agent can be an antibody, such as a monoclonal antibody.
  • the activation agent can specifically activate the growth of one or more types of ⁇ T-cells, such ⁇ 1, 52, ⁇ 1 and ⁇ 3, or ⁇ 1 and ⁇ 4 cell populations.
  • the activation agent specifically activates the growth of ⁇ 1 cell populations to provide an enriched ⁇ - cell population. In other cases, the activation agent specifically activates the growth of ⁇ 2 cell populations to provide an enriched ⁇ 2 T-cell population.
  • An activation agent may stimulate the expansion of engineered and non-engineered ⁇ T- cells at a fast rate of growth.
  • an activation agent may stimulate the expansion of engineered and non- engineered ⁇ T-cells at a mean rate of about 1 division per about 4 hours, a mean rate of about 1 division per about 5 hours, a mean rate of about 1 division per about 6 hours, a mean rate of about 1 division per about 7 hours, a mean rate of about 1 division per about 8 hours, a mean rate of about 1 division per about 9 hours, a mean rate of about 1 division per about 10 hours, a mean rate of about 1 division per about 11 hours, a mean rate of about 1 division per about 12 hours, a mean rate of about 1 division per about 13 hours, a mean rate of about 1 division per about 14 hours, a mean rate of about 1 division per about 15 hours, a mean rate of about 1 division per about 16 hours, a mean rate of about 1 division per about 17 hours, a mean rate of about 1 division per about 18 hours, a mean rate of about 1 division per about 19 hours, a mean rate of about 1 division per about 20 hours, a mean rate of about 1
  • an activation agent may stimulate the rapid expansion of engineered and/or non-engineered ⁇ T-cells in a ⁇ T-cell expansion culture, wherein the rapid expansion is at any one of the foregoing mean rates of cell division and is maintained for between about 1 contiguous day and about 19 contiguous days, between about 1 contiguous day and about 14 contiguous days, between about 1 contiguous day and about 7 contiguous days, between about 1 contiguous day and about 5 contiguous days, between about 2 contiguous days and about 19 contiguous days, between about 2 contiguous days and about 14 contiguous days, between about 2 contiguous days and about 7 contiguous days, between about 2 contiguous days and about 5 contiguous days, between about 4 contiguous days and about 19 contiguous days, between about 4 contiguous days and about 14 contiguous days, between about 4 contiguous days and about 7 contiguous days, or between about 4 contiguous days and about 5 contiguous days.
  • an activation agent may stimulate the expansion of engineered and/or non- engineered ⁇ T-cells in a ⁇ T-cell expansion culture that has been maintained for between about 2 and about 7 contiguous days, or between about 2 and about 5 contiguous days, at a mean rate of about 1 division per about 12 hours (e.g., 10-12 hours), a mean rate of about 1 division per about 13 hours (e.g., 10-13 hours), a mean rate of about 1 division per about 14 hours (e.g., 10-14 hours), a mean rate of about 1 division per about 15 hours (e.g., 10-15 hours), a mean rate of about 1 division per about 16 hours (e.g., 10-16 hours), a mean rate of about 1 division per about 17 hours (e.g., 10- 17 hours or 12-17 hours), a mean rate of about 1 division per about 18 hours (e.g., 10-18 hours or 12-18 hours), a mean rate of about 1 division per about 19 hours (e.g., 10-19 hours or 12-19 hours),
  • an activation agent may stimulate the expansion of engineered and/or non- engineered ⁇ T-cells in a ⁇ T-cell expansion culture that has been maintained for between about 2 and about 7 contiguous days, or between about 2 and about 5 contiguous days at a mean rate of about 1 division per about 25 hours (e.g., 12-25 hours, 16-25 hours 18-25 hours, or 20-25 hours), a mean rate of about 1 division per about 26 hours (e.g., 12-26 hours, 16-26 hours 18-26 hours, or 20- 26 hours), a mean rate of about 1 division per about 27 hours (e.g., 12-27 hours, 16-27 hours 18-27 hours, or 20-27 hours), a rate of about 1 division per about 28 hours (e.g., 12-28 hours, 16-28 hours 18-28 hours, 20-28 hours, or 22-28 hours), a rate of about 1 division per about 29 hours (e.g., 16-29 hours 18-29 hours, 20-29 hours, or 22-29 hours), a mean rate of about
  • an activation agent may stimulate the expansion of engineered and/or non- engineered ⁇ T-cells in a ⁇ T-cell expansion culture that has been maintained for at least 14 contiguous days at a mean rate of about 1 division per about 12 hours (e.g., 10-12 hours), a mean rate of about 1 division per about 13 hours (e.g., 10-13 hours), a mean rate of about 1 division per about 14 hours (e.g., 10-14 hours), a mean rate of about 1 division per about 15 hours (e.g., 10-15 hours), a mean rate of about 1 division per about 16 hours (e.g., 10-16 hours), a mean rate of about 1 division per about 17 hours (e.g., 10-17 hours or 12-17 hours), a mean rate of about 1 division per about 18 hours (e.g., 10-18 hours or 12-18 hours), a mean rate of about 1 division per about 19 hours (e.g., 10-19 hours or 12-19 hours), a mean rate of about 1 division per about 20 hours (e.g.
  • an activation agent may stimulate the expansion of engineered and/or non- engineered ⁇ T-cells in a ⁇ T-cell expansion culture that has been maintained for at least 14 contiguous days at a mean rate of about 1 division per about 25 hours (e.g., 12-25 hours, 16-25 hours 18-25 hours, or 20-25 hours), a mean rate of about 1 division per about 26 hours (e.g., 12-26 hours, 16-26 hours 18-26 hours, or 20-26 hours), a mean rate of about 1 division per about 27 hours (e.g., 12-27 hours, 16-27 hours 18-27 hours, or 20-27 hours), a rate of about 1 division per about 28 hours (e.g., 12-28 hours, 16-28 hours 18-28 hours, 20-28 hours, or 22-28 hours), a rate of about 1 division per about 29 hours (e.g., 16-29 hours 18-29 hours, 20-29 hours, or 22-29 hours), a mean rate of about 1 division per about 30 hours (e.g., 12-25 hours
  • an activation agent may stimulate the expansion of engineered and/or non- engineered ⁇ T-cells in a ⁇ T-cell expansion culture that has been maintained for at least 19 contiguous days at a mean rate of about 1 division per about 12 hours (e.g., 10-12 hours), a mean rate of about 1 division per about 13 hours (e.g., 10-13 hours), a mean rate of about 1 division per about 14 hours (e.g., 10-14 hours), a mean rate of about 1 division per about 15 hours (e.g., 10-15 hours), a mean rate of about 1 division per about 16 hours (e.g., 10-16 hours), a mean rate of about 1 division per about 17 hours (e.g., 10-17 hours or 12-17 hours), a mean rate of about 1 division per about 18 hours (e.g., 10-18 hours or 12-18 hours), a mean rate of about 1 division per about 19 hours (e.g., 10-19 hours or 12-19 hours), a mean rate of about 1 division per about 20 hours (e.g.
  • an activation agent may stimulate the expansion of engineered and/or non- engineered ⁇ T-cells in a ⁇ T-cell expansion culture that has been maintained for at least 19 contiguous days at a mean rate of about 1 division per about 25 hours (e.g., 12-25 hours, 16-25 hours 18-25 hours, or 20-25 hours), a mean rate of about 1 division per about 26 hours (e.g., 12-26 hours, 16-26 hours 18-26 hours, or 20-26 hours), a mean rate of about 1 division per about 27 hours (e.g., 12-27 hours, 16-27 hours 18-27 hours, or 20-27 hours), a rate of about 1 division per about 28 hours (e.g., 12-28 hours, 16-28 hours 18-28 hours, 20-28 hours, or 22-28 hours), a rate of about 1 division per about 29 hours (e.g., 16-29 hours 18-29 hours, 20-29 hours, or 22-29 hours), a mean rate of about 1 division per about 30 hours (e.g.,
  • An activation agent may stimulate the expansion of sub-populations of engineered or non- engineered ⁇ T-cells at different rates of growth. For instance, an agent may stimulate the growth of a ⁇ 1 cell population at a faster rate such that over a period of time from 1 day to 90 days of culture (e.g., about 1 day to about 19, 21, or 23 days of culture) the expansion results in greater than about 10-fold, 100-fold, 200-fold, 300-fold, 400-fold, 500-fold, 600-fold, 700-fold, 800-fold, 900-fold, 1,000-fold, 10,000-fold, 20,000-fold, 30,000-fold, 50,000-fold, 70,000-fold, 100,000-fold or
  • the agent may stimulate the growth of a ⁇ 1 and ⁇ 4 population at faster rates such that over a period of time from 1 day to 90 days of culture (e.g., about 1 day to about 19, 21, or 23 days of culture) the expansion results in greater than 10-fold, 100-fold, 200-fold, 300-fold, 400- fold, 500-fold, 600-fold, 700-fold, 800-fold, 900-fold, 1,000-fold, 10,000-fold, 20,000-fold, 30,000- fold, 50,000-fold, 70,000-fold, 100,000-fold or 1,000,000-fold expansion over a ⁇ 2 T-cell population; over another ⁇ T-cell sub-population; over a starting number of ⁇ T-cells before the expansion; over a starting number of ⁇ 1 T-cells before the expansion; over a starting number of ⁇ 1 and ⁇ 3 T- cells before the expansion; or over an ⁇ T cell population in the culture.
  • the agent may stimulate the growth of a ⁇ 1 and ⁇ 4 population at faster rates such that over a period of time from 1 day to 90 days of culture (e.g., about 1 day to about 19, 21, or 23 days of culture) the expansion results in greater than 10-fold, 100-fold, 200-fold, 300-fold, 400- fold, 500-fold, 600-fold, 700-fold, 800-fold, 900-fold, 1,000-fold, 10,000-fold, 20,000-fold, 30,000- fold, 50,000-fold, 70,000-fold, 100,000-fold or 1,000,000-fold expansion over a ⁇ 2 T-cell population; over another ⁇ T-cell sub-population; over a starting number of ⁇ T-cells before the expansion; over a starting number of ⁇ 1 T-cells before the expansion; over a starting number of ⁇ 1 and ⁇ 4 T- cells before the expansion; or over an ⁇ T cell population in the culture.
  • the agent may stimulate the growth of a ⁇ 1, ⁇ 3, ⁇ 4 and ⁇ 5 population at faster rates such that over a period of time from 1 day to 90 days of culture (e.g., about 1 day to about 19, 21, or 23 days of culture) the expansion results in greater than 10-fold, 100-fold, 200-fold, 300-fold, 400-fold, 500-fold, 600-fold, 700-fold, 800-fold, 900-fold, 1,000-fold, 10,000-fold, 20,000-fold, 30,000-fold, 50,000-fold, 70,000-fold, 100,000-fold or 1,000,000-fold expansion over a ⁇ 2 T -cell population; over another ⁇ T-cell sub-population; over a starting number of ⁇ T-cells before the expansion; over a starting number of ⁇ 1 T-cells before the expansion; over a starting number of ⁇ 1 and ⁇ 3 T-cells before the expansion; over a starting number of ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T-cells before the expansion; or over an
  • the agent may stimulate the growth of a ⁇ 2 population at faster rates such that over a period of time from 1 day to 90 days of culture (e.g., about 1 day to about 19, 21, or 23 days of culture) the expansion results in greater than 10-fold, 100-fold, 200-fold, 300-fold, 400-fold, 500- fold, 600-fold, 700-fold, 800-fold, 900-fold, 1,000-fold, 10,000-fold, 20,000-fold, 30,000-fold, 50,000-fold, 70,000-fold, 100,000-fold or 1,000,000-fold expansion over a ⁇ 1 T-cell population; over a ⁇ 3 T-cell population; over another ⁇ T-cell sub-population; over a starting number of ⁇ T- cells before the expansion, over a starting number of ⁇ 2 T-cells before the expansion, or over ⁇ T- cells.
  • 1 day to 90 days of culture e.g., about 1 day to about 19, 21, or 23 days of culture
  • the expansion results in greater than 10-fold, 100-fold, 200-fold, 300
  • the disclosure provides an engineered or non-engineered ⁇ T-cell population, in contact with an agent that stimulates an expansion of the ⁇ T-cell population at a rapid rate, such as a rate of about 1 cell division per 30 hours or faster.
  • the agent selectively stimulates the proliferation of either ⁇ 1 ; ⁇ 2; ⁇ 1 and ⁇ 4; or ⁇ 1, ⁇ 3, ⁇ 4, and ⁇ 5 T-cells.
  • a ⁇ T-cell population can comprise an amount of non-engineered ⁇ T-cells and an amount of engineered ⁇ T-cells.
  • the ⁇ T-cell population comprises different percentages of ⁇ 1, 52, ⁇ 3, and ⁇ 4 T-cells.
  • An engineered or non-engineered ⁇ T-cell population can comprise, for example, fewer than 90% ⁇ 1 T-cells, fewer than 80% ⁇ 1 T-cells, fewer than 70% ⁇ 1 T-cells, fewer than 60% ⁇ 1 T-cells, fewer than 50% ⁇ 1 T-cells, fewer than 40% ⁇ 1 T-cells, fewer than 30% ⁇ 1 T- cells, fewer than 20% ⁇ 1 T-cells, fewer than 10% ⁇ 1 T-cells, or fewer than 5% ⁇ 1 T-cells.
  • an engineered or non-engineered ⁇ T-cell population can comprise greater than 5% ⁇ 1 T-cells, greater than 10% ⁇ 1 T-cells, greater than 20% ⁇ 1 T-cells, greater than 30% ⁇ 1 T-cells, greater than 40% ⁇ 1 T-cells, greater than 50% ⁇ 1 T-cells, greater than 60% ⁇ 1 T-cells, greater than 70%) ⁇ 1 T-cells, greater than 80% ⁇ 1 T-cells, or greater than 90% ⁇ 1 T-cells.
  • the agent is one of the selective expansion agents described herein.
  • the agent is immobilized on a surface such as a cell culture surface, or a surface of an APC (e.g., expressed on the surface of the APC or bound to an Fc receptor expressed on the surface of the APC).
  • An engineered or non-engineered ⁇ T-cell population can comprise, for example, fewer than 90% ⁇ 2 T -cells, fewer than 80% ⁇ 2 T -cells, fewer than 70% ⁇ 2 T -cells, fewer than 60% ⁇ 2 T -cells, fewer than 50% ⁇ 2 T -cells, fewer than 40% ⁇ 2 T -cells, fewer than 30% ⁇ 2 T -cells, fewer than 20% ⁇ 2 T -cells, fewer than 10% ⁇ 2 T -cells, or fewer than 5% ⁇ 2 T -cells.
  • an engineered or non-engineered ⁇ T-cell population can comprise greater than 5% ⁇ 2 T -cells, greater than 10% 62 T-cells, greater than 20% ⁇ 2 T -cells, greater than 30% ⁇ 2 T -cells, greater than 40% ⁇ 2 T -cells, greater than 50% ⁇ 2 T -cells, greater than 60% ⁇ 2 T -cells, greater than 70% ⁇ 2 T -cells, greater than 80% ⁇ 2 T -cells, or greater than 90% ⁇ 2 T -cells.
  • An engineered or non-engineered ⁇ T-cell population can comprise, for example, fewer than 90% ⁇ 1 and ⁇ 4 T-cells, fewer than 80% ⁇ 1 and ⁇ 4 T-cells, fewer than 70% ⁇ 1 and ⁇ 4 T-cells, fewer than 60% ⁇ 1 and ⁇ 4 T-cells, fewer than 50% ⁇ 1 and ⁇ 4 T-cells, fewer than 40% ⁇ 1 and ⁇ 4 T-cells, fewer than 30% ⁇ 1 and ⁇ 4 T-cells, fewer than 20% ⁇ 1 and ⁇ 4 T-cells, fewer than 10% ⁇ 1 and ⁇ 4 T- cells, or fewer than 5% ⁇ 1 and ⁇ 4 T-cells.
  • an engineered or non-engineered ⁇ T-cell population can comprise greater than 5% ⁇ 1 and ⁇ 4 T-cells, greater than 10% ⁇ 1 and ⁇ 4 T-cells, greater than 20% ⁇ 1 and ⁇ 4 T-cells, greater than 30% ⁇ 1 and ⁇ 4 T-cells, greater than 40% ⁇ 1 and ⁇ 4 T-cells, greater than 50% ⁇ 1 and ⁇ 4 T-cells, greater than 60% ⁇ 1 and ⁇ 4 T-cells, greater than 70% ⁇ 1 and ⁇ 4 T-cells, greater than 80% ⁇ 1 and ⁇ 4 T-cells, or greater than 90% ⁇ 1 and ⁇ 4 T-cells.
  • An engineered or non-engineered ⁇ T-cell population can comprise, for example, fewer than
  • an engineered or non-engineered ⁇ T-cell population can comprise greater than 5% ⁇ 1 and ⁇ 4 T-cells, greater than 10% ⁇ 1 and ⁇ 4 T-cells, greater than 20% ⁇ 1 and ⁇ 4 T-cells, greater than 30% ⁇ 1 and ⁇ 4 T-cells, greater than 40% ⁇ 1 and ⁇ 4 T-cells, greater than 50% ⁇ 1 and ⁇ 4 T-cells, greater than 60% ⁇ 1 and ⁇ 4 T-cells, greater than 70% ⁇ 1 and ⁇ 4 T-cells, greater than 80% ⁇ 1 and ⁇ 4 T-cells, or greater than 90% ⁇ 1 and ⁇ 4 T-cells.
  • An engineered or non-engineered ⁇ T-cell population can comprise, for example, fewer than 90% ⁇ 1 and ⁇ 4 T-cells, fewer than 80% ⁇ 1 and ⁇ 4 T-cells, fewer than 70% ⁇ 1 and ⁇ 4 T- cells, fewer than 60% ⁇ 1 and ⁇ 4 T-cells, fewer than 50% ⁇ 1 and ⁇ 4 T-cells, fewer than 40% ⁇ 1 and 64 T-cells, fewer than 30% ⁇ 1 and ⁇ 4 T-cells, fewer than 20% ⁇ 1 and ⁇ 4 T-cells, fewer than 10% ⁇ 1 and ⁇ 4 T-cells, or fewer than 5% ⁇ 1 and ⁇ 4 T-cells.
  • the present invention provides admixtures of expanded ⁇ T-cell populations comprising 10-90%> ⁇ 1 T-cells and 90-10%> -ce ⁇ l2ls T. In certain embodiments, the present invention provides admixtures of expanded ⁇ T-cell populations comprising 10-90%) 51 and 53 T-cells and 90-10% ⁇ 2 T-cells. In certain embodiments, the present invention provides admixtures of expanded ⁇ T-cell populations comprising 10-90%> 51 and ⁇ 4 T-cells and 90-10% 52 T-cells. In certain embodiments, the present invention provides admixtures of expanded ⁇ T-cell populations comprising 10-90% ⁇ 1, 63, 54 and ⁇ 5 T-cells and 90-10% - ⁇ c2el Tls.
  • One or more activation agent can contact the ⁇ T-cells (for example an activator ⁇ T cell innate receptor) and thereafter a costimulatory molecule can contact the ⁇ T-cells to provide further stimulation and to expand the ⁇ T-cells.
  • the activation agent and/or costimulatory agent can be lectins of plant and non-plant origin, monoclonal antibodies that activate ⁇ T-cells, and other non-lectin/ non- antibody agents.
  • the plant lectin can be concanavalin A (ConA) although other plant lectins such as may be used.
  • lectins include protein peanut agglutinin (PNA), soybean agglutinin (SBA), les culinaris agglutinin (LCA), pisum sativum agglutinin (PSA), Helix pomatia agglutinin (HP A), Vicia graminea Lectin (VGA), Phaseolus Vulgaris Erythroagglutinin (PHA-E), Phaseolus Vulgaris Leucoagglutinin (PHA-L), Sambucus Nigra Lectin (SNA, EBL), Maackia Amurensis, Lectin II (MAL II), Sophora Japonica Agglutinin (SJA), Dolichos Biflorus Agglutinin (DBA), Lens Culinaris Agglutinin (LCA), Wisteria Floribunda Lectin (WFA, WFL).
  • PNA protein peanut agglutinin
  • SBA soybean agglutin
  • Non-limiting examples of activating agents and costimulatory molecules include any one or more antibodies selective for a ⁇ or ⁇ -chain or subtypes thereof described herein, antibodies such as 5A6.E9, Bl, TS8.2, 15D, B6, B3, TS-1, ⁇ 3.20, 7A5, IMMU510, R9.12, 1 1 F2, or a combination thereof.
  • Other examples of activating agents and costimulatory molecules include zoledronate, phorbol 12-myristate- 13 -acetate (TPA), mezerein, staphylococcal enterotoxin A (SEA),
  • streptococcal protein A or a combination thereof.
  • the activation agent and/or costimulatory agent can be, antibodies or iigands to a TCR, ⁇ I CR, ⁇ I CR, 6 I CR, CD277, CD28, CD46, CD81, CTLA4, ICOS, PD-1, CD30, NKG2D, KG2A, HVEM, 4-1 BB (CD137), OX40 (CD134), CD70, CD80, CD86, DAP, CD122, GITR, FcsRIy, CD1, CD 16, CD 1 ⁇ 1, DNAX, accessory molecule- 1 (DNAM-1), one or more NCRs (e.g., Kp30, Kp44, Kp46), SLAM, Coxsackie virus and adenovirus receptor or a combination thereof.
  • Engineered ⁇ T-cells may be generated with various methods known in the art.
  • An engineered ⁇ T-cell may be designed to stably express a particular tumor recognition moiety.
  • a polynucleotide encoding an expression cassette that comprises a tumor recognition, or another type of recognition moiety, can be stably introduced into the ⁇ T-cell by a
  • transposon/transposase system or a viral -based gene transfer system such as a lentiviral or a retroviral system, or another suitable method, such as transfection, el ectrop oration, transduction, lipofection, calcium phosphate (CaP0 4 ), nanoengineered substances, such as Ormosil, viral delivery methods, including adenoviruses, retroviruses, lentiviruses, adeno-associated viruses, or another suitable method.
  • An antigen specific TCR can be introduced into the engineered ⁇ T-cell by stably inserting a polynucleotide comprising a genetic code for the antigen specific TCR into the genome of the ⁇ T-cell.
  • a polynucleotide encoding a CAR with a tumor recognition moiety may be introduced into the engineered ⁇ T-cell by stably inserting the polynucleotide into the genome of the ⁇ T-cell.
  • the engineered tumor recognition moiety is an
  • engineered ⁇ T-cell comprises a polynucleotide encoding an engineered TCR a (TCR alpha) gene, an engineered TCR ⁇ (TCR beta) gene, an TCR ⁇ (TCR delta) gene, or an engineered TCR ⁇ (TCR gamma) gene.
  • TCR alpha an engineered TCR alpha
  • TCR beta an engineered TCR ⁇
  • TCR delta an engineered TCR ⁇
  • TCR gamma the expression cassette incorporated into the genome of the
  • the engineered ⁇ T-cell comprises a polynucleotide encoding an antibody fragment or an antigen binding portion thereof.
  • the antibody fragment or antigen binding fragment thereof is a polynucleotide encoding a whole antibody, an antibody fragment, a single-chain variable fragment (scFv), a single domain antibody (sdAb), a Fab, F(ab) 2 , an Fc, the light or heavy chains on an antibody, the variable or the constant region of an antibody, or any combination thereof that binds to a cell surface tumor antigen as part of the Chimeric Antigen Receptor (CAR) construct, or a bi- specific construct, comprising a CAR and a T-cell receptor (TCR), or CARs with antibodies directed to different antigens.
  • CAR Chimeric Antigen Receptor
  • the polynucleotide is derived from a human or from another species.
  • An antibody fragment or antigen binding fragment polynucleotide that is derived from a non-human species can be modified to increase their similarity to antibody variants produced naturally in humans, and an antibody fragment or antigen binding fragment can be partially or fully humanized.
  • An antibody fragment or antigen binding fragment polynucleotide can also be chimeric, for example a mouse-human antibody chimera.
  • An engineered ⁇ T-cell that expresses a CAR can also be engineered to express a ligand to the antigen recognized by the tumor recognition moiety.
  • RNA-guided Cas9 nuclease from the microbial clustered regularly interspaced short palindromic repeats (CRISPR) system, zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), and meganuclease technologies, as described, respectively by WO201409370, WO2003087341, WO2014134412, and WO2011090804, each of which is incorporated by reference herein in its entireties, can be used to provide efficient genome engineering in ⁇ T-cell(s).
  • CRISPR microbial clustered regularly interspaced short palindromic repeats
  • ZFNs zinc finger nucleases
  • TALENs transcription activator-like effector nucleases
  • the technologies described herein can also be used to insert the expression cassette into a genomic location that simultaneously provides a knockout of one gene and a knock-in of another gene.
  • a polynucleotide comprising an expression cassette of the disclosure can be inserted into a genomic region that encodes for an MHC gene.
  • Such engineering can simultaneously provide the knock-in of one or more genes, e.g. the genes comprised in the expression cassette, and a knock-out of another gene, e.g. an MHC locus.
  • a Sleeping Beauty transposon that includes a nucleic acid coding for the tumor recognition moiety is introduced into the cell ⁇ T-cell that is being engineered.
  • a mutant Sleeping Beauty transposase that provides for enhanced integration as compared to the wild-type Sleeping Beauty, such as the transposase described in US 7,985,739, which is incorporated by reference herein in its entirety, may be used to introduce a polynucleotide in the engineered ⁇ T-cell.
  • a viral method is used to introduce a polynucleotide comprising a tumor recognition moiety into the genome of an engineered ⁇ T-cell.
  • a number of viral methods have been used for human gene therapy, such as the methods described in WO 1993020221, which is incorporated herein in its entirety.
  • Non-limiting examples of viral methods that can be used to engineer a ⁇ T-cell include retroviral, adenoviral, lentiviral, herpes simplex virus, vaccinia virus, pox virus, or adeno-virus associated viral methods.
  • a polynucleotide containing the genetic code for a tumor recognition moiety may comprise mutations or other transgenes that affect the growth, proliferation, activation status of the engineered ⁇ T-cell or an antigen specific to tumor cells such as testis-specific cancer antigens.
  • a ⁇ T-cell of the disclosure may be engineered to express a polynucleotide comprising an activation domain that is linked to the antigen recognition moiety, such as a molecule in TCR-CD3 complex or a co- stimulatory factor.
  • An engineered ⁇ T-cell can express an intracellular signaling domain that is a T- lymphocyte activation domain.
  • the ⁇ T-cell may be engineered to express an intracellular activation domain gene or an intracellular signaling domain.
  • the intracellular signaling domain gene may be, for example ⁇ 3 ⁇ , CD28, CD2, ICOS, JAML, CD27, CD30, OX40, KG2D, CD4, OX40/CD134, 4-1BB/CD137, FcsRLy, IL-2RB/CD 122, IL- 2RG/CD132, DAP molecules, CD70, cytokine receptor, CD40, or any combination thereof.
  • the engineered ⁇ T-cell is also engineered to express a cytokine, an antigen, a cellular receptor, or other immunomodulatory molecule.
  • a tumor recognition moiety is a TCR.
  • a tumor recognition moiety is a receptor to a ligand that is expressed on a cancer cell.
  • suitable receptors include NKG2D, NKG2A, NKG2C, NKG2F, LLT1, AICL, CD26, NKRPl, CD244 (2B4), DNAM-1, NKp30, NKp44, NKp46, and NKp80.
  • a tumor recognition moiety can include a ligand, e.g. IL-13 ligand, or a ligand mimetic to the tumor antigen, such as the IL-13 mimetic to IL13R.
  • a ⁇ T-cell may be engineered to express a chimeric tumor recognition moiety comprising a ligand binding domain derived from NKG2D, NKG2A, NKG2C, NKG2F, LLT1, AICL, CD26, NKRPl, CD244 (2B4), DNAM-1, or an anti -tumor antibody such as anti-Her2neu or anti-EGFR and a signaling domain obtained from CD3- ⁇ Dap 10, Dap 12, CD28, 41BB, and CD40L.
  • a chimeric tumor recognition moiety comprising a ligand binding domain derived from NKG2D, NKG2A, NKG2C, NKG2F, LLT1, AICL, CD26, NKRPl, CD244 (2B4), DNAM-1, or an anti -tumor antibody such as anti-Her2neu or anti-EGFR and a signaling domain obtained from CD3- ⁇ Dap 10, Dap 12, CD28, 41BB, and CD40L.
  • the chimeric receptor binds MICA, MICB, Her2neu, EGFR, EGFRvIII, mesothelin, CD38, CD20, CD19, BCMA, PSA, RON, CD30, CD22, CD37, CD38, CD56, CD33, CD138, CD123, CD79b, CD70, CD75, CA6, GD2, alphafetoprotein (AFP), CS1, carcinoembryonic antigen (CEA), CEACAM5, CA-125, MUC-16, 5T4, NaPi2b, ROR1, ROR2, PLIF, Her2/Neu, EGFRvIII, GPMNB, LTV-1, glycolipidF77,fibroblast activation protein (FAP), PSMA, STEAP-1, STEAP-2, c-Met, CSPG4, CD44v6, PVRL-4, VEGFR2, C4.4a, PSCA, folate binding protein/receptor, SLC44A4, Cripto, CTAG1B, AXL, IL-13
  • MAGEA4 KKLC1, mutated ras (H, N, K), BRaf, p53, ⁇ -catenin, EGFRT790, MHC class I chain- related molecule A (MICA), or MHC class I chain-related molecule B (MICB), or one or more antigens of HP V, CMV, or EB V.
  • MICA MHC class I chain- related molecule A
  • MICB MHC class I chain-related molecule B
  • the tumor recognition moiety targets an MHC class I molecule (HLA-A, HLA-B, or HLA-C) in complex with a tumor-associated peptide.
  • MHC class I molecule HLA-A, HLA-B, or HLA-C
  • Methods and compositions for generating and using tumor recognition moieties that target a tumor-associated peptide in complex with a MHC class I molecule include those described in Weidanz et al., Int. Rev. Immunol. 30:328- 40, 2011; Scheinberg et al, Oncotarget. 4(5):647-8, 2013; Cheever et al, Clin. Cancer Res.
  • the targeted tumor-associated peptide of the peptide MHC complex is a peptide of Wilms' tumor protein 1 (WTl), human telom erase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 (CYP1B), KRAS, or BRAF.
  • WTl Wilms' tumor protein 1
  • hTERT human telom erase reverse transcriptase
  • MDM2 mouse double minute 2 homolog
  • CYP1B cytochrome P450
  • KRAS KRAS
  • Two or more tumor recognition moieties may be expressed in the ⁇ T-cell from genetically different, substantially different, or substantially identical, ⁇ TCR polynucleotides stably expressed from the engineered ⁇ T-cell or from genetically distinct ⁇ TCR polynucleotides stably incorporated in the engineered ⁇ T-cell.
  • ⁇ TCR(s) recognizing different antigens associated with the same condition may be utilized.
  • a ⁇ T-cell is engineered to express different TCRs, from human or mouse origin, from one or more expression cassettes that recognize the same antigen in the context of different MHC haplotypes.
  • a ⁇ T-cell is engineered to express one TCR and two or more antibodies directed to the same or different peptides from a given antigen complexed with different MHC haplotypes.
  • expression of a single TCR by an engineered ⁇ T-cell facilitates proper TCR pairing.
  • An engineered ⁇ T-cell that expresses different TCRs can provide a universal allogeneic engineered ⁇ T-cell.
  • a ⁇ T-cell is engineered to express one or more different antibodies directed to peptide-MHC complexes, each directed to the same or different peptide complexed with the same or different MHC haplotypes.
  • a tumor recognition moiety can be an antibody that binds to peptide-MHC complexes.
  • a ⁇ T-cell can be engineered to express TCRs from one or more expression cassettes that recognize the same antigen in the context of different MHC haplotypes.
  • an engineered ⁇ T-cell is designed to express a single TCR, or a TCR in combination with a CAR to minimize the likelihood of TCR mispairing within the engineered cell.
  • the tumor recognition moieties expressed from two or more expression cassettes preferably have different polynucleotide sequences, and encode tumor recognition moieties that recognize different epitopes of the same target, e.g., in the context of different HLA haplotypes.
  • An engineered ⁇ T-cell that expresses such different TCRs or CARs can provide a universal allogeneic engineered ⁇ T-cell.
  • a ⁇ T-cell is engineered to express one or more tumor recognition moieties.
  • Two or more tumor recognition moieties may be expressed from genetically identical, or substantially identical, antigen-specific chimeric (CAR) polynucleotides engineered in the ⁇ T-cell.
  • Two or more tumor recognition moieties may be expressed from genetically distinct CAR polynucleotides engineered in the ⁇ T-cell.
  • the genetically distinct CAR(s) may be designed to recognize different antigens associated with the same condition.
  • a ⁇ T-cell may alternatively be bi-specific.
  • a bi-specific engineered ⁇ T-cell can express two or more tumor recognition moieties.
  • a bi-specific engineered ⁇ T-cell can express both TCR and CAR tumor recognition moieties.
  • a bi-specific engineered ⁇ T-cell can be designed to recognize different antigens associated with the same condition.
  • An engineered ⁇ T-cell can express two or more CAR/TCR(s) bi-specific polynucleotides that recognize an identical or substantially identical antigen.
  • An engineered ⁇ T-cell can express two or more CAR/TCR(s) bi- specific constructs that recognize distinct antigens.
  • a bi-specific construct of the disclosure binds to an activating and an inactivating domain of a target cell, thereby providing increased target specificity.
  • the ⁇ T-cell may be engineered to express at least 1 tumor recognition moiety, at least 2 tumor recognition moieties, at least 3 tumor recognition moieties, at least 4 tumor recognition moieties, at least 5 tumor recognition moieties, at least 6 tumor recognition moieties, at least 7 tumor recognition moieties, at least 8 tumor recognition moieties, at least 9 tumor recognition moieties, at least 10 tumor recognition moieties, at least 11 tumor recognition moieties, at least 12 tumor recognition moieties, or another suitable number of tumor recognition moieties.
  • Proper TCR function may be enhanced by two functioning ⁇ (zeta) proteins comprising ITAM motifs. Proper TCR function may also be enhanced by expression of ⁇ or ⁇ activation domains, such as ⁇ 3 ⁇ , CD28, CD2, CTLA4, ICOS, JAML, PD-1, CD27, CD30, 41-BB, OX40, KG2D, HVEM, CD46, CD4, FcsRIy, IL-2RB/CD122, IL-2RG/CD132, DAP molecules, and CD70.
  • the expressed polynucleotide may include the genetic code for a tumor recognition moiety, a linker moiety, and an activation domain.
  • Translation of the polynucleotide by the engineered ⁇ T-cell may provide a tumor recognition moiety and an activation domain linked by a protein linker.
  • the linker comprises amino acids that do not obstruct the folding of the tumor recognition moiety and the activation domain.
  • a linker molecule can be at least about 5 amino acids, about 6 amino acids, about 7 amino acids, about 8 amino acids, about 9 amino acids, about 10 amino acids, about 11 amino acids, about 12 amino acids, about 13 amino acids, about 14 amino acids, about 15 amino acids, about 16 amino acids, about 17 amino acids, about 18 amino acids, about 19 amino acids, or about 20 amino acids in length. In some cases, at least 50%, at least 70% or at least 90% of the amino acids in the linker are serine or glycine.
  • an activation domain can comprise one or more mutations. Suitable mutations may be, for example, mutations that render an activation domain constitutively active. Altering the identity of one or more nucleic acids changes the amino acid sequence of the translated amino acid.
  • a nucleic acid mutation can be made such that the encoded amino acid is modified to a polar, non- polar, basic or acidic amino acid.
  • a nucleic acid mutation can be made such that the tumor recognition moiety is optimized to recognize an epitope from a tumor.
  • the engineered tumor recognition moiety, an engineered activation domain, or another engineered component of a ⁇ T- cell may include more than 1 amino acid mutation, 2 amino acid mutations, 3 amino acid mutations, 4 amino acid mutations, 5 amino acid mutations, ⁇ amino acid mutations, 7 amino acid mutations, 8 amino acid mutations, 9 amino acid mutations, 10 amino acid mutations, 11 amino acid mutations, 12 amino acid mutations, 13 amino acid mutations, 14 amino acid mutations, 15 amino acid mutations, 16 amino acid mutations, 17 amino acid mutations, 18 amino acid mutations, 19 amino acid mutations, 20 amino acid mutations, 21 amino acid mutations, 22 amino acid mutations, 23 amino acid mutations, 24 amino acid mutations, 25 amino acid mutations, 26 amino acid mutations, 27 amino acid mutations, 28 amino acid mutations, 29 amino acid mutations, 30 amino acid mutations, 31 amino acid mutations, 32 amino acid mutations, 33 amino acid mutations, 34 amino acid mutations, 35 amino acid mutations, 36 amino acid mutations, 37 amino acid mutations,
  • a ⁇ T-cell of the disclosure does not express one or more MHC molecules. Deletion of one or more MHC loci in an engineered ⁇ T-cell can decrease the likelihood that the engineered ⁇ T-cell will be recognized by the host immune system.
  • the human Major The human Major
  • HLA loci known as the human leukocyte antigen (HLA) system, comprises a large gene family that is expressed in antigen presenting cells, including ⁇ T-cells.
  • the HLA- A, HLA-B, and HLA-C molecules function to present intracellular peptides as antigens to antigen presenting cells.
  • the HLA-DP, HLA-DM, HLA-DOA, HLA-DOB, HLA-DQ, and HLA- DR molecules function to present extracellular peptides as antigens to antigen presenting cells.
  • An engineered ⁇ T-cell described herein can be further engineered to lack, or to disrupt gene expression of one or more HLA genes.
  • An engineered ⁇ T-cell described herein can be further engineered to lack, or to disrupt gene expression of one or more components of the MHC complex, such as complete deletion of one or more of the MHC genes, deletion of specific exons, or deletion of the ⁇ 2 microglobulin (B2m).
  • Genetic excision or genetic disruption of at least one HLA gene can provides a clinically therapeutic ⁇ T-cell that can be administered to a subject with any HLA haplotype without causing host-versus-graft disease.
  • An engineered ⁇ T-cell as described herein can be a universal donor for a human subject with any HLA haplotype.
  • a ⁇ T-cell can be engineered to lack one or various HLA locus (loci).
  • An engineered ⁇ T- cell can be engineered to lack an HLA-A allele, an HLA-B allele, an HLA-C allele, an HLA-DR allele, an HLA-DQ allele, or an HLA-DP allele.
  • an HLA allele is associated with a human condition, such as an auto-immune condition.
  • the HLA-B27 allele has been associated with arthritis and uveitis
  • the HLA-DR2 allele has been associated with systemic lupus erythematosus
  • multiple sclerosis the HLA-DR3 allele has been associated with 21 -hydroxylase deficiency
  • the HLA-DR4 has been associated with rheumatoid arthritis and type 1 diabetes.
  • An engineered ⁇ T-cell that lacks, for example, the HLA-B27 allele can be administered to a subject afflicted with arthritis without being readily recognized the immune system of the subject.
  • deletion of one or more HLA loci provides an engineered ⁇ T-cell that is a universal donor for any subject with any HLA haplotype.
  • engineering a ⁇ T-cell requires the deletion of a portion of the ⁇ T-cell genome.
  • the deleted portion of the genome comprises a portion of the MHC locus (loci).
  • the engineered ⁇ T-cell is derived from a wild-type human ⁇ T-cell, and the MHC locus is an HLA locus.
  • the deleted a portion of the genome comprises a portion of a gene corresponding to a protein in the MHC complex.
  • the deleted portion of the genome comprises the ⁇ 2 microglobulin gene.
  • the deleted portion of the genome comprises an immune checkpoint gene, such as PD-1, CTLA-4, LAG3, ICOS, BTLA, KIR, TEVI3, A2aR, B7-H3, B7-H4, and CECAM-1.
  • an engineered ⁇ T-cell can be designed to express an activation domain that enhances T-cell activation and cytotoxicity.
  • activation domains that can be expressed by an engineered ⁇ T-cell include: CD2, ICOS, 4-1 BB (CD137), OX40 (CD134), CD27, CD70, CD80, CD86, DAP molecules, CD122, GITR, FcsRIy.
  • Non-limiting examples of genomic regions that can be deleted or disrupted in the genome of an ⁇ T-cell include a promoter, an activator, an enhancer, an exon, an intron, a non-coding RNA, a micro-RNA, a small-nuclear RNA, variable number tandem repeats (VNTRs), short tandem repeat (STRs), SNP patterns, hypervariable regions, mini satellites, dinucleotide repeats, trinucleotide repeats, tetranucleotide repeats, or simple sequence repeats.
  • VNTRs variable number tandem repeats
  • STRs short tandem repeat
  • the deleted a portion of the genome ranges between 1 nucleic acid to about 10 nucleic acids, 1 nucleic acid to about 100 nucleic acids, 1 nucleic acid to about 1,000 nucleic acids, 1 nucleic acid to about 10,000 nucleic acids, 1 nucleic acid to about 100,000 nucleic acids, 1 nucleic acid to about 1,000,000 nucleic acids, or other suitable range.
  • HLA gene expression in an engineered ⁇ T-cell can also be disrupted with various techniques known in the art.
  • large loci gene editing technologies are used to excise a gene from the engineered ⁇ T-cell genome, or to disrupt gene expression of at least one HLA locus in the engineered ⁇ T-cell.
  • Non-limiting examples of gene editing technologies that can be used to edit a desired locus on a genome of an engineered ⁇ T-cell include Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)-Cas, zinc finger nucleases (ZFNs), Transcription activator-like effector nucleases (TALENs), and meganuclease technologies, as described, respectively by WO201409370, WO2003087341, WO2014134412, and WO 2011090804, and each of which is incorporated by reference herein in its entireties.
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • ZFNs zinc finger nucleases
  • TALENs Transcription activator-like effector nucleases
  • meganuclease technologies as described, respectively by WO201409370, WO2003087341, WO2014134412, and WO 2011090804, and each of which is incorporated by reference herein in its entireties.
  • a ⁇ T-cell may be engineered from an isolated non-engineered ⁇ T-cell that already expresses a tumor recognition moiety.
  • the engineered ⁇ T-cell can retain a tumor cell recognition moiety that is endogenously expressed by the isolated wild-type ⁇ T-cell, e.g., isolated from tumor infiltrating lymphocytes of a tumor sample.
  • the engineered ⁇ T-cell tumor cell recognition moiety replaces the wild-type ⁇ TCR.
  • a ⁇ T-cell can be engineered to express one or more homing molecules, such as a lymphocyte homing molecule.
  • Homing molecules can be, for instance, lymphocyte homing receptors or cell adhesion molecules.
  • a homing molecule can help an engineered ⁇ T-cell to migrate and infiltrate a solid tumor, including a targeted solid tumor upon administration of the engineered ⁇ T- cell to the subject.
  • Non-limiting examples of homing receptors include members of the CCR family, e g: CCR2, CCR4, CCR7, CCR8, CCR9, CCR10, CLA, CD44, CD103, CD62L, E-selectin, P- selectin, L-selectin, integrins, such as VLA-4 and LFA-1.
  • Non -limiting examples of cell adhesion molecules include ICAM, N-CAM, VCAM, PE-CAM, Ll-CAM, Nectins (PVRL1, PVRL2,
  • cell adhesion molecules include calcium dependent molecules, such as T-cadherin, and antibodies to matrix metaloproteinases (MMPs) such as MMP9 or MMP2.
  • MMPs matrix metaloproteinases
  • T-cell maturation, activation, proliferation, and function may be regulated through co-stimulatory and inhibitory signals through immune checkpoint proteins.
  • Immune checkpoints are co-stimulatory and inhibitory elements intrinsic to the immune system. Immune checkpoints aid in maintaining self-tolerance and modulating the duration and amplitude of physiological immune responses to prevent injury to tissues when the immune system responds to disease conditions, such as cell transformation or infection.
  • the equilibrium between the co- stimulatory and inhibitory signals used to control the immune response from either ⁇ and ⁇ T-cells can be modulated by immune checkpoint proteins.
  • Immune checkpoint proteins such as PD1 and CTLA4 are present on the surface of T-cells and can be used to turn an immune response "on" or "off.” Tumors can dysregulate checkpoint protein function as an immune-resistance mechanism, particularly against T-cells that are specific for tumor antigens.
  • An engineered ⁇ T-cell of the disclosure can be further engineered to lack one or more immune checkpoint locus (loci), such as PD-1, CTLA-4, LAG3, ICOS, BTLA, KIR, TIM3, A2aR, CEACAM1, B7-H3, and B7-H4.
  • loci immune checkpoint locus
  • an endogenous immune check point gene in an engineered ⁇ T-cell of the disclosure can be disrupted with gene editing technologies.
  • Immunological checkpoints can be molecules that regulate inhibitory signaling pathways (exemplified by CTLA4, PDl, and LAG3) or molecules that regulate stimulatory signaling pathways (exemplified by ICOS) in an engineered ⁇ T-cell of the disclosure.
  • Several proteins in the extended immunoglobulin superfamily can be ligands for immunological checkpoints.
  • Non-limiting examples of immune checkpoint ligand proteins include B7-H4, ICOSL, PD-L1, PD-L2, MegaCD40L, MegaOX40L, and CD137L.
  • immune checkpoint ligand proteins are antigens expressed by a tumor.
  • the immune checkpoint gene is a CTLA-4 gene.
  • the immune checkpoint gene is a PD-1 gene.
  • PDl is an inhibitory receptor belonging to the CD28/CTLA4 family and is expressed on activated T lymphocytes, B cells, monocytes, DCs, and T-regs.
  • T lymphocytes B cells
  • monocytes DCs
  • T-regs T-regs
  • ligands for PDl PD-L1 and PD-L2 which are expressed on T cells, APCs, and malignant cells function to suppress self-reactive lymphocytes and to inhibit the effector function of TAA-specific cytotoxic T lymphocytes (CTLs).
  • CTLs cytotoxic T lymphocytes
  • an engineered ⁇ T-cell that lacks PDl can retain its cytotoxic activity regardless of expression of PD-L1 and PD-L2 by tumor cells.
  • an engineered ⁇ T-cell of the disclosure lacks the gene locus for the PD-1 gene.
  • expression of the PD-1 gene in an engineered ⁇ T-cell is disrupted by gene editing technologies.
  • CTLA4 cytotoxic T-lymphocyte antigen 4
  • CD 152 Cluster of CD 152
  • CTLA4 shares sequence homology and ligands (CD80/B7-1 and CD86/B7-2) with the costimulatory molecule CD28, but differs by delivering inhibitory signals to T-cells expressing CTLA4 as a receptor.
  • CTLA4 has a much higher overall affinity for both ligands and can out-compete CD28 for binding when ligand densities are limiting.
  • CTLA4 is often expressed on the surface of CD8 + effector T-cells, and plays a functional role in the initial activation stages of both naive and memory T-cells.
  • CTLA4 counteracts the activity of CD28 via increased affinity for CD80 and CD86 during the early stages of T-cell activation.
  • CTLA4 The major functions of CTLA4 include down-modulation of helper T-cells and enhancement of regulatory T-cell immunosuppressive activity.
  • an engineered ⁇ T-cell of the disclosure lacks the CTLA4 gene.
  • expression of the CTLA4 gene in an engineered ⁇ T-cell is disrupted by gene editing technologies.
  • LAG3 (Lymphocyte-activation gene 3) is expressed on activated antigen-specific cytotoxic T-cells, and can enhance the function of regulatory T-cells and independently inhibit CD8 + effector T-cell activity.
  • LAG3 is a CD-4-like negative regulatory protein with a high affinity binding to MHC Class II proteins, which are upregulated on some epithelial cancers, leading to tolerance of T cell proliferation and homeostasis. Reduction of the LAG-3/Class II interaction using a LAG-3-IG fusion protein may enhance antitumor immune responses.
  • an engineered ⁇ T-cell of the disclosure lacks the gene locus for the LAG3gene. In some instances, expression of the
  • LAG3gene in an engineered ⁇ T-cell is disrupted by gene editing technologies.
  • An engineered ⁇ T-cell may home to a specific physical location in a subject's body.
  • cytokines including but not limited to CXCR3 (whose ligands are represented by IP-10/CXCLlO and
  • CCR4+ CXCR5+ may affect homing of engineered ⁇ T cells.
  • an engineered ⁇ T-cell may home to sites of inflammation and injury, and to diseased cells to perform repair functions.
  • an engineered ⁇ T-cell can home to a cancer.
  • an engineered ⁇ T-cell may home to a thymus, a bone marrow, a skin, a larynx, a trachea, pleurae, a lung, an esophagus, an abdomen, a stomach, a small intestine, a large intestine, a liver, a pancreas, a kidney, a urethra, a bladder, a testis, a prostate, a ductus deferens, am ovary, an uretus, a mary gland, a parathyroid gland, a spleen or another site in a subject's body.
  • An engineered ⁇ T-cell can express one or more homing moieties, such as particular TCR allele and/or a lymphocyte homing molecule.
  • An engineered ⁇ T-cell may have a particular phenotype and a phenotype can be described in terms of cell-surface marker expression.
  • Various types of ⁇ T-cells can be engineered as described herein.
  • the engineered ⁇ T-cell is derived from a human, but the engineered ⁇ T-cell may also be derived from a different source, such as a mammal or a synthetic cell.
  • the immunophenotype of the expanded cell populations may be determined using markers including but not limited to CD27, CD45RA, CD45RO, CCR7 and CD62L (Klebanoff et al., Immunol Rev.211 : 214 2006).
  • CD45RA is expressed on naive T lymphocytes, replaced by
  • CD45RO upon antigen encounter, but re-expressed in late effector cells (Michie et al., Nature 360, 264 - 265 (1992); CD62L is a cell adhesion molecule that acts as a homing molecule to enter secondary lymphoid tissues and is lost after T-cell activation, when T-cells acquire effector functions (Sallusto et al., Nature. 401 :708 (1999);. CD27 is costimulation markers that are lost during T-cell differentiations (Appay et al., Nat Med.8:379 (2002); Klebanoff et al., Immunol Rev.211 : 214 2006). Antigens
  • the invention disclosed herein provides an engineered ⁇ T-cell that expresses an antigen recognition moiety, wherein the antigen recognition moiety recognizes a disease-specific epitope.
  • An antigen may be a molecule that provokes an immune response. This immune response may involve either antibody production, the activation of specific immunologically-competent cells, or both.
  • An antigen may be, for example, a peptide, a protein, a hapten, a lipid, a carbohydrate, bacteria, a pathogen, or a virus.
  • An antigen may be a tumor antigen.
  • a tumor epitope may be presented by the MHC I or MHC II complexes on the surface of tumor cells.
  • An epitope can be the portion of the antigen that is expressed on the cell surface and recognized by the tumor recognition moiety.
  • Non-limiting examples of antigens recognized by an engineered ⁇ T-cell include CD 19,
  • CA6 GD2, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), RON, CEACAM5, CA-125, MUC-16, 5T4, NaPi2b, ROR1, ROR2, PLIF, Her2/Neu, EGFRvIII, GPMNB, LTV-1,
  • glycolipidF77 glycolipidF77,fibroblast activation protein (FAP), PSMA, STEAP-1, STEAP-2, mesothelin, c-Met, CSPG4, PVRL-4, VEGFR2, PSCA, CLEC12a, LI CAM, GPC2, GPC3, folate binding
  • An antigen can be expressed in the intracellular or the extracellular compartment of a cell and an engineered ⁇ T-cell can recognize an intracellular or an extracellular tumor antigen.
  • an ⁇ TCR in the engineered ⁇ T-cell recognizes a peptide derived from either an
  • an antigen may be a protein
  • An antigen may also be a protein intracellularly or extracellularly expressed by a cancerous cell.
  • An antigen recognition moiety may recognize an antigen from a cell in distress, such as a cancerous cell or a cell that has been infected with a virus.
  • a cell in distress such as a cancerous cell or a cell that has been infected with a virus.
  • the human MHC class I chain-related genes (MICA and MICB) are located within the HLA class I region of chromosome 6.
  • MICA and MICB proteins are considered to be markers of "stress" in the human epithelia, and act as ligands for cells expressing a common natural killer-cell receptor (NKG2D).
  • NSG2D common natural killer-cell receptor
  • MICA and MICB can be highly expressed from cancerous cells.
  • An engineered ⁇ T-cell can recognize a MICA or a MICB tumor epitope.
  • a tumor recognition moiety may be engineered to recognize an antigen with certain avidity.
  • a tumor recognition moiety encoded by a TCR or CAR construct may recognize an antigen with a dissociation constant of at least at least 10 fM, at least 100 fM, at least 1 picomolar (pM), at least 10 pM, at least 20 pM, at least 30 pM, at least 40 pM, at least 50 pM, at least 60 pM, at least 7 pM, at least 80 pM, at least 90 pM, at least 100 pM, at least 200 pM, at least 300 pM, at least 400 pM, at least 500 pM, at least 600 pM, at least 700 pM, at least 800 pM, at least 900 pM, at least 1 nanomolar (nM), at least 2 nM, at least 3 nM, at least 4 nM, at least 5 nM, at least 6 nM, at least 7 nM, at least 8 nM, at least 9 nM, at least 10
  • a tumor recognition moiety may be engineered to recognize an antigen with a dissociation constant of at most 10 fM, at most 100 fM, at most 1 picomolar (pM), at most 10 pM, at most 20 pM, at most 30 pM, at most 40 pM, at most 50 pM, at most 60 pM, at most 7 pM, at most 80 pM, at most 90 pM, at most 100 pM, at most 200 pM, at most 300 pM, at most 400 pM, at most 500 pM, at most 600 pM, at most 700 pM, at most 800 pM, at most 900 pM, at most 1 nanomolar (nM), at most 2 nM, at most 3 nM, at most 4 nM, at most 5 nM, at most 6 nM, at most 7 nM, at most 8 nM, at most 9 nM, at most 10 nM, at most 20
  • the inventors of the present invention have identified activation agents that bind specific subtypes of ⁇ TCRs and thereby activate specific populations of ⁇ T cells.
  • the invention provides novel activating agents which bind the novel activating epitopes identified and described herein in Examples 14, and 39, and FIGS 23-30, and 33-36.
  • Activation agents include, but are not limited to MAbs TS8.2, TS-1, 15D, B6, R9.12, ⁇ 1-05, ⁇ 1-08, ⁇ 1-18, ⁇ 1-22, ⁇ 1-23, ⁇ 1-26, ⁇ 1- 35, ⁇ 1-37, ⁇ 1-39, ⁇ 1-113, ⁇ 1-143, ⁇ 1-149, ⁇ 1-155, ⁇ 1-182, ⁇ 1-183, ⁇ 1-191, ⁇ 1-192, ⁇ 1-195, ⁇ 1-197, ⁇ 1-199, ⁇ 1-201, ⁇ 1-203, ⁇ 1-239, ⁇ 1-253, ⁇ 1-257, ⁇ 1-278, ⁇ 1-282, ⁇ 1-285, 52-14, 52-17, 52-22, 52-30, 52-31, 52-32, 52-33, 52-35, 52-36, and ⁇ 2-37.
  • activation agents further include, but are not limited to activation agents that bind the same epitope or compete with one or more MAbs selected from the group consisting of TS8.2, TS-1, 15D, B6, R9.12, ⁇ 1-05, ⁇ 1-08, ⁇ 1-18, ⁇ 1-22, ⁇ 1-23, ⁇ 1-26, ⁇ 1-35, ⁇ 1-37, ⁇ 1-39, ⁇ 1-113, ⁇ 1-143, ⁇ 1- 149, ⁇ 1-155, ⁇ 1-182, ⁇ 1-183, ⁇ 1-191, ⁇ 1-192, ⁇ 1-195, ⁇ 1-197, ⁇ 1-199, ⁇ 1-201, ⁇ 1-203, ⁇ 1-239, ⁇ 1- 253, ⁇ 1-257, ⁇ 1-278, ⁇ 1-282, ⁇ 1-285, 52-14, 52-17, 52-22, 52-30, 52-31, 52-32, 52-33, 52-35, 52-36, and ⁇ 2-37.
  • MAbs selected from the group consisting of TS8
  • activation agents further include, but are not limited to activation agents that contain the complementarity determining regions (CDRs) and/or variable regions of a MAb selected from the group consisting of TS8.2, TS-1, 15D, B6, R9.12, ⁇ 1-05, ⁇ 1-08, ⁇ 1-18, ⁇ 1-22, ⁇ 1-23, ⁇ 1-26, ⁇ 1- 35, ⁇ 1-37, ⁇ 1-39, ⁇ 1-1 13, ⁇ 1-143, ⁇ 1-149, ⁇ 1-155, ⁇ 1-182, ⁇ 1-183, ⁇ 1-191, ⁇ 1-192, ⁇ 1-195, ⁇ 1-197, ⁇ 1-199, ⁇ 1-201, ⁇ -203, ⁇ 1-239, ⁇ 1-253, ⁇ 1-257, ⁇ 1-278, ⁇ 1-282, ⁇ 1-285, ⁇ 2-14, ⁇ 2-17, ⁇ 2-22, ⁇ 2-30, ⁇ 2-31, ⁇ 2-32, ⁇ 2-33, ⁇ 2-35, ⁇ 2-36, and ⁇
  • the present invention also provides a nucleic acid encoding an activation agent that: (i) contains the complementarity determining regions (CDRs) and/or variable regions of; (ii) binds the same epitope as or competes with; or (iii) is a MAb selected from the group consisting of TS8.2, TS- 1, 15D, B6, R9.12, ⁇ 1-05, ⁇ 1-08, ⁇ 1-18, ⁇ 1-22, ⁇ 1 -23, ⁇ 1-26, ⁇ 1-35, ⁇ 1-37, ⁇ 1-39, ⁇ 1-1 13, ⁇ 1-143, ⁇ 1-149, ⁇ 1-155, ⁇ 1-182, ⁇ 1-183, ⁇ 1-191, ⁇ 1-192, ⁇ 1-195, ⁇ 1-197, ⁇ 1-199, ⁇ 1-201, ⁇ 1-203, ⁇ 1-239, ⁇ 1-253, ⁇ 1-257, ⁇ 1-278, ⁇ 1-282, ⁇ 1-285, ⁇ 2-14, ⁇ 2-17, ⁇ 2-2
  • the nucleic acid is in a host cell (e.g., a heterologous host cell). In some cases, the nucleic acid is operably linked to a heterologous promoter or operably linked to a nucleic acid encoding a heterologous polypeptide.
  • heterologous refers to two components that do not naturally exist together in nature.
  • the activating agent expands or activates one or more ⁇ T-cell populations (e.g., ⁇ 1 T-cells or ⁇ 2 T-cells).
  • the activating agent selectively activates ⁇ 1 and ⁇ 3 T-cells.
  • the activating agent selectively activates ⁇ 1 and ⁇ 4 T-cells.
  • the activating agent selectively activates ⁇ 1 T- cells.
  • the activating agent selectively activates ⁇ 1, ⁇ 3, ⁇ 5, and ⁇ 5 T-cells.
  • the activating agent selectively activates ⁇ 2 T-cells.
  • the present invention also provides methods of producing one or more of the foregoing activation agents.
  • a host cell containing a nucleic acid encoding an activation agent can be cultured to produce one or more of the foregoing activation agents.
  • APCs for expansion of engineered or non-engineered ⁇ T-cells, such as one or more subpopulations of ⁇ T-cells.
  • an APC that contains a heterologous nucleic acid encoding one or more of the foregoing activation agents.
  • described herein is an APC that expresses one or more of the foregoing activation agents on a cell surface.
  • described herein is an APC that expresses one or more Fc receptors on its cell surface, wherein the Fc receptor(s) are in contact with and/or bound to one or more of the foregoing activation agents.
  • the APCs do not express, or exhibit reduced expression of, ULA class I, ULA class I, invariant chain, and/or HLA-DM.
  • the APCs express adhesion molecules such as intercellular adhesion molecule- 1, CD1 la, CD 18, CD54, and/or leukocyte function-associated antigen-3.
  • the APCs express an Fc receptor, such as an Fc receptor that is specific for an isotype of an activation agent used in a ⁇ T- cell expansion method described herein.
  • the APCs express one or more Fc receptors selected from the group consisting of CD64, CD32A, CD32B, CD32C, CD 16 A, CD16B, FcRn, TRTM21, or CD307, or an engineered variant thereof having a higher affinity or altered specificity.
  • cultures comprising one or more of the foregoing APCs.
  • the culture can further contain expanded or unexpanded, engineered or non-engineered, ⁇ T-cells.
  • the culture can additionally or alternatively contain a selective or non-selective ⁇ T-cell activation agent including any one of the ⁇ T-cell activation agents described herein.
  • the culture does not contain IL-21.
  • the culture does not contain IL-4, IL-2, or IL-15, or a combination thereof.
  • the culture does not contain a cytokine that selectively expands a sub- population of ⁇ T cells.
  • the inventors of the present invention have identified binding regions within the epitope of ⁇ TCR activating MAbs TS8.2, TS-1, 15D, B6, R9.12, ⁇ 1-05, ⁇ 1-08, ⁇ 1-18, ⁇ 1-22, ⁇ 1-23, ⁇ 1-26, ⁇ 1-35, ⁇ 1-37, ⁇ 1-39, ⁇ 1-1 13, ⁇ 1-143, ⁇ 1-149, ⁇ 1-155, ⁇ 1-182, ⁇ 1-183, ⁇ 1-191, ⁇ 1-192, ⁇ 1-195, ⁇ 1- 197, ⁇ 1-199, ⁇ 1-201, ⁇ 1-203, ⁇ 1-239, ⁇ 1-253, ⁇ 1-257, ⁇ 1-278, ⁇ 1-282, ⁇ 1-285, 52-14, 52-17, 52-22, ⁇ 2-30, 52-31, 52-32, ⁇ 2-33, ⁇ 2-35, ⁇ 2-36, and ⁇ 2-37.
  • Exemplary epitopes include, but are not limited to, the epitopes of ⁇ TCR activating MAbs TS8.2, TS-1, 15D, B6, R9.12, ⁇ 1-05, ⁇ 1-08, ⁇ 1- 18, ⁇ 1-22, ⁇ 1-23, ⁇ 1-26, ⁇ 1-35, ⁇ 1-37, ⁇ 1-39, ⁇ 1-1 13, ⁇ 1-143, ⁇ 1-149, ⁇ 1-155, ⁇ 1-182, ⁇ 1-183, ⁇ 1- 191, ⁇ 1-192, ⁇ 1-195, ⁇ 1-197, ⁇ 1-199, ⁇ 1-201, ⁇ 1-203, ⁇ 1-239, ⁇ 1-253, ⁇ 1-257, ⁇ 1-278, ⁇ 1-282, ⁇ 1- 285, 52-14, 52-17, ⁇ 2-22, ⁇ 2-30, 52-31, 52-32, ⁇ 2-33, ⁇ 2-35, ⁇ 2-36, and ⁇ 2-37.
  • the epitope is an epitope specifically bound by one or more of ⁇ TCR activating MAbs TS8.2, TS-1, 15D, B6, R9.12, ⁇ 1-05, ⁇ 1-08, ⁇ 1-22, ⁇ 1-26, ⁇ 1-35, ⁇ 1-37, ⁇ 1-39, ⁇ 1-1 13, ⁇ 1- 143, ⁇ 1-149, ⁇ 1-155, ⁇ 1-182, ⁇ 1-183, ⁇ 1-191, ⁇ 1-192, ⁇ 1-195, ⁇ 1-197, ⁇ 1-199, ⁇ 1-201, ⁇ 1-203, ⁇ 1- 253, ⁇ 1-257, ⁇ 1-278, ⁇ 1-282, ⁇ 1-285, ⁇ 2-14, ⁇ 2-17, ⁇ 2-30, ⁇ 2-31, ⁇ 2-32, ⁇ 2-33, ⁇ 2-35, ⁇ 2-36, and ⁇ 2-37.
  • the disclosure provides a method for identifying the epitope of an agent that stimulates the expansion of engineered and non-engineered ⁇ T-cells at a fast rate of growth.
  • An epitope can include at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids in a unique spatial conformation.
  • Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids can be typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding can be typically lost on treatment with denaturing solvents.
  • Epitope mapping can be performed to identify the linear or non-linear, discontinuous amino acid sequence(s), i.e. the epitope, that is (e.g., specifically) recognized by an activating agent of interest, such as the TS8.2, 15D, B6, TS-1, and R9.12, antibodies.
  • an activating agent of interest such as the TS8.2, 15D, B6, TS-1, and R9.12, antibodies.
  • a general approach for epitope mapping can require the expression of the full- length polypeptide sequence that is recognized by an antibody or ligand of interest, as well as various fragments, i.e., truncated forms of the polypeptide sequence, generally in a heterologous expression system.
  • polypeptide sequences or fragments thereof e.g., fused with an N-terminal protein (e.g., GFP)
  • an N-terminal protein e.g., GFP
  • the recombinant polypeptide sequences are chimeras containing joined fragments of two or more homologous parental polypeptides, wherein at least one parental polypeptide binds to the activating agent of interest and at least one parental polypeptide does not bind to the activating agent of interest.
  • segments of a human ⁇ 1 chain can gene be joined with segments of a homologous dolphin ⁇ chain gene, and tested for the ability to generate a chimeric TCR in a recombinant expression system.
  • Chimeric TCR genes that form a TCR as e.g., indicated by detection with a pan-y6-TCR antibody on a cell surface, can then be tested for binding to the activation agent of interest.
  • segments of a human ⁇ 2 chain can gene be joined with segments of a homologous macaque ⁇ chain gene, and tested for the ability to generate a chimeric TCR in a recombinant expression system.
  • Chimeric TCR genes that form a TCR as e.g., indicated by detection with a pan-y6-TCR antibody on a cell surface, can then be tested for binding to the activation agent of interest.
  • a library of epitopes can be created by synthetically designing various possible
  • ⁇ T-cell receptor ⁇ TCR
  • a plurality of ⁇ 1 gene segments differing in their J ⁇ region can be synthetically designed, including J ⁇ 1, J ⁇ 2 and J ⁇ 3 gene segments.
  • V ⁇ 3J ⁇ 1 chains can also be ordered as synthetic genes and cloned into suitable vectors.
  • a plurality of synthetically cloned ⁇ TCR chains such as V ⁇ 1J ⁇ 1, V ⁇ 1J ⁇ 2, V ⁇ 1J ⁇ 3, V ⁇ 1J ⁇ 4, V ⁇ 2 and V ⁇ 3, chains can be co-transfected into a host system with synthetically cloned ⁇ TCR chains such as Vy2, Vy3, Vy4,Vy5,Vy8, Vy9 and Vy10 synthetically designed gene segments.
  • ⁇ TCR chains such as V ⁇ 1J ⁇ 1, V ⁇ 1J ⁇ 2, V ⁇ 1J ⁇ 3, V ⁇ 1J ⁇ 4, V ⁇ 2 and V ⁇ 3, chains can be amplified out of Total RNA extracted from human PBMCs or ⁇ T-cells isolated from human normal and malignant tissue.
  • the host system can be any suitable expression system such as 293 cells, insect cells, or a suitable in-vitro translation system.
  • the plurality of various possible recombinations of synthetically designed ⁇ T-cell segments transfected into a host system can provide, for instance, more than 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, or 90 possible pairing combinations of ⁇ TCRs.
  • the binding of an agent to one of the epitopes in the previously described library can be detected by contacting a labeled antibody, such as TS8.2, 15D, B6, TS-1, and R9.12, with an epitope of the library and detecting a signal from the label
  • Conformational epitopes can be identified by determining spatial conformation of amino acids with methods that include, e.g., x-ray crystallography and 2-dimensional nuclear magnetic resonance.
  • Some epitope mapping methods such as, x-ray analyses of crystals of antigen: antibody complexes can provide atomic resolution of the epitope.
  • computational combinatorial methods for epitope mapping can be employed to model a potential epitope based on the sequence of the antibody, such as TS-1 antibody or TS8.2 antibody. In such cases, the antigen binding portion of the antibody is sequenced, and computation models are used to reconstruct and predict a potential binding site of the antibody.
  • the disclosure provides a method of determining an epitope of a ⁇ T-cell receptor, comprising: (a) preparing a library of epitopes from the ⁇ T-cell receptor; (b) contacting the library of epitopes with an antibody; and (b) identifying the amino acid sequence of at least one epitope in the library of epitopes that is bound by the antibody.
  • the antibody is selected from the group consisting of, TS8.2, 15D, B6, TS-1, and R9.12, antibodies. In one instance, the antibody is attached to a solid support.
  • the library of epitopes can comprise sequences that correspond to continuous and discontinuous epitopes of a T-cell receptor, such as a ⁇ TCR or a ⁇ TCR.
  • the library of epitopes comprises fragments from a ⁇ T-cell receptor ranging from about 10 amino acids to about 30 amino acids in length, from about 10 amino acids to about 20 amino acids in length, or from about 5 amino acids to about 12 amino acids in length.
  • the antibody is labeled and the label is a radioactive molecule, a luminescent molecule, a fluorescent molecule, an enzyme, or biotin.
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 47-70 of human ⁇ 1 (SKEMIFLIRQ GSDEQNA) and Jl (TDKLIFGKGTRVTVEP) or J2 (LTAQLFFGKGTQLIVEP), wherein the activating agent does not bind an epitope containing a K120T mutation in Jl or J2.
  • This epitope is referred to herein as a Bin 1 ⁇ 1 epitope.
  • Exemplary activating agents that bind a Bin 1 ⁇ 1 epitope include but are not limited to TS-1 ; and ⁇ 1-18.
  • a human ⁇ 1 J region can vary due to (D)(J) recombination, an exemplary ⁇ 1 J region of a ⁇ 1 chain of a ⁇ TCR having the Bin 1 ⁇ 1 epitope is SKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGTGVRGLQD TDKLIFGKGTRVTVEP; and another exemplary ⁇ 1 J region Bin 1 ⁇ 1 epitope of a ⁇ 1 chain of a ⁇ TCR is SKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGEAPSAWGK HLT AQLFF GKGTQLI VEP .
  • activating agents that bind a Bin 1 ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the activating agents that bind a Bin 1 ⁇ 1 epitope can also bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 47-70 of human V ⁇ 1 (SKEMTFLIRQ GSDEQNA) and Jl (TDKLIFGKGTRVTVEP), wherein the activating agent does not bind an epitope containing a K120T mutation in Jl .
  • This epitope is referred to herein as a Bin lb ⁇ 1 epitope.
  • Exemplary activating agents that bind a Bin lb ⁇ 1 epitope include but are not limited to ⁇ 1-37.
  • An exemplary V ⁇ 1 J region of a ⁇ 1 chain of a ⁇ TCR having the Bin lb ⁇ 1epitope is
  • activating agents that bind a Bin lb ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the activating agents that bind a Bin lb ⁇ 1 epitope also do not bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 1 1-21 of human V ⁇ 1 (VSMPVRKAVTL). This epitope is referred to herein as a Bin 2 ⁇ 1 epitope.
  • exemplary activating agents that bind a Bin 2 ⁇ 1 epitope include but are not limited to and ⁇ 1-285.
  • activating agents that bind a Bin 2 ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 1 1-21 of human V ⁇ 1 (VSMPVRKAVTL), wherein the activating agent that binds this epitope does not bind an epitope containing a mutation of R16 in V ⁇ 1, such as an R16N mutation.
  • This epitope is referred to herein as a Bin 2b ⁇ 1 epitope.
  • Exemplary activating agents that bind a Bin 2b ⁇ 1 epitope include but are not limited to R9.12.
  • activating agents that bind a Bin 2b ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 1 1-21 of human V ⁇ 1 (VSMPVRKAVTL), wherein the activating agent that binds this epitope also binds (cross-reacts) with ⁇ 3, 54, and ⁇ 5 ⁇ TCRs.
  • This epitope is referred to herein as a Bin 2c ⁇ 1 epitope.
  • Exemplary activating agents that bind a Bin 2c ⁇ 1 epitope include but are not limited to ⁇ 1-39.
  • activating agents that bind a Bin 2c ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 80-95 of human V ⁇ 1
  • Bin 3 ⁇ 1 epitope exemplary activating agents that bind a Bin 3 ⁇ 1 epitope include but are not limited to ⁇ 1-08; and ⁇ 1-23.
  • activating agents that bind a Bin 3 ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 1-1 1 of human V ⁇ 1 (AQKVTQAQSSV) and Jl or J2.
  • This epitope is referred to herein as a Bin 4 ⁇ 1 epitope.
  • the Bin 4 ⁇ 1 epitope binding activating agent does not bind an epitope containing a K120T mutation in Jl or J2.
  • Exemplary activating agents that bind a Bin 4 ⁇ 1 epitope include but are not limited to ⁇ 1-35; and ⁇ 1-203.
  • activating agents that bind a Bin 4 ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • activating agents that bind a Bin 4 ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 28-47 of human V ⁇ 1
  • This epitope is referred to herein as a Bin 5 ⁇ 1 epitope.
  • Exemplary activating agents that bind a Bin 5 ⁇ 1 epitope include but are not limited to ⁇ -1 13; ⁇ 1- 155; ⁇ 1-183; ⁇ 1-191 ; ⁇ 1-278; and ⁇ 1-282.
  • An exemplary V ⁇ 1 Jl region of a ⁇ 1 chain of a ⁇ TCR having the Bin 5 ⁇ 1 epitope is
  • activating agents that bind a Bin 5 ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of: AQKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQ NAKSGRYSV FKKAAKSVALTISALQLEDSAKYFCALGTGVRGLQDTDKLIFGKGTRVTVE
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 21-28 of human V ⁇ 1 (LNCLYETS) and Jl .
  • This epitope is referred to herein as a Bin 6 ⁇ 1 epitope.
  • Exemplary activating agents that bind a Bin 6 ⁇ 1 epitope include but are not limited to TS 8.2 and ⁇ 1-143.
  • An exemplary V ⁇ 1 Jl region of a ⁇ 1 chain of a ⁇ TCR having the Bin 6 ⁇ 1 epitope is
  • activating agents that bind a Bin 6 ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 47-70 of human V ⁇ 1
  • Bin 7 ⁇ 1 epitope This epitope is referred to herein as a Bin 7 ⁇ 1 epitope.
  • Exemplary activating agents that bind a Bin 7 ⁇ 1 epitope include but are not limited to ⁇ 1-149; ⁇ 1- 253, and ⁇ 1-257.
  • An exemplary V ⁇ 1 J region of a ⁇ 1 chain of a ⁇ TCR having the Bin 7 ⁇ 1epitope is
  • activating agents that bind a Bin 7 ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 70-80 of human V ⁇ 1 (AKSGRYSV F) and Jl or J2.
  • This epitope is referred to herein as a Bin 8 ⁇ 1 epitope.
  • Exemplary activating agents that bind a Bin 8 ⁇ 1 epitope include but are not limited to ⁇ 1-192.
  • An exemplary V ⁇ 1 J region of a ⁇ 1 chain of a ⁇ TCR having the Bin 8 ⁇ 1 epitope is
  • Bin 8 ⁇ 1 epitope of a ⁇ 1 chain of a ⁇ TCR is
  • activating agents that bind a Bin 8 ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 80-95 of human ⁇ 1
  • Bin 9 ⁇ 1 epitope This epitope is referred to herein as a Bin 9 ⁇ 1 epitope.
  • exemplary activating agents that bind a Bin 9 ⁇ 1 epitope include but are not limited to ⁇ 1-201.
  • activating agents that bind a Bin 9 ⁇ 1 epitope bind a ⁇ 1 chain of a ⁇ TCR having the sequence of:
  • ⁇ 1 -specific antibodies described herein selectively bind ⁇ 1 -containing ⁇ -TCRs over 52- containing ⁇ -TCRs. As such, the foregoing ⁇ 1-specific antibodies do not bind, e.g., the sequence of and/or a ⁇ -TCR comprising the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 83-94 of human ⁇ 2 (AK LAVLKILAP).
  • This epitope is referred to herein as a Bin 1 ⁇ 2 epitope.
  • the activating agent that binds the Bin 1 ⁇ 2 epitope does not bind an epitope containing a mutation of K90 in ⁇ 2, such as an K90N mutation.
  • Exemplary activating agents that bind a Bin 1 ⁇ 2 epitope include but are not limited to 52- 17, and B6.
  • activating agents that bind a Bin 1 ⁇ 2 epitope bind a ⁇ 2 chain of a ⁇ TCR having the sequence of
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 28-38 of human ⁇ 2 (EAIGNYY). This epitope is referred to herein as a Bin 2 ⁇ 2 epitope.
  • the activating agent that binds the Bin 2 52 epitope does not bind an epitope containing a mutation of G35 in V ⁇ 2, such as an G35S mutation.
  • Exemplary activating agents that bind a Bin 2 52 epitope include but are not limited to 15D.
  • activating agents that bind a Bin 2 52 epitope bind a 52 chain of a ⁇ TCR having the sequence of:
  • the epitope that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 72-83 of human V ⁇ 2 (KD FQGDIDIA).
  • This epitope is referred to herein as a Bin 3 52 epitope.
  • Exemplary activating agents that bind a Bin 3 52 epitope include but are not limited to 52-32.
  • activating agents that bind a Bin 3 52 epitope bind a 52 chain of a ⁇ TCR having the sequence of:
  • the epitope, that is (e.g., specifically) recognized by an activating agent of interest is an epitope comprised of amino acids 1-27 of human ⁇ 2
  • Bin 4 ⁇ 2 epitope This epitope is referred to herein as a Bin 4 ⁇ 2 epitope.
  • exemplary activating agents that bind a Bin 4 ⁇ 2 epitope include but are not limited to 52-14; 52-22; ⁇ 2-30; 62-31 ; ⁇ 2-36; and ⁇ 2-37.
  • activating agents that bind a Bin 4 ⁇ 2 epitope bind a ⁇ 2 chain of a ⁇ TCR having the sequence of:
  • the 52-specific antibodies described herein selectively bind ⁇ 2-containing ⁇ -TCRs over ⁇ 1- containing ⁇ -TCRs. As such, the foregoing 52-specific antibodies do not bind, e.g., the sequence of and/or a ⁇ -TCR comprising the sequence of:
  • the ⁇ 1- and 52-specific antibodies described herein recognize a conformational epitope in the context of a ⁇ -TCR.
  • the ⁇ 1- and ⁇ 2-specific antibodies described herein are specific for one or more pairs of ⁇ 1- or ⁇ 2- TCRs respectively.
  • the ⁇ 1- specific antibodies described herein are specific for a ⁇ -TCR.
  • the ⁇ 1- specific antibodies described herein bind ⁇ -TCR but not y9 ⁇ 1-TCR.
  • compositions containing a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, as described herein may be administered for prophylactic and/or therapeutic treatments.
  • the compositions can be administered to a subject already suffering from a disease or condition in an amount sufficient to cure or at least partially arrest the symptoms of the disease or condition.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, can also be administered to lessen a likelihood of developing, contracting, or worsening a condition.
  • Effective amounts of a population of a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, for therapeutic use can vary based on the severity and course of the disease or condition, previous therapy, the subject's health status, weight, and/or response to the drugs, and/or the judgment of the treating physician.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and /or admixtures thereof, of the disclosure can be used to treat a subject in need of treatment for a condition.
  • conditions include cancer, infectious disease, autoimmune disorder and sepsis.
  • Subjects can be humans, non-human primates such as chimpanzees, and other apes and monkey species; farm animals such as cattle, horses, sheep, goats, swine; domestic animals such as rabbits, dogs, and cats; laboratory animals including rodents, such as rats, mice and guinea pigs, and the like.
  • a subject can be of any age.
  • Subjects can be, for example, elderly adults, adults, adolescents, pre-adolescents, children, toddlers, infants.
  • a method of treating a condition (e.g., ailment) in a subject with an enriched ⁇ T-cell population of the instant invention may comprise administering to the subj ect a therapeutically- effective amount of a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T- cell population, and/or admixtures thereof.
  • An enriched ⁇ T-cell population, and/or admixtures thereof, of the disclosure may be administered at various regimens (e.g., timing, concentration, dosage, spacing between treatment, and/or formulation).
  • a subject can also be preconditioned with, for example, chemotherapy, radiation, or a combination of both, prior to receiving a an enriched ⁇ T-cell population and/or admixtures thereof, of the disclosure.
  • a non- engineered, enriched ⁇ T-cell population, an engineered , enriched ⁇ T-cell population, and/or admixtures thereof may be administered to a subj ect at a first regimen and the subject may be monitored to determine whether the treatment at the first regimen meets a given level of therapeutic efficacy.
  • the engineered ⁇ T-cell or another engineered ⁇ T-cell may be administered to a subj ect at a first regimen and the subject may be monitored to determine whether the treatment at the first regimen meets a given level of therapeutic efficacy.
  • the engineered ⁇ T-cell or another engineered ⁇ T-cell may be
  • FIG. 2 schematically illustrates a method for treating a subject.
  • a first operation 201 at least one engineered ⁇ T-cell is administered to a subject that has or is suspected of having a given condition (e.g., cancer).
  • the engineered ⁇ T-cell may be administered at a first regimen.
  • the subject may be monitored, for example by a healthcare provider (e.g., treating physician or nurse).
  • the subject is monitored to determine or gauge an efficacy of the engineered ⁇ T-cell in treating the condition of the subject.
  • the subject may also be monitored to determine the in vivo expansion of a ⁇ T-cell population in the subject.
  • a third operation 203 at least one other engineered ⁇ T-cell is administered to the subject at a second regimen.
  • the second regimen may be the same as the first regimen or different than the first regimen.
  • the third operation 203 is not performed, for example, if the administration of the engineered ⁇ T-cell in the first operation 201 is found to be effective (e.g., a single round of administration may be sufficient to treat the condition). Due to their allogeneic and universal donor characteristics, a population of engineered ⁇ T-cells may be administrated to various subjects, with different MHC haplotypes. An engineered ⁇ T-cell may be frozen or cryopreserved prior to being administered to a subject.
  • a enriched population of ⁇ T-cells may also be frozen or cryopreserved prior to being administered to a subject.
  • a population of engineered, enriched ⁇ T-cells can comprise two or more cells that express identical, different, or a combination of identical and different tumor recognition moieties.
  • a population of engineered, enriched ⁇ T-cells can comprises several distinct engineered ⁇ T-cells that are designed to recognize different antigens, or different epitopes of the same antigen.
  • human cells afflicted with melanoma can express the NY-ESO-1 oncogene.
  • FIG. 3 schematically illustrates a method for treating a subject with a population of engineered ⁇ T-cells that recognizes different epitopes of the melanoma antigen NY-ESO-1.
  • a population of engineered ⁇ T-cells that recognize different epitopes of the same antigen is selected.
  • the population of engineered ⁇ T-cells may comprise two or more cells that expressing different tumor recognition moieties that recognize different portions of the NY-ESO-1 protein.
  • the population of engineered ⁇ T-cells may be administered at a first regimen.
  • the subject may be monitored, for example by a healthcare provider (e.g., treating physician or nurse).
  • An enriched ⁇ T-cell population i.e., non-engineered or engineered, and/or admixtures thereof, of the disclosure may be used to treat various conditions.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the disclosure may be used to treat a cancer, including solid tumors and hematologic malignancies.
  • Non-limiting examples of cancers include: acute lymphoblastic leukemia, acute myeloid leukemia, adrenocortical carcinoma, AIDS-related cancers, AIDS-related lymphoma, anal cancer, appendix cancer, astrocytomas, neuroblastoma, basal cell carcinoma, bile duct cancer, bladder cancer, bone cancers, brain tumors, such as cerebellar astrocytoma, cerebral astrocytoma/malignant glioma, ependymoma, medulloblastoma, supratentorial primitive neuroectodermal tumors, visual pathway and hypothalamic glioma, breast cancer, bronchial adenomas, Burkitt lymphoma, carcinoma of unknown primary origin, central nervous system lymphoma, cerebellar astrocytoma, cervical cancer, childhood cancers, chronic lymphocytic leukemia, chronic myelogenous leukemia, chronic myeloproliferative disorders, colon cancer,
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the disclosure may be used to treat an infectious disease.
  • An infectious disease may be caused, for example, by a pathogenic bacterium or by a virus.
  • Various pathogenic proteins, nucleic acids, lipids, or fragments thereof can be expressed by a diseased cell.
  • An antigen presenting cell can internalize such pathogenic molecules, for instance with phagocytosis or by receptor-mediated endocytosis, and display a fragment of the antigen bound to an appropriate MHC molecule. For instance, various 9 mer fragments of a pathogenic protein may be displayed by an APC.
  • Engineered, enriched ⁇ T-cell populations of the disclosure may be designed to recognize various antigens and antigen fragments of a pathogenic bacterium or a virus.
  • pathogenic bacteria can be found in the: a) Bordetella genus, such as Bordetella pertussis species; b) Borrelia genus, such Borrelia burgdorferi species; c) Brucella genus, such as Brucella abortus, Brucella canis, Brucela meliterisis, and/or Brucella suis species; d) Campylobacter genus, such as Campylobacter jejuni species; e) Chlamydia and Chlamydophila genuses, such as Chlamydia pneumonia, Chlamydia trachomatis, and/or Chlamydophila psittaci species; f)
  • Clostridium genus such as Clostridium botulinum, Clostridium difficile, Clostridium perfringens, Clostridium tetani species; g) Corynebacterium genus, such as Corynebacterium diphtheria species; h) Enterococcus genus, such as Enterococcus faecalis, and/or Enterococcus faecium species; i) Escherichia genus, such as Escherichia coli species; j) Francisella genus, such as Francisella tularensis species; k) Haemophilus genus, such as Haemophilus influenza species; 1) Helicobacter genus, such as Helicobacter pylori species; m) Legionella genus, such as Legionella pneumophila species; n) Leptospira genus, such as Leptospira interrogans species; o) Listeria genus,
  • Staphylococcus genus such as Staphylococcus aureus, Staphylococcus epidermidis, and/or
  • Staphylococcus saprophyticus species x) Streptpcoccus genus, such as Streptococcus agalactiae, Streptococcus pneumonia, and/or Streptococcus pyogenes species; y) Treponema genus, such as Treponema pallidum species; z) Vibrio genus, such as Vibrio cholera; and/or aa) Yersinia genus, such as Yersinia pestis species.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the disclosure may be used to treat an infectious disease, an infectious disease may be caused a virus.
  • viruses can be found in the following families of viruses and are illustrated with exemplary species: a) Adenoviridae family, such as Adenovirus species; b) Herpesviridae family, such as Herpes simplex type 1, Herpes simplex type 2, Varicella-zoster virus, Epstein-barr virus, Human cytomegalovirus, Human herpesvirus type 8 species; c) Papillomaviridae family, such as Human papillomavirus species; d) Polyomaviridae family, such as BK virus, JC virus species; e) Poxviridae family, such as Smallpox species; f) Hepadnaviridae family, such as Hepatitis B virus species; g) Parvoviridae family, such as Human bocavirus, Parvovirus B19 species; h) Astroviridae family, such as Human astrovirus species; i) Caliciviridae family, such as Norwalk virus species
  • Respiratory syncytial virus Human metapneumovirus, Hendra virus and/or Nipah virus species
  • r Rhabdoviridae genus, such as Rabies virus species
  • s Reoviridae family, such as Rotavirus
  • Orbivirus, Coltivirus and/or Banna virus species are unassigned to a viral family, such as Hepatitis D.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the disclosure may be used to treat an immune disease, such as an autoimmune disease.
  • an immune disease such as an autoimmune disease.
  • Inflammatory diseases, including autoimmune diseases are also a class of diseases associated with B- cell disorders.
  • immune diseases or conditions include: rheumatoid arthritis, rheumatic fever, multiple sclerosis, experimental autoimmune encephalomyelitis, psoriasis, uveitis, diabetes mellitus, systemic lupus erythematosus (SLE), lupus nephritis, eczema, scleroderma, polymyositis/scleroderma,
  • polymyositis/dermatomyositis uncerative protitis, severe combined immunodeficiency (SCID), DiGeorge syndrome, ataxia-telangiectasia, seasonal allergies, perennial allergies, food allergies, anaphylaxis, mastocytosis, allergic rhinitis, atopic dermatitis, Parkinson's, Alzheimer's, hypersplenism, leukocyte adhesion deficiency, X-linked lymphoproliferative disease, X-linked agammaglobulinemia, selective immunoglobulin A deficiency, hyper IgM syndrome, HIV, autoimmune lymphoproliferative syndrome, Wiskott-Aldrich syndrome, chronic granulomatous disease, common variable immunodeficiency (CVID), hyperimmunoglobulin E syndrome,
  • thrombocytopenia purpura dermatomyositis, Sydenham'a chorea, myasthenia gravis, polyglandular syndromes, bullous pemphigoid, Henoch-Schonlein purpura, poststreptococcalnephritis, erythema nodosum, erythema multiforme, gA nephropathy, Takayasu's arteritis, Addison's disease, sarcoidosis, ulcerative colitis, polyarteritis nodosa, ankylosing spondylitis, Goodpasture's syndrome, thromboangitisubiterans, Sjogren's syndrome, primary biliary cirrhosis, Hashimoto's thyroiditis, thyrotoxicosis, chronic active hepatitis, polychondritis, pamphigus vulgaris, Wegener's
  • granulomatosis membranous nephropathy, amyotrophic lateral sclerosis, tabes dorsalis, giant cell arteritis,/polymyalgia, peraiciousanemia, rapidly progressive glomerulonephritis, psoriasis, fibrosing alveolitis, and cancer.
  • Treatment with a ⁇ T-cell population, and/or admixtures thereof, of the disclosure may be provided to the subject before, during, and after the clinical onset of the condition.
  • Treatment may be provided to the subject after 1 day, 1 week, 6 months, 12 months, or 2 years after clinical onset of the disease.
  • Treatment may be provided to the subject for more than 1 day, 1 week, 1 month, 6 months, 12 months, 2 years, 3 years, 4 years, 5 years, ⁇ years, 7 years, 8 years, 9 years, 10 years or more after clinical onset of disease.
  • Treatment may be provided to the subject for less than 1 day, 1 week, 1 month, 6 months, 12 months, or 2 years after clinical onset of the disease.
  • Treatment may also include treating a human in a clinical trial.
  • a treatment can comprise administering to a subject a pharmaceutical composition comprising a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixture thereof, of the disclosure.
  • administration of a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixture thereof, of the disclosure to a subject modulates the activity of endogenous lymphocytes in a subject's body.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixture thereof, of the disclosure modulates the activity of endogenous lymphocytes in a subject's body.
  • administration of the non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T- cell population, and/or admixtures thereof, to a subject provides an antigen to an endogenous T-cell and may boost an immune response.
  • the memory T-cell is a CD4 T-cell.
  • the memory T-cell is a CD8 + T-cell.
  • administration of the non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, to a subject activates the cytotoxicity of another immune cell.
  • the other immune cell is a CD8+ T-cell.
  • the other immune cell is a Natural Killer T-cell.
  • administration of the non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, to a subject suppress a regulatory T-cell.
  • the regulatory T-cell is a Fox3+ Treg cell. In some cases, the regulatory T-cell is a Fox3- Treg cell.
  • Non-limiting examples of cells whose activity can be modulated by a non- engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the disclosure include: hematopioietic stem cells; B cells; CD4; CD8; red blood cells; white blood cells; dendritic cells, including dendritic antigen presenting cells;
  • leukocytes fibroblasts; macrophages; memory B cells; memory T-cells; monocytes; natural killer cells;
  • neutrophil granulocytes neutrophil granulocytes
  • T-helper cells neutrophil granulocytes
  • T-killer cells neutrophil granulocytes
  • a combination of cyclophosphamide with total body irradiation is conventionally employed to prevent rejection of the hematopietic stem cells (HSC) in the transplant by the subject's immune system.
  • HSC hematopietic stem cells
  • incubation of donor bone marrow with interleukin-2 (IL-2) ex vivo is performed to enhance the generation of killer lymphocytes in the donor marrow.
  • Interleukin-2 (IL-2) is a cytokine that is necessary for the growth, proliferation, and differentiation of wild-type lymphocytes.
  • Current studies of the adoptive transfer of ⁇ T-cells into humans may require the co-administration of ⁇ T-cells and interleukin-2.
  • the disclosure provides a method for administrating a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, to a subject without the co-administration of a cytokine, such as IL-2, IL-15, IL-12, or IL-21.
  • a cytokine such as IL-2, IL-15, IL-12, or IL-21.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof can be administered to a subject without co-administration with IL-2.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof is administered to a subject during a procedure, such as a bone marrow transplant without the co-administration of IL-2.
  • One or multiple non-engineered, enriched ⁇ T-cell population, engineered, enriched ⁇ T- cell population, and/or admixtures thereof, of the invention can be administered to a subject in any order or simultaneously. If simultaneously, the multiple non-engineered, enriched ⁇ T-cell population, engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the invention can be provided in a single, unified form, such as an intravenous injection, or in multiple forms, for example, as multiple intravenous infusions, s.c, injections or pills.
  • the non-engineered, enriched ⁇ T-cell population, engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the invention can be packed together or separately, in a single package or in a plurality of packages.
  • One or all of the non-engineered, enriched ⁇ T-cell population, engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the invention can be given in multiple doses. If not simultaneous, the timing between the multiple doses may vary to as much as about a week, a month, two months, three months, four months, five months, six months, or about a year.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the invention can expand within a subject's body, in vivo, after administration to a subject.
  • Non-engineered, enriched ⁇ T-cell population, engineered, enriched ⁇ T-cell population, and/or admixtures thereof can be frozen to provide cells for multiple treatments with the same cell preparation.
  • Non-engineered, enriched ⁇ T-cell population, engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the disclosure, and pharmaceutical compositions comprising the same can be packaged as a kit.
  • a kit may include instructions (e.g., written instructions) on the use of the non-engineered, enriched ⁇ T-cell population, the engineered, enriched ⁇ T-cell population, and/or admixtures thereof, and compositions comprising the same.
  • a method of treating a cancer comprises administering to a subject a therapeutically-effective amount of a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, wherein the administration treats the cancer.
  • the therapeutically-effective amount of the non-engineered, enriched ⁇ T-cell population, the engineered, enriched ⁇ T-cell population, and/or admixtures thereof is administered for at least about 10 seconds, 30 seconds, 1 minute, 10 minutes, 30 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, ⁇ hours, 12 hours, 24 hours, 2 days, 3 days, 4 days, 5 days, ⁇ days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, ⁇ months, or 1 year.
  • the therapeutically-effective amount of the non-engineered, enriched ⁇ T-cell population, the engineered, enriched ⁇ T-cell population, and/or admixtures thereof is administered for at least one week. In some embodiments the therapeutically-effective amount of the non- engineered, enriched ⁇ T-cell population, the engineered, enriched ⁇ T-cell population, and/or admixtures thereof, is administered for at least two weeks.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, described herein can be administered before, during, or after the occurrence of a disease or condition, and the timing of administering a pharmaceutical composition containing a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, can vary.
  • the non-engineered, enriched ⁇ T-cell population, the engineered, enriched ⁇ T-cell population, and/or admixtures thereof can be used as a prophylactic and can be administered continuously to subjects with a propensity to conditions or diseases in order to lessen a likelihood of the occurrence of the disease or condition.
  • the non-engineered, enriched ⁇ T-cell population, the engineered, enriched ⁇ T-cell population, and/or admixtures thereof can be administered to a subject during or as soon as possible after the onset of the symptoms.
  • the administration of the non-engineered, enriched ⁇ T-cell population, the engineered, enriched ⁇ T-cell population, and/or admixtures thereof, can be initiated immediately within the onset of symptoms, within the first 3 hours of the onset of the symptoms, within the first 6 hours of the onset of the symptoms, within the first 24 hours of the onset of the symptoms, within 48 hours of the onset of the symptoms, or within any period of time from the onset of symptoms.
  • the initial administration can be via any route practical, such as by any route described herein using any formulation described herein.
  • the administration of a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the disclosure is an intravenous administration.
  • One or multiple dosages of a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, can be administered as soon as is practicable after the onset of a cancer, an infectious disease, an immune disease, sepsis, or with a bone marrow transplant, and for a length of time necessary for the treatment of the immune disease, such as, for example, from about 24 hours to about 48 hours, from about 48 hours to about 1 week, from about 1 week to about 2 weeks, from about 2 weeks to about 1 month, from about 1 month to about 3 months.
  • one or multiple dosages of a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof can be administered years after onset of the cancer and before or after other treatments.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof can be administered for at least about 10 minutes, 30 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, ⁇ hours, 12 hours, 24 hours, at least 48 hours, at least 72 hours, at least 96 hours, at least 1 week, at least 2 weeks, at least 3 weeks, at least 4 weeks, at least 1 month, at least 2 months, at least 3 months, at least 4 months, at least 5 months, at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, at least 12 months, at least 1 year, at least 2 years at least 3 years, at least 4 years, or at least 5 years.
  • the length of treatment can vary for each subject.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, as disclosed herein may be formulated in unit dosage forms suitable for single administration of precise dosages.
  • the unit dosage forms comprise additional lymphocytes.
  • the formulation is divided into unit doses containing appropriate quantities of one or more compounds.
  • the unit dosage can be in the form of a package containing discrete quantities of the formulation. Non-limiting examples are packaged tablets or capsules, and powders in vials or ampoules.
  • Aqueous suspension compositions can be packaged in single-dose non-reclosable containers. Multiple-dose reclosable containers can be used, for example, in combination with a preservative or without a preservative.
  • the pharmaceutical composition does not comprise a preservative.
  • Formulations for parenteral injection can be presented in unit dosage form, for example, in ampoules, or in multi-dose containers with a preservative.
  • a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, as described herein may be present in a composition in an amount of at least 5 cells, at least 10 cells, at least 20 cells, at least 30 cells, at least 40 cells, at least 50 cells, at least 60 cells, at least 70 cells, at least 80 cells, at least 90 cells, at least 100 cells, at least 200 cells, at least 300 cells, at least 400 cells, at least 500 cells, at least 600 cells, at least 700 cells, at least 800 cells, at least 900 cells, at least 1 x 10 3 cells, at least 2 x 10 3 cells, at least 3 x 10 3 cells, at least 4 x 10 3 cells, at least 5 x 10 3 cells, at least 6 x 10 3 cells, at least 7 x 10 3 cells, at least 8 x 10 3 cells, at least 9 x 10 3 cells, at least 1 x 10 4 cells, at least 2 x 10 4 cells, at least 3 x 10 4
  • the therapeutically effective dose of a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the invention can be from about 1 cell to about 10 cells, from about 1 cell to about 100 cells, from about 1 cell to about 10 cells, from about 1 cell to about 20 cells, from about 1 cell to about 30 cells, from about 1 cell to about 40 cells, from about 1 cell to about 50 cells, from about 1 cell to about 60 cells, from about 1 cell about 70 cells, from about 1 cell to about 80 cells, from about 1 cell to about 90 cells, from about 1 cell to about 100 cells, from about 1 cell to about 1 x 10 3 cells, from about 1 cell to about 2 x 10 3 cells, from about 1 cell to about 3 x 10 3 cells, from about 1 cell to about 4 x 10 3 cells, from about 1 cell to about 5 x 10 3 cells, from about 1 cell to about 6 x 10 3 cells, from about 1 cell to about 7 x 10 3 cells, from about 1 cell to about 8
  • the therapeutically effective dose of a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the invention can be from about 1 x 10 3 cells to about 2 x 10 3 cells, from about 1 x 10 3 cells to about 3 x 10 3 cells, from about 1 x 10 3 cells to about 4 x 10 3 cells, from about 1 x 10 3 cells to about 5 x 10 3 cells, from about 1 x 10 3 cells to about 6 x 10 3 cells, from about 1 x 10 3 cells to about 7 x 10 3 cells, from about 1
  • 3 3 3 3 3 3 3 3 3 x 10 cells to about 8 x 10 cells from about 1 x 10 cells to about 9 x 10 cells, from about 1 x 10 cells to about 1 x 10 4 cells, from about 1 x 10 3 cells to about 2 x 10 4 cells, from about 1 x 10 3 cells to about 3 x 10 4 cells, from about 1 x 10 3 cells to about 4 x 10 4 cells, from about 1 x 10 3 cells to about 5 x 10 4 cells, from about 1 x 10 3 cells to about 6 x 10 4 cells, from about 1 x 10 3 cells to about 7 x 10 4 cells, from about 1 x 10 3 cells to about 8 x 10 4 cells, from about 1 x 10 3 cells to about 9 x 10 4 cells, from about 1 x 10 3 cells to about 1 x 10 5 cells, from about 1 x 10 3 cells to about 2 x 10 5 cells, from about 1 x 10 3 cells to about 3 x 10 5 cells, from about 1 x 10 3 cells to about 4 x 10 5 cells
  • 8 3 8 3 8 3 8 x 10 cells from about 1 x 10 cells to about 6 x 10 cells, from about 1 x 10 cells to about 7 x 10 cells, from about 1 x 10 3 cells to about 8 x 10 8 cells, from about 1 x 10 3 cells to about 9 x 10 8 cells, or from about 1 x 10 3 cells to about 1 x 10 9 cells.
  • the therapeutically effective dose of a non-engineered, enriched ⁇ T-cell population, an engineered, enriched ⁇ T-cell population, and/or admixtures thereof, of the invention can be from about 1 x 10 6 cells to about 2 x 10 6 cells, from about 1 x 10 6 cells to about 3 x 10 6 cells, from about 1 x 10 6 cells to about 4 x 10 6 cells, from about 1 x 10 6 cells to about 5 x 10 6 cells, from about 1 x 10 6 cells to about 6 x 10 6 cells, from about 1 x 10 6 cells to about 7 x 10 6 cells, from about 1 x 10 6 cells to about 8 x 10 6 cells, from about 1 x 10 6 cells to about 9 x 10 6 cells, from about 1 x 10 6 cells to about 1 x 10 7 cells, from about 1 x 10 6 cells to about 2 x 10 7 cells, from about 1 x 10 6 cells to about 3 x 10 7 cells, from about 1 x 10 6 cells to about 4 x 10 7
  • enriched ⁇ T-cell populations, and/or admixtures thereof may be formulated in freezing media and placed in cryogenic storage units such as liquid nitrogen freezers (- 195C) or ultra-low temperature freezers (-65C, -80C or -120C) for long-term storage of at least about 1 month, 2 months, 3 months, 4 months, 5 months, ⁇ months, 1 year, 2 years, 3 years, or at least 5 years.
  • cryogenic storage units such as liquid nitrogen freezers (- 195C) or ultra-low temperature freezers (-65C, -80C or -120C) for long-term storage of at least about 1 month, 2 months, 3 months, 4 months, 5 months, ⁇ months, 1 year, 2 years, 3 years, or at least 5 years.
  • the freeze media can contain dimethyl sulfoxide (DMSO), and/or sodium chloride (NaCl), and/or dextrose, and/or dextran sulfate and/or hydroyethyl starch (HES) with physiological pH buffering agents to maintain pH between about 6.0 to about 6.5, about 6.5 to about 7.0, about 7.0 to about 7.5, about 7.5 to about 8.0 or about 6.5 to about 7.5.
  • DMSO dimethyl sulfoxide
  • NaCl sodium chloride
  • HES dextran sulfate and/or hydroyethyl starch
  • the cryopreserved ⁇ T-cells can be thawed and further processed by stimulation with antibodies, proteins, peptides, and/or cytokines as described herein.
  • cryopreserved ⁇ T-cells can be thawed and genetically modified with viral vectors (including retroviral and lentiviral vectors) or non-viral means (including RNA, DNA, and proteins) as described herein.
  • viral vectors including retroviral and lentiviral vectors
  • non-viral means including RNA, DNA, and proteins
  • non-engineered ⁇ T-cells can be expanded by the methods described herein, genetically modified, and cryopreserved.
  • genetically engineered and/or non-engineered ⁇ T-cells can be further provided.
  • cryopreserved to generate cell banks in quantities of at least about 1, 5, 10, 100, 150, 200, 500 vials at about at least 10 1 , 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , 10 7 , 10 8 , 10 9 , or at least about 10 10 cells per mL in freeze media.
  • the cryopreserved cell banks may retain their functionality and can be thawed and further stimulated and expanded.
  • thawed cells can be stimulated and expanded in suitable closed vessels such as cell culture bags and/or bioreactors to generate quantities of cells as allogeneic cell product.
  • Cryopreserved ⁇ T-cells can maintain their biological functions for at least about 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 13 months, 15 months, 18 months, 20 months, 24 months, 30 months, 36 months, 40 months, 50 months, or at least about 60 months under cryogenic storage condition. In some aspects, no preservatives are used in the formulation.
  • the cryopreserved ⁇ T-cells can be thawed and infused into multiple patients as allogeneic off-the-shelf cell product.
  • PBMCs Primary human peripheral blood mononuclear cells
  • the PBMCs are purified with the Ficolll-PaqueTM PLUS (GE Healthcare Bio-Sciences AB, Uppsala, Sweden) system or similar systems. The cells are then re- suspended in an appropriate growth medium.
  • Ficolll-PaqueTM PLUS GE Healthcare Bio-Sciences AB, Uppsala, Sweden
  • primary human cells are collected from peripheral blood, cord blood, bone marrow, healthy tissues, or tissues afflicted with a disease, such as cancerous tissues.
  • Fresh tissues from healthy donors are received from The Cooperative Human Tissue Network (CHTN) and are transported to the laboratory in RPMI-1640 media. Tissues are sliced into 1-3 mm 3 fragments with a scalpel. 2-5 fragments/well placed in a 24-well plate (Costar) in 2 mL RPMI-1640 supplemented with GlutaMAX, 25 mM HEPES pH 7.2, 100 U/ml penicillin, 100 U/ml streptomycin and 10% Human AB Serum and 100 IU/ ml of rhIL-2 or digested as described below. The plates are incubated in a humidified incubator at 37 C, with 5% CO 2 in air. Cultures are inspected every other day to monitor proliferation of lymphocytes. Half of the medium is replaced in all wells every 7 days after culture initiation. Lymphocytes are collected when a dense lymphocytic carpet covers the surrounding the fragments or lymphocyte population derived from digested tissues reached the proper concentration, as described below.
  • CHTN Cooperative Human
  • Lymphocytes were isolated by enzymatic digestion using two enzyme blend LiberaseTM DL Research Grade (Sigma Aldrich Co., St. Louis, MO), or LiberaseTM TM Research Grade (Sigma Aldrich Co., St. Louis, MO) or the Miltenyi tumor dissociation kit (130-095-929) with the gentleMACS Dissociator.
  • the tissues were cut into 2-3mm 3 fragments and digested for 1 hour at 37° C and 5% C02.
  • the digested cell suspension was passed through a 40-micron filter, spun down and washed with RPMI-1640 medium.
  • Cells were counted and re-suspended in RPMI medium (GIBCO BRL), supplemented with 10% Human AB serum(Corning) and 100 R7 / ml of rhIL-2.
  • the collected cell population was seeded at 0.5 to 1 X 10 6 cells/ml in 24-well tissue culture plates. Cells were split into RPMI-IL2 containing medium when cells exceeded concentration of 1.5 X 10 6 cells/ml. Culture of Tumor Specimens
  • CHTN Cooperative Human Tissue Network
  • the plates were incubated in a humidified incubator at 37° C, with 5% CO 2 in air. Cultures were inspected every other day to monitor proliferation of lymphocytes. Half of the medium was replaced in all wells every 7 days after culture initiation. Lymphocytes were collected when a dense lymphocytic carpet covers the surrounding the fragments. Fresh Tumor Specimens Enzymatic Digestion
  • CHTN Cooperative Human Tissue Network
  • the digested cell suspension was passed through a 40-micron filter, spun down and washed with RPMI-1640 medium. Cells were counted and re-suspended in RPMI medium (GIBCO BRL), supplemented with 10% Human AB Serum (Corning) and 100 IU/ml of rhIL-2. The collected cell population was seeded at 0.5 to 1 X 10 6 cells/ml in 24-well tissue culture plates. Cells were split into RPMI-IL2 containing medium when cells exceeded concentration of 1.5 X 10 6 cells/ml.
  • PBMC populations were generated by separation from buffy coats derived from healthy donors, using Ficoll-PaqueTM PLUS (GE Healthcare Bio-Sciences PA, USA).
  • PBMCs were cultured at 1 X 10 6 cells/mL in 24-well tissue culture plate in RPMI-1640 (Corning CellGro) supplemented with 10% fetal Bovine serum (Gibco), 2 mmol/L L-glutamine, 100 U/mL penicillin, 100 U/mL streptomycin, and 100 RJ rhIL-2/ml.
  • Similar culture conditions can be used to grow primary human cells collected from peripheral blood, cord blood, bone marrow, healthy tissues, or tissues afflicted with a disease, such as the cancerous tissues previously described.
  • PBMC populations were generated by separation from buffy coats derived from healthy donors, using Ficoll-PaqueTM PLUS (GE Healthcare Bio-Sciences PA, USA). PBMCs were cultured at 1 X 10 6 cells/mL in 24-well tissue culture plate in CTS serum-free media with CTS-OpTmizer supplement.
  • Similar culture conditions can be used to grow primary human cells collected from peripheral blood, cord blood, bone marrow, healthy tissues, or tissues afflicted with a disease, such as the cancerous tissues previously described.
  • Example 2 Depletion of Adherent Monocytes and Macrophages and CD4+ and CD8+ ⁇ T cells
  • PMBCs are collected with apheresis methods as previously described and red blood cells are removed by hypotonic treatment or density separation using Ficoll gradient centrifugation.
  • the red blood cell-free PBMCs are incubated in large-scale tissue culture vessels such as 10-stack or 40- stack Cell Factory (Nunc), roller bottles (Nunc).
  • Adherent populations comprising macrophages and monocytes, typically remain bound to the surface of the cell culture vessels.
  • the cell population grown in suspension population is enriched in ⁇ T-cells.
  • Approximately 10 8 , 10 9 or 10 10 PBMC are incubated with anti-human CD4 and anti-human CD8 coated iron-containing microbeads (e.g.
  • PMBCs are collected with apheresis methods as previously described and red blood cells are removed by hypotonic treatment or density separation using Ficoll gradient centrifugation.
  • the red blood cell-free PBMCs are incubated in large-scale tissue culture vessels such as 10-stack or 40- stack Cell Factory (Nunc), roller bottles (Nunc).
  • Monocytes and macrophages are removed by flowing the red blood cell-removed PBMC over a packed glass wool column.
  • the "flow-through" cell population is enriched in ⁇ T-cells for further processing.
  • PMBCs are collected with apheresis methods as previously described and red blood cells are removed by hypotonic treatment or density separation using Ficoll gradient centrifugation.
  • the red blood cell-free PBMCs are incubated in large-scale tissue culture vessels such as 10-stack or 40- stack Cell Factory (Nunc), roller bottles (Nunc). Monocytes and macrophages are depleted either with the methods described in Example 2 or in Example 3.
  • Approximately 10 8 , 10 9 or 10 10 PBMC are incubated with CD4 and CD8 coated iron-containing microbeads (e.g. Miltenyi Biotech
  • the "flow-through" cell population is enriched for ⁇ T-cells.
  • Undesired cells, such as NK, ⁇ T-cells, B cells, monocytes and macrophages are removed by immunomagnetic beads separation (e.g. Miltenyi Biotech AutoMACS system) using a cocktail of antibodies directed against the undesired cell types.
  • undesired cell types are removed by using mouse anti human ⁇ TCR (IP26, BW242/412) antibody, one or more other antibody directed against surface receptors on NK, ⁇ cells, B cells, monocytes or macrophages and attached to Anti-Mouse IgG MicroBeads (Miltenyi 130-048-401), or one or more tetrameric antibody complex or bi-specific antibody directed against surface receptors on NK, ⁇ T cells, B cells, monocytes or macrophages, or combinations thereof.
  • mouse anti human ⁇ TCR (IP26, BW242/412) antibody one or more other antibody directed against surface receptors on NK, ⁇ cells, B cells, monocytes or macrophages and attached to Anti-Mouse IgG MicroBeads (Miltenyi 130-048-401), or one or more tetrameric antibody complex or bi-specific antibody directed against surface receptors on NK, ⁇ T cells, B cells, monocytes or macrophages, or combinations thereof
  • native ⁇ T-cells are isolated from primary cultures with flow cytometry sorting, based on the positive (i.e. ⁇ TCR) or negative (i.e. ⁇ TCR, CD4, CD8, CD56), expression of cell surface markers.
  • T-cells were isolated according to the methods detailed in Example 1. Briefly, freshly harvested tumor specimens were obtained from NCI Cooperative Human Tissue Network (CHTN). Colon adenocarcinoma metastasis to liver (TIL 1) and renal tumor (TIL 2) were shipped in RPMI- 1640 media. The tumor tissues were minced into small pieces of 2mm 3 in size using a flat blade followed by digestion with 2mL Liberase enzyme cocktail (Sigma Chemical Co., St. Louis, MO) in RPMI and 3000 units of DNase as described. After digestion tumors were filtered through sterile gauze 40-micron nylon mesh, and washed twice in RPMI- 1640.
  • CHTN NCI Cooperative Human Tissue Network
  • TIL 2 NCI Cooperative Human Tissue Network
  • TIL 2mL Liberase enzyme cocktail Sigma Chemical Co., St. Louis, MO
  • ⁇ T lymphocytes were counted and plated in 24 well plate at lxl06/ml in RPMI- 1640 containing 10% human AB serum supplemented with L- glutamine, and 100 U/mL of rhIL-2. Tumor infiltrating lymphocytes were collected after 6 days in culture. The presence of ⁇ T lymphocytes was analyzed by flow cytometry anti- ⁇ 1 TCR (FITC conjugated anti V ⁇ 1TS8.2, (Thermo Fisher) and anti -V ⁇ 2 B6 (Biolegend). Data was analyzed with FlowJo software.
  • FIG. 4 depicts a graph illustrating growth of ⁇ 1 and ⁇ 2 lymphocytes isolated from colon adenocarcinoma metastasis to liver (TIL 1) and renal tumors (TIL 2). These lymphocytes have been shown to express CCR4 and CCR7 (data not shown). As illustrated by FIG. 4, the V ⁇ 1 subset was the predominant population isolated from both types of tumors.
  • ⁇ T-Cells are stimulated and expanded in serum-free media such as Ex- Vivo 10 (Lonza 04- 380Q ), Ex- Vivo 15 (Lonza 04-744Q), Ex- Vivo 20 (Lonza 04-448Q), AEVIV media (ThermoFisher Scientific 12055091) , Optimizer CTS (ThermoFisher Scientific A1048501), containing cytokines (IL-2, IL-4, IL-7, IL-15, IL-12, IL-21, IL-23 or IL-33), growth factors (insulin and transferrin, insulin-like growth factors), albumin, lipids (cholesterol, lipid solutions, lipid pre-cursors), vitamins, copper, iron, selenium, protein hydrolysate, essential amino acids, non-essential amino acids, and shear protectant (Pluronic F-68).
  • serum-free media such as Ex- Vivo 10 (Lonza 04- 380Q ), Ex- Vivo 15 (Lonza 04
  • the serum-free media described in the examples herein can also be supplemented with additives to support high cell density ⁇ T-cell growth between 10 5 to 2 x 10 7 cells/mL in suspension culture (e.g. WAVE bioreactor) while maintaining biological functionality of the ⁇ T-cell.
  • additives to support high cell density ⁇ T-cell growth between 10 5 to 2 x 10 7 cells/mL in suspension culture (e.g. WAVE bioreactor) while maintaining biological functionality of the ⁇ T-cell.
  • Additional additives that provided robust ⁇ T-cell growth include, for example, Calcium Chloride, Anhydrous, Calcium Nitrate, Cupric Sulfate, Pentahydrate, Ferric Citrate, Ferric Nitrate, Ferrous Sulfate, Zinc Sulfate, and/or Putrescine.
  • Trace metals were provided in the serum free media to provide low levels of elemental components to replace serum, including Ammonium Paramolybdate, Vanadium, Manganese, Nickel, Sodium Selenite, Sodium Metasilicate, Nonahydrate, Stannous Chloride, Aluminum Chloride, Barium Acetate, Cadmium Chloride, Chromic Chloride, Cobalt, Germanium Dioxide, Potassium Bromide, Potassium Iodide, Rubidium Chloride, Silver Nitrate, Sodium Fluoride, and/or Zirconyl Chloride.
  • ⁇ T-cells include, for example, Adenosine, Guanosine, Cytidine, Uridine, Betaine, Taurine, Folinic acid, Ethanolamine, Linoleic Acid, Oleic Acid Hydrocortisone, pyruvate, plant hydrolysates, yeast hydrolysates, and/or beta-mercaptoethanol .
  • Vitamins added to promote robust ⁇ T cell growth include: Biotin (B7), D-Calcium
  • Pantothenate (B5), Choline Chloride, Cyanocobalamin (B12), Folic Acid (B9), i-Inositol (myo- Inositol), Niacinamide(B3), Pyridoxal, Monohydrochloride, Pyridoxine, Monohydrochloride (B6), Riboflavin (B2), Thiamine, and/or Monohydrochloride (Bl).
  • Expanded T-cell populations may be characterized, for example, by FACS staining for cell surface markers that distinguish between the different populations.
  • the cells were washed once in HEPES buffered saline solution (HBSS) containing 2% fetal bovine serum, incubated with appropriate amounts of MAbs at 4° C for 30 minutes and rewashed in HBSS.
  • HBSS HEPES buffered saline solution
  • FSM FACS staining medium
  • HBSS HBSS containing 2% fetal bovine serum
  • FITC fluoroisothiocyanate
  • PE phycoerythrin conjugated MAbs directed against CD2, CD3 (BioLegend, clone OKT3), CD4 (BioLegend clone OKT4), CD7, CD8
  • cytokine secretion intracellular cytokines and/or membrane associated cytokines including, for example, TNF-a IFN- ⁇ , GM-CSF, IL-1, IL-2, IL-4, IL-6, IL-7, IL-10, IL-17, or IL-21 may be characterized according to methods known in the art.
  • live cells were determined by absence or low incorporation of zombie violet (BioLegend) amine dye.
  • Fluorescence Minus One (FMO) controls are used to define positive and negative gate boundaries of the surface expression of each antigen. Stained cells are collected on a Sony SH800 cytometer and data analyzed using FlowJo vlO.1. Flow cytometry data are visualized as dot plots.
  • R2 serum-containing media
  • serum-free media AFMV + bovine albumin
  • CTS serum-free Supplement CTS serum-free Supplement
  • FIG. 5 depicts a graph illustrating the growth of ⁇ 2 T -cells. All media used in the current experiment contained 100 IU/mL IL-2, 2 mM glutamine and lx penicillin/streptomycin. In addition, cells were stimulated with Zoledronic acid at 1, 5, and 20 ⁇ on day 0. Media was replenished every 2-3 days without further addition of Zoledronic acid. The total number ⁇ 2 T -cells expanded from 10 6 PBMC and the fold expansion of each treatment after a time period of 13 days are shown in FIG. 5. These results indicate that ⁇ 2 T -cells can be expanded in serum-free media.
  • FIG. 6 and FIG. 7 depict graphs illustrating anti- ⁇ TCR antibody blocking experiments
  • FIG. 8 and FIG. 9 depict antibody competition assays.
  • FIG. 6 and FIG. 7 illustrate the results of blocking experiments where PBMCs were pre-incubated with various antibodies, namely, 5A6.E9, Bl, TS8.2, 15D, B3, B6, TS-1, ⁇ 3.20, FMMU510, or 11F2. The cells were subsequently washed and stained with the secondary TS8.2-FITC ( ⁇ 1-specific) or B6-PE (62-specific) antibodies. PBMCs samples were analyzed by flow cytometry. Reduction in geometric mean fluoresce intensity (gMFI) was used to assess degree of blocking. The level of inhibition is illustrated against TS8.2-FITC (FIG. 6) and against B6-PE (FIG. 7).
  • gMFI geometric mean fluoresce intensity
  • % Competition is calculated by change in geometric mean fluorescence divided by the maximum change in geometric mean fluorescence.
  • TS-1 antibody competed with TS8.2 binding to the cells as effectively as the TS8.2 antibody itself. None of the other antibodies tested were able to compete with TS8.2 binding.
  • TS8.2 antibody competed with TS-1 binding to the cells but not as effectively as the TS-1 itself. Some level of competition with TS-1 binding was also observed with 11F2 antibody. These results indicate that both TS-1 and TS8.2 antibodies bind to ⁇ 1 but likely not at the same epitope.
  • Example 10 Enzymatic Digestion of Tumor Specimens and ⁇ T-cell Expansion with Antibodies to Specific ⁇ Epitopes
  • Specimens Enzymatic Digestion were counted and seeded on antibody coated wells of a 3D cell culture plate (Corning® Costar® Ultra-Low attachment multi well plates) at 0.5-1 X 10 6 cell/ml in RPMI 1640 medium supplemented with 10% human AB serum and rhIL-2 (100 IU/mL). The cultures were incubated at 37° C, 5% CO 2 for 7-21 days.
  • Activating agents were tested either as soluble agents, or agents immobilized on the culture wells.
  • Soluble antigens and antibodies were added at a final concentration of 0.1-5 ⁇ g/ml to human PBMCs cultured in 24 well plate at a cell density of 1 X 10 6 cell/ml.
  • the same anti ⁇ TCR antibodies were immobilized by coating wells of 24-well culture plates.
  • Anti ⁇ TCR antibodies were added at 0.1-10 ⁇ g/ml concentration.
  • Wells were washed twice with PBS, then PBMCs were transferred to the plates and cultured in either RPMI-1640, AIM-V or CTS-OpTmizer media as described above. Cultured media was supplemented with 100 R7/mL of rhIL-2.
  • FIG. 10 and FIG. 11 depict graphs illustrating activation and expansion of ⁇ 1 and ⁇ 2 T-cells respectively from PBMC.
  • Cells were activated and expanded in media containing RPMI with 10% FBS, 100 R7/mL rhIL-2, glutamine and lx penicillin streptomycin. On Day-7 after the initial stimulation, cells were passaged in fresh media and placed in a newly coated 24-well plate with the same antibodies at the same concentrations. Media in the re-stimulated cultures were replenished every 2-3 days until Day 13 and analyzed by flow cytometry.
  • FIG. 12 illustrates the total number of ⁇ 1 T-cells
  • FIG. 13 illustrates the total number of ⁇ 2 T -cells after 13 days of growth and expansion.
  • the total number of ⁇ T-cells was calculated by multiplying the percentage ⁇ 1 and ⁇ 2 T-cells (as determined by flow cytometry using TS8.2-FITC and B6-PE, respectively) by the total viable cell number and subtracting the negative control values from ⁇ 1 and ⁇ 2 T-cell cells activated by the non-specific mouse IgG MG1-45 (BioLegend 401403).
  • Example 13 Activation and Expansion of Specific ⁇ T Cell Populations from PBMCs Activation and Expansion of V ⁇ l T-Cells from PBMCs
  • Activating antibodies were immobilized directly to plastic 24-well plates at 0.25 or 1 ⁇ g/mL (data shown for 0.25 ⁇ g/mL) or captured at 0.05 or 0.1 mg/mL (data shown for 0.05 ⁇ g/mL) by plate-bound goat anti-mouse IgGFc (5 ⁇ g/mL) in 24-well plates.
  • Human PBMCs were activated at 1 X 10 6 cell/ml in media containing RPMI with 10% FBS, 100 R7/mL rhIL-2. Media in the cultures were replenished every 2-3 days.
  • FIG. 16 depicts graphs illustrating activation and expansion of V ⁇ 1 T-cells from PBMC from different donors.
  • MAbs TS-1. R9.12 and TS8.2 induced significant selective growth and enrichment of V ⁇ 1 T-cell population.
  • V ⁇ 1 T-cells were expanded from 400 to 14,500 fold (FIG.
  • T lymphocytes population which comprised about 95% of the total cell population (FIG. 16B) in 14 days.
  • V ⁇ 1 T- cells were expanded by 26,330 fold (FIG. 16D) in 23 days.
  • Activating antibodies (TS1, TS8.2, R9.12, B6 and 15D) were immobilized directly to plastic 24-well plates at 0.25 or 1 ⁇ g/mL (data shown for 0.25 ⁇ g/mL) or captured at 0.05 or 0.1 ⁇ g/mL (data shown for 0.05 ⁇ g/mL) by plate-bound goat anti-mouse IgGFc (5 ⁇ g/mL).
  • Human PBMCs were activated at 1 X 10 6 cell/ml in media containing RPMI with 10% FBS, 100 IU/mL rhIL-2. Media in the cultures were replenished every 2-3 days. On day-7 cells were transferred into new plates without activating antibodies and further expanded by replenishing fresh media every 2-3 days for a total of 14 days.
  • FIG. 17 illustrate the fold expansion and percentage of V ⁇ 2 T -cells after 14 days from different donors.
  • MAbs B6 and 15D induced selective expansion of V ⁇ 2 T -cell population from 70 fold to 4,740 fold (FIG. 17A, 17C and 17E) over 14-days and enriched ⁇ 2 populations up to 80% of the T lymphocytes population, which comprised about 95% of the total cell population (FIG. 17B and 17D).
  • Immobilized activating agents were tested in cell culture wells.
  • MAbs (TS 1, TS8.2, B6 and 15D) were directly coated (1 ⁇ g/mL) or captured (0.1 ⁇ g/mL) with goat-anti-mouse Fc (5 ⁇ g/mL) in 24-well plates.
  • Human PBMC were activated at 1 X 10 6 cell/ml in media containing RPMI with 10%) FBS, 100 R7/mL rhIL-2. Media in the cultures were replenished every 2-3 days. On day-7, cells were transferred into new plates without antibodies and further expanded by replenishing media every 2-3 days until day 14 and analyzed by flow cytometry.
  • FIG. 18 illustrates the fold expansion and percentage of ⁇ T-cells after 14 days.
  • MAbs were directly coated (1 ⁇ g/mL) or captured (0.1 ⁇ g/mL) with goat-anti-mouse Fc (5 ⁇ .) in 24-well plates.
  • PBMCs were plated at 10 6 cells/mL in RPMI with 10% FBS and 100 IU/mL IL-2. Cells were transferred to new plate without antibodies on day 7, adjusted to 10 6 cells/mL with fresh media. Culture was transferred to a new plate without antibodies and adjusted to 10 6 cells/mL on day 7 and replenished with fresh media every 2-3 days. The results are depicted in Fig. 19.
  • V ⁇ 1 T-cells population doubling time was reduced from 37 hours in the absence of activating antibody to 24 hours in the presence of immobilized TS1 antibody.
  • V ⁇ 2 T -cells population doubling time was reduced from 125 hours in the absence of activating antibody to 27.5 hours when activated with immobilized 15D antibody.
  • Alpha beta T-cells population doubling time was not affected significantly by ⁇ TCR antibody activation
  • Antibodies TS8, R9.12 and Immuno510 were immobilized directly to plastic wells at a concentration of 1.0 ⁇ g/mL.
  • Human PBMCs were activated at 1 X 10 6 cell/ml and cultured in media containing RPMI with 10% FBS, 100 R7/mL rhIL-2. Media in the cultures were replenished every 2-3 days until Day 23 and analyzed by flow cytometry on days 0, 14 and 23.
  • Fig. 20 depicts phenotype of V ⁇ 1 T-cells on days 14 and 23 as determined by CD45RA and CD27 expression analysis by flow cytometry.
  • Phenotypes of the ⁇ cells were defined as na ' ive (CD45RA+/CD27+), central memory (TCM, CD45RA-/CD27+), effector memory (TEM, CD45RA-/CD27-) and effector memory expressing (TEMRA, CD45RA+/CD27-).
  • Activation with TS8.2 and R9.12 maintained the V ⁇ 1 T-cell phenotype over the 23-day expansion period with 43% to 63% na ' ive populations and 23% to 27%) central memory populations.
  • activation with pan- ⁇ antibody Immuno510 resulted in the reduction in the na ' ive V ⁇ 1-T cells from 47% to between 8% and 33%.
  • PBMCs Human PBMCs were activated with plate-bound TS8.2 antibody (1 ⁇ g/mL) or plate-bound TS8.2 and MICA-Fc fusion protein (1 and 5 ⁇ g/mL, respectively). Cultures were expanded in RPMI media containing 10% FBS, 100 IU/mL rhIL-2. Fig. 21 depicts cell expansion after 10 days.
  • Fig. 22 shows that V ⁇ 1 T-cells were expanded by up to 152 fold using ⁇ 1-speicfic antibodies and V ⁇ 2 T -cells were expanded by up to 93 fold using 62-speicific antibodies over 7 days.
  • Epitope binding domains of ⁇ TCR activating antibodies were determined.
  • the binding epitope of ⁇ TCR ⁇ 1 specific activating MAbs TS8.2, TSl and the ⁇ 2 specific activating MAbs 15D and B6 was determined in ELISA binding assays using different combinations of wild type and mutated ⁇ TCR paired chains.
  • TSl, TS8.2 and R9.12 are ⁇ 1 specific MAbs that bind the surface of human T-leukemia cell line BE 13 expressing ⁇ 1 TCR as detected by flow cytometry (data not shown).
  • the BE13 TCR chains ⁇ 1 Jl and y8J2 were cloned and used for epitope mapping of ⁇ 1 specific MAbs.
  • Soluble TCR constructs containing the extracellular V, diversity (D), joining (J), and C regions domains of ⁇ and ⁇ chains were cloned and fused to the hinge region, CH2 and CH3 domains of human IgGl heavy chain Fusion y ⁇ TCR-FC proteins expressed by transient transfection of 293 cells.
  • the different ⁇ TCRs were co- transfected into 293 cells and were able to assemble correctly and to form disulfide-linked, heterodimers secreted as correctly paired receptor chains.
  • the correct folding of the TCR ⁇ -FC heterodimers was confirmed by an ELISA binding assay using the anti-TCR pan ⁇ antibodies including Bl . l (Biolegend #331202), 5E6.E9 (ThermoFisher Scientific #TCR10 ⁇ 1), 11F2 (Beckman Coulter #340884) and IMMU510 (Beckman Coulter #F 1349) antibodies which recognize all ⁇ T cell receptors.
  • Transfected 293 cells were incubated for 48-72 hours, at 37°C (5% C02).
  • Cell supematants were collected at 48 hours post transfection and tested for binding to selected anti human ⁇ TCR monoclonal antibodies by ELISA assay.
  • Sandwich ELISA Assay Cell culture supematants were tested by enzyme-linked immunosorbent assay (ELISA).
  • Assay plates (Greiner Bio-One high binding microplates) were incubated overnight at 4°C with 100 ⁇ of 1 ⁇ g/ml Goat Anti -Human IgG, Fey fragment specific antibody (Jackson ImmunoResearch # 109-005-008).
  • binding of TSl and TS8.2 to soluble TCRs was detected when the ⁇ 1 chain include V ⁇ 1 Jl and V ⁇ 1 J2 sequences but not to the V ⁇ 1 J3 chain, indicating that the binding of TSl and TS8.2 involved critical residues in the delta Jl and delta J2 region, that are missing in the delta J3.
  • Data indicates that TSl and TS8.2 bind ⁇ 1J1 and ⁇ 1J2 TCR, and R9.12 binds ⁇ 1J1 ⁇ 1J2 and ⁇ 1J3 TCR, and that Jl and J2 segments contain sequences that are critical for TSl and TS8.2 binding.
  • sequence alignment of human delta J region pointed to 4 possible residues 9 J1/J2 residues Leul 16, Lysl20 and Thrl22 that are shared between Jl and J2 but different in the J3 sequence.
  • the 5J1 sequence was modified according to the J3 sequence at the selected positions; Leul 16 was modified to Met, Lys 120 was modified to Thr and Ala, and Thrl22 was replaced by He. Change of Lysl20 by Thr abolished the binding of both TS8.2 and TSl but not binding of R9.12. As shown in FIGS. 24 and 25, the Lysine residue at position 120 at the delta Jl and delta J2 is critical for TS-1 and TS8.2 antibody binding.
  • V ⁇ 1 sequences important for TS8.2 and TSl binding additional mutated V ⁇ 1 TCR constructs were made. As shown in Fig 26, six mutated V ⁇ 1 chains were constructed. The mutations were designed based on the differences in amino acid sequences between the highly homologous bovine V ⁇ 1 S1 and the human V ⁇ 1 (68% identity). Mutated V ⁇ 1 chains were generated using synthetic genes (Integrated DNA Technologies). Soluble TCRS were expressed as V ⁇ 1 chains paired with human ⁇ 8 TCR Fc chain.
  • V ⁇ 1Mutl displays 9 residue changes in the stretch of residues between the region of Gly57 to Ala88 of the variable region of human ⁇ 1 chain
  • V ⁇ 1Mut6 displays a change in two residues at position 71 and 72 (numbering as shown in FIG. 14).
  • the binding of V ⁇ 1 MAb R9.12 and pan ⁇ chain constant MAb Immuno510 were not affected by any of the changes to the V ⁇ 1. Therefore, the V ⁇ 1 residues at position Arg71 and Asp72 together with Lysl20 at The J1/J2 region are critical for binding of both Ts-1 and TS8.2 MAbs.
  • the correct folding of the secreted ⁇ 2 TCR heterodimer was confirmed by an ELISA binding assay using the anti-TCR PAN ⁇ antibody FMMU510 (Backman Coulter #FM1349) and with the ⁇ 9 specific MAb the 7A5 (ThermoFisher Scientific #TCR1720).
  • Binding of B6 was affected by the ychain selected for paring with the 62 chain. Binding of B6 was detected when the 62 chain was paired with the ⁇ 9 chain regardless of the ⁇ 9 J sequence. The binding to the ⁇ 3 ⁇ 2 T CR pair was greatly reduced, and the binding to the 62 chain paired with ⁇ 8 was undetectable. As shown in FIG. 28, the most stabilized binding of the B6 MAb is to the 62 ⁇ 9 TCR. Both ⁇ 3 and ⁇ 8 belong to gamma family 1 and share high sequence homology (75%) with each other, ⁇ 9 a member of the gamma 2 family and shares low sequence homology with ⁇ 3 and ⁇ 8 (-20%).
  • B6 High binding affinity of B6 involves residues on both 62 and ⁇ 9 chains.
  • Positive control MAbs were FMMU510 a pan y ⁇ TCR that binds the constant region of the 6chain and recognize all y ⁇ TCRs, and 7A5 MAb a ⁇ 9 specific MAb. Binding of the B6 MAb was detected to the 52 ⁇ 9 TCR.
  • B3 is a Vy9 antibody.
  • FIG 29 shows the protein sequence alignment of human (IMGT Human TRDV2) and Rhesus monkey (GenBank: AY190028.1) V ⁇ 2 variable regions. The changes were made in CDRl (G35S), CDR2 (D65G) and the CDR3 C104S (numbering as shown in FIG.
  • CD2 epitopes CD2 epitopes
  • the CD2 molecule consists of two extracellular immunoglobulin superfamily domains Ig- like V-type domain and Ig-like C-type domain, on which three major immunogenic regions have been described (Davis et al., Immunol Today 1996; 17: 177-187). Regions 1 and 2 are located in the first domain and region 3 is located in the second domain. MAbs that recognize region 1 bind both resting and activated T-cells and can strongly inhibit the binding of CD58 to CD2. Monoclonal antibodies that recognize region 2 have similar binding properties but are not effective at blocking CD58 binding. Monoclonal antibodies that recognize region 3 recognize CD2 only on activated T- cells and do not block CD58 binding.
  • Mapping of the binding epitope of CD2 agonist MAbs is done by competition assays against CD58, the natural ligand of CD2 and activation assays.
  • site directed mutagenesis of critical CD2 binding residues is that leads to loss of binding of CD58, is tested for MAbs binding.
  • mutations include mutagenesis of the CD2 sequence at position 67 (K to R), 70 (Q to K), 110 (Y to D) and at position 111 (D to H).
  • To design constructs for the mapping of the binding epitope of CD2 a sequence alignment of human and mouse CD2 using VectorNTI (Thermo Fisher) are performed. The alignments show a 50% sequence homology between human and mouse CD2 .
  • MAbs that bind the extracellular domain of human CD2 are not expected to cross react with the mouse CD2.
  • the human N-terminal Ig-like V-type domain (residues 25-128) is replaced with mouse residues (23-121) in expression vector expressing the extra cellular domain of CD2.
  • Chimeric cDNA species are transiently transfected into CHO or 293 cells.
  • Human wildtype CD2 and human mouse chimeric constructs are expressed on the surface of CHO cells.
  • Chimeric CD2 Cell-surface expression is analyzed by FACScanto. Binding or loss of binding to chimeric molecule is detected by flow cytometry and validated by activation assays.
  • Epitope mapping of activating MAbs against KG2D is tested by the ability of anti- h KG2D antibody to reduce or block KG2D interactions with one or more of its ligands,
  • MICA/MICB MICA/MICB
  • Agonist MAb is identified by its ability to reduce KG2D-mediated activation of K or T-cells. This can be evaluated by typical cytotoxicity assays, addition of ligand-blocking antibodies, or by blocking ⁇ T-cells mediated killing of MICA-expressing tumor cells in a dose-dependent fashion.
  • CD27 epitopes CD27 epitopes
  • CD27 expressing cells are incubated for 30 min with 5 ⁇ g of MAbs at 4 °C, after which 1 ⁇ g of
  • biotinylated CD70 is added to the tube.
  • the mixture is incubated for another 15 min at 4 °C before washing.
  • cells are incubated for 30 min with a mixture of streptavidin-PE (for detection of CD70 ligand binding) followed by several washing steps and analysis using FACS. Blockage of CD70 binding indicates that the MAb and CD70 share the same epitope.
  • Example 16 Characterization of TCR V ⁇ Repertoire of a Population of Expanded ⁇ T- cells
  • PCR polymerase chain reaction
  • RNA from the aforementioned ⁇ -cells is extracted, reverse transcribed into cDNA, and amplified by PCR using V ⁇ 1, V ⁇ 2, and V ⁇ 3 -specific primer pairs.
  • V ⁇ 2 forward primer (5'ATGCAGAGGATCTCCTCCCTCATCCATCT 3'; SEQ ID NO: 2) and V ⁇ 3 forward primer (5 'ATGATTCTT ACTGTGGGCTTT AGCTTTTTG 3 ' ; SEQ 3D NO: 3) were used in combination with A C ⁇ reverse primer (5 ' CTTGGGGTAGAATTCCTTC ACC AGAC AAGC3 ' ; SEQ ID NO: 4) to amplify 500 bp DNA fragments.
  • the ⁇ chain was amplified in separated RT-PCR reaction using Vy specific primers to amplify Vy2, Vy3, Vy4, and Vy5 (5' GGTGCTTCTAGCTTTCCTGTCTCCTGC3 ' (SEQ ID NO: 10)), Vy8 (5'ATGCTGTTGGCTCTAGCTCTGCTTCTA3' (SEQ ID NO: 11)) and Vy9
  • Vy primers are paired with the Cy reverse primer (5 ' GGAAGAAAAAT AGTGGGCTTGGGGGAA3 ' (SEQ ID NO: 13)).
  • the ⁇ reverse primer based on consensus sequence of the Cyl and Cy2. PCR fragments are cloned and the nucleotide sequence of 80 independent Vy inserts are obtained. The V ⁇ , D6 and J ⁇ junctional sequences are analyzed, together with CDR3 sequence alignment.
  • Example 17 MAbs and Related Targeting Constructs for Engineering of ⁇ T-Cells
  • the human CD20 gene is obtained from a cDNA clone (Origene Technologies, Inc., 6 Taft Court, Suite 100, Rockville, Md. 20850).
  • the CD20 gene is amplified using the forward primer (5' ATGAC AAC ACCC AGAAATTC AGTAAATGG3 ' (SEQ ID NO: 14)) and the reverse primer (5' TCAAGGAGAGCTGTCATTTTCTATTGGTG3' (SEQ ID NO: 15)) the amplified CD20 cDNA is incorporated into pCDNA3.4 (Thermo Fisher Scientific) as a high expression vector for mammalian cells, and transfected into CHO cells as the host cells.
  • Recombinant CHO cells (CD20/CHO cells) expressing CD20 molecules at a high level on their cell surfaces are identified by FACS analysis.
  • the CD20/CHO cells are used to immunize BALB/C mice or transgenic mice engineered to produce fully human antibodies as described in Jakobovits and Bornstein (Jakobovits Curr. Opin. Biotechnol. 1995 6:5 ⁇ 1-6; Bornstein et al., Invest New Drugs. 2010 28:5 ⁇ 1-74.).
  • Antibodies with high affinity and specificity towards human CD20 are screened by FACS assays.
  • Mouse antibodies are humanized by CDR grafting (Kim and Hong Methods Mol Biol. 2012;907:237-45.
  • Human single domain CD20 antibodies are also generated from mice or rats engineered to produce human heavy chain single domain antibodies (Janssens et al., PNAS 2006 vol. 103 : 15130).
  • ⁇ T-Cells are engineered with the CD20 MAbs described herein.
  • Example 18 TCR Constructs for Engineering of ⁇ T-Cells
  • TCRs comprising sequences of highly reactive ⁇ TCR chains are isolated from T-lymphocytes expressing NY-ESO-1-MHC specific peptide complexes.
  • the NY- ESO-l-MHC specific peptide complexes induce potent in vitro and in vivo anti-tumor activity against various NYESO- 1 -expressing tumors.
  • the highly reactive ⁇ TCR chains are isolated from melanoma, sarcoma patients or from mice bearing patient-derived xenografts derived from human melanoma or sarcoma tumors.
  • the TCR is derived from mice altered to have a humanized immune system that expresses NY-ESO-1 peptides or NYESO- 1 -peptide complexes ⁇ See Gonzales et al., Immunol Res. 2013 57: 326-334; Boucherma etal., J Immuno. 2013. 191; 583-593; Liang-PingL. Et al., Nature Med. 2010, 16: 1029-1035).
  • T-cells that recognize epitopes of the NY-ESO-l-in the context of the dominant class I alleles HLA-A*02 for example, peptide SLLMWITQC Residues 157-167(SEQ ID NO: 16)
  • dominant HLA-A*01 -associated peptide are identified.
  • TCRa and TCR transcripts are generated by reverse transcription-polymerase chain reaction (RT-PCR) using the One step RT-PCR kit (Qiagen Hilden Germany) according to the manufacturer's suggestions.
  • First strand cDNA is generated from RNA isolated from the reactive T- cell.
  • Total RNA is extracted with TRIzol Total RNA Isolation Reagent (Invitrogen Life).
  • TCR a and ⁇ chains are produced by a set of degenerate primers that can bind to highly conserved region of the TCR a and ⁇ chain V regions centered around the tryptophan-tyrosine residues at amino acid positions 34 and 35 (Kabat numbering) are used in combination with the a and ⁇ constant region reverse primers (Moonka and Loh Journal of Immunological Methods 169 (1994) 41-51). Amplified PCR fragments are gel purified and directly sequenced. Sequence information is used to design PCR primers suitable for cloning of the individual full-length cDNAs.
  • TCRs genes are cloned and inserted into MSGV-based retroviral vectors and full-length cDNAs amplified from selected T cells.
  • Retroviral vectors encoding both a and ⁇ chains of wild- type NY-ESO-1 -reactive human TCR are constructed using a MSGV1 backbone. Linking of the TCRa and TCR ⁇ chains is done via an internal ribosome entry site (IRES) element in one construct, or by separation using a cleavable picorovirus peptide sequence.
  • IRS internal ribosome entry site
  • Retroviral supernatants are generated by co-transfecting 293 cells that stably expressed MMLV gag and pol proteins with each MSGV1 TCR vector and a vector encoding the endogenous virus retroviral envelope protein using Lipofectamine 2000 (Invitrogen) as described previously or by el ectropi oration using the Nucleofector (Lonza). Supernatants are collected at day 2 and 3 post- transfection and were diluted 1 : 1 with fresh DMEM containing 10% FCS. Engineered ⁇ T-cells are capable of properly express the genes encoding the TCR a and ⁇ chains without any further manipulation.
  • a polynucleotide comprising an ⁇ TCR (tumor recognition moiety) is cloned from T-cells selected to be specific to the desired antigen using standard techniques. Isolated endogenous wild- type ⁇ T-cells are grown with methods described in previous examples to at least 6 ⁇ 10 6 cells prior to infection with the retrovirus or a lentivirus comprising an expression cassette encoding the tumor recognition moiety. A standard protocol for viral infection can be used to introduce the vector system into the wild-type ⁇ T-cell. Expression of the selection marker is used to select cells that have been successfully transfected.
  • the expression of the engineered ⁇ TCR can be evaluated by flow cytometry and/or by quantitative QRT-PCR and by functional assays with target cells for cytotoxicity and cytokine secretion.
  • the expression of the engineered activation domain can also be evaluated by flow cytometry and/or by quantitative qRT-PCR.
  • the number of engineered ⁇ T-cells expressing a cell surface marker of interest is determined by flow cytometry.
  • the engineered ⁇ T-cell is further engineered with a suitable methodology described herein, such as the CRISPR-Cas, talen, meganucleases, zinc finger, or sleeping beauty transposon technologies to delete an exon associated with an HLA gene or a ⁇ 2 ⁇ gene.
  • ⁇ T-cells are transduced with retro- or lenti- viral based vectors to express targeting moieties that can direct the engineered ⁇ T-cells to specifically recognize tumor cells and get activated to kill it.
  • the transduced targeting moieties include MAbs directed against tumor-specific surface proteins or tumor-specific intracellular peptides, ⁇ T-cells are also engineered with high affinity TCRs directed to peptide-MHC complexes.
  • cells can be engineered via transduction with non-viral vectors.
  • Example 21 Engineering of Isolated ⁇ T-Cells with Targeting Moieties
  • CAR construct design comprises of different main functional domains, a target moiety that recognizes a protein or a MHC associated peptide of interest displayed on a tumor cell, a short spacer that connects the extracellular receptor targeting element to the transmembrane domain, which transverses the cell membrane and connects to the intracellular activation signaling domain.
  • the target moiety receptor expressed on the surface of a ⁇ T-cell will be designed to specifically bind to a target protein that is expressed on a cancer cell.
  • Tumor recognition moieties will be designed against targets including CD19, CD20, CD22, CD37, CD38, CD56, CD33, CD30, CD138, CD123, CD79b, CD70, CD75, CA6, GD2, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), CEACAM5, CA-125, MUC-16, 5T4, NaPi2b, RORl, ROR2, 5T4, PLIF, Her2/Neu, EGFRvIII, GPMNB, LIV-1, glycolipidF77,fibroblast activation protein (FAP), PSMA, STEAP-1, STEAP-2, mesothelin, c-Met, CSPG4, PVRL-4, VEGFR2, PSCA, folate binding protein/receptor, SLC44A4, Cripto, CTAG1B, AXL, IL
  • the target moiety receptor can be derived from a portion of an antibody specific to tumor glycoprotein expressed on the surface of tumor cells, or alternatively the engineered receptor can be derived from a TCR receptor with a known specificity or an antibody recognizing a specific peptide sequence derived from intracellular tumor specific antigen presented on the on the surface in association with MHC complex including gplOO, MARTI, Tyrosinase, SSX2, SSX4, NYESO-1, epithelial tumor antigen (ETA), MAGEA family genes (such as MAGE A3.
  • MAGEA4 KKLC1, mutated N, and K and H ras , BRaf, p53, MHC class I chain-related molecule A (MICA), MHC class I chain-related molecule B (MICB), or one or more antigens of HPV, EBV, or CMV.
  • MICA MHC class I chain-related molecule A
  • MICB MHC class I chain-related molecule B
  • Example 22 Targeting Moiety Constructs with a Spacer and a Transmembrane Domain
  • Different spacers will be engineered into a tumor recognition moiety construct in order to optimize the potency of an engineered T-cell towards a cancer cell.
  • the size of each spacer will vary according to the size of the target protein, the epitope recognized by the receptor, the size of the engineered tumor recognition moiety and the affinity of the receptor. Spacers that can accommodate conformational changes including sequences of human IgG, CD8a and CD4 hinge region.
  • Spacers that are tested consist of Gly, Ser, and Thr amino acids used at different lengths (from 19 to 9 residues) in order to provide chimeric receptor with improved binding affinity properties.
  • the hinge and transmembrane portions of each construct is derived from the CD8a sequence (residues 117 to 178 of human CD8a) or alternatively the human IgGl hinge-Fc cDNA with CD28 transmembrane domain (residues 153-179).
  • a co-stimulatory domain comprising a CD28, 4- IBB, CD2, CD27, KG2D, DAP10, DAP 12, CD1 ⁇ 1, CD30, JAML, TLRs, CD244 or CD100 costimulatory signaling domain is engineered into a ⁇ T-cell to mimic a "second signal" that amplifies the activation through the chimeric receptor, leading to a more robust signal to multiply and kill the cancer cell.
  • the cytoplasmic region is derived from the endodomains of ⁇ and/or ⁇ T-cell co- stimulatory molecules including: CD28 (residues 180-220), CD137 (residues 214-255), ICOS (residues 165-199) CD27 (residues 213-260) KG2D (Residues 1-51) , JAML (residues 297 - 394) CD2 (residues 236 - 351), CD30 (residues 408 - 595) OX40 (Residues 1 - 23), HVEM (residues 224 - 283), or CD46 molecules.
  • the optimal constructs are selected based on the degree of activation of the engineered ⁇ T-cell populations for induced cell cytotoxicity and based on the degree of cytokine secretion in-vitro and in-vivo.
  • the intracellular CD3 ⁇ (residues 52-164) containing three IT AM domains (IT AMI :
  • PQRRKNPQEGLYNELQKDKMAEAYSEIGM (SEQ ID NO: 6); and ITAM3 :
  • ERRRGKGHDGLYQGLSTATKDTYDALHMQ (SEQ ID NO: 7) was cloned.
  • the intracellular domain of TCR- ⁇ was amplified using primers 5 '
  • the CAR constructs are generated by multistep overlap extension PCR.
  • the products were fused in a separate PCR reaction driven by primers tailed with the Platinum Taq DNA Polymerase High Fidelity kit (Invitrogen), using the Overlap extension polymerase chain reaction protocol,
  • the DNA encoding the full-length construct was ligated into MSGV1 Retroviral Vector.
  • the construct provides a CAR targeting moiety comprising a CO3 activating domain.
  • Example 25 Engineering ⁇ T-Cells with More Than One Recognition Moiety
  • ⁇ T-cells are transduced with more than one construct comprising a tumor recognition moiety, including a TCR and a MAb directed to the same intracellular tumor-specific protein.
  • a tumor recognition moiety including a TCR and a MAb directed to the same intracellular tumor-specific protein.
  • Each construct is selected to recognize a specific peptide in the context of different MHC haplotypes, such as A2 and Al, antibodies directed to different targets expressed on the same tumor cells or antibodies directed to different epitopes on the same target.
  • Engineered ⁇ T-cells are grown and expanded with an appropriate tissue culture media, such as the tissue culture media described in previous examples.
  • the Engineered ⁇ T-cells are grown exponentially to about 1 x 10 6 in a 5% CO 2 incubator at 37° C with or without stimulation by an external antigen and without co-culture with APCs or aminophosphates.
  • IFN- ⁇ , TNF-a (R&D Systems), IL- ⁇ ⁇ , IL-2, (Biosource International), IL- 12 (Diaclone Research), IL-6, and IL-18 will be measured using commercial enzyme-linked immunosorbent assay (ELISA) kits.
  • the enzyme-linked immunosorbent assays will be performed according to the manufacturers' instructions.
  • the amount of cytokine will be measured at different time points (from 24 to 72 hours) in a polystyrene 96-well plate (Maxisorb, Nunc) coated with a monoclonal mouse IgGl against the human cytokine, at a concentration of 1 ⁇ g/ml in 0.05 M sodium bicarbonate buffer overnight at 4 C.
  • the plate After washing with PBS containing 0.05% Tween 20 the plate will be blocked with 3% bovine serum albumin (BSA, wt/vol, Sigma) in PBST for 1 h at 37° C. A standard (recombinant human Cytokine from R&D) and supernatant from ⁇ cultures samples will be added and the plate will be incubated at RT for 2 h. Detection is performed with a matched antibody pairs in relation to recombinant human cytokine standards.
  • BSA bovine serum albumin
  • co-stimulatory agents to support activation, expansion and viability of engineered and non-engineered ⁇ T-cells is tested by adding co-stimulatory agents to whole PBMCs or enriched engineered and non-engineered ⁇ T-cell populations.
  • Co-stimulatory agents are added in a soluble or immobilized form to different activating agents, including anti ⁇ TCR specific MAbs.
  • Human PBMCs purified from buffy coats of healthy donors as described in previous examples or lymphocytes isolated from tissues are plated at 2 X 10 6 in 1 mL of complete RPMI-1640 media supplemented with 100 R7/mL rhIl-2 in 24-well flat-bottom tissue with 2-10 ⁇ g of anti y ⁇ TCR antibody in the presence or absence of soluble or immobilized agonistic antibodies to CD2, CD27, CD28, CD30, CD 137, ICOS, CD1 ⁇ 1, CD 122, CD244, and NKG2D, or stimulating ligands including, CD70-FC (ligand to CD27) MICA, MICB and ULBP (ligands to KG2D), 4- IBB (ligand to CD137), and Pilar 9 (ligand to CD1 ⁇ 1).
  • CD70-FC ligand to CD27
  • MICA MICB
  • ULBP ligands to KG2D
  • 4- IBB ligand to CD137
  • Pilar 9 ligand to CD
  • cytokines The ability of different cytokines to support activation, expansion and viability of engineered and non-engineered ⁇ T-cells is tested by adding cytokines to whole PBMCs or enriched engineered and non-engineered ⁇ T-cell populations.
  • cytokine activation support various cytokines are individually added to separate cell cultures every 3 days at 100 R7/mL.
  • the cytokines that are tested include IL-2, IL-7, IL-12, IL-15, IL-33, IL-21, IL-18, IL-19, IL-4, IL-9, IL-23, IFN- ⁇ , and ILl .
  • a sample of cells is harvested and the composition of the cell population, i.e., percentages of ⁇ T-cells, ⁇ T-cells, B-cells, and K cells is determined by flow cytometry.
  • Example 30 Activation-derived V ⁇ 1+, V ⁇ 2+ T cell populations are cytotoxic to tumor cells
  • PBMCs were isolated from buffy coat obtained from normal donors using Ficoll paque PLUS (GE Healthcare #17-1440-02) density gradient centrifugation and plated in 24-well plates at 1 x 106 cells/mL in R2 medium (10% fetal bovine serum in RPMI1640 supplemented with penicillin/streptomycin, L-glutamine and 100 IU/mL of human recombinant IL2).
  • ⁇ T cells were plated on wells coated with either 1 ⁇ g/ml of ⁇ 1 specific MAbs (TS1, TS8.2) or 62 specific MAbs (15D, B6) to activate ⁇ cells within the PBMC population. 50% medium exchange was performed on day 3 and 5.
  • activated cells were moved to 6-well culture dishes without any MAb coating, expanded and maintained at -l x lO 6 cells/mL until day 14.
  • ⁇ T cells were positively selected and depleted from ⁇ 1 and ⁇ 2 activated cultures using IP26 monoclonal antibody (Biolegend #306702) bound to anti-Mouse IgG MicroBeads (Miltenyi # 130-048-401).
  • V ⁇ 1+ and V ⁇ 2+ T cell populations were highly enriched.
  • Positively selected ⁇ T cells were also collected ( ⁇ enriched). These enriched V ⁇ 1+, V ⁇ 2+ and ⁇ T cell cultures were maintained in R2 medium until Day 22.
  • ⁇ and ⁇ T cell composition of enriched cultures was determined by flow cytometry surface TCR staining using TS8.2, B6 and IP26 antibodies for ⁇ 1, 62 and ⁇ , respectively.
  • the highly enriched cultures contained 92%, 98% and 99% of V ⁇ 1+ (TS8.2+), V ⁇ 2+ (B6+) and ⁇ (IP26+) T cells respectively.
  • V ⁇ 1+ T cells show killing of the epithelial tumor cell lines BxPC3 and SKMEL5 as well as the plasmacytoma cell line RPMI8226.
  • FIG. 32A while V ⁇ 2+ T cells show potency mostly towards RPMI8226 and were less effective against the solid tumor cell lines, ⁇ T cells do not show any cytotoxic activity.
  • the cytotoxic activity against various tumor cell lines and primary tumor cells are tested at effector to target ratio between 1 : 1 to 40: 1. Lysis of tumor cell lines and primary tumor cells are measured by detecting the release of intracellular enzymes lactate dehydrogenase. The percentage of ⁇ T-cells expressing engineered tumor recognition moieties in the culture is measured by flow cytometry, ELISA and/or ELISPOT assays.
  • Cohorts of immune-deficient mice engrafted with human tumor xenografts, or huPBMC- NOG (Taconic) mice, or mice with humanized immune system as described above, are injected subcutaneously or orthotopically with cells derived from patient-derived tumor or tumor cell lines, including cancers of the colon, breast, ovary, kidney, head and neck, prostate, bladder, oral cavity, pancreas and liver, and allowed to reach an average size of 50-100mm 3 .
  • Enriched or isolated ⁇ - ⁇ cells are injected intravenously into mice or directly into the tumor at a range of doses.
  • Tumor regression is defined as a reduction in tumor volume after ⁇ - ⁇ cell dosing, and compared to untreated and standard of care for the specific indication.
  • naive or engineered ⁇ T-cells are labeled with GFP or luciferase and injected to tumor-bearing mice to follow their persistence and homing.
  • tumors are harvested and GFP positive cells were analyzed by flow cytometry and immunohistochemistry.
  • Example 33 Polyclonal TCR diversity of V ⁇ 1 and V ⁇ 2 populations derived from antibody specific activation TCR chains were amplified and cloned out of TS8.2 and B6 activated populations.
  • PBMCs cultures were harvested after 14 days of specific activation with ⁇ 1 specific activating mAbs TS8.2 and the 62 specific MAb B6.
  • PBMCs cultures were lysed in 350 ⁇ RLT buffer (Qiagen,), Total RNA was purified from 5X10 5 cell using the Qiagen RNeasy Mini Kit (Qiagen, catalog number 74106), following the manufacturer' s instructions. In brief, 350 ⁇ of 70% Ethanol was added to the cell lysate to provide ideal binding conditions.
  • RT PCR Full length delta chains were amplified using the 5' ⁇ 1 (5'
  • TCTTCCAACTTGGAAGGGAGAACGAAGTC 3 ' ⁇ 5 (5' TCTTCCAACTTGGAAGGGGGAACGA 3') , ⁇ 8 (5' TCTTCCAACTTGGAAGGGAGAACAAAGTC 3') ⁇ 9 (5' GCAGGTCACCTAGAGCAACCTCAAATTTCC 3') in combination with a single 3 ' Cgamma primer (5' G G AAG A A A A ATAGTG G G CTTG G G G G G A A 3')
  • the delta and gamma transcripts were amplified from 100 ng total RNA using reverse transcriptase polymerase chain reaction (RT-PCR). A total of five RT-PCR reactions were run for each sample activated with the TS8.2 MAb ( ⁇ 1, ⁇ 2- ⁇ 4, ⁇ 5, ⁇ 8 and ⁇ 9 ) and two RT-PCR reactions were run for each sample activated with the B6 MAb (62, and ⁇ 9).
  • RT-PCR reverse transcriptase polymerase chain reaction
  • the QIAGEN One Step RT-PCR kit was used for amplification, (Qiagen, Inc.). This kit provides a blend of Sensiscript and
  • RNA RNA
  • dNTP mix dNTP mix
  • buffer dNTP mix
  • Q- Solution a novel additive that enables efficient amplification of "difficult" (e.g., GC-rich) templates.
  • Reaction mixtures were prepared that included 5 ⁇ 1 of RNA, 0.5 of 100 ⁇ of either delta or gamma chains primers (custom synthesized by IDT), 5 ⁇ of 5 xRT-PCR buffer, 1 ⁇ dNTPs, 1 ⁇ of enzyme mix containing reverse transcriptase and DNA polymerase, and 0.4 ⁇ of ribonuclease inhibitor RNasin (1 unit).
  • the reaction mixture contains all of the reagents required for both reverse transcription and PCR.
  • the thermal cycler program was RT step 50° C. for 30 minutes 95° C. for 15 minutes followed by 30 cycles of (95° C. for 30 seconds, 48° C. for 30 seconds, 72° C. for 1.0 minutes). There was then a final incubation at 72° C. for 10 minutes.
  • the extracted PCR products were directly cloned into pCI expression vector. Nucleotide sequences were analyzed using EVIGT to identify germline V, D and J gene members with the highest sequence homology.
  • Non-modified ⁇ T-Cells will be formulated in freezing media and placed in cryogenic storage units such as liquid nitrogen freezers (-195° C) or ultra-low temperature freezers (-65° C, -80° C or -120° C) for long-term storage.
  • the freeze media will contain dimethyl sulfoxide (DMSO), sodium chloride (NaCl), dextrose, dextran sulfate or hydroyethyl starch (HES) with physiological pH buffering agents ranging between 6.5 and 7.5.
  • the cryopreserved ⁇ T-cells will be thawed and further processed by stimulation with antibodies, proteins, peptides, and cytokines.
  • the cryopreserved ⁇ T-Cells will be thawed and genetically modified as previously described in this application.
  • the engineered ⁇ T-cells will be further cryopreserved to generate cell banks in quantities of 10, 100, 200 vials at 10 6 to 10 8 cells per mL in freeze media.
  • the non-engineered and/or engineered ⁇ T-cells will be further cryopreserved to generate cell banks in quantities of 10, 100, 200, 500, and 1,000 vials or bags at 10 6 to 10 8 cells per mL in freeze media.
  • Example 35 Alternative Cryopreservation of ⁇ T-Cells in Freeze Media to Generate
  • cryoprotectants are added to the cryopreservation support described in the previous example to provide nutritional support and biophysical cell protection against lysis during the freezing and thawing process. These include D-glucose, mannitol, sucrose, adenine, guanosine, recombinant human albumin, citrate, ant-coagulant, Benzonase, DNase, propylene glycol, ethylene glycol, 2-methyl-2,4-pentanediol. Additional additives designed to provide buffering capacity for high cell density frozen product include inorganic phosphate, sodium bicarbonate and HEPES.
  • Example 36 Cryopreservation of ⁇ T-Cells in Freeze Media to Generate Cell Banks for Further Processing
  • Initial freezing of ⁇ T-cells are performed in a temperature controlled ramp designed to achieve a freezing rate of between -0.1° C to -5° C per minute using a controlled rate freezer (e.g. CryoMed Controlled Rate Freezer) or a mechanical -70° C freezer with appropriately insulated racking system to deliver the desired freeze rate.
  • the frozen cells are placed in -70° C freezers for short-term storage of up to 30 to 60 days.
  • the frozen cells are placed in liquid N 2 storage tanks for longer-term storage of up to 12, 24, 36 and 48 months while maintaining ⁇ T-cell number and cell functions without deterioration as measured by methods described in earlier sections.
  • cryopreserved cells described in this example will be thawed and further stimulated and expanded in suitable closed vessels such as cell culture bags and/or bioreactors to generate suitable quantities of engineered ⁇ T-cells for administration to a subject.
  • Example 37 Formulation of ⁇ T-Cells for Direct Infusion into Patients
  • Engineered ⁇ T-cells are concentrated by centrifugation and/or membrane dia-filtration to between 5 x 10 6 cells/mL and 10 8 cells/mL in physiological buffer containing cryo-protective excipients and placed in cryogenic storage units such as liquid nitrogen, or ultra-low temperature freezers for long-term storage.
  • Fresh or frozen engineered and/or non-engineered ⁇ T-cells are thawed at bedside and intravenously infused into human subjects. About 1 cell per kilogram to about 1 x 10 10 cells per kilogram engineered and/or non-engineered ⁇ T-cells are infused into the human subject over a 30- 60 minute period of time.
  • the engineered ⁇ T-cells are administered with or without the aid of the co-stimulatory cytokine IL-2 or other cytokines. Optionally, the procedure is repeated. In vivo expansion of the ⁇ T-cells in the subject is measured by flow cytometry.
  • ⁇ T cell activators in the form of murine antibodies were produced by immunization of recombinant soluble human ⁇ TCR.
  • ⁇ 1 -specific activators were generated by immunization using ⁇ 1- TCR- FC
  • ⁇ 2-specific activators were generated by immunization using ⁇ 9 ⁇ 2- TCR- FC, both constructs comprising the mature ECD of the y ⁇ TCR chains fused to human IgGlFC.
  • Three strains of mice (Balb/c, CD-I and FVB) were inoculated with human recombinant y ⁇ TCR to provide hybridomas that secrete high affinity, murine monoclonal antibody activators.
  • hy ⁇ TCR-Fc fusion constructs were generated by PCR amplification, ⁇ 1 TCR chains were amplified from RNA isolated from the BE13 (DSMZ #ACC 396), a T cell leukemia cell line expressing ⁇ 1 TCR. ⁇ 9 ⁇ 2 TCR chains were amplified from RNA isolated from Zoledronic acid activated human PBMCs. Soluble ⁇ 1TCR-FC and ⁇ 2TCR-FC were purified from the supernatant of transiently transfected HEK 293 cells.
  • soluble TCR 10 ⁇ g was emulsified with an equal volume of TITERMAX® Gold (Sigma Aldrich) or Imject Alum Adjuvant (Thermo Fisher) and used for the immunization of each mouse.
  • the resulting emulsions were then injected into six mice (2 each: Balb/c, CD-I and FVB) via the footpad route.
  • Solid-phase ELIS A assays were used to screen mouse sera for mouse IgG antibodies specific for human y ⁇ TCR. Briefly, 96 well plates (VWR International, Cat. # ⁇ 10744) were coated with recombinant y ⁇ TCR- at 1 ⁇ g/ml in ELIS A coating buffer overnight. After washing with PBS containing 0.02% (v/v) Tween 20, the wells were blocked with 3% (w/v) BSA in PBS, 200 L/well for 1 hour at room temperature (RT). Mouse serum was titrated (1 : 100, 1 :200, 1 :400, and 1 :800) and added to the y ⁇ TCR coated plates at 50 ⁇ ⁇ and incubated at RT for 1 hour.
  • the plates are washed and then incubated with 50 ⁇ ⁇ HRP-labeled goat anti -mouse IgG diluted 1 : 10,000 in 3% BSA-PBS or 2% FCS in PBS for 1 hour at RT. Again the plates were washed and 40 L/well of a TMB substrate solution (Thermo Scientific 34028) was added for 15 minutes at RT. After developing, an equal volume of 2N H2S04 was added to stop substrate development and the plates were analyzed by spectrophotometer at OD 450.
  • Sera-positive immunized mice were sacrificed and draining lymph nodes (popliteal and inguinal) were dissected out and used as a source for antibody producing cells.
  • a single cell suspension of B cells (766x 106 cells) was fused with non-secreting P3x63Ag8.653 myeloma cells (ATCC #CRL-1580) at a ratio of 1 : 1 by electrofusion. Electrofusion was performed using the BTX HybrimmuneTM System, (BTX Harvard Apparatus) as per the manufacturer's directions.
  • the cells were resuspended in hybridoma selection medium supplemented with Azaserine (Sigma #A9666), high glucose DMEM medium with sodium pyruvate (Cellgro cat#15-017-CM) containing 15% Fetal Clone I serum (Hyclone), 10% BM Condimed (Roche Applied Sciences), 4 mM L-glutamine, 100 R7 Penicillin-Streptomycin and 50 ⁇ 2-mercaptoethanol and then plated in three T150 flasks in 50 mL selection medium per flask. The flasks were then placed in a humidified 37° C. incubator containing 5% C02 and 95% air for 6-7 days.
  • the library consisting of the cells grown in bulk in the T150 flask was plated at 1 cell per well in Falcon 384 well flat-bottom plates using the Aria II cell sorter.
  • the selected hybridomas were then grown in 90 ⁇ L, of culture medium containing 15% Fetal Clone I serum (Hyclone), 10% BM-Condimed (Roche Applied Sciences), 1 mM sodium pyruvate, 4 mM L- glutamine, 100 R7 Penicillin-Streptamycin, 50 ⁇ 2-mercaptoethanol, and 100 ⁇ hypoxanthine. Any remaining unused hybridoma library cells were frozen for future library testing. After ten days of growth supernatants from each well of the plated cells were assayed for antibodies reactive for ⁇ 1TCR by ELISA and FACS assays.
  • High bond ELISA 96 well plates were coated with soluble y ⁇ TCR proteins generated by paring the following ⁇ TCR chains: ⁇ 1, ⁇ 8 ⁇ 2, ⁇ 9 ⁇ 1 and ⁇ 9 ⁇ 2.
  • Soluble TCRs were diluted and used at ⁇ g/ml in sodium carbonate buffer overnight at 4° C. The plates were washed and blocked with 3% BSA in PBS/Tween for one hour at 37° C. and used immediately or kept at 4° C. Undiluted hybridoma supernatants were incubated on the plates for one hour at RT. The plates were washed and probed with HRP labeled goat anti-mouse IgG diluted 1 : 10,000 in 3% BSA-PBS for one hour at RT. The plates were then incubated with substrate solution as described above and read at OD 450. Wells containing immunoglobulin that preferentially bound human ⁇ 1 TCR chain as determined by a signal above background, were transferred and expanded.
  • the resulting ⁇ 1 and ⁇ 2 TCR specific clonal hybridomas were cryopreserved in CS-10 freezing medium (Biolife Solutions) and stored in liquid nitrogen.
  • Exemplary distinct monoclonal antibodies that specifically bind, activate, and expand ⁇ 1 T cells were selected for sequencing and further analysis.
  • sequence analysis of the heavy chain variable regions (FIG. 33) and light chain variable regions (FIG. 34) of selected ⁇ 1- ⁇ TCR specific monoclonal antibodies generated in Example 39 confirmed novel complementarity determining regions and display of novel VDJ arrangements.
  • the complementarity determining regions set forth in FIGs. 33-34 are as defined by Kabat.
  • Exemplary distinct monoclonal antibodies that specifically bind, activate, and expand ⁇ 2 T cells were separately selected for sequencing and further analysis.
  • sequence analysis of the heavy chain variable regions (FIG. 35) and light chain variable regions (FIG. 36) of selected ⁇ 2- ⁇ TCR specific monoclonal antibodies generated in Example 39 confirmed novel complementarity determining regions and display of novel VDJ arrangements.
  • the complementarity determining regions set forth in FIGs. 35-36 are as defined by Kabat.
  • RNA was eluted by 100 ⁇ of RNase-free water loaded directly to the spin column membrane.
  • the quality of the RNA preparations was determined by fractionating 3 ⁇ ⁇ in a 1% agarose gel before being stored at -80° C. until used.
  • variable region of the Ig heavy chain of each hybridoma was amplified using a 5' primer mix comprising thirty-two mouse specific leader sequence primers, designed to target the complete mouse VH repertoire, in combination with a 3 ' mouse Cy primer specific for all mouse Ig isotypes.
  • a 400 bp PCR fragment of the VH was sequenced from both ends using the same PCR primers.
  • VH and VL transcripts were amplified from 100 ng total RNA using reverse transcriptase polymerase chain reaction (RT-PCR).
  • RT-PCR reactions were run for each hybridoma: four for the VK light chain and four for the V ⁇ heavy chain.
  • the One Step OneStep Ahead RT-PCR kit was used for amplification (Qiagen # 220213).
  • Reaction mixtures were prepared that included 5 ⁇ _, of RNA, 0.5 of 100 ⁇ of either heavy chain or ⁇ light chain primers (custom synthesized by IDT), 12.5 ⁇ _, of master mix with DNA polymerases, buffers, dNTPs, 1 ⁇ . of enzyme mix containing reverse transcriptase and DNA polymerase, and 0.4 ⁇ _, of ribonuclease inhibitor RNasin (1 unit).
  • the reaction mixture contains all of the reagents required for both reverse transcription and PCR.
  • the thermal cycler program was set for an RT step 50° C. for 10 minutes, 95° C. for 5 minutes, followed by 30 cycles of PCR (95° C. for 30 seconds, 58° C. for 30 seconds, 72° C. for one minute). There was then a final incubation at 72° C. for 10 minutes.
  • PCR products were prepared for direct DNA sequencing, with the QIAquickTM PCR
  • FIG. 33 depicts the contiguous amino acid sequences of heavy chain variable regions from ⁇ 1 -specific antibodies.
  • FIG. 34 depicts the corresponding contiguous amino acid sequences of the light chain variable regions. Taken together FIGs. 33-34 provide the annotated sequences of the identified operable anti ⁇ 1 TCR antibodies.
  • FIG. 35 depicts the contiguous amino acid sequences of heavy chain variable regions from ⁇ 2-specific antibodies.
  • FIG. 36 depicts the corresponding contiguous amino acid sequences of the light chain variable regions. Taken together FIGs. 35-36 provide the annotated sequences of the identified operable anti ⁇ 2 T CR antibodies.
  • the third gamma delta population is V ⁇ 3 T cells, which take up about 0.2% of circulating T cells.
  • V ⁇ 3 T cells are rare in blood but are rich in liver and in patients with leukemias and some chronic viral infections.
  • Other minor subsets include V ⁇ 4, V ⁇ 5, V ⁇ 6, V ⁇ 7, and V ⁇ 8 ⁇ T cells, are composed of VJa genes spliced to the C5 respectively, encoding distinct TCR alpha and delta proteins.
  • each plasmid (delta+ gamma chains) were co- transfected using 293fectinTM Transfection Reagent (Thermo Fisher #12347019) in serum free media.
  • Soluble TCRs-FC proteins were captured to the surface of ELISA plate coated with 1 ⁇ g/mL goat anti human FC (Goat Anti-Human IgG, Fc ⁇ Fragment Specific- Jackson ImmunoResearch # 109-005-098). Binding was perform overnight at 4° C. Binding of ⁇ 1-specific specific activators to soluble ⁇ TCRs captured on plates was tested by detection with HRP conjugated secondary antibody: Goat anti mouse FC specific (Jackson ImmunoResearch Laboratories, Inc. Peroxidase- AffiniPure Goat Anti -Mouse IgG, Fc ⁇ Fragment Specific # 115-035-008) diluted to 1 : 10,000 in blocking buffer, followed by adding TMB substrate per well. The results are shown in Fig. 37.
  • TRDV4 and TRDV8 T cells were shown to contribute to the immune response directed against AML, while oligoclonal TRDV ⁇ and TRDV ⁇ might occur in patients who undergo relapse.
  • ⁇ 1 and ⁇ 2 TCR specific antibodies were tested for induction of activation and proliferation of ⁇ T cells. Briefly, 48-well plates (Corning) were coated with goat-anti -mouse Fc- ⁇ polyclonal antibodies at 5 ⁇ g/mL in 50 mM NaHC03 or PBS overnight. Wells were washed with PBS and further blocked with 1% BSA in PBS for 1 hr at 37C and ⁇ -TCR specific antibodies were added at 1 ⁇ g/mL in 0.1% BSA for 2 hrs. For cell labeling, after overnight rest in complete medium fresh or frozen human PBMCs were washed and reconstituted in 5 ⁇ CFSE (PBS) and incubated for 5 min in the dark at room temperature.
  • PBS 5 ⁇ CFSE
  • PBMCs were washed with FBS containing media and reconstituted in RPMI-1640 culture media containing 10% FBS, 2mM Glutamine, 25mM HEPES and 200 IU/mL of rhIL-2 at 10 6 /mL.
  • CFSE-labeled PBMCs were plated at 0.5xl0 6 /well and cultured for 5 days.
  • Example 43 One-step expansion of V ⁇ 1 and V ⁇ 2 T-cells from human PBMCs using specific MAbs
  • D2-22, D2-30, D2-32, D2-33, D2-33, D2-35, D2-36, D2-37) and OKT3 were captured at 1 ⁇ g/mL in 2% FBS (PBS) by pre-coated goat-anti -mouse Fey antibodies in 24-well plates as in example 2 above.
  • Human PBMCs from several donors having initial ⁇ 1 populations between 0.2-0.28%) of total cells and ⁇ 2 population of - 0.2-4% of total cells were plated at 10 6 /mL/well in RPMI-1640 media containing 10% FBS, 2mM Glutamine, 100 IU/mL of rhIL-2. Cells in culture were fed every 2-3 days by media replenishment.
  • Fig. 40 shows fold expansion of ⁇ 1 (A) and 52 (B) cells in PBMC cultures.
  • V ⁇ 1 and V ⁇ 2 MAbs induced expansion of ⁇ 1 and c ⁇ e2ll Ts in 21 days up to -12000 fold for V ⁇ 1 and up to 6700 fold for V ⁇ 2 T cells.
  • Phenotype of expanded ⁇ 1 cells on Day 21 was evaluated by CD27 surface marker expression.
  • Fig. 41 shows that phenotype of V ⁇ 1 T-cells activated with of MAbs on Day 21 is predominantly (>50%) CD27+CD45RA+ (naive) and CD27+CD45RA- (central memory).
  • Example 44 One-step expansion of ⁇ - ⁇ cells from umbilical cord blood
  • V ⁇ 1 T-cells expanded by up to 1503 fold in 21 days after activation with ⁇ 1 specific MAbs.
  • V ⁇ 1 antibodies TS-1, Dl-08, Dl-37, Dl-39 were captured in 24-well plates via coated goat-anti-mouse Fey polyclonal antibodies and cells were activated and expanded as described.
  • ⁇ 1 T cells were enriched by depletion of ⁇ T cells using biotinylated anti-TCR ⁇ antibody and magnetic microbeads (Miltenyi Biotec). Enriched V ⁇ 1 cells were subjected to a second step
  • irradiated PBMC feeder cells 130,000 total enriched cells were cultured in 20 mL of RPMI-1640 medium containing 10% FBS, 2 mM Glutamine, 100 IU/mL IL-2 and 30 ng/mL Dl-35 MAb in the presence of irradiated human allogeneic PBMCs at a ratio of 200: 1
  • the cultures were placed vertically in T25 flask. On Day 18 cells were fed by replacing 70% of the media. From then on, cells were fed every 2-3 days by exchanging 50% of the media and adjusting viable cell density to lxl0 6 /mL and harvested on Day 28. As illustrated in the table below, ⁇ 1 cells were expanded up to about 28,000-fold in a 2-step expansion procedure.
  • Example 46 Two-step expansion of V ⁇ 1 T cells using feeder cells, without ⁇ T cell depletion
  • human PBMCs with starting V ⁇ 1 population of 0.2% were activated and ⁇ 1 cells were expanded for 7 days following a protocol described in Example 6. Briefly, V ⁇ 1 antibodies TS-1, Dl-08, Dl-37, Dl-39 were captured in 24-well plates via coated goat-anti-mouse Fey polyclonal antibodies and cells were activated and expanded as described. On Day 7 cell cultures were harvested and expanded cells were subjected to a second step activation/expansion using irradiated feeder cells.
  • Example 47 Two-step expansion of V ⁇ 1 T cells using feeder cells with ⁇ T cell depletion
  • human PBMCs with starting V ⁇ 1 population of 0.36% were activated and V ⁇ 1 cells were expanded for 14 days following protocol described in Example 4.
  • enriched cells were cultured in 20 mL of RPMI-1640 medium containing 10% FBS, 2 mM Glutamine, 100 IU/mL IL-2 and 30 ng/mL Dl-35 MAb in the presence of irradiated K562 cells at ratios of 49: 1, 9: 1 and 2: 1.
  • the cultures at the specified ratios (25xl0 6 each total live cells) were placed in 6-well G-Rex flask (Wilson Wolf). On Day 18 cells were fed by replacing 75% of the media and harvested on Day 21.
  • ⁇ 1 cells were expanded up to about 31,000-fold in a 2-step expansion procedure.
  • Example 48 ⁇ 1 T cells activated and expanded with V ⁇ 1 MAbs show robust cytotoxicity against tumor cell lines
  • ⁇ 1 T cells were enriched by depletion of ⁇ T cells using anti-TCRaP antibody and magnetic microbeads (Miltenyi). Purified ⁇ 1 cells were used in cytotoxicity assay against Jurkat (leukemia) and Colo205 (colon cancer) cell lines. Briefly, expanded ⁇ 1 T cells were incubated with CFSE labeled target cells at 10: 1, 5: 1, 2: 1, 1 : 1 and 1 :5 effectontarget cell ratio for 4 hours in 96-well round bottom plates (suspension) in complete media containing 100 IU/mL IL-2.
  • V ⁇ 1 cells demonstrated cytotoxicity against both tumor cell lines at various ratios in 4hr assay up to 45%.
  • Example 49 ⁇ 1 T cells activated and expanded with a 2-step procedure including a second step with shaking
  • Fresh blood product collected from an apheresis machine is diluted 1 :3 with PBS without Ca 2+ and Mg 2+ .
  • Diluted blood product is then purify using the Ficoll-PaqueTM PLUS (GE Healthcare) system using the Sepmate (STEMCELL).
  • the enriched lymphocyte layer is then enriched washed twice, first with PBS without Ca 2+ and Mg 2+ , then with 0.25% human serum albumin in PBS without Ca 2+ and Mg 2+ .
  • purified blood product is rested overnight in fetal bovine serum containing and serum free medium on ultra-low attachment 24-well plate, 6-well plate, and T-75 flasks at lxlO 7 cells/mL.
  • the appropriate cell culture vessels including tissue culture treated 24-well plate, 6-well plate, T75 flask, or gas permeable bags are coated with anti-Fc antibody. After initial coating, the vessels are stored at 2-8 °C in the dark overnight. After initial anti-Fc coating, the vessel is blocked with 5% fetal bovine serum in PBS without Ca 2+ and Mg 2+ , and incubated for 1-hour at 37 °C CO 2 incubator. After the 1-hour incubation, the vessel is washed once with PBS without Ca 2+ and Mg 2+ , then the vessel is captured with V ⁇ 1 specific monoclonal antibodies. Then the vessel is incubated at room temperature for up to 4 hours with and without shaking. At the end of the capture, the vessel is washed twice with PBS without Ca 2+ and Mg 2+ , and is ready for T-cell activation.
  • PBMC is diluted to 0.5 x 10 6 to 2 x 10 6 cells/cm 2 using either fetal bovine serum containing and serum free medium. Then the diluted PBMC is added to the V ⁇ 1 specific monoclonal antibodies immobilized vessel. PBMC is maintained statically between 3 to 7 days. Fresh cell culture medium is added daily starting on day 3 to maintain sufficient nutrient level such as glucose and glutamine, and diluting the accumulation of toxic byproducts such as lactate and ammonium. At the end of the initial activation, cells are harvested by mechanical or chemical methods. Cells are then transferred to new flasks for subsequent expansion.
  • T-cell activation After initial T-cell activation, cell culture is maintained in 37 °C CO 2 incubator for up to 21 days. Initially, activated cell culture is diluted to le6 cells/mL in either fetal bovine serum containing and serum free medium.
  • the T-cells can be cultivated in static T-flasks with ultra-low attachment or tissue culture treated surfaces, including T-25, T-75, T-150 and T-225 flasks, or in standard non- baffled or baffled shake flasks, including 125 mL, 250 mL, 500 mL, 1000 mL, 2000 mL, and 3000 mL total vessel volumes.
  • the working volume to surface area ratio is maintained at 0.5 mL/cm 2 or below to ensure sufficient culture oxygenation.
  • the working volume to total vessel volume ratio is maintain at 1 to 2 or below on orbital shaking platforms to ensure sufficient mixing and aeration.
  • Viable cell culture density VCD
  • Metabolite measurements are taken of glucose, lactate, glutamine, glutamate, ammonium, sodium ion, potassium ion, and calcium ion.
  • pH and gas measurements including partial pressure of oxygen, CO 2 , and pH are also taken.
  • Oxygen, CO 2 , and pH measurement are taken with temperature compensation.
  • Feeding based on VCD or metabolite can be both used to maintain cell cultures. For VCD-based feeding strategy, if VCD increased to 1.5 x 10 6 cells/mL or above, culture is diluted to 1 x 10 6 cells/mL using fresh medium. For metabolite-based feeding strategy, fresh medium is added when glucose level is below lg/L to increase to 1.5g/L.
  • Donor A fresh blood product which had a starting V ⁇ 1 composition of 0.4%, was purified by Ficoll and rested overnight in ultra-low attachment T75 flask. After activation with immobilized ⁇ 1 specific monoclonal antibodies ⁇ 1-35 and ⁇ 1-08 from day 0 to day 5, the cultures were transferred to shake flasks. From day 5 to day 19, the cultures were sampled daily, and nutrient and waste concentrations were maintained by VCD-based feeding strategies using fresh serum medium. The V ⁇ 1 fold expansion and purity for ⁇ 1-35 and ⁇ 1-08 activated cultures are illustrated in Fig. 43
  • Donor B fresh blood product which had a starting V ⁇ 1 composition of 0.1%, was purified by Ficoll and rested overnight in ultra-low attachment T75 flask. After activation with immobilized ⁇ 1 specific monoclonal antibody ⁇ 1-08 from day 0 to day 5, the cultures were transferred to shake flasks. From day 5 to day 19, the cultures are sampled daily, and nutrient and waste concentrations were maintained by VCD-based feeding strategies using either fresh serum- containing medium or fresh serum free medium. The V ⁇ 1 fold expansion and doubling time (DT) (accumulative from day 0 to day 19) in serum containing and serum free medium expanded cultures are illustrated in Fig. 44.
  • Donor C fresh blood product which had a starting V ⁇ 1 composition of 0.5%, was purified by Ficoll and rested overnight in ultra-low attachment T75 flask. After activation with immobilized ⁇ 1 specific monoclonal antibody ⁇ 1-08 from day 0 to day 7 (49c.1) and from day 0 to day 5, the cultures were transferred to shake flasks. From day 7 to day 19, the cultures were sampled daily, and nutrient and waste concentrations were maintained by glucose-based feeding strategies using fresh serum medium. And for the other two cultures, from day 7 to day 19, the cultures were sampled daily, and nutrient and waste concentrations were maintained by either VCD based feeding or glucose-based feeding strategies using fresh serum medium.
  • the V ⁇ 1 fold expansion and doubling time (DT) (accumulative from day 14 to day 19) are illustrated in Fig. 45.
  • Fig. 45 section 49c.1 illustrates V ⁇ 1 fold expansion and DT (accumulative from day 14 to day 19) from culture that was 7 day activated and then maintained using glucose-based feeding strategy from day 7 to day 19.
  • Fig. 45 section 49c.2 illustrates V ⁇ 1 fold expansion and DT (accumulative from day 14 to day 19) 5 day activated culture that was then maintained using VCD- based feeding strategy from day 7 to day 19.
  • Fig. 45 section 49c.3 illustrates V ⁇ 1 fold expansion and DT (accumulative from day 14 to day 19) 5 day activated culture that was then maintained using VCD-based feeding strategy from day 7 to day 19.
  • Example 50 Transduction of V ⁇ 1 T cells with retroviral chimeric antigen receptor construct
  • Peripheral blood mononuclear cells from a healthy donor were stimulated with an immobilized anti-V ⁇ 1 specific monoclonal antibody ( ⁇ 1-08) and cultured for 19 days in media supplemented with rhIL-2 as described in example 49a.
  • isolated PBMCs were activated in 24-well plates with Dl-08 V ⁇ 1 MAb captured via pre-coated goat-anti -mouse Fey antibodies.
  • Cells were plated at le 6 /mL/well in RPMI1640 media containing 10% FBS, 25 mM HEPES, 2 mM Glutamine and 100 IU/mL IL-2. After five days cells were transferred to shake flasks and expanded as described in example 49a. On day 19 cells were harvested, washed and re-stimulated with PHA (2 ⁇ g/mL) for 2 days followed by transduction with a retroviral vector encoding an anti-CD20
  • Example 51 Epitope Mapping of antibodies to ⁇ T cell TCRs
  • the aim was to map the epitope specificities of ⁇ 1-specific activators. All ⁇ 1-specific activators are directed against the ⁇ 1 chain of the ⁇ TCR. Mapping was done by using recombinant chimeric molecules of human and dolphin ⁇ 1 TCR chain. Despite of a high amino acid identity between the human and dolphin ⁇ 1 chain, ⁇ 1 specific activators did not bind dolphin ⁇ 1 chain.
  • mAbs were confirmed to bind specifically to the variable region of the ⁇ 1 chain of ⁇ TCR by Flow cytometry analysis.
  • the ⁇ 1 ⁇ 8 TCR was expressed as soluble FC fusion protein in a correctly folded conformation, determined by binding of all panel of anti ⁇ 1 mouse monoclonal antibodies (mAbs). These mAbs were shown to target conformationally-dependent epitopes of the ⁇ TCR.
  • the expression vector used in this study is pCI-Neo Mammalian Expression Vector
  • the ECD of human ⁇ 1 chain was amplified from ⁇ 1 BE- 13 T cell line.
  • the dolphin V ⁇ 1 sequence was ordered as a synthetic gene base on the published sequence (Tursiops truncatus mRNA for T cell receptor delta chain (TRD gene), isolate 5R1D80) (GenBank: LN ⁇ 10748.1). Using these cDNAs as templates new chimeric molecules were cloned from synthetic fragments (IDT DNA) to be cloned into the 5' Agel site at the signal peptide and 3' E.coRI at the delta constant region.
  • HEK-293 cells were cultured in 90-mm cell culture plates in a DMEM medium (Thermo Fisher Scientific) with 10% fetal calf serum (HyCloneTM FetalCloneTM I Serum (U.S.) - GE
  • ⁇ 1 specific activators- monoclonal antibodies differed in their binding pattern to the chimeras and a distinct binding pattern could be identified for each monoclonal antibody, as tested in ELISA assay.
  • Polystyrene microtiter plates (Greiner bio-one # 6550 ⁇ 1) were coated overnight at room temperature with 1 ⁇ g/well of Goat anti human FC specific antibody (Jackson ImmunoResearch # 109-005-098) in ELISA coating buffer (50 mm Na2C03, 0 05% NaH3, pH 9 6). The plates were washed three times with washing buffer (PBS 0 05% (v/v) Tween 20) and then blocked for 1 h at room temperature (RT) with 100 ⁇ /well of ELISA blocking buffer (3%BSA in PBST). Binding of soluble TCRs to blocked plates was done by adding 100ml of each supernatant and incubation for 1 hour at Room temperature. Each antibody was diluted to 1 ⁇ g/ml in ELISA blocking buffer, and tested for binding to each ⁇ TCR chimeric molecule.
  • Detection of binding was done by adding 100 ⁇ /well of HRP conjugated secondary antibody: Goat anti mouse FC specific (Jackson ImmunoResearch Laboratories, Inc. Peroxidase- AffiniPure Goat Anti -Mouse IgG, Fey Fragment Specific # 1 15-035-008) diluted to 1 : 10,000 in blocking buffer. The amount of bound antibodies was detected by the use of TMB substrate (Thermo Fisher

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Hematology (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Rheumatology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Pain & Pain Management (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2017/032530 2016-05-12 2017-05-12 METHODS FOR SELECTIVE EXPANSION OF γδ T-CELL POPULATIONS AND COMPOSITIONS THEREOF Ceased WO2017197347A1 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
EP17796994.6A EP3454870A4 (en) 2016-05-12 2017-05-12 METHOD FOR SELECTIVE EXPANSION OF GAMMA DELTA T CELL POPULATIONS AND COMPOSITIONS THEREOF
JP2018559834A JP7210286B2 (ja) 2016-05-12 2017-05-12 γδT細胞集団の選択的増殖方法及びその組成物
IL301527A IL301527B2 (en) 2016-05-12 2017-05-12 Methods for selective expansion of gamma delta T-cell populations and preparations thereof
KR1020187035576A KR102519861B1 (ko) 2016-05-12 2017-05-12 γδ T-세포 집단의 선택적 확장을 위한 방법 및 그의 조성물
CA3023993A CA3023993A1 (en) 2016-05-12 2017-05-12 Methods for selective expansion of .gamma..delta. t-cell populations and compositions thereof
MX2018013864A MX2018013864A (es) 2016-05-12 2017-05-12 Métodos para la expansión selectiva de poblaciones de células t gama y composicicones de estas.
CN201780042797.3A CN110072533B (zh) 2016-05-12 2017-05-12 选择性扩增γδT细胞群的方法及其组合物
AU2017261804A AU2017261804A1 (en) 2016-05-12 2017-05-12 Methods for selective expansion of γδ T-cell populations and compositions thereof
US15/563,830 US11299708B2 (en) 2016-05-12 2017-05-12 Methods for selective expansion of γδ T-cell populations and compositions thereof
CN202410184013.2A CN118421557A (zh) 2016-05-12 2017-05-12 选择性扩增γδT细胞群的方法及其组合物
IL262919A IL262919B2 (en) 2016-05-12 2018-11-11 Methods for selective expansion of gamma delta t-cell populations and preparations thereof
ZA2018/08140A ZA201808140B (en) 2016-05-12 2018-11-30 Methods for selective expansion of gd t-cell populations and compositions thereof
US17/718,152 US12364714B2 (en) 2016-05-12 2022-04-11 Methods for selective expansion of gamma delta t-cell populations and compositions thereof
JP2022133983A JP7791789B2 (ja) 2016-05-12 2022-08-25 γδT細胞集団の選択的増殖方法及びその組成物
AU2023278051A AU2023278051A1 (en) 2016-05-12 2023-12-06 Methods for selective expansion of γδ T-cell populations and compositions thereof
JP2025123803A JP2025170245A (ja) 2016-05-12 2025-07-24 γδT細胞集団の選択的増殖方法及びその組成物

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662335572P 2016-05-12 2016-05-12
US62/335,572 2016-05-12

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/563,830 A-371-Of-International US11299708B2 (en) 2016-05-12 2017-05-12 Methods for selective expansion of γδ T-cell populations and compositions thereof
US17/718,152 Division US12364714B2 (en) 2016-05-12 2022-04-11 Methods for selective expansion of gamma delta t-cell populations and compositions thereof

Publications (1)

Publication Number Publication Date
WO2017197347A1 true WO2017197347A1 (en) 2017-11-16

Family

ID=60267413

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/032530 Ceased WO2017197347A1 (en) 2016-05-12 2017-05-12 METHODS FOR SELECTIVE EXPANSION OF γδ T-CELL POPULATIONS AND COMPOSITIONS THEREOF

Country Status (11)

Country Link
US (2) US11299708B2 (https=)
EP (1) EP3454870A4 (https=)
JP (3) JP7210286B2 (https=)
KR (1) KR102519861B1 (https=)
CN (2) CN118421557A (https=)
AU (2) AU2017261804A1 (https=)
CA (1) CA3023993A1 (https=)
IL (2) IL301527B2 (https=)
MX (2) MX2018013864A (https=)
WO (1) WO2017197347A1 (https=)
ZA (1) ZA201808140B (https=)

Cited By (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018147805A1 (en) * 2017-02-08 2018-08-16 Agency For Science, Technology And Research Gamma delta t cells and a method of augmenting the tumoricidal activity of the same
CN109234236A (zh) * 2018-09-29 2019-01-18 吉林大学第医院 一种嵌合抗原受体γδT细胞的制备方法
WO2019069125A1 (en) 2017-10-06 2019-04-11 Oslo Universitetssykehus Hf CHIMERIC ANTIGEN RECEPTORS
GB2569692A (en) * 2018-10-30 2019-06-26 Tc Biopharm Ltd T cell antigen receptor chimera
WO2019147735A1 (en) * 2018-01-23 2019-08-01 New York University Antibodies specific to delta 1 chain of t cell receptor
WO2019222760A1 (en) * 2018-05-18 2019-11-21 Children's National Medical Center Improved targeted t-cell therapy
WO2020010229A1 (en) * 2018-07-06 2020-01-09 Arizona Board Of Regents On Behalf Of The University Of Arizona Car t cell therapy to target t cell specific cancers
WO2020021045A3 (en) * 2018-07-26 2020-03-12 Ospedale Pediatrico Bambino Gesù (Opbg) Therapeutic preparations of gamma-delta t cells and natural killer cells and methods for manufacture and use
WO2020060406A1 (en) * 2018-09-19 2020-03-26 Lava Therapeutics B.V. Novel bispecific antibodies for use in the treatment of hematological malignancies
WO2020072536A1 (en) 2018-10-01 2020-04-09 Adicet Bio, Inc. COMPOSITIONS AND METHODS REGARDING ENGINEERED AND NON- ENGINEERED γδ-Τ CELLS FOR TREATMENT OF HEMATOLOGICAL TUMORS
WO2020072546A2 (en) 2018-10-01 2020-04-09 Adicet Bio, Inc. COMPOSITIONS AND METHODS REGARDING ENGINEERED AND NON-ENGINEERED γδ -T CELLS FOR TREATMENT OF SOLID TUMORS
WO2020117862A1 (en) 2018-12-03 2020-06-11 Adicet Bio, Inc. Methods for selective in vivo expansion of gamma delta t-cell populations and compositions thereof
US20210015866A1 (en) * 2018-03-23 2021-01-21 La Jolla Institute For Allergy And Immunology Tissue resident memory cell profiles, and uses thereof
WO2021032963A1 (en) 2019-08-16 2021-02-25 GammaDelta Therapeutics Limited Therapeutic uses of anti-tcr delta variable 1 antibodies
WO2021032961A1 (en) 2019-08-16 2021-02-25 GammaDelta Therapeutics Limited Ex vivo gamma delta t cell populations
WO2021084063A1 (en) 2019-10-31 2021-05-06 Morphosys Ag Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells
US20210137930A1 (en) * 2018-02-13 2021-05-13 Iovance Biotherapeutics, Inc. Expansion of tumor infiltrating lymphocytes (tils) with adenosine a2a receptor antagonists and therapeutic combinations of tils and adenosine a2a receptor antagonists
WO2021113558A3 (en) * 2019-12-03 2021-07-08 Adicet Bio, Inc. METHODS FOR EXPANDING γδ T-CELL POPULATIONS WITH MULTIVALENT AGENTS AND COMPOSITIONS THEREOF
WO2021142260A1 (en) * 2020-01-10 2021-07-15 Dyne Therapeutics, Inc. Muscle targeting complexes and uses thereof for modulation of acvr1
US20210284730A1 (en) * 2020-03-13 2021-09-16 Janssen Biotech, Inc. Materials and methods for modulating delta chain mediated immunity
US20210309711A1 (en) * 2018-07-20 2021-10-07 Duke University Anti-lypd3 car t-cell therapy for the treatment of cancer
WO2021229226A1 (en) * 2020-05-12 2021-11-18 GammaDelta Therapeutics Limited Methods for isolating gamma delta t cells
WO2021226321A3 (en) * 2020-05-07 2021-12-16 Phanes Therapeutics, Inc. Anti-tumor associated antigen antibodies and uses thereof
WO2022034562A1 (en) 2020-08-14 2022-02-17 GammaDelta Therapeutics Limited Multispecific anti-tcr delta variable 1 antibodies
WO2022049550A1 (en) 2020-09-04 2022-03-10 GammaDelta Therapeutics Limited Immunotherapy composition
US20220088069A1 (en) * 2018-11-05 2022-03-24 Iovance Biotherapeutics, Inc. Treatment of nsclc patients refractory for anti-pd-1 antibody
EP4015525A2 (en) 2018-03-23 2022-06-22 GammaDelta Therapeutics Limited Lymphocytes expressing heterologous targeting constructs
WO2022175413A1 (en) 2021-02-17 2022-08-25 Adaptate Biotherapeutics Ltd. Anti-tcr delta variable 1 antibodies
JP2022550649A (ja) * 2019-03-30 2022-12-05 ビオンテック ユーエス インコーポレイテッド T細胞組成物を調製するための組成物および方法、ならびにそれらの使用
WO2022258606A1 (en) * 2021-06-07 2022-12-15 Gadeta B.V. Delta T-cell or Gamma T-cell receptor chains or parts thereof that mediate an anti-tumour or anti-infective response
WO2023102615A1 (en) * 2021-12-09 2023-06-15 The University Of Melbourne Modified t cell receptors and uses thereof
US11686724B2 (en) 2012-03-28 2023-06-27 Gadeta B.V. Compositions comprising gamma 9 delta 2 T-cell receptors and methods of use thereof to treat cancer
WO2023156604A1 (en) 2022-02-17 2023-08-24 Gammadelta Therapeutics Ltd Multispecific anti-tcr delta variable 1 antibodies
WO2023156506A1 (en) 2022-02-16 2023-08-24 Priothera Sas Methods of treatment with car cells in combination with s1p receptor modulators
WO2023250485A1 (en) * 2022-06-23 2023-12-28 LAVA Therapeutics N.V. Assay for t cell dependent multispecific compounds
WO2024097864A1 (en) * 2022-11-02 2024-05-10 Tigen Pharma Sa Expansion of lymphocytes
US12084500B2 (en) 2019-01-23 2024-09-10 New York University Antibodies specific to delta 1 chain of T cell receptor
US12161669B2 (en) 2017-05-18 2024-12-10 Umc Utrecht Holding B.V. Compositions and methods for cell targeting therapies
WO2025022361A1 (en) * 2023-07-26 2025-01-30 Janssen Biotech, Inc. Materials and methods for cell growth
US12221480B2 (en) 2017-11-15 2025-02-11 Adicet Therapeutics, Inc. Methods for selective expansion of delta-3 gamma delta T-cell populations and compositions thereof
WO2025045018A1 (en) * 2023-08-31 2025-03-06 Nanjing Legend Biotech Co., Ltd. Anti-gamma delta tcr antibodies and uses thereof
EP4419118A4 (en) * 2021-10-20 2025-04-30 University of Pittsburgh - Of the Commonwealth System of Higher Education Methods and materials for expanding tumor infiltrating gamma-delta t cells
US12297274B2 (en) 2016-06-10 2025-05-13 Umc Utrecht Holding B.V. Method of cell therapy
US12312408B2 (en) 2021-02-17 2025-05-27 Gammadelta Therapeutics Ltd Multispecific anti-TCR delta variable 1 antibodies
US12350349B2 (en) 2016-08-03 2025-07-08 Washington University Gene editing of CAR-T cells for the treatment of T cell malignancies with chimeric antigen receptors
US12364714B2 (en) 2016-05-12 2025-07-22 Adicet Therapeutics, Inc. Methods for selective expansion of gamma delta t-cell populations and compositions thereof
WO2026013158A1 (en) 2024-07-10 2026-01-15 Cytospire Therapeutics Limited Antibodies binding to constant domains of gamma delta t-cell receptors
WO2026013159A1 (en) 2024-07-10 2026-01-15 Cytospire Therapeutics Limited Antibodies binding to constant domains of gamma delta t-cell receptors
US12611427B2 (en) * 2019-11-04 2026-04-28 Iovance Biotherapeutics, Inc. Treatment of NSCLC patients refractory for anti-PD-1 antibody

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021173560A1 (en) * 2020-02-24 2021-09-02 Immatics US, Inc. Methods for expanding t cells for the treatment of cancer and related malignancies
GB202002581D0 (en) * 2020-02-24 2020-04-08 Gammadelta Therapeutics Ltd Novel antibodies
CN111748519A (zh) * 2020-07-06 2020-10-09 深圳市人民医院 成纤维细胞的原代培养方法
AU2021324767A1 (en) * 2020-08-12 2023-04-13 University Of Central Florida Research Foundation, Inc. Methods and compositions for stimulating gamma delta T cells
US11999968B2 (en) * 2021-10-22 2024-06-04 Fullhope Biomedical Co., Ltd Modified T cells, pharmaceutical composition, manufacturing method thereof, and method of using the same
CA3238458A1 (en) * 2021-11-18 2023-05-25 Regents Of The University Of Minnesota Large-scale expansion of engineered human gamma delta t cells
EP4543466A1 (en) * 2022-06-21 2025-04-30 Kiromic BioPharma, Inc. Methods for generating gamma delta t-cells and related compositions
CN120359293A (zh) * 2022-12-15 2025-07-22 加利福尼亚大学董事会 用于免疫疗法的增强型gamma delta t细胞
WO2024238812A2 (en) * 2023-05-16 2024-11-21 The Brigham And Women’S Hospital, Inc. Metabolically enhanced vd1 t cells and uses thereof
TW202537974A (zh) * 2023-11-15 2025-10-01 大陸商上海盛迪醫藥有限公司 Trgv9結合蛋白及其醫藥用途

Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5185250A (en) * 1986-07-03 1993-02-09 T Cell Sciences, Inc. Human γ, δT cell antigen receptor polypeptides and nucleic acids
WO1993020221A1 (en) 1992-04-03 1993-10-14 Young Alexander T Gene therapy using targeted viral vectors
US20030138433A1 (en) * 1999-06-17 2003-07-24 Newell Martha K. Autologous adoptive immunotherapy with antigen-specific primed T cells or B cells to promote antigen-specific immune responses with an appropriate cytokine bias
WO2003087341A2 (en) 2002-01-23 2003-10-23 The University Of Utah Research Foundation Targeted chromosomal mutagenesis using zinc finger nucleases
US20100272739A1 (en) * 1999-09-30 2010-10-28 National Jewish Medical And Research Center Modulation of Gamma-Delta T Cells to Regulate Airway Hyperresponsiveness
US7985739B2 (en) 2003-06-04 2011-07-26 The Board Of Trustees Of The Leland Stanford Junior University Enhanced sleeping beauty transposon system and methods for using the same
WO2011090801A1 (en) 2010-01-23 2011-07-28 Genefluidics, Inc. Modular cartridge for liquid transport
US20120034221A1 (en) * 2008-08-26 2012-02-09 Macrogenics Inc. T-Cell Receptor Antibodies And Methods of Use Thereof
WO2014009370A2 (en) 2012-07-10 2014-01-16 Laboratoire Meiners Sàrl Core-shell capsules and methods for encapsulation including diffusion through spherical capsule membranes
US20140141513A1 (en) * 2011-05-19 2014-05-22 Instituto De Medicina Molecular Cell line of lymphocytes comprising gamma-delta t cells, composition and production method thereof
WO2014134412A1 (en) 2013-03-01 2014-09-04 Regents Of The University Of Minnesota Talen-based gene correction
WO2015061694A2 (en) * 2013-10-25 2015-04-30 Board Of Regents, The University Of Texas System Polyclonal gamma delta t cells for immunotherapy
US20150259645A1 (en) * 2012-11-08 2015-09-17 INSERM (Institut National de la Santé et de la Recherche Médicale Method for inducing il-2-free proliferation of gamma delta t cells
US9540448B2 (en) 2011-04-01 2017-01-10 Memorial Sloan Kettering Cancer Center T cell receptor-like antibodies specific for a WTI peptide presented by HLA-A2
WO2017011804A1 (en) 2015-07-15 2017-01-19 Juno Therapeutics, Inc. Engineered cells for adoptive cell therapy

Family Cites Families (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5260223A (en) 1986-07-03 1993-11-09 President & Fellows Of Harvard College Methods for detection of human gamma, γ T cell receptor
CA2110946A1 (en) 1992-12-09 1994-06-10 Elazar Rabbani Induction of immunocompatibility by nucleic acid
WO2001022816A1 (en) 1999-09-30 2001-04-05 National Jewish Medical And Research Center MODULATION OF ηδ T CELLS TO REGULATE AIRWAY HYPERRESPONSIVENESS
CN1306027C (zh) 2002-12-12 2007-03-21 中国医学科学院基础医学研究所 一种体外扩增γδT淋巴细胞的方法
US20060205089A1 (en) 2003-04-14 2006-09-14 Montana State University Mapping discontinuous antibody or aptamer epitopes for protein structure determination and other applications
JP5139800B2 (ja) 2004-06-03 2013-02-06 ノビミューン エスアー 抗cd3抗体およびその使用方法
US7340913B2 (en) 2004-08-05 2008-03-11 Manitowoc Foodservice Companies, Inc. Ice machine and ice-making assembly including a water distributor
US20080026986A1 (en) 2006-06-05 2008-01-31 Rong-Fu Wang Reversal of the suppressive function of specific t cells via toll-like receptor 8 signaling
CA2914170C (en) 2006-09-08 2018-10-30 Abbvie Bahamas Ltd. Interleukin-13 binding proteins
KR101866578B1 (ko) 2010-01-22 2018-06-11 다우 아그로사이언시즈 엘엘씨 표적화된 게놈 교체
US8324914B2 (en) * 2010-02-08 2012-12-04 Genia Technologies, Inc. Systems and methods for characterizing a molecule
CA2993567C (en) 2010-07-21 2022-06-28 Sangamo Biosciences, Inc. Methods and compositions for modification of a t-cell receptor gene
WO2013074916A1 (en) 2011-11-18 2013-05-23 Board Of Regents, The University Of Texas System Car+ t cells genetically modified to eliminate expression of t- cell receptor and/or hla
HRP20201595T1 (hr) 2011-11-28 2020-12-11 Merck Patent Gmbh Anti-pd-l1 protutijela i njihova uporaba
CN104769104A (zh) * 2011-12-12 2015-07-08 细胞药物有限公司 扩大t细胞的方法
CN102994448A (zh) 2012-12-13 2013-03-27 上海柯莱逊生物技术有限公司 一种体外扩增γδT细胞的方法
EP3129404B1 (en) 2014-04-10 2026-01-28 LAVA Therapeutics N.V. Immunoglobulins binding human vgamma9vdelta2 t cell receptors
WO2016081518A2 (en) 2014-11-17 2016-05-26 Adicet Bio, Inc. Engineered gamma delta t-cells
AU2016274633B2 (en) 2015-06-09 2022-04-21 Gammadelta Therapeutics Ltd Methods for the production of TCR gamma delta+ T cells
EP3454870A4 (en) 2016-05-12 2020-03-04 Adicet Bio Inc. METHOD FOR SELECTIVE EXPANSION OF GAMMA DELTA T CELL POPULATIONS AND COMPOSITIONS THEREOF

Patent Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5185250A (en) * 1986-07-03 1993-02-09 T Cell Sciences, Inc. Human γ, δT cell antigen receptor polypeptides and nucleic acids
WO1993020221A1 (en) 1992-04-03 1993-10-14 Young Alexander T Gene therapy using targeted viral vectors
US20030138433A1 (en) * 1999-06-17 2003-07-24 Newell Martha K. Autologous adoptive immunotherapy with antigen-specific primed T cells or B cells to promote antigen-specific immune responses with an appropriate cytokine bias
US20100272739A1 (en) * 1999-09-30 2010-10-28 National Jewish Medical And Research Center Modulation of Gamma-Delta T Cells to Regulate Airway Hyperresponsiveness
WO2003087341A2 (en) 2002-01-23 2003-10-23 The University Of Utah Research Foundation Targeted chromosomal mutagenesis using zinc finger nucleases
US7985739B2 (en) 2003-06-04 2011-07-26 The Board Of Trustees Of The Leland Stanford Junior University Enhanced sleeping beauty transposon system and methods for using the same
US20120034221A1 (en) * 2008-08-26 2012-02-09 Macrogenics Inc. T-Cell Receptor Antibodies And Methods of Use Thereof
WO2011090801A1 (en) 2010-01-23 2011-07-28 Genefluidics, Inc. Modular cartridge for liquid transport
US9540448B2 (en) 2011-04-01 2017-01-10 Memorial Sloan Kettering Cancer Center T cell receptor-like antibodies specific for a WTI peptide presented by HLA-A2
US20140141513A1 (en) * 2011-05-19 2014-05-22 Instituto De Medicina Molecular Cell line of lymphocytes comprising gamma-delta t cells, composition and production method thereof
WO2014009370A2 (en) 2012-07-10 2014-01-16 Laboratoire Meiners Sàrl Core-shell capsules and methods for encapsulation including diffusion through spherical capsule membranes
US20150259645A1 (en) * 2012-11-08 2015-09-17 INSERM (Institut National de la Santé et de la Recherche Médicale Method for inducing il-2-free proliferation of gamma delta t cells
WO2014134412A1 (en) 2013-03-01 2014-09-04 Regents Of The University Of Minnesota Talen-based gene correction
WO2015061694A2 (en) * 2013-10-25 2015-04-30 Board Of Regents, The University Of Texas System Polyclonal gamma delta t cells for immunotherapy
WO2017011804A1 (en) 2015-07-15 2017-01-19 Juno Therapeutics, Inc. Engineered cells for adoptive cell therapy

Non-Patent Citations (38)

* Cited by examiner, † Cited by third party
Title
APPAY ET AL., NAT MED., vol. 8, 2002, pages 379
BEAGLEY KWHUSBAND AJ, CRIT REV IMMUNOL, vol. 18, no. 3, 1998, pages 237 - 254
BORNSTEIN ET AL., INVEST NEW DRUGS, vol. 28, 2010, pages 561 - 74
BOUCHERMA ET AL., J IMMUNO, vol. 191, 2013, pages 583 - 593
CARDINGEGAN, NAT REV IMMUNOL, vol. 2, 2002, pages 336
CHEEVER ET AL., CLIN. CANCER RES., vol. 15, no. 17, 2009, pages 5323 - 37
CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883
CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
DAO ET AL., SCI TRANSL MED, vol. 5, no. 176, 13 March 2013 (2013-03-13), pages 176ra33
DAUBENBERGER CA ET AL., J IMMUNOL, vol. 167, 2001, pages 6421 - 30
DAVIS ET AL., IMMUNOL TODAY, vol. 17, 1996, pages 177 - 187
DOHANREITER, EXPERT REV MOL MED, vol. 14, 2012, pages 6
GONZALES ET AL., IMMUNOL RES, vol. 57, 2013, pages 326 - 334
HAMERS-CASTERMAN ET AL., NATURE, vol. 363, 1993, pages 446 - 448
HAYDAY AC, ANNU REV IMMUNOL, vol. 18, 2000, pages 975 - 1026
JAKOBOVITS, CURR. OPIN. BIOTECHNOL, vol. 6, 1995, pages 561 - 6
JANSSENS ET AL., PNAS, vol. 103, 2006, pages 15130
JIN ET AL., JOURNAL OF HEMATOLOGY & ONCOLOGY, vol. 9, 2016, pages 126
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE
KIMHONG, METHODS MOL BIOL, vol. 907, 2012, pages 237 - 45
KLEBANOFF ET AL., IMMUNOL REV, vol. 211, 2006, pages 214
KONDO ET AL., CYTOTHERAPY, vol. 10, 2008, pages 842 - 856
LANG ET AL., CANCER IMMUNOLOGY, IMMUNOTHERAPY: CII, vol. 60, 2011, pages 1447 - 1460
LEFRANC ET AL., DEVELOPMENTAL AND COMPARATIVE IMMUNOLOGY, vol. 248, 2003, pages 55 - 77
LIANG-PINGL. ET AL., NATURE MED., vol. 16, 2010, pages 1029 - 1035
MALMBORG ET AL., J. IMMUNOL. METHODS, vol. 183, 1995, pages 7 - 13
MICHIE ET AL., NATURE, vol. 360, 1992, pages 264 - 265
MOONKALOH, JOURNAL OF IMMUNOLOGICAL METHODS, vol. 169, 1994, pages 269 - 315
NICOL ET AL., BRITISH JOURNAL OF CANCER, vol. 105, 2011, pages 778 - 786
SALLUSTO ET AL., NATURE, vol. 401, 1999, pages 708
SCHEINBERG ET AL., ONCOTARGET, vol. 4, no. 5, 2013, pages 647 - 8
See also references of EP3454870A4
SHERIFF ET AL., NATURE STRUCT. BIOL., vol. 3, 1996, pages 733 - 736
WEIDANZ ET AL., INT. REV. IMMUNOL, vol. 30, 2011, pages 328 - 40
WILHELM ET AL., BLOOD, vol. 102, no. 1, 1 July 2003 (2003-07-01), pages 200 - 6
XU ET AL., IMMUNITY, vol. 13, 2000, pages 37 - 45
ZAPATA ET AL., PROTEIN ENG, vol. 8, no. 10, 1995, pages 1057 - 1062

Cited By (82)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11686724B2 (en) 2012-03-28 2023-06-27 Gadeta B.V. Compositions comprising gamma 9 delta 2 T-cell receptors and methods of use thereof to treat cancer
US12364714B2 (en) 2016-05-12 2025-07-22 Adicet Therapeutics, Inc. Methods for selective expansion of gamma delta t-cell populations and compositions thereof
US12297274B2 (en) 2016-06-10 2025-05-13 Umc Utrecht Holding B.V. Method of cell therapy
US12564648B2 (en) 2016-08-03 2026-03-03 Washington University Gene editing of CAR-T cells for the treatment of T cell malignancies with chimeric antigen receptors
US12350349B2 (en) 2016-08-03 2025-07-08 Washington University Gene editing of CAR-T cells for the treatment of T cell malignancies with chimeric antigen receptors
US11629333B2 (en) 2017-02-08 2023-04-18 Agency For Science, Technology And Research Gamma delta T cells and a method of augmenting the tumoricidal activity of the same
WO2018147805A1 (en) * 2017-02-08 2018-08-16 Agency For Science, Technology And Research Gamma delta t cells and a method of augmenting the tumoricidal activity of the same
US12161669B2 (en) 2017-05-18 2024-12-10 Umc Utrecht Holding B.V. Compositions and methods for cell targeting therapies
WO2019069125A1 (en) 2017-10-06 2019-04-11 Oslo Universitetssykehus Hf CHIMERIC ANTIGEN RECEPTORS
US12221480B2 (en) 2017-11-15 2025-02-11 Adicet Therapeutics, Inc. Methods for selective expansion of delta-3 gamma delta T-cell populations and compositions thereof
EP3743081A4 (en) * 2018-01-23 2021-12-01 New York University SPECIFIC ANTIBODIES OF THE DELTA 1 CHAIN OF THE T-LYMPHOCYTE RECEPTOR
US11673952B2 (en) 2018-01-23 2023-06-13 New York University Antibodies specific to delta 1 chain of T cell receptor
US10519236B2 (en) 2018-01-23 2019-12-31 New York University Antibodies specific to delta 1 chain of T cell receptor
WO2019147735A1 (en) * 2018-01-23 2019-08-01 New York University Antibodies specific to delta 1 chain of t cell receptor
US20210137930A1 (en) * 2018-02-13 2021-05-13 Iovance Biotherapeutics, Inc. Expansion of tumor infiltrating lymphocytes (tils) with adenosine a2a receptor antagonists and therapeutic combinations of tils and adenosine a2a receptor antagonists
EP4015525A2 (en) 2018-03-23 2022-06-22 GammaDelta Therapeutics Limited Lymphocytes expressing heterologous targeting constructs
US20210015866A1 (en) * 2018-03-23 2021-01-21 La Jolla Institute For Allergy And Immunology Tissue resident memory cell profiles, and uses thereof
WO2019222760A1 (en) * 2018-05-18 2019-11-21 Children's National Medical Center Improved targeted t-cell therapy
CN112512538A (zh) * 2018-05-18 2021-03-16 国家儿童医疗中心 改进的靶向t细胞疗法
WO2020010229A1 (en) * 2018-07-06 2020-01-09 Arizona Board Of Regents On Behalf Of The University Of Arizona Car t cell therapy to target t cell specific cancers
US20210309711A1 (en) * 2018-07-20 2021-10-07 Duke University Anti-lypd3 car t-cell therapy for the treatment of cancer
WO2020021045A3 (en) * 2018-07-26 2020-03-12 Ospedale Pediatrico Bambino Gesù (Opbg) Therapeutic preparations of gamma-delta t cells and natural killer cells and methods for manufacture and use
CN112912494A (zh) * 2018-07-26 2021-06-04 耶稣圣婴儿童医院 γ-δT细胞和自然杀伤细胞的治疗制剂以及制造和使用方法
JP7565271B2 (ja) 2018-07-26 2024-10-10 オスペダーレ ペディアトリコ バンビーノ ジェズ ガンマ-デルタt細胞およびナチュラルキラー細胞の治療的調製物ならびに製造および使用する方法
JP2025011150A (ja) * 2018-07-26 2025-01-23 オスペダーレ ペディアトリコ バンビーノ ジェズ ガンマ-デルタt細胞およびナチュラルキラー細胞の治療的調製物ならびに製造および使用する方法
AU2019311290B2 (en) * 2018-07-26 2025-11-27 Ospedale Pediatrico Bambino Gesù (Opbg) Therapeutic preparations of gamma-delta T cells and Natural Killer cells and methods for manufacture and use
JP2021532829A (ja) * 2018-07-26 2021-12-02 オスペダーレ ペディアトリコ バンビーノ ジェズ ガンマ−デルタt細胞およびナチュラルキラー細胞の治療的調製物ならびに製造および使用する方法
US12077586B2 (en) 2018-09-19 2024-09-03 LAVA Therapeutics N.V. Bispecific antibodies for use in the treatment of hematological malignancies
WO2020060406A1 (en) * 2018-09-19 2020-03-26 Lava Therapeutics B.V. Novel bispecific antibodies for use in the treatment of hematological malignancies
CN109234236A (zh) * 2018-09-29 2019-01-18 吉林大学第医院 一种嵌合抗原受体γδT细胞的制备方法
WO2020072546A2 (en) 2018-10-01 2020-04-09 Adicet Bio, Inc. COMPOSITIONS AND METHODS REGARDING ENGINEERED AND NON-ENGINEERED γδ -T CELLS FOR TREATMENT OF SOLID TUMORS
JP7679298B2 (ja) 2018-10-01 2025-05-19 アディセット セラピューティクス, インク. 固形腫瘍を治療するための遺伝子操作しているγδ-T細胞及び遺伝子操作していないγδ-T細胞に関する組成物及び方法
JP2022501074A (ja) * 2018-10-01 2022-01-06 アディセット バイオ, インコーポレイテッド 血液腫瘍を治療するための遺伝子操作しているγδ−T細胞及び遺伝子操作していないγδ−T細胞に関する組成物及び方法
JP7687952B2 (ja) 2018-10-01 2025-06-03 アディセット セラピューティクス, インク. 血液腫瘍を治療するための遺伝子操作しているγδ-T細胞及び遺伝子操作していないγδ-T細胞に関する組成物及び方法
JP2022513321A (ja) * 2018-10-01 2022-02-07 アディセット バイオ, インコーポレイテッド 固形腫瘍を治療するための遺伝子操作しているγδ-T細胞及び遺伝子操作していないγδ-T細胞に関する組成物及び方法
WO2020072536A1 (en) 2018-10-01 2020-04-09 Adicet Bio, Inc. COMPOSITIONS AND METHODS REGARDING ENGINEERED AND NON- ENGINEERED γδ-Τ CELLS FOR TREATMENT OF HEMATOLOGICAL TUMORS
GB2569692A (en) * 2018-10-30 2019-06-26 Tc Biopharm Ltd T cell antigen receptor chimera
US20220088069A1 (en) * 2018-11-05 2022-03-24 Iovance Biotherapeutics, Inc. Treatment of nsclc patients refractory for anti-pd-1 antibody
US20220218747A1 (en) * 2018-12-03 2022-07-14 Adicet Bio, Inc. Methods for selective in vivo expansion of gamma delta t-cell populations and compositions thereof
CN113518624A (zh) * 2018-12-03 2021-10-19 阿迪塞特生物股份有限公司 用于选择性体内扩增γδT细胞群的方法及其组合物
IL283614B1 (en) * 2018-12-03 2026-03-01 Adicet Bio Inc Methods for selective in vivo expansion of gamma delta T-cell populations and preparations thereof
WO2020117862A1 (en) 2018-12-03 2020-06-11 Adicet Bio, Inc. Methods for selective in vivo expansion of gamma delta t-cell populations and compositions thereof
JP2022510387A (ja) * 2018-12-03 2022-01-26 アディセット バイオ, インコーポレイテッド ガンマデルタt細胞集団の選択的生体内増殖方法及びその組成物
US12084500B2 (en) 2019-01-23 2024-09-10 New York University Antibodies specific to delta 1 chain of T cell receptor
JP7668226B2 (ja) 2019-03-30 2025-04-24 ビオンテック ユーエス インコーポレイテッド T細胞組成物を調製するための組成物および方法、ならびにそれらの使用
JP2022550649A (ja) * 2019-03-30 2022-12-05 ビオンテック ユーエス インコーポレイテッド T細胞組成物を調製するための組成物および方法、ならびにそれらの使用
CN114599783A (zh) * 2019-08-16 2022-06-07 伽马三角洲疗法有限公司 离体gamma delta t细胞群
WO2021032963A1 (en) 2019-08-16 2021-02-25 GammaDelta Therapeutics Limited Therapeutic uses of anti-tcr delta variable 1 antibodies
WO2021032961A1 (en) 2019-08-16 2021-02-25 GammaDelta Therapeutics Limited Ex vivo gamma delta t cell populations
WO2021032960A1 (en) 2019-08-16 2021-02-25 GammaDelta Therapeutics Limited Novel anti-tcr delta variable 1 antibodies
EP4706673A2 (en) 2019-10-31 2026-03-11 Incyte Corporation Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells
WO2021084063A1 (en) 2019-10-31 2021-05-06 Morphosys Ag Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells
US12611427B2 (en) * 2019-11-04 2026-04-28 Iovance Biotherapeutics, Inc. Treatment of NSCLC patients refractory for anti-PD-1 antibody
WO2021113558A3 (en) * 2019-12-03 2021-07-08 Adicet Bio, Inc. METHODS FOR EXPANDING γδ T-CELL POPULATIONS WITH MULTIVALENT AGENTS AND COMPOSITIONS THEREOF
US20230009275A1 (en) * 2019-12-03 2023-01-12 Adicet Bio, Inc. Methods for expanding gamma delta t-cell populations with multivalent agents and compositions thereof
EP4072567A4 (en) * 2019-12-03 2024-03-27 Adicet Therapeutics, Inc. METHOD FOR EXPANDING GAMMA DELTA T-CELL POPULATIONS USING MULTIVALENT AGENTS AND CORRESPONDING COMPOSITIONS
WO2021142260A1 (en) * 2020-01-10 2021-07-15 Dyne Therapeutics, Inc. Muscle targeting complexes and uses thereof for modulation of acvr1
US20210284730A1 (en) * 2020-03-13 2021-09-16 Janssen Biotech, Inc. Materials and methods for modulating delta chain mediated immunity
WO2021226321A3 (en) * 2020-05-07 2021-12-16 Phanes Therapeutics, Inc. Anti-tumor associated antigen antibodies and uses thereof
WO2021229226A1 (en) * 2020-05-12 2021-11-18 GammaDelta Therapeutics Limited Methods for isolating gamma delta t cells
WO2022034562A1 (en) 2020-08-14 2022-02-17 GammaDelta Therapeutics Limited Multispecific anti-tcr delta variable 1 antibodies
EP4269445A2 (en) 2020-08-14 2023-11-01 GammaDelta Therapeutics Limited Multispecific anti-tcr delta variable 1 antibodies
EP4269446A2 (en) 2020-08-14 2023-11-01 GammaDelta Therapeutics Limited Multispecific anti-tcr delta variable 1 antibodies
EP4269444A2 (en) 2020-08-14 2023-11-01 GammaDelta Therapeutics Limited Multispecific anti-tcr delta variable 1 antibodies
EP4265642A2 (en) 2020-08-14 2023-10-25 GammaDelta Therapeutics Limited Multispecific anti-tcr delta variable 1 antibodies
EP4218932A2 (en) 2020-08-14 2023-08-02 GammaDelta Therapeutics Limited Multispecific anti-tcr delta variable 1 antibodies
EP4010082B1 (en) 2020-08-14 2023-01-25 GammaDelta Therapeutics Limited Multispecific anti-tcr delta variable 1 antibodies
WO2022049550A1 (en) 2020-09-04 2022-03-10 GammaDelta Therapeutics Limited Immunotherapy composition
WO2022175414A1 (en) 2021-02-17 2022-08-25 Adaptate Biotherapeutics Ltd. Multispecific anti-tcr delta variable 1 antibodies
WO2022175413A1 (en) 2021-02-17 2022-08-25 Adaptate Biotherapeutics Ltd. Anti-tcr delta variable 1 antibodies
US12312408B2 (en) 2021-02-17 2025-05-27 Gammadelta Therapeutics Ltd Multispecific anti-TCR delta variable 1 antibodies
WO2022258606A1 (en) * 2021-06-07 2022-12-15 Gadeta B.V. Delta T-cell or Gamma T-cell receptor chains or parts thereof that mediate an anti-tumour or anti-infective response
EP4419118A4 (en) * 2021-10-20 2025-04-30 University of Pittsburgh - Of the Commonwealth System of Higher Education Methods and materials for expanding tumor infiltrating gamma-delta t cells
WO2023102615A1 (en) * 2021-12-09 2023-06-15 The University Of Melbourne Modified t cell receptors and uses thereof
WO2023156506A1 (en) 2022-02-16 2023-08-24 Priothera Sas Methods of treatment with car cells in combination with s1p receptor modulators
WO2023156604A1 (en) 2022-02-17 2023-08-24 Gammadelta Therapeutics Ltd Multispecific anti-tcr delta variable 1 antibodies
WO2023250485A1 (en) * 2022-06-23 2023-12-28 LAVA Therapeutics N.V. Assay for t cell dependent multispecific compounds
WO2024097864A1 (en) * 2022-11-02 2024-05-10 Tigen Pharma Sa Expansion of lymphocytes
WO2025022361A1 (en) * 2023-07-26 2025-01-30 Janssen Biotech, Inc. Materials and methods for cell growth
WO2025045018A1 (en) * 2023-08-31 2025-03-06 Nanjing Legend Biotech Co., Ltd. Anti-gamma delta tcr antibodies and uses thereof
WO2026013158A1 (en) 2024-07-10 2026-01-15 Cytospire Therapeutics Limited Antibodies binding to constant domains of gamma delta t-cell receptors
WO2026013159A1 (en) 2024-07-10 2026-01-15 Cytospire Therapeutics Limited Antibodies binding to constant domains of gamma delta t-cell receptors

Also Published As

Publication number Publication date
JP7791789B2 (ja) 2025-12-24
IL262919B2 (en) 2023-08-01
EP3454870A1 (en) 2019-03-20
IL262919B1 (en) 2023-04-01
CN118421557A (zh) 2024-08-02
JP2019519210A (ja) 2019-07-11
JP2022180371A (ja) 2022-12-06
CA3023993A1 (en) 2017-11-16
MX2023006546A (es) 2023-06-16
JP2025170245A (ja) 2025-11-18
IL301527B1 (en) 2025-11-01
CN110072533A (zh) 2019-07-30
MX2018013864A (es) 2019-06-10
US11299708B2 (en) 2022-04-12
KR102519861B1 (ko) 2023-04-10
KR20190016960A (ko) 2019-02-19
US20190119634A1 (en) 2019-04-25
IL262919A (en) 2018-12-31
JP7210286B2 (ja) 2023-01-23
CN110072533B (zh) 2024-04-02
EP3454870A4 (en) 2020-03-04
IL301527A (en) 2023-05-01
IL301527B2 (en) 2026-03-01
AU2023278051A1 (en) 2024-02-01
ZA201808140B (en) 2024-03-27
US12364714B2 (en) 2025-07-22
AU2017261804A1 (en) 2018-11-29
US20220372439A1 (en) 2022-11-24

Similar Documents

Publication Publication Date Title
US12364714B2 (en) Methods for selective expansion of gamma delta t-cell populations and compositions thereof
US12371663B2 (en) Engineered γδ T-cells
US20230009275A1 (en) Methods for expanding gamma delta t-cell populations with multivalent agents and compositions thereof
US12221480B2 (en) Methods for selective expansion of delta-3 gamma delta T-cell populations and compositions thereof
HK1242585A1 (en) Engineered gamma delta t-cells
HK1242585B (en) Engineered gamma delta t-cells

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 3023993

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2018559834

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17796994

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2017261804

Country of ref document: AU

Date of ref document: 20170512

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20187035576

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017796994

Country of ref document: EP

Effective date: 20181212

WWG Wipo information: grant in national office

Ref document number: 11201810053T

Country of ref document: SG

WWP Wipo information: published in national office

Ref document number: 11201810053T

Country of ref document: SG