WO2017197238A1 - Aav split cas9 genome editing and transcriptional regulation - Google Patents
Aav split cas9 genome editing and transcriptional regulation Download PDFInfo
- Publication number
- WO2017197238A1 WO2017197238A1 PCT/US2017/032362 US2017032362W WO2017197238A1 WO 2017197238 A1 WO2017197238 A1 WO 2017197238A1 US 2017032362 W US2017032362 W US 2017032362W WO 2017197238 A1 WO2017197238 A1 WO 2017197238A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cas9
- protein
- cas9 protein
- nucleic acid
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
- C12N15/1024—In vivo mutagenesis using high mutation rate "mutator" host strains by inserting genetic material, e.g. encoding an error prone polymerase, disrupting a gene for mismatch repair
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/8509—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
- C12N15/861—Adenoviral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/80—Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14132—Use of virus as therapeutic agent, other than vaccine, e.g. as cytolytic agent
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
Definitions
- the CRISPR type II system is a recent development that has been efficiently utilized in a broad spectrum of species. See Friedland, A.E., et al., Heritable genome editing in C. elegans via a CRISPR-Cas9 system. Nat Methods, 2013. 10(8): p. 741-3, Mali, P., et al, RNA-guided human genome engineering via Cas9. Science, 2013. 339(6121): p. 823-6, Hwang, W.Y., et al., Efficient genome editing in zebrafish using a CRISPR-Cas system.
- CRISPR is particularly customizable because the active form consists of an invariant Cas9 protein and an easily programmable guide RNA (gRNA). See Jinek, M., et al., A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science, 2012. 337(6096): p. 816-21. Of the various CRISPR orthologs, the Streptococcus pyogenes (Sp) CRISPR is the most well-characterized and widely used.
- gRNA easily programmable guide RNA
- the Cas9-gRNA complex first probes DNA for the protospacer-adjacent motif (PAM) sequence (-NGG for Sp Cas9), after which Watson-Crick base-pairing between the gRNA and target DNA proceeds in a ratchet mechanism to form an R-loop.
- PAM protospacer-adjacent motif
- the Cas9 protein Following formation of a ternary complex of Cas9, gRNA, and target DNA, the Cas9 protein generates two nicks in the target DNA, creating a blunt double-strand break (DSB) that is predominantly repaired by the non-homologous end joining (NHEJ) pathway or, to a lesser extent, template-directed homologous recombination (HR).
- CRISPR methods are disclosed in US 9,023,649 and US 8,697,359.
- CRISPR-Cas9 systems including nuclease null variants (dCas9) and nuclease null variants functionalized with effector domains such as transcriptional activation domains or repression domains
- dCas9 nuclease null variants
- effector domains such as transcriptional activation domains or repression domains
- J. D. Sander and J. K. Joung Nature biotechnology 32 (4), 347 (2014)
- P. D. Hsu E. S. Lander, and F. Zhang, Cell 157 (6), 1262 (2014)
- L. S. Qi M. H. Larson, L. A. Gilbert et al, Cell 152 (5), 1173 (2013)
- the CRISPR-Cas9 system enables facile genetic and epigenetic manipulations (Mali,
- AAV-CRISPR-Cas9 for modulating postnatal chromatin status or gene expression would vest profound biological control, particularly in treating diseases resulting from epigenetic alterations irresolvable by genome-editing.
- this ability has yet to be realized, in part because the large Cas9 transgenes leave little space for additional function-conferring elements within current designs (AAV payload limit ⁇ 4.7 kb)
- aspects of the present disclosure are directed to the use of split Cas9 to perform CRISPPv-based methods in cells.
- two or more portions or segments of a Cas9 are provided to a cell, such as by being expressed from corresponding nucleic acids introduced into the cell.
- the two or more portions are combined within the cell to form the Cas9 which has an ability to colocalize with guide RNA at a target nucleic acid.
- the Cas9 may have one or more modifications from a full length Cas9 known to those of skill in the art, yet still retain or have the capability of colocalizing with guide RNA at a target nucleic acid.
- the two or more portions or segments, when joined together need only produce or result in a Cas9 which has an ability to colocalize with guide RNA at a target nucleic acid.
- the two or more portions or segments of an RNA guided DNA binding protein such as Cas9
- the RNA guided DNA binding protein such as Cas9.
- the RNA guided DNA binding protein, such as Cas9, and a guide RNA produces a complex of the RNA guided DNA binding protein, the guide RNA and a double stranded DNA target sequence.
- the RNA is said to guide the DNA binding protein to the double stranded DNA target sequence for binding thereto.
- This aspect of the present disclosure may be referred to as co-localization of the RNA and DNA binding protein to or with the double stranded DNA.
- DNA binding proteins within the scope of the present disclosure may include those which create a double stranded break (which may be referred to as a DNA binding protein nuclease), those which create a single stranded break (referred to as a DNA binding protein nickase) or those which have no nuclease activity (referred to as a nuclease null DNA binding protein) but otherwise bind to target DNA.
- a DNA binding protein nuclease those which create a single stranded break
- a DNA binding protein nickase those which create a single stranded break
- nuclease null DNA binding protein those which have no nuclease activity but otherwise bind to target DNA.
- a DNA binding protein-guide RNA complex may be used to create a double stranded break at a target DNA site, to create a single stranded break at a target DNA site or to localize a transcriptional regulator or functional group, function-conferring protein or domain, which may be expressed by the cell, at a target DNA site so as to regulate expression of target DNA.
- the foreign nucleic acid sequence may encode one or more of a DNA binding protein nuclease, a DNA binding protein nickase or a nuclease null DNA binding protein.
- the foreign nucleic acid sequence may also encode one or more transcriptional regulator or functional group, function-conferring proteins or domains or one or more donor nucleic acid sequences that are intended to be inserted into the genomic DNA.
- the foreign nucleic acid sequence encoding an RNA guided enzymatically active DNA binding protein further encodes the transcriptional regulator or functional group, function- conferring protein or domain fused to the RNA guided enzymatically active DNA binding protein. Accordingly, expression of a foreign nucleic acid sequence by a cell may result in a double stranded break, a single stranded break and/or transcriptional activation or repression of the genomic DNA.
- Donor DNA may be inserted at the break site by cell mechanisms such as homologous recombination or nonhomologous end joining. It is to be understood that expression of a foreign nucleic acid sequence as described herein may result in a plurality of double stranded breaks or single stranded breaks at various locations along target genomic DNA, including one or more or a plurality of gene sequences, as desired.
- aspects of the present disclosure are directed to methods of using an enzymatically active Cas9, such as a Cas9 nuclease or nickase, optionally having a functional group attached thereto, and a guide RNA which is used to guide the enzymatically active Cas9 with the functional group attached thereto to a target nucleic acid.
- an enzymatically active Cas9 such as a Cas9 nuclease or nickase
- a guide RNA which is used to guide the enzymatically active Cas9 with the functional group attached thereto to a target nucleic acid.
- the functional group is directed to a target nucleic acid to perform the desired function on the target nucleic acid, such as transcriptional regulation.
- transcriptional regulation can also be accomplished according to methods described herein where an enzymatically active Cas9 is used without any attached functional group and transcriptional regulation is accomplished by inhibition of transcription due to the Cas9 forming a complex at the target nucleic acid and without cutting the target nucleic acid.
- the guide can also be accomplished according to methods described herein where an enzymatically active Cas9 is used without any attached functional group and transcriptional regulation is accomplished by inhibition of transcription due to the Cas9 forming a complex at the target nucleic acid and without cutting the target nucleic acid.
- the guide can also be accomplished according to methods described herein where an enzymatically active Cas9 is used without any attached functional group and transcriptional regulation is accomplished by inhibition of transcription due to the Cas9 forming a complex at the target nucleic acid and without cutting the target nucleic acid.
- RNA includes a truncated spacer sequence having a length sufficient to bind to a target nucleic acid and form a complex with the enzymatically active Cas9 optionally with the functional group attached thereto, but insufficient for the enzymatically active Cas9 to function to cut or nick the target nucleic acid.
- the endonucleolytic activity of the enzymatically active Cas9 is blocked or prevented or otherwise inhibited, and the otherwise enzymatically active Cas9 is effectively rendered a nuclease null Cas9.
- the functional group when attached to the enzymatically active Cas9 performs the desired function of the functional group, as the enzymatically active Cas9 nuclease does not function to cut or nick the target nucleic acid.
- the enzymatically active Cas9 optionally with the functional group attached thereto forms a co-localization complex with the guide RNA and the target nucleic acid, however, the length of the truncated spacer sequence of the guide RNA results in an inability of the Cas9 to cleave the target nucleic acid substrate.
- the present disclosure are directed to methods of using a enzymatically active Cas9, such as a Cas9 nuclease or nickase, optionally having a functional group attached thereto and a guide RNA with a spacer sequence having a length sufficient to bind to a target nucleic acid and to form a complex with the enzymatically active Cas9 optionally with the functional group attached thereto, and sufficient to allow the enzymatically active Cas9 to function as a nuclease or nickase with respect to the target nucleic acid.
- the functional group when optionally attached to the enzymatically active Cas9 does not perform the desired function of the functional group, as the target nucleic acid is either cut or nicked by the enzymatically active Cas9.
- aspects of the present disclosure are directed to methods of using a enzymatically active Cas9, such as a Cas9 nuclease or nickase, optionally having a functional group attached thereto, a first guide RNA with a spacer sequence having a length sufficient to bind to a first target nucleic acid and form a complex with the enzymatically active Cas9 optionally having the functional group attached thereto, but insufficient to allow the enzymatically active Cas9 to function as a nuclease or nickase with respect to the first target nucleic acid, and a second guide RNA with a spacer sequence having a length sufficient to bind to a second target nucleic acid and form a complex with the enzymatically active Cas9 optionally having the functional group attached thereto, such as a Cas9 nuclease or nickase, and sufficient to allow the enzymatically active Cas9 to function as a nuclease or nicka
- the enzymatically active Cas9 when complexed with the first guide RNA at the first target nucleic acid will function as a nuclease null Cas9 to deliver a functional group if present to the first target nucleic acid and the enzymatically active Cas9 when complexed with the second guide RNA at the second target nucleic acid will also function as a nuclease or nickase to either cut or nick the second target nucleic acid.
- aspects of the present disclosure are directed to programmable genome editing as an enzymatically active Cas9 can be used to cut or nick a target nucleic acid by selection of a first guide RNA sequence and the same Cas9 can be effectively rendered nuclease null by selection of a second guide RNA sequence which allows the Cas9 to complex at the target nucleic acid sequence but not cut or nick the target nucleic acid sequence.
- Such complex formation can have an inhibitory effect on transcription and therefore can regulate gene expression without using a separate transcription regulator functional group.
- aspects of the present disclosure are directed to programmable genome editing and use of a functional group, such as a transcriptional regulator, using the same species of enzymatically active Cas9 having the functional group attached thereto.
- Methods described herein are directed to the use of a single species of enzymatically active Cas9 having a transcriptional regulator attached thereto which can be simultaneously used for genome editing of target nucleic acids and transcriptional regulation of genes, based on the spacer sequence length of the particular guide RNA.
- the length of the guide RNA spacer sequence determines the ability of the enzymatically active Cas9 species having a functional group (such as a transcriptional regulator) attached thereto to either (1) function to deliver the functional group to a target nucleic acid so that the functional group can perform its desired function or (2) function as an enzyme to cut or nick a target nucleic acid.
- a functional group such as a transcriptional regulator
- the enzymatically active Cas9 optionally having a functional group attached thereto is present within a cell and two or more guide RNAs are provided to a cell in series or simultaneously wherein each guide RNA is designed to complex with the enzymatically active Cas9 optionally having a functional group attached thereto at respective target nucleic acid sites or sequences.
- Each guide RNA has a spacer sequence length that determines whether the enzymatically active Cas9 optionally having a functional group attached thereto will function as either an enzyme to cut or nick a nucleic acid or as a nuclease null Cas9 to form a complex at the target nucleic acid and deliver the functional group if present to a target nucleic acid so that the functional group may perform its function on a target nucleic acid.
- enzymatically active Cas9 optionally having a functional group attached thereto may first be used to cut or nick a nucleic acid and then be used to deliver a functional group if present to a nucleic acid sequence so that the functional group may perform the function or vice versa.
- a plurality of guide RNAs may be used to target the enzymatically active Cas9 optionally having a functional group attached thereto, such as a single species of an enzymatically active Cas9 optionally having a functional group attached thereto, to a plurality of different target nucleic acid sites to perform either cutting or nicking or functional group delivery.
- methods described herein contemplate the use of one or more donor nucleic acids that may be inserted into one or more cut or nick sites through homologous recombination or nonhomologous end joining. Accordingly, methods described herein are directed to methods of genome editing using the enzymatically active Cas9 optionally having a functional group attached thereto and also methods of targeting a functional group when present to a target nucleic acid to perform the function of the functional group using the enzymatically active Cas9 having a functional group attached thereto.
- the utility of the enzymatically active Cas9 optionally having a functional group attached thereto is determined by the spacer sequence length of the guide RNA and whether the guide R A has a spacer sequence length that facilitates enzymatic activity of the enzymatically active Cas9 or not.
- a functional group may be any desired functional group as known to those of skill in the art.
- An exemplary functional group may be an effector domain, such as a transcriptional activator or transcriptional repressor, or a detectable group, such as fluorescent protein, or a binding functional group, such as an aptamer or a protein-protein binding domain, which can be used to bind to a desired functional group or a nuclear localization signal, which can be used to deliver the Cas9 to a nucleus.
- a guide RNA that allows enzymatic activity of the enzymatically active Cas9 having a functional group attached thereto includes a spacer sequence having an exemplary nucleotide length of between about 25 and about 15 nucleotides, such as between about 20 and about 16 nucleotides.
- a guide RNA that inhibits enzymatic activity of the enzymatically active Cas9 optionally having a functional group attached thereto includes a spacer sequence having an exemplary nucleotide length of between about 8 and about 16 nucleotides.
- a guide RNA that inhibits enzymatic activity of the enzymatically active Cas9 optionally having a functional group attached thereto includes a spacer sequence having an exemplary nucleotide length of between 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20 nucleotides.
- a truncated spacer sequence has a nucleotide length that is shorter than the full length spacer sequence of the corresponding guide R A.
- a guide RNA includes a spacer sequence and a tracr mate sequence forming a crRNA, as is known in the art.
- a tracr sequence as is known in the art, is also used in the practice of methods described herein.
- the tracr sequence and the crRNA sequence may be separate or connected by the linker, as is known in the art.
- the present disclosure provides a method of altering a target nucleic acid in a cell including providing to the cell a first nucleic acid encoding a first portion of a Cas9 protein and a guide RNA (gRNA), providing to the cell a second nucleic acid encoding a second portion of the Cas9 protein and optionally a transcriptional regulator, wherein the cell expresses the first portion of the Cas9 protein, the gRNA and the second portion of the Cas9 protein or the second portion of the Cas9 and the transcriptional regulator fusion protein, and wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein, or the first portion of the Cas9 protein and the second portion of the Cas9 and the transcriptional regulator fusion protein are joined together to form the Cas9 protein or the Cas9 fusion protein, wherein the gRNA and the Cas9 protein, or the gRNA and the Cas9 fusion protein form a co-localization complex with the target nucleic acid and
- the present disclosure provides a method of altering a target nucleic acid in a cell of a subject including delivering to the cell of the subject a first nucleic acid encoding a first portion of a Cas9 protein and a guide RNA (gRNA) wherein the first nucleic acid is within a first vector, delivering to the cell of the subject a second nucleic acid encoding a second portion of the Cas9 protein and optionally a transcriptional regulator wherein the second nucleic acid is within a second vector, wherein the cell expresses the first portion of the Cas9 protein, the gRNA and the second portion of the Cas9 protein or the second portion of the Cas9 and the transcriptional regulator fusion protein, wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein, or the first portion of the Cas9 protein and the second portion of the Cas9 and the transcriptional regulator fusion protein are joined together to form the Cas9 protein or the Cas9 fusion protein, and where
- the present disclosure provides a method of modulating a target gene expression in a cell including providing to the cell a first recombinant adeno-associated virus comprising a first nucleic acid encoding an N-terminal portion of the Cas9 protein (Cas9 N ) and a gRNA, providing to the cell a second recombinant adeno-associated virus comprising a second nucleic acid encoding a fusion protein comprising a C-terminal portion of the Cas9 protein (Cas9 c ) fused with a transcriptional regulator (TR), wherein the cell expresses the Cas9 N protein and the Cas9 c -TR fusion protein and join them to form a full length Cas9 FL -TR fusion protein, and wherein the cell expresses the gRNA, and the gRNA directs the Cas9 FL -TR fusion protein to the target gene and modulates target gene expression.
- a transcriptional regulator TR
- the present disclosure provides a method of imaging a target nucleic acid in a cell including providing to the cell a first recombinant adeno- associated virus comprising a first nucleic acid encoding an N-terminal portion of the Cas9 protein (Cas9 N ) and a gRNA, providing to the cell a second recombinant adeno-associated virus comprising a second nucleic acid encoding a fusion protein comprising a C-terminal portion of the Cas9 protein (Cas9 c ) fused with a fluorescent protein, wherein the cell expresses the Cas9 N protein and the Cas9 c fluorescent fusion protein and join them to form a full length Cas9 FL fluorescent fusion protein, and wherein the cell expresses the gRNA, and the gRNA directs the Cas9 FL fluorescent fusion protein to the target nucleic acid and produces fluorescent imaging of the target nucleic acid.
- FIGS. 1A-H depict that split-Cas9 retains full activity of Cas9 FL and enables AAV packaging with fusion domains.
- SpCas9 canonical PAM: NGG
- TSS human exome and transcriptional start sites
- Sp* and Sa* denote engineered Cas9 variants and include non-canonical PAMs.
- FIG. IB Schematic of split- Cas9 and AAV-Cas9.
- FIG. 1C Split-Cas9 achieves equivalent editing frequencies as Cas9 FL (one-way ANOVA).
- FIG. ID AAV-Cas9-gRNAs gene-edited myotubes.
- mutation frequency increased with AAV dose (one-way ANOVA), but began to plateau at -6% (n.s., not significant between 1E11 and 1E12).
- AAV-Cas9- gRNAs black edited the Mstn gene in GC-1 spermatogonial cells, while AAV-Cas9-VPR- gRNAs (cyan) exhibited reduced endonucleolytic activity (Cas9 N :Cas9 c , 1 : 1) (n-way ANOVA).
- FIG. IF Schematic of genome-editing and transcriptional regulation within a single system. A nuclease-active Cas9 is fused to a transcriptional activator domain.
- Cas9- mediated endonucleolytic DNA cleavage is programmed with a full-length gRNA
- Cas9-mediated transcriptional activation is programmed with a truncated gRNA.
- FIG. 1G AAV-Cas9-VPR-gRNAs upregulated target genes, as assessed by qRT-PCR (top, GC-1 cells; bottom, C2C12 myotubes; one-way ANOVA).
- FIG. 1H Transcriptional activation levels correlate inversely with basal gene expression levels. Data from GC-1 cells in red, data from C2C12 myotubes in black; closed dots denote with single-gRNA, and open circles denote with dual-gRNAs. *, P ⁇ 0.05, ***, P ⁇ 0.001, ANOVA followed by Holm-Sidak test. Error bars denote s.e.m.
- FIGS. 2A-D depict that split-Cas9 retains full biological activity of full-length Cas9.
- SpCas9 consists of a bi-lobed structure (PDB IDs: 4008 and 4CMP) (Nishimasu,
- FIGS. 3A-D depict that transduction of AAV-Cas9-gRNAs directs gene-editing in differentiated myotubes and tail -tip fibroblasts.
- FIGS. 3A-D depict that transduction of AAV-Cas9-gRNAs directs gene-editing in differentiated myotubes and tail -tip fibroblasts.
- FIG. 3A Schematic of AAV-Cas9-gRNAs.
- ITR AAV inverted terminal repeat
- SMVP and CASI promoters
- IntN/IntC split-inteins
- NLS nuclear localization signal
- polyA SV40 polyadenylation signal
- AAV-Cas9-gRNAs edited the targeted endogenous loci in differentiated C2C12 myotubes.
- Cas9 N :Cas9 c ratio of 1 : 1 was used. Each dot represents the mutation frequency detected per transduction per condition (P-values, one-tailed Wilcoxon rank-sum against no-gRNA controls, Bonferroni corrected). Red lines denote means ⁇ s.e.m.
- TdTomato was not observed in negative controls transduced with 6.7E11 (total vg) of Cas9 c -P2A-turboGFP only. Images were taken 7 days post- transduction. Scale bars, 500 ⁇ .
- FIGS. 4A-D depict postnatal genome -editing with AAV9-Cas9-gRNAs and transcriptional activation with AAV9-Cas9-VPR-gRNAs.
- FIGS. 4A-D depict postnatal genome -editing with AAV9-Cas9-gRNAs and transcriptional activation with AAV9-Cas9-VPR-gRNAs.
- FIG. 4A AAV9-Cas9-gRNAs targeting the endogenous Mstn gene or the 3xStop cassette in neonatal mice.
- FIGS. 4A-D depict postnatal genome -editing with AAV9-Cas9-gRNAs and transcriptional activation with AAV9-Cas9-VPR-gRNAs.
- AAV-Cas9 N -gRNAs:AAV- Cas9 c -VPR ratio of 1 : 1 was used in all experiments. Error bars denote s.e.m.
- FIGS. 5A-H depict that systemically delivered AAV9-Cas9-gR As genetically modify multiple organs, with editing frequency reflecting viral transduction efficiency.
- FIG. 5B Putative off-target sites were assessed by deep-sequencing.
- FIG. 6 depicts whole-mount epifluorescence images from neonatal Ai9 mice injected systemically with AAV9-Cas9-gR As (5E11 vg) targeting the 3xStop cassette and controls. Numerous tdTomato+ cells were observed in mice injected with AAV9-Cas9-gRNAs targeting the genomic 3xStop cassette, but not in negative control vehicle-injected mice, indicating that fluorescence activation resulted from 3xStop excision.
- AAV9-Cas9-gR As 5E11 vg
- TdTomato+ cells were also observed, at lower frequencies, in mice injected with AAV9s encoding two gRNAs both targeting one side of the 3xStop cassette (AAV9-Cas9-gRNAs Td5+TdL or AAV9-Cas9- gRNAs Td3+TdR ), suggesting the introduction of large deletions that removed the 3xStop terminators.
- Gray tdTomato.
- FIGS. 7A-C depict that tissue sections from Ai9 mice injected with AAV9-Cas9- gRNAs.
- TdTomato+ cells were not detected in control mice injected with AAV9-Cas9-gRNAs M3+M4 . Scale bars, 500 ⁇ .
- FIGS. 8A-I depict that AAV9 and Cas9 activate immune responses.
- FIG. 8A Intramuscular Cas9-expression via AAV9-split-Cas9 injection or plasmid-Cas9 FL electroporation.
- FIG. 8D ⁇ 16 CDR3 C AS SLDRGQDTQYF is a public Cas9-responsive T-cell clonotype (Welch's t- test). Numbers in parentheses denote clonotypic rank within each TCR- ⁇ CDR3 repertoire after Cas9 re -stimulation.
- FIG. 8E Epitope mapping by Ml 3 phage display (all Ig subclasses). (FIG.
- Counts denote number of animals with capsid-specific antibodies, and red bars denote immunodominant epitopes.
- AAV9 capsid expresses as three isoforms (VP 1/2/3).
- FIG. 8H Capsid residues within identified epitopes preferentially confer loss of viral blood persistency when mutated (Adachi, K., Enoki, T., Kawano, Y., Veraz, M. & Nakai, H. Drawing a high-resolution functional map of adeno-associated virus capsid by massively parallel sequencing. Nat Commun 5, 3075, doi: 10.1038/ncomms4075 (2014)), suggesting their association with maintaining blood persistency.
- Each dot represents a double-alanine mutated AAV9 capsid variant, plotted according to its measured blood persistency and antigenicity of the residue. Red bar, mean.
- FIG. 81 Capsid residues within identified epitopes preferentially de-targets the liver when mutated (Adachi, K., Enoki, T., Kawano, Y., Veraz, M. & Nakai, H. Drawing a high-resolution functional map of adeno- associated virus capsid by massively parallel sequencing. Nat Commun 5, 3075, doi: 10.1038/ncomms4075 (2014)), suggesting their association with hepatotropism.
- Each dot represents a double-alanine mutated AAV9 capsid variant, plotted according to its measured tropism and antigenicity of the residue.
- Blue bar mean liver transduction efficiency;
- Magenta bar mean global transduction efficiency, excluding the liver.
- Antigenicity ranging from 0 to 8, denotes number of animals in which a particular residue is part of a linear epitope.
- FIGS. 9A-D depict additional data for epitope-mapping and recoding of AAV9- CRISPR-Cas9.
- FIG. 9B Known functional variants of Cas9 (Jinek, M. et al. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science 343, 1247997, doi: 10.1126/science.1247997 (2014); Kleinstiver, B.
- FIGS. 9C AAV9-specific antibodies were elicited by two weeks post-injection, as determined by fluorescent immunoassay (FIAX). Two groups of mice injected with 4E12 vg AAV9-Cas9-VPR-gRNAs are shown, differing only in the gRNA spacers employed (* *, P ⁇ 0.01; one-way ANOVA, followed by Dunnett's test against vehicle-injected mice).
- FIG. 9D AAV9 capsid-specific epitopes reside predominantly on the capsid surface. Red bar, mean. Antigenicity, ranging from 0 to 8, denotes number of animals in which a particular residue is part of a linear epitope.
- FIG. 10A depict that AAV-CRISPR-Cas9 does not induce effector cytolysis seen with DNA electroporation.
- FIG. 10B All injections included 1E1 1 vg of AAV9-turboRFP to demarcate transduction.
- Embodiments of the present disclosure are directed to a method of altering a target nucleic acid in a cell.
- the method includes providing to the cell a first nucleic acid encoding a first portion of a Cas9 protein and a guide RNA (gRNA), providing to the cell a second nucleic acid encoding a second portion of the Cas9 protein and optionally a transcriptional regulator, wherein the cell expresses the first portion of the Cas9 protein, the gRNA and the second portion of the Cas9 protein or the second portion of the Cas9 and the transcriptional regulator fusion protein, wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein, or the first portion of the Cas9 protein and the second portion of the Cas9 and the transcriptional regulator fusion protein are joined together to form the Cas9 protein or the Cas9 fusion protein, and wherein the gRNA and the Cas9 protein, or the gRNA and the Cas9 fusion protein form a co-localization
- the Cas9 protein is enzymatically active and the enzymatically active Cas9 protein cleaves the target nucleic acid in a site specific manner.
- the gRNA can have full length or truncated spacer sequence.
- the gRNA having a truncated spacer sequence guides the Cas9 protein or the Cas9 fusion protein to the target nucleic acid and regulate the expression of the target nucleic acid without cleaving the target nucleic acid.
- the first nucleic acid and the second nucleic acid are delivered to the cell by separate vectors.
- the first nucleic acid is delivered to the cell by a plasmid or adeno-associated virus.
- the second nucleic acid is delivered to the cell by a plasmid or an adeno-associated virus.
- the first nucleic acid encodes a first port- on of the Cas9 proreia having a " -spht- réellen rnafrPN and wherein the secoad rsuciesc acid encodes a second portion of toe Caso prosesn baling a Csspht-anteni Rroalntf: and wherein the first portion of the C ' as9 ps-osens and the second porooo of the Cas9 proton; are ionsed together to form the Ca-oP protei
- Embodiments of the present disclosure are directed to a method of altering a target nucleic acid in a cell of a subject.
- the method includes delivering to the cell of the subject a first nucleic acid encoding a first portion of a Cas9 protein and a guide
- RNA wherein the first nucleic acid is within a first vector, delivering to the cell of the subject a second nucleic acid encoding a second portion of the Cas9 protein and optionally a transcriptional regulator wherein the second nucleic acid is within a second vector, wherein the cell expresses the first portion of the Cas9 protein, the gRNA and the second portion of the Cas9 protein or the second portion of the Cas9 and the transcriptional regulator fusion protein, wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein, or the first portion of the Cas9 protein and the second portion of the Cas9 and the transcriptional regulator fusion protein are joined together to form the Cas9 protein or the Cas9 fusion protein, and wherein the gRNA and the Cas9 protein, or the gRNA and the
- Cas9 fusion protein form a co-localization complex with the target nucleic acid and alter the expression of the target nucleic acid.
- the Cas9 protein is enzymatically active and the enzymatically active Cas9 protein cleaves the target nucleic acid in a site specific manner.
- the gRNA can have full length or truncated spacer sequence.
- the gRNA having a truncated spacer sequence guides the Cas9 protein or the Cas9 fusion protein to the target nucleic acid and regulate the expression of the target nucleic acid without cleaving the target nucleic acid.
- the firs- vector is a phtsaud or adeiiomssoeiated vires
- the s c nd vector is a iasimd or adenomssociated virus.
- the b ob nucleic aosd encodes a first portion of the Casb protect having a fi rst spi iocntem aed where -n the second nucleic acid encodes a second portion of the Casb protein having a second splm-line ra corn pic nicntarv to the fhrst sphpentein and coherent Pie first portion of t e Casb protein and Use second it n of the Cash protect are j ned together to toon the Casb protect
- the first nucleic acid encodes a fi rst portion of tbe Cash proton; having a N-ophtontel n Rrna nt and wherein the second nucleic acid encodes a second portion of the Casb protect having a ihemhocnteln RrnalntC and wherei n the first portion of the Cash protein and the second portion of the Casb protect
- the first portion oi ' the Casb protetn is the rC-terrmnal lobe of the Cash protei n and he second portion of Pie C asb protein ;s the C-teiTra cai lobe of the Casb protein .
- the first portion of the Casb protein is the " Noter mal lobe of the Casb protein up to amino acid V 7 B and the second port-on of the Casb nrotent is the C "terminal lone of die Casb protein beginning at D714.
- the vectors are delivered to the cell of the subject via various routes known to a skilled in the art including systemic, local, intravenous, intraperitoneal, intramuscular routes or via injection or electroporation.
- the subject of the disclosure includes human, patients or an animal. No overt cellular or tissue damage is observed when the vectors are adeno-associated viruses.
- Einbod irneiits of the present disclosure are directed to a method of modulating a target gene expression ;n a cell, in one entoodhnent tee ntethod includes providing to the cell a first, recombinant adeno-assoelated vi rus comprising a fi rst nucleic acid encoding ac Nbcrnti nai p ri n of t e Cas9 protein fCas9 ) and a gRNA.
- the gRNA directs the Cas9 :': --TR fission protein to the target, gene and modulates target gene expression.
- fi some ensbodiffients.
- die transcriptional regulator Is a transcrsptsonai acts s k ater or a " transcriptional repressor. Its one eaaSodsmerub the tsaaseriptionai activator is VpR.
- hs certain estiisodstoetits, tits ttaascriptioaal mgulator is a recruiter protein bsat recrasts epsgenedo modulators to the target gerse.
- R exemplars- eruhodmseuts.
- the gRNA has traucated spacer sequence attd directs Cas9 ;L AfR fusion protein bsnd g to target DNA without cleavnrg the target. DNA .
- Embodiments of the present disclosure are directed to a .method of imaging a target, itaeieic acid ;r; a ceil, R; one eruhodmseei, the snethod ;r;cb.;des providing to the cell a first reeombtmsstn adeno-assoclated virus comprising a first rstscloic acid ettcodmg att Nuermuud portion of hse € ' as9 protein iCas9 ) and a gRNA..
- the Cas9 is a Type II CRISPR system Cas9.
- the Cas9 protein is an enzymatically active Cas9 protein, a Cas9 protein nickase or a nuclease null Cas9 protein.
- the cell according to some embodiments of the present disclosure is a eukaryotic cell or a prokaryotic cell.
- the cell is a bacteria cell, a yeast cell, a mammalian cell, a human cell, a plant cell or an animal cell.
- the cell is in vitro, in vivo or ex vivo.
- RNA guided DNA binding proteins such as Cas9
- Such DNA binding proteins are readily known to those of skill in the art to bind to DNA for various purposes. Such DNA binding proteins may be naturally occurring.
- DNA binding proteins included within the scope of the present disclosure include those which may be guided by RNA, referred to herein as guide RNA.
- the guide RNA is between about 10 to about 500 nucleotides.
- the RNA is between about 20 to about 100 nucleotides.
- the guide RNA and the RNA guided DNA binding protein form a co-localization complex at the DNA.
- DNA binding proteins having nuclease activity are known to those of skill in the art, and include naturally occurring DNA binding proteins having nuclease activity, such as Cas9 proteins present, for example, in Type II CRISPR systems.
- Cas9 proteins and Type II CRISPR systems are well documented in the art. See Makarova et al., Nature Reviews, Microbiology, Vol. 9, June 2011, pp. 467-477 including all supplementary information hereby incorporated by reference in its entirety.
- Exemplary Cas include S. pyogenes Cas9 (SpCas9), S. aureus Cas9 (SaCas9) and S. thermophilus Cas9 (StCas9).
- Additional exemplary CRISPR systems include Cpfl proteins for RNA-guided genome-editing. See Zetsche, B. et al. Cpfl is a single RNA-guided endonuclease of a class 2 CRISPR-Cas system. Cell, 2015, 163, 759-771. Additional exemplary nucleic-acid guided systems include argonaute proteins for DNA-guided genome-editing. See Gao F, Shen XZ, Jiang F, Wu Y, Han C, DNA-guided genome editing using the Natronobacterium gregoryi Argonaute, Nat Biotechnol, 2016 May 2. doi: 10.1038/nbt.3547 hereby incorporated by reference in its entirety.
- CRISPR-Cas systems rely on short guide RNAs in complex with Cas proteins to direct degradation of complementary sequences present within invading foreign nucleic acid. See Deltcheva, E. et al. CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III. Nature 471, 602-607 (2011); Gasiunas, G., Barrangou,
- CRISPR RNA crRNA fused to a normally trans-encoded tracrRNA (“trans-activating CRISPR RNA”) is sufficient to direct Cas9 protein to sequence-specifically cleave target DNA sequences matching the crR A.
- CRISPR RNA a normally trans-encoded tracrRNA
- trans-activating CRISPR RNA is sufficient to direct Cas9 protein to sequence-specifically cleave target DNA sequences matching the crR A.
- gRNA complementary to a target site results in Cas9 recruitment and degradation of the target DNA. See H. Deveau et al., Phage response to CPJSPR-encoded resistance in Streptococcus thermophilus. Journal of Bacteriology 190, 1390 (Feb, 2008).
- Class 1 and class 2 Two classes of CRISPR systems are generally known and are referred to as class 1 and class 2. Class 1 systems can be further classified into types I, III, and IV, while class 2 systems can be further classified into type II and V.
- a particular useful enzyme according to the present disclosure to cleave dsDNA is the single effector enzyme, Cas9, common to Type II. See K. S. Makarova et al, Evolution and classification of the CRISPR-Cas systems. Nature reviews. Microbiology 9, 467 (Jun, 201 1) hereby incorporated by reference in its entirety.
- the Type II effector system consists of a long pre-crRNA transcribed from the spacer-containing CRISPR locus, the multifunctional Cas9 protein, and a tracrRNA important for gRNA processing.
- the tracrRNAs hybridize to the repeat regions separating the spacers of the pre-crRNA, initiating dsRNA cleavage by endogenous RNase III, which is followed by a second cleavage event within each spacer by Cas9, producing mature crRNAs that remain associated with the tracrRNA and Cas9.
- TracrRNA-crRNA fusions are contemplated for use in the present methods.
- the enzyme of the present disclosure such as Cas9 unwinds the DNA duplex and searches for sequences matching the crRNA to cleave. Target recognition occurs upon detection of complementarity between a "protospacer" sequence in the target DNA and the remaining spacer sequence in the crRNA. Importantly, Cas9 cuts the
- NGGGG sequence can be any nucleotide.
- S. thermophilus Type II systems require NGGNG (see P. Horvath, R. Barrangou, CRISPR/Cas, the immune system of bacteria and archaea. Science 327, 167 (Jan 8, 2010) hereby incorporated by reference in its entirety and NNAGAAW (see H. Deveau et al. , Phage response to CRISPR-encoded resistance in Streptococcus thermophilus.
- a particular useful enzyme according to the present disclosure to cleave dsDNA is the single effector enzyme, Cpfl, belonging to Type V. See Zetsche, B. et al. Cpfl is a single RNA-guided endonuclease of a class 2 CRISPR-Cas system. Cell, 20 5, 163, 759-771.
- Exemplary DNA binding proteins having nuclease activity function to nick or cut double stranded DNA. Such nuclease activity may result from the DNA binding protein having one or more polypeptide sequences exhibiting nuclease activity. Such exemplary DNA binding proteins may have two separate nuclease domains with each domain responsible for cutting or nicking a particular strand of the double stranded DNA.
- Exemplary polypeptide sequences having nuclease activity known to those of skill in the art include the McrA-HNH nuclease related domain and the RuvC-like nuclease domain. Accordingly, exemplary DNA binding proteins are those that in nature contain one or more of the McrA- HNH nuclease related domain and the RuvC-like nuclease domain.
- Cas9 In S. pyogenes, Cas9 generates a blunt-ended double-stranded break 2-4bp upstream of the protospacer-adjacent motif (PAM) via a process mediated by two catalytic domains in the protein: an HNH domain that cleaves the complementary strand of the DNA and a RuvC- like domain that cleaves the non-complementary strand.
- PAM protospacer-adjacent motif
- the Cas9 protein may be referred by one of skill in the art in the literature as Csnl .
- An exemplary S. pyogenes Cas9 protein sequence is shown below. See Deltcheva et al., Nature 471, 602-607 (2011) hereby incorporated by reference in its entirety.
- the specificity of gRNA-directed Cas9 cleavage is used as a mechanism for genome engineering.
- hybridization of the gRNA need not be 100 percent in order for the enzyme to recognize the gRNA/DNA hybrid and affect cleavage. Some off-target activity could occur.
- the S. pyogenes system tolerates mismatches in the first 6 bases out of the 20bp mature spacer sequence in vitro.
- greater stringency may be beneficial in vivo when potential off- target sites matching (last 14 bp) NGG do not exist within the human reference genome for the gRNAs.
- specificity may be improved.
- AT-rich target sequences may have fewer off-target sites. Carefully choosing target sites to avoid pseudo-sites with at least 14bp matching sequences elsewhere in the genome may improve specificity.
- the gRNAs can be designed to include 16-18 nucleotide spacers, which increases specificity while retaining Cas9 endonucleolytic activity (Fu Y, Sander JD, Reyon D, Cascio VM, Joung JK, Improving CRISPR-Cas nuclease specificity using truncated guide RNAs, Nat Biotechnol , 2014 Mar;32(3):279-84, hereby incorporated by reference in its entirety).
- the use of a Cas9 variant requiring a longer PAM sequence may reduce the frequency of off-target sites.
- Directed evolution may improve Cas9 specificity to a level sufficient to completely preclude off-target activity, ideally requiring a perfect 20bp gRNA match with a minimal PAM. Accordingly, modification to the Cas9 protein is a representative embodiment of the present disclosure.
- CRISPR systems useful in the present disclosure are described in R. Barrangou, P. Horvath, CRISPR: new horizons in phage resistance and strain identification. Annual review of food science and technology 3, 143 (2012) and B. Wiedenheft, S. H. Sternberg, J. A. Doudna, RNA-guided genetic silencing systems in bacteria and archaea. Nature 482, 331 (Feb 16, 2012) each of which are hereby incorporated by reference in their entireties.
- Guide RNAs useful in the disclosed methods include those having a spacer sequence, a tracr mate sequence and a tracr sequence, with the spacer sequence being between about 16 to about 20 nucleotides in length and with the tracr sequence being between about 60 to about 500 nucleotides in length and with a portion of the tracr sequence being hybridized to the tracr mate sequence and with the tracr mate sequence and the tracr sequence being linked by a linker nucleic acid sequence of between about 4 to about 6 nucleotides.
- crRNA-tracrRNA fusions are contemplated as exemplary guide RNA.
- the DNA binding protein is altered or otherwise modified to inactivate the nuclease activity.
- alteration or modification includes altering one or more amino acids to inactivate the nuclease activity or the nuclease domain.
- modification includes removing the polypeptide sequence or polypeptide sequences exhibiting nuclease activity, i.e. the nuclease domain, such that the polypeptide sequence or polypeptide sequences exhibiting nuclease activity, i.e. nuclease domain, are absent from the DNA binding protein.
- Other modifications to inactivate nuclease activity will be readily apparent to one of skill in the art based on the present disclosure.
- a nuclease- null DNA binding protein includes polypeptide sequences modified to inactivate nuclease activity or removal of a polypeptide sequence or sequences to inactivate nuclease activity.
- the nuclease-null DNA binding protein retains the ability to bind to DNA even though the nuclease activity has been inactivated.
- the DNA binding protein includes the polypeptide sequence or sequences required for DNA binding but may lack the one or more or all of the nuclease sequences exhibiting nuclease activity.
- the DNA binding protein includes the polypeptide sequence or sequences required for DNA binding but may have one or more or all of the nuclease sequences exhibiting nuclease activity inactivated.
- a DNA binding protein having two or more nuclease domains may be modified or altered to inactivate all but one of the nuclease domains.
- a DNA binding protein nickase Such a modified or altered DNA binding protein is referred to as a DNA binding protein nickase, to the extent that the DNA binding protein cuts or nicks only one strand of double stranded DNA.
- the DNA binding protein nickase is referred to as an RNA guided DNA binding protein nickase.
- An exemplary DNA binding protein is an RNA guided DNA binding protein nuclease of a Type II CRISPR System, such as a Cas9 protein or modified Cas9 or homolog of Cas9 or ortholog of Cas9.
- An exemplary DNA binding protein is an RNA guided DNA binding protein nuclease of a Type V CRISPR System, such as a Cpfl protein or modified Cpfl or homolog of Cpfl or ortholog of Cpfl .
- An exemplary DNA binding protein is a Cas9 protein nickase.
- An exemplary DNA binding protein is an RNA guided DNA binding protein of a Type II CRISPR System which lacks nuclease activity.
- An exemplary DNA binding protein is a nuclease-null Cas9 protein.
- An exemplary DNA binding protein is an RNA guided DNA binding protein of a Type V CRISPR System which lacks nuclease activity.
- An exemplary DNA binding protein is a nuclease-null Cpfl protein.
- the Cas9 protein, Cas9 protein nickase or nuclease null Cas9 includes homologs and orthologs thereof which retain the ability of the protein to bind to the DNA and be guided by the RNA.
- the Cas9 protein includes the sequence as set forth for naturally occurring Cas9 from S. pyogenes and protein sequences having at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98% or 99% homology thereto and being a DNA binding protein, such as an RNA guided DNA binding protein.
- the transcriptional regulator protein or domain upregulates expression of the target nucleic acid.
- the transcriptional regulator protein or domain downregulates expression of the target nucleic acid. Transcriptional activators and transcriptional repressors can be readily identified by one of skill in the art based on the present disclosure.
- two or more guide RNAs are provided with each guide RNA being complementary to an adjacent site in the DNA target nucleic acid.
- At least one RNA guided DNA binding protein nickase is provided and being guided by the two or more RNAs, wherein the at least one RNA guided DNA binding protein nickase co-localizes with the two or more RNAs to the DNA target nucleic acid and nicks the DNA target nucleic acid resulting in two or more adjacent nicks.
- the two or more adjacent nicks are on the same strand of the double stranded DNA.
- the two or more adjacent nicks are on the same strand of the double stranded DNA and result in homologous recombination.
- the two or more adjacent nicks are on different strands of the double stranded DNA. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA and create double stranded breaks. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA and create double stranded breaks resulting in nonhomologous end joining. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA and are offset with respect to one another. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA and are offset with respect to one another and create double stranded breaks.
- the two or more adjacent nicks are on different strands of the double stranded DNA and are offset with respect to one another and create double stranded breaks resulting in nonhomologous end joining. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA and create double stranded breaks resulting in fragmentation of the target nucleic acid thereby preventing expression of the target nucleic acid.
- binding specificity of the RNA guided DNA binding protein may be increased according to methods described herein.
- off-set nicks are used in methods of genome-editing (see Mali, P. et al. CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature biotechnology, 31, 833-838, doi: 10.1038/nbt.2675 (2013) hereby incorporated by reference in its entirety).
- a large majority of nicks seldom result in NHEJ events, (see Certo et al, Nature Methods 8, 671-676 (201 1) hereby incorporated by reference in its entirety) thus minimizing the effects of off-target nicking.
- DSBs double stranded breaks
- 5 ' overhangs generate more significant NHEJ events as opposed to 3' overhangs.
- 3' overhangs favor HR over NHEJ events, although the total number of HR events is significantly lower than when a 5 ' overhang is generated. Accordingly, methods are provided for using nicks for homologous recombination and off-set nicks for generating double stranded breaks to minimize the effects of off-target Cas9-gRNA activity.
- Target nucleic acids include any nucleic acid sequence to which a co-localization complex as described herein can be useful to either cut, nick, regulate or bind.
- Target nucleic acids include genes.
- DNA such as double stranded
- DNA can include the target nucleic acid and a co-localization complex can bind to or otherwise co-localize with the DNA at or adjacent or near the target nucleic acid and in a manner in which the co-localization complex may have a desired effect on the target nucleic acid.
- target nucleic acids can include endogenous (or naturally occurring) nucleic acids and exogenous (or foreign) nucleic acids.
- DNA including a target nucleic acid includes genomic DNA, mitochondrial DNA, viral DNA or exogenous DNA.
- CRISPR Cas9 system can also be programmed to target RNA (See,
- Foreign nucleic acids i.e. those which are not part of a cell's natural nucleic acid composition
- Such methods include transfection, transduction, viral transduction, microinjection, electroporation, lipofection, nucleofection, nanoparticle bombardment, transformation, conjugation and the like.
- transfection transduction, viral transduction, microinjection, electroporation, lipofection, nucleofection, nanoparticle bombardment, transformation, conjugation and the like.
- Tiaasciipboaa j regulator paAeies or domains w ic are irar-scripiuai-ai activators or aaiiscripdoiud repressors may be readily id ntifiable by those skilled in ibe art based on die present sclos re
- Vectors used to deliver the nucleic acids to cells as described herein include vectors known to those of skill in the art and used for such purposes.
- C&nain exemplary vectors may be ps'asmnss or adenoaa:socaeed iruses k own to Parse or skill a; the art.
- AAVs are highly prevalent within the human population (see Gao, G., et al., Clades of Adeno-associated viruses are widely disseminated in human tissues. J Virol, 2004. 78(12): p.
- AAVs are prevalent within human populations (see Gao, G., et al, Clades of Adeno-associated viruses are widely disseminated in human tissues. J Virol, 2004. 78(12): p. 6381-8), and there have been no established cases of pathology associated with AAV infection, making them one of the most promising vectors currently used in clinical trials. Moreover, tissue-targeting is easily accomplished by pseudotyping to AAV serotypes with suitable tropism. Of particular sH3 ⁇ 4re ⁇ i k AAV serotype 9, which robustly transduces multiple cell types in the body (see Zincarelli, C, et al, Analysis of AAV serotypes 1-9 mediated gene expression and tropism in mice after systemic injection.
- Intravascular AAV9 preferentially targets neonatal neurons and adult astrocytes. Nat Biotechnol, 2009. 27( 1): p. 59-65.) and crosses endothelial barriers (e.g. blood-brain barrier, see Foust, K.D., et al., Intravascular AAV9 preferentially targets neonatal neurons and adult astrocytes. Nat Biotechnol, 2009. 27(1): p. 59-65 and Zhang, H. et al.
- Several rAAV vectors efficiently cross the blood-brain barrier and transduce neurons and astrocytes in the neonatal mouse central nervous system.
- Sp Cas9 has a least restrictive PAM and most consistent efficacy, but its size (4.2 kb) makes packaging into AAV challenging, necessitating use of a limited repertoire of compact regulatory elements ( ⁇ 500 bp) (see Swiech, L., et al, In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9.
- two or more portions of a Cas9 protein are provided within a cell or are otherwise expressed within a cell and are combined together to form the
- Cas9 protein This structure-guided design is essential since splitting Cas9 at ordered protein regions significantly impacts function. See Nishimasu, H. et al. Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell 156, 935-949 (2014), Jinek, M. et al.
- two portions of a Cas9 protein are provided within a cell or are otherwise expressed within a cell and are combined together to form the Cas9 protein.
- the two portions of the Cas9 protein are sufficient in length such that when they are combined into the Cas9 protein, the Cas9 protein has the function of co-localizing at a target nucleic acid with a guide RNA as described above.
- various methods known to those of skill in the art may be used to combine the two or more portions of a Cas9 protein together. Exemplary methods and linkers include split-intein protein trans- splicing for reconstituting the Cas9 protein as is known in the art and as described herein.
- Tyszkiewicz A. B. & Muir, T. W. Conditional protein splicing: a new tool to control protein structure and function in vitro and in vivo. J Am Chem Soc 125, 10561-10569, doi: 10.1021/ja0362813 (2003).
- Embodiments of the present disclosure are directed to the use of a CRISPR/Cas system and, in particular, an enzymatically active Cas9 protein optionally having a functional group attached thereto, and one or more guide RNAs which includes a spacer sequence, a tracr mate sequence and a tracr sequence.
- a guide RNA which facilities enzymatic activity of the Cas9 protein has an exemplary spacer sequence including between 25 and 15 nucleotides in length.
- a guide RNA which inhibits enzymatic activity of the Cas9 protein has an exemplary spacer sequence including between 14 and 8 nucleotides in length.
- two or more or a plurality of guide RNAs may be used in the practice of certain embodiments based on whether one of skill desires the species of enzymatically active Cas9 protein optionally having a functional group attached thereto to cut or nick a desired nucleic acid or to deliver the functional group to a desired nucleic acid so that the functional group can perform the function.
- spacer sequence is understood by those of skill in the art and may include any polynucleotide having sufficient complementarity with a target nucleic acid sequence to hybridize with the target nucleic acid sequence and direct sequence-specific binding of a
- a CRISPR complex may include the guide RNA and the Cas9 protein.
- the guide RNA may be formed from a spacer sequence covalently connected to a tracr mate sequence (which may be referred to as a crRNA) and a separate tracr sequence, wherein the tracr mate sequence is hybridized to a portion of the tracr sequence.
- the tracr mate sequence and the tracr sequence are connected or linked such as by covalent bonds by a linker sequence, which construct may be referred to as a fusion of the tracr mate sequence and the tracr sequence.
- the linker sequence referred to herein is a sequence of nucleotides, referred to herein as a nucleic acid sequence, which connect the tracr mate sequence and the tracr sequence.
- a guide RNA may be a two component species (i.e., separate crRNA and tracr RNA which hybridize together) or a unimolecular species (i.e., a crRNA-tracr RNA fusion, often termed an sgRNA).
- Tracr mate sequences and tracr sequences are known to those of skill in the art, such as those described in US 2014/0356958.
- the tracr mate sequence and tracr sequence used in the present disclosure is N20 or more to N8- gttttagagctagaaatagcaagttaaaataaggctagtccgttatcaactt ⁇ with N20-8 being the number of nucleotides complementary to a target locus of interest.
- the guide RNA spacer sequence length determines whether the enzymatically active Cas9 optionally having a functional group attached thereto will function to cut or nick the target nucleic acid or to act as a nuclease null Cas9 and deliver the functional group if present to the target nucleic acid so that the functional group can perform the desired function.
- a guide RNA having a spacer sequence length where the enzymatically active Cas9 will cut or nick the target nucleic acid may be termed an
- an enzymatic guide RNA to the extent that such a guide RNA facilitates enzymatic activity of the Cas9.
- An enzymatic guide RNA has an exemplary spacer sequence length of 25 to 15 nucleotides.
- Cas9 will function as a nuclease null Cas9 and may be termed a "nonenzymatic guide RNA" to the extent that such a guide RNA will inhibit enzymatic activity of the Cas9.
- a nonenzymatic guide RNA has an exemplary spacer sequence length of 16 to 8 nucleotides. It is to be understood that the enzymatically active Cas9 may still be referred to as such even though it is used with a nonenzymatic guide RNA and where the enzymatically active Cas9 does not cut or nick the target nucleic acid.
- the enzymatically active Cas9 can be programmed to cut or operate as a nuclease null Cas9 based on the selected spacer sequence length. It is to be understood that for particular target nucleic acids, an exemplary enzymatic guide RNA length or an exemplary nonenzymatic guide RNA length may include 1 or two nucleotides outside of the exemplary ranges described herein.
- the tracr mate sequence is between about 17 and about 27 nucleotides in length. According to certain aspects, the tracr sequence is between about 65 and about 75 nucleotides in length. According to certain aspects, the linker nucleic acid sequence is between about 4 and about 6.
- the functional group or firaeiion conferring proiera or d main ay be joined, fused, corrected, hrked or therwise tethered , sach s by covale . beads , to the ercyn-aticaby active Casb protein using methods known to those of sbb ; as the an.
- Frncdonai groups or function conferring proteins or dormers uath iu the scope of the present disclosure include transcriptional uusduhrhors or e free tor domains known to those of sb;h in ti;e art.
- Sui table transcriptional modulators include t.ranscnpt.-onal repressors .
- Transcriptional acti vators and iraascopboaai repressors cau be read dy identified by one of skid in the art based or Use present, d sclosure
- Faction l groups, function conferring proteins or domains within the scope of t.be present disclosure include detectable groups or markers or labels Sacb detectable groups or markers or labels can be delected or imaged usi ng methods known to those of skill in fee art to identify die location of toe targe nucleic acid sequence , indirect abaoho;ent of a detectable label or maker i conic in plated by aspects of die present disclosure.
- Detectable labels or markers can be readily identified by one of skill i n the ad based on the present disclosure .
- Detectable ro s incl ude fluorescent protei ns such as GFP, FP, FJFig FYFP, stCiFP.
- nreberryc i PPP ci trine, atorange, cerulean, mturquotse, FB Fik BBFP2, Aeusfte, mKaiaiual.
- ECFP CYFiilk mTurquoisea, YEP, Venus, and Y ei and d e like.
- Other useful detectable groups include sp ing, spycaicber, s a tags, biobn, sbepta idi.tr ami suniag arid d;e bke.
- Functional groups fis notion conferring proteins or doatairts lthm the scope of the present disclosure include binding functional groups hich may iunetion to bind to desired molecules.
- binding functional groups hich may iunetion to bind to desired molecules.
- Such btndu-g rimctionai groups incl ude aniauiers tns2 to iVtCF, ppf to POh com to (too; binding protein, mtcins, IBkBP to FEB, pniAG to nblAG and Cry2 arid the like .
- embodiments described herein include guide RNA having a length including the sum of the lengths of a spacer sequence, tracr mate sequence, tracr sequence, and linker sequence (if present). Accordingly, such a guide RNA may be described by its total length which is a sum of its spacer sequence, tracr mate sequence, tracr sequence, and linker sequence. According to this aspect, all of the ranges for the spacer sequence, tracr mate sequence, tracr sequence, and linker sequence (if present) are incorporated herein by reference and need not be repeated. One of skill will readily be able to sum each of the portions of a guide RNA to obtain the total length of the guide RNA sequence. Aspects of the present disclosure are directed to methods of making such guide RNAs as described herein by expressing constructs encoding such guide RNA using promoters and terminators and optionally other genetic elements as described herein.
- the guide RNA and the enzymatically active Cas9 optionally having a functional group attached thereto which interacts with the guide RNA are foreign to the cell into which they are introduced or otherwise provided.
- the guide RNA and the enzymatically active Cas9 optionally having a functional group attached thereto are nonnaturally occurring in the cell in which they are introduced, or otherwise provided.
- cells may be genetically engineered or genetically modified to include the CRISPR /Cas systems described herein.
- S. pyogenes Cas9 nuclease Sp. Cas9 nuclease
- Sp. Cas9 an extremely high-affinity (see Sternberg, S.H., Redding, S., Jinek, M., Greene, E.C. & Doudna,
- Cas9-bound RNA cofactor referred to herein and in the art as a guide RNA. Altering this guide RNA is sufficient to target Cas9 to a target nucleic acid. In a multitude of CRISPR- based biotechnology applications, the guide is often presented in a so-called sgRNA (single guide RNA), wherein the two natural Cas9 RNA cofactors (crRNA and tracrRNA) are fused via an engineered loop.
- sgRNA single guide RNA
- Embodiments of the present disclosure are directed to a method of delivering a functional group or moiety attached to a enzymatically active Cas9 protein to a target nucleic acid in a cell comprising providing to the cell the enzymatically active Cas9 protein having the functional group or moiety attached thereto and a guide RNA having spacer sequence between 16 and 8 nucleotides in length wherein the guide RNA and the Cas9 protein form a co-localization complex with the target nucleic acid and where the enzymatically active Cas9 protein is rendered non-endonucleolytically active and where the functional group or moiety is delivered to the target nucleic acid.
- Methods described herein can be performed in vitro, in vivo or ex vivo.
- the cell is a eukaryotic cell or a prokaryotic cell.
- the cell is a bacteria cell, a yeast cell, a mammalian cell, a plant cell or an animal cell.
- the Cas9 protein is an enzymatically active Cas9 protein, a Cas9 protein wild-type protein, or an enzymatically active Cas9 nickase.
- Fu-ca aal prolans such as tramcrip ⁇ .io?s3 ⁇ 4l regulators, such as trar aprbor-al activators or ⁇ p es r , VFtL a Fok-doinairj.. such as Fok L an aptaroor. a bird i protein FP?., MS2 and the like.
- Embodiments of the present disclosure are directed to a method of delivering an enzymatically active Cas9 protein optionally having a functional group attached thereto to cells within a subject comprising administering to the subject, such as systemically administering to the subject, such as by intravenous administration or injection, intraperitoneal administration or injection, intramuscular administration or injection, intracranial administration or injection, intraocular administration or injection, subcutaneous administration or injection, a enzymatically active Cas9 protein optionally having a functional group attached thereto or a nucleic acid encoding the enzymatically active Cas9 protein optionally having a functional group attached thereto.
- Embodiments of the present disclosure are directed to a method of delivering a guide RNA to cells within a subject comprising administering to the subject, such as systemically administering to the subject, such as by intravenous administration or injection, intraperitoneal administration or injection, intramuscular administration or injection, intracranial administration or injection, intraocular administration or injection, subcutaneous administration or injection, a guide RNA or a nucleic acid encoding the guide RNA.
- Embodiments of the present disclosure are directed to a method of delivering an enzymatically active Cas9 protein optionally having a functional group attached thereto and a guide RNA to cells within a subject comprising administering to the subject, such as systemically administering to the subject, such as by intravenous administration or injection, intraperitoneal administration or injection, intramuscular administration or injection, intracranial administration or injection, intraocular administration or injection, subcutaneous administration or injection, an enzymatically active Cas9 optionally having a functional group attached thereto or a nucleic acid encoding the enzymatically active Cas9 protein optionally having a functional group attached thereto and a guide RNA or a nucleic acid encoding the guide RNA.
- Methods of non-viral delivery of nucleic acids or native DNA binding protein, native guide RNA or other native species include lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA.
- Lipofection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., TransfectamTM and LipofectinTM).
- Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91/17424; WO 91/16024. Delivery can be to cells (e.g. in vitro or ex vivo administration) or target tissues (e.g. in vivo administration).
- the term native includes the protein, enzyme or guide RNA species itself and not the nucleic acid encoding the species.
- regulatory element is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences).
- promoters e.g. promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences).
- ITR internal ribosomal entry sites
- regulatory elements e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences.
- Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences).
- a tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal- dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific. Regulatory elements may also direct expression in an inducible manner, such as in a small-molecule dependent or light- dependent manner.
- a vector may comprise one or more pol III promoter (e.g. 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1, 2,
- pol II promoters 3, 4, 5, or more pol II promoters
- one or more pol I promoters e.g. 1, 2, 3, 4, 5, or more pol I promoters
- pol III promoters include, but are not limited to, U6 and HI promoters.
- pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) (see, e.g., Boshart et al, Cell, 41 :521-530 (1985)), the SV40 promoter, the dihydrofolate reductase promoter, the ⁇ -actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EFl a promoter and Pol II promoters described herein.
- RSV Rous sarcoma virus
- CMV cytomegalovirus
- PGK phosphoglycerol kinase
- enhancer elements such as WPRE; CMV enhancers; the R-U5 ' segment in LTR of HTLV-I (Mol. Cell. Biol, Vol. 8(1), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit ⁇ -globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31, 1981).
- WPRE WPRE
- CMV enhancers the R-U5 ' segment in LTR of HTLV-I
- SV40 enhancer SV40 enhancer
- the intron sequence between exons 2 and 3 of rabbit ⁇ -globin Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31, 1981.
- a vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., clustered regularly interspersed short palindromic repeats (CRISPR) transcripts, proteins, enzymes, mutant forms thereof, fusion proteins thereof, etc.).
- CRISPR clustered regularly interspersed short palindromic repeats
- a terminator sequence includes a section of nucleic acid sequence that marks the end of a gene or operon in genomic DNA during transcription. This sequence mediates transcriptional termination by providing signals in the newly synthesized mRNA that trigger processes which release the mRNA from the transcriptional complex. These processes include the direct interaction of the mRNA secondary structure with the complex and/or the indirect activities of recruited termination factors. Release of the transcriptional complex frees RNA polymerase and related transcriptional machinery to begin transcription of new mRNAs. Terminator sequences include those known in the art and identified and described herein.
- epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags.
- reporter genes include, but are not limited to, glutathione-S- transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, betaglucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP).
- GST glutathione-S- transferase
- HRP horseradish peroxidase
- CAT chloramphenicol acetyltransferase
- beta-galactosidase beta-galactosidase
- betaglucuronidase beta-galactosidase
- luciferase green fluorescent protein
- GFP green fluorescent protein
- HcRed HcRed
- DsRed cyan fluorescent protein
- YFP yellow fluorescent protein
- CRISPR-Cas9 holds tremendous promise in correcting genetic defects, and its delivery by adeno-associated viruses (AAVs) is thought to be exceptionally safe.
- AAVs adeno-associated viruses
- immunological reactions against encoded transgenes and/or the viral capsid have sometimes been observed (reviewed in Mays, L. E. & Wilson, J. M. The complex and evolving story of T cell activation to AAV vector-encoded transgene products. Mol Ther 19, 16-27, doi: 10.1038/mt.2010.250 (2011)).
- it has been sought to first establish a flexible AAV-CRiSPR-CasS? ⁇ that enables the wide spectrum of unrealized applications in vivo. Second, the host response to the system has been tracked.
- AAV-CRISPR-Cas9 This is important because the exogenous nature of AAV-CRISPR-Cas9 might incite detrimental host reactions against the encoded transgenes and/or viral capsid (reviewed in Mays, L. E. & Wilson, J. M. The complex and evolving story of T cell activation to AAV vector-encoded transgene products. Mol Ther 19, 16-27, doi: 10.1038/mt.2010.250 (201 1)). Understanding the host responses towards AAV-CRISPR-Cas9 would identify confounding factors that impact experimental rigor, highlight relevant considerations for clinical translation, and provide a roadmap for engineering efficient genome manipulation systems.
- this example describes the immunogenicity of AAV-CRISPR-Cas9 in mice, specifically that of AAV-split- Cas9, a platform capable of postnatal genome-editing, transcriptional regulation, and further domain fusions.
- AAV elicits a humoral immune response, inducing antibodies targeting motifs associated with viral functions.
- Cas9 elicits both humoral and cellular immune responses, but its delivery by AAV mitigates overt tissue or cellular damage seen with alternative delivery methods.
- This study provides the first demonstration of postnatal CRISPR-Cas9 applications beyond genome-editing, and elucidates the AAV-CRISPR-Cas9 safety profile necessary for bringing it into the clinic.
- SpCas9 has the least restrictive protospacer adjacent motif (PAM) requirement, which fundamentally dictates the density of possible target sites per given genome (FIG. 1A).
- PAM protospacer adjacent motif
- more restrictive PAM requirements e.g., Stl (Esvelt, K. M. et al. Orthogonal Cas9 proteins for RNA-guided gene regulation and editing. Nature methods 10, 1116-1121, doi: 10.1038/nmeth.2681 (2013)); Nm (Esvelt, K. M. et al. Orthogonal Cas9 proteins for RNA-guided gene regulation and editing. Nature methods 10, 1116-1121, doi: 10.1038/nmeth.2681 (2013)); and Sa (Ran, F. A. et al.
- the Cas9 N-terminal lobe is fused with the Rhodothermus marinus N-split-intein (Cas9 N ) (2.5 kb), and the C-terminal lobe is fused with C-split-intein (Cas9 c ) (2.2 kb) (FIGS. 2A and 2B), and each is designed to be individually packaged into a separate AAV vector (FIG. 3A), thereby liberating > 2 kb within each AAV vector for additional elements.
- split-Cas9 was fully active, targeting all endogenous genes tested at efficiencies 85% to 115% of Cas9 FL (FIG. 1C and FIGS. 2C and 2D).
- Cas9 c -P2A-turboGFP and Cas9 N -U6-gRNAs were packaged into AAV serotype DJ (AAV-Cas9-gRNAs) (FIG. 3A) and the viruses were to cultured cells.
- AAV-Cas9-gRNAs modified all targeted genes in differentiated myotubes (FIG. ID, FIGS. 3B and 3C), tail-tip fibroblasts (FIG. 3D) and spermatogonial cells (FIG. IE), demonstrating robustness in three distinct cell types of proliferative and terminally differentiated states.
- nuclease-active Cas9 can be programmed with truncated gRNAs to bind genomic loci without inducing DNA breaks, thereby allowing a single Cas9 fusion protein to simultaneously effect genome- editing and epigenetic regulation (Kiani, S. et al. Cas9 gRNA engineering for genome editing, activation and repression. Nature methods 12, 1051-1054, doi: 10.1038/nmeth.3580 (2015); Dahlman, J. E. et al. Orthogonal gene knockout and activation with a catalytically active Cas9 nuclease. Nature biotechnology 33, 1159-1161, doi: 10.1038/nbt.3390 (2015)) (FIG. IF).
- nuclease-active AAV-Cas9-VPR programmed with truncated gRNAs (14-15 nt spacers) upregulated gene expression of the targeted PD-L1, FST, and CD47 genes (FIG. 1G).
- nuclease-inactive 'dead' Cas9 FL (dCas9)-activators Choavez, A. et al. Highly efficient Cas9-mediated transcriptional programming. Nature methods 12, 326-328, doi: 10.1038/nmeth.3312 (2015); Konermann, S. et al. Genome-scale transcriptional activation by an engineered CRISPR-Cas9 complex.
- a AVR. ' as9 hi desi ns as rev ousl descri ed arc enable to aceotootodare the i k b V pR doraaia fasaon.
- AAV ' -Ca V-gR As targeting Ms in svas eext psendoeyped io sero y e 9 at;d systern -caby deliv red die vira es
- AAV9 showed preferential tropism for liver, heart and skeletal muscle (vg/dg of 850, 370, 140, respectively), while lower vg/dg were detected in the brain and gonads (FIG.
- AAV9-Cas9-gRNAs activity was tracked at single-cell resolution, using the Ai9 mouse line (Madisen, L. et al. A robust and high-throughput Cre reporting and characterization system for the whole mouse brain. Nat Neurosci 13, 133-140, doi: 10.1038/nn.2467 (2010)) that accurately couples genomic excision of a 3xStop cassette with tdTomato fluorescence activation.
- Systemic delivery of AAV9- Cas9-gRNAs TdL+TdR (5E1 1 or 4E12 vg) targeting the 3xStop cassette generated excision- dependent tdTomato+ cells in all examined organs FIG. 4C and FIG.
- the platform enables transcriptional regulation in vivo.
- Mice were intramuscularly injected with the same dosage oi AAV9 -Cas9- VPE gR As : var ing only the spacer sequences to target different sets of genes.
- the targeted PD-L1 and CD47 genes were activated by 2-fold and 1.6-fold respectively, as determined by qRT-PCR and total mRNA- sequencing (FIGS. 4D and 4E). This demonstrates, for the first time, postnatal transcriptional regulation with CRISPR-Cas9.
- T-cell(s) mediating the cellular response
- TCR- ⁇ repertoires of lymphocytes infiltrating the draining lymph nodes were sequenced. It was observed that Cas9-exposure stimulated skewed expansion of T-cell clonotypic subsets (FIG. 8C), which implies antigen-specific T-cell activation and proliferation.
- 122-IVDEVAYHEKYP- 133 resides in the REC 1 domain also contributing to Cas9:gRNA interactions, but do not cover residues mediating the contact (Nishimasu, H. et al. Crystal structure of Cas9 in complex with guide RNA and target DNA.
- 1 126-WDPKKYGGFD- 1135 resides in the PAM-binding loop and contains conserved residues, but maintains wild- type Cas9 endonucleolytic function when selectively mutated ( 1 125-DWD ⁇ AAA (Jinek, M. et al. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science 343, 1247997, doi: 10.1 126/science.1247997 (2014)), or D 1 135E (Kleinstiver, B. P. et al. Engineered CRISPR-Cas9 nucleases with altered PAM specificities.
- AAV9 elicited capsid-specific antibodies (FIG. 9C) against epitopes that were shared among injected animals at surprisingly high degrees (FIG. 8G), reminiscent of a public response to viruses recently observed also in humans (Xu, G. J. et al. Viral immunology. Comprehensive serological profiling of human populations using a synthetic human virome. Science 348, aaa0698, doi: 10.1126/science.aaa0698 (2015)).
- Epitope -mapping provides intriguing support that AAV9 antigenicity derives from biophysical and functional aspects, instead of purely sequence-level motifs.
- the metastable VPl unique and VP 1/2 common regions are antigenic, suggesting their extemalization from the viral interior for antigen capture.
- Immunodominant epitopes in VP3 lie predominantly on the capsid surface (FIG. 9D). Notably, while many of these residues can be separately double-alanine mutated without disrupting viral assembly (Adachi, K., Enoki, T., Kawano, Y., Veraz, M. & Nakai, H. Drawing a high-resolution functional map of adeno-associated virus capsid by massively parallel sequencing.
- TQNNNSEFAWPG-505) cover 12/18 of these residues associated with AAV9 hepatotropism.
- AAV9 elicits humoral immunogenicity that overlaps among all animals, across substantial regions of the capsid protein that modulate viral biodistribution.
- mRNA-sequencing was next conducted on tissues from AAV9-Cas9-VPR-gR As and AAV9-turboRFP treated mice (4E12 and IE 11 vg), and the whole transcriptomes were compared against those from mice treated with AAV9-turboRFP only (IE 11 vg).
- Interleukin-2 is pivotal for cytolytic T-cell differentiation (Pipkin, M. E. et al.
- AAV-CRISPR-Cas9 activates the host immune system, it does not trigger overt cellular damage observed with alternative delivery methods.
- CRISPR-Cas9 allows user-defined DNA-RNA-protein interactions, driving a wide range of applications that includes epigenetic regulation and protein-complex recruitment.
- the use of CRISPR-Cas9 in vivo has the potential not just to correct genetic defects, but also to modulate the epigenome.
- Sph ⁇ .--Cas9 shortens the coding sequenc s below that of ah aceo nxxkie there current, forms (Ran, F. A. et al. In vivo genome editing using
- AAV system enables the Cas9-mediated correction of a metabolic liver disease in newborn mice. Nature biotechnology, doi: 10.1038/nbt.3469 (2016); Yin, H. et al. Therapeutic genome editing by combined viral and non-viral delivery of CRISPR system components in vivo.
- AAV-CRISPR-Cas9 The fundamental consideration for clinical implementation of AAV-CRISPR-Cas9 lies in its safety.
- Alternative delivery methods such as DNA electroporation and adenoviruses (Wang, D. et al. Adenovirus-Mediated Somatic Genome Editing of Pten by CRISPR/Cas9 in Mouse Liver in Spite of Cas9-Specific Immune Responses. Hum Gene Ther 26, 432-442, doi: 10.1089/hum.2015.087 (2015)) cause severe inflammation and immunological reactions within the host. Inherently benign delivery vectors are hence particularly attractive.
- U6-driven gRNA plasmids were constructed as described
- AAV plasmid backbone was derived from pZac2.1- CASI-EGFP-RGB, a gift from Luk Vandenberghe.
- Minicircles parental plasmids were cloned in ZYCY10P3S2T, and minicircles were generated as described (Kay, M. A., He, C. Y. & Chen, Z. Y. A robust system for production of minicircle DNA vectors. Nature biotechnology 28, 1287-1289, doi: 10.1038/nbt. l708 (2010)).
- AAV plasmids were cloned in Stbl3 (Life Technologies C7373-03). All other plasmids were cloned in DH5a (NEB C2987H). Protein transgenes were expressed from ubiquitous hybrid promoters: SMVP promoter (generated by fusing SV40enhancer-CMV-promoter-chimeric intron), CASI promoter (Balazs, A. B. et al. Antibody-based protection against HIV infection by vectored immunoprophylaxis. Nature 481, 81-84, doi: 10.1038/nature 10660 (2012)), or CAG promoter (Matsuda, T. & Cepko, C. L.
- SMVP plasmid was derived from pMAXGFP (Lonza).
- pCAG-GFP was a gift from Connie Cepko (Addgene plasmid # 11150).
- pAAV- CMV-HI-EGFP-Cre-WPRE-SV40pA was obtained from the University of Pennsylvania Vector Core.
- AAV packaging and purification were packaged via the triple-transfection method (Grieger, J. C, Choi, V. W. & Samulski, R. J. Production and characterization of adeno-associated viral vectors. Nat Protoc 1, 1412-1428, doi: 10.1038/nprot.2006.207 (2006);
- HEK293 cells (Cell Biolabs AAV- 100 or Agilent 240073) were plated in growth media consisting of DMEM+glutaMAX+pyruvate+10%FBS (Life Technologies), supplemented with lx MEM non-essential amino acids (Gibco). Confluency at transfection was between
- HYPERFlask 'M' (Corning) were used, and the transfection mixture consisted of 200 ⁇ g of pHelper, 100 ug of pRepCap, 100 ug of pAAV, and 2 mg of PEIMAX.
- media was changed to DMEM+glutamax+pyruvate+2%FBS.
- Cells were harvested 48-72 hrs after transfection by scrapping or dissociation with lxPBS (pH7.2) + 5 mM EDTA, and pelleted at 1500 g for 12 min.
- Cell pellets were resuspended in 1-5 ml of lysis buffer (Tris HC1 pH 7.5 + 2 mM MgCl + 150 mM NaCl), and freeze-thawed 3x between dry-ice-ethanol bath and 37 °C water bath. Cell debris was clarified via 4000 g for 5 min., and the supernatant collected. Downstream processing differed depending on applications.
- the collected supernatant was treated with 50 U/ml of Benzonase ( Sigma- Aldrich) and 1 U/ml of Riboshredder (Epicentre) for 30 min. at 37 °C to remove unpackaged nucleic acids, filtered through a 0.45 ⁇ PVDF filter (Millipore), and used directly on cells or stored in -80 °C.
- Benzonase Sigma- Aldrich
- Riboshredder Epicentre
- the collected AAV supernatant was first treated with 50 U/ml Benzonase and 1 U/ml Riboshredder for 30 min. at 37 °C. After incubation, the lysate was concentrated to ⁇ 3 ml by ultrafiltration with Amicon Ultra- 15 (50 kDa MWCO) (Millipore), and loaded on top of a discontinuous density gradient consisting of 2 ml each of 15%, 25%, 40%, 60% Optiprep (Sigma-Aldrich) in an 11.2 ml Optiseal polypropylene tube (Beckman-Coulter).
- the tubes were ultracentrifuged at 58000 rpm, at 18 °C, for 1.5 hr, on an NVT65 rotor. The 40% fraction was extracted, and dialyzed with IxPBS (pH 7.2) supplemented with 35 mM NaCl, using Amicon Ultra-15 (50 kDa or 100 kDa MWCO) (Millipore). The purified AAVs were quantified for viral titers, and stored in -80 °C.
- AAV2/9-CMV-HI-EGFP-Cre-WPRE-SV40 (Lot V4565MI-R), AAV2/9-CB7-CI- EGFP-WPRE-rBG [Lot CS0516(293)], AAV2/9-CB7-CI-mCheny-WPRE-rBG (Lot V4571MI-R), and AAV2/9-CMV-turboRFP-WPRE-rBG (Lot V4528MI-R-DL) were obtained from the University of Pennsylvania Vector Core.
- AAV titers (vector genomes) were quantified via hydrolysis-probe qPCR (Aurnhammer, C. et al.
- Sp gRNAs Spacer sequence including 5' G from U6 promoter
- Table 2 A list of locus-specific genotyping primers for deep-sequencing used in this study.
- Rmalnt -SpCas9 c -P2A-turboGFP MAAACPELRQLAQSDVYWDPIVSIEPDGVEEVFDLTVPGPHNFVANDIIAHNSGQGDSLHEHIANLAGS PAIKKGILQTVKWDELVKVMGRHK
- C2C12 cells were obtained from the American Tissue Collection Center (ATCC, Manassas, VA), and grown in growth media (DMEM+glutaMAX+10% FBS). Cells were split with TypLE Express (Invitrogen) every 2-3 days and before reaching 80% confluency, to prevent terminal differentiation. Passage number was kept below 15.
- DMEM+glutaMAX+10% FBS growth media
- Passage number was kept below 15.
- 10 5 cells were plated per well in a 24-well plate, in 500 ⁇ of growth media. The following day, fresh media was replaced, and 800ng of total plasmid DNA was transfected with 2.4 ⁇ of Lipofectamine 2000 (Life Technologies). 1 : 1 mass ratio of vectors encoding Cas9:gRNA(s) was used. Media was replaced with differentiation media (DMEM+glutaMAX+2% donor horse serum) on the 1 st and 3 rd days post-lipofection.
- differentiation media DMEM+glutaMAX+2% donor horse serum
- 2xl0 4 cells were plated per well in a 96- well plate, in 100 ⁇ of growth media. At confluency, 1-2 day(s) after plating, media was replaced with fresh differentiation media (DMEM+glutaMAX+2% donor horse serum), and further incubated for 4 days. Fresh differentiation media was replaced before transduction with AAVs. Culture media was replaced with fresh differentiation media Id after transduction, and cells incubated for stated durations.
- fresh differentiation media DMEM+glutaMAX+2% donor horse serum
- the 3xStop-tdTomato reporter cell line was derived from tail-tip fibroblasts of Ai9 (Madisen, L. et al. A robust and high-throughput Cre reporting and characterization system for the whole mouse brain. Nat Neurosci 13, 133-140, doi: 10.1038/nn.2467 (2010)) mouse (JAX 007905), and immortalized with lentiviruses encoding the large SV40 T-antigen (GenTarget Inc, LVP016-Puro). Cells were cultured in DMEM+pyruvate+glutaMAX+10%FBS. Lipofectamine 2000 (Life Technologies) was used for transfection of plasmids, and images were taken 5 days after transfection.
- AAV AAV-containing lysates or purified AAVs were applied at confluency of 70- 90%. Culture media was replaced with fresh growth media the next day, and cells incubated for stated durations.
- the GC-1 spg mouse spermatogonial cell line (CRL-2053) was obtained from ATCC. Cells were cultured and transduced similarly to the 3xStop-tdTomato cell line, with a Cas9 N :Cas9 c of 1 : 1.
- mice (JAX No. 007905) were used for tdTomato activation, and for systemic AAV9-Cas9-gRNAs and AAV9-GFP-Cre experiments.
- C57BL/6 male mice were used for in vivo electroporation and intramuscular AAV injections. All animals were randomly allocated to treatment groups and handled equally.
- FK506 Sigma-Aldrich, F4679 was administered daily at 5mg/kg (body weight), commencing 1 day before electroporation.
- both tibialis anterior muscles of 11-week old male C57BL/6 mice were each electroporated with 30 ⁇ g of pSMVP-Cas9 FL .
- Control mice were electroporated with 30 ⁇ g of plasmid vector control (consisting of the same plasmid with Cas9 coding sequence removed) per muscle. Vehicle electroporations were similarly performed.
- C2C12 cells were harvested 4 days post-lipofection, with 100 ⁇ of QuickExtract DNA Extraction Solution (Epicentre) per well of a 24-well plate; and C2C12 myotubes were harvested 7 days post- AAV transduction, with 20 ⁇ of DNA QuickExtract per well of a 96-well plate.
- Cell lysates were heated at 65 °C for 10 min., 95 °C for 8 min., and stored at -20 °C. Each locus was amplified from 0.5 ⁇ of cell culture lysate per 25 ⁇ PCR reaction, for 20-25 cycles.
- conservative variant calling was performed by ignoring base substitutions, and calling only variants that overlap with a ⁇ 30 bp window from the designated Cas9-gRNA cut sites. Negative controls were equally analyzed for baseline sequencing error rates, to which statistical tests were performed against.
- Off-target sites for Mstn gRNAs were predicted using the online CRISPR Design Tool (Hsu, P. D. et al. DNA targeting specificity of RNA-guided Cas9 nucleases. Nature biotechnology 31, 827-832, doi: 10.1038/nbt.2647 (2013)) (world wide website crispr.mit.edu). Off-target sites were ranked by number of mismatches to the on-target sequence, and deep sequencing performed on top hits. Sequencing reads were analyzed equally between experimental samples (AAV9-Cas9-gRNAs M3+M4 ) and control samples (AAV9-Cas9-gRNAs TdL+TdR ) using BLAT. Variant calls were performed for insertions and deletions that lie within a ⁇ 15 bp window from potential off-target cut-sites.
- qRT-PCR Quantitative reverse-transcription PCR
- Cells were processed with Taqman Cells-to-Ct kits (Thermo Fisher Scientific #4399002) as per manufacturer's instructions, with the modification that each qRT-PCR reaction was scaled down to 25 ⁇ .
- Taqman hydrolysis probes used: PD-L1 (Mm00452054_ml), FST (Mm00514982_ml), CD47 (Mm0049501 l_ml), and housekeeping gene Abl l (Mm00802029_ml).
- Gene expression from targeted genes were normalized to that of Abll (ACt) and fold-changes were calculated against AAV-Cas9 c -VPR- only controls (no-gRNA) (2 " ⁇ ).
- Basal gene expression percentiles for C2C 12 myotubes and GC-1 spermatogonial cells (type B spermatogonia) were retrieved from the Gene Expression Omnibus (GEO) repository (GDS2412 and GDS2390 respectively).
- GEO Gene Expression Omnibus
- RNA from skeletal muscle tissues was extracted via TRIzol. Reverse transcription was conducted with High-Capacity cDNA Reverse Transcription Kit (Applied Biosystems #4368814), and 5 ⁇ of each reaction was used for qRT-PCR in lx FastStart Essential DNA Probes Master (Roche #06402682001). Gene expression from targeted genes were normalized to that of Abl l (ACt) and fold-changes were calculated against AAV9- turboRFP-only controls (2 " ⁇ ).
- AAV administration in mice was conducted in a randomized and double-blind fashion. The allocation code was unblinded only after analyses were completed.
- AAV9-Cas9-gRNAs injections utilized AAV9-Cas9 N -gRNA:AAV9-Cas9 c - P2A-turboGFP ratio of 1 : 1.
- 3-day old neonates were each intraperitoneally injected with 4E12, 5E11, or 2.5E11 vector genomes (vg) of total AAV9.
- Vector volumes were kept at 100 ⁇ . Animals were euthanized via CO2 asphyxia and cervical dislocation 3 weeks following injections.
- AAV9-GFP and AAV9-mCherry co-transduction experiments animals were euthanized 9 days after injection.
- samples were taken from the heart body wall, liver, gastrocnemius muscle, olfactory bulb, ovary, testis, and diaphragm.
- AAV9-Cas9-VPR-gRNAs were intramuscularly injected at AAV9-Cas9 N - gRNAs:AAV9-Cas9 c -VPR ratio of 1: 1, at a total of 4E12 vg.
- 1E11 of AAV9-turboRFP was coadministered in the same mix.
- Controls mice were injected with 1E11 of AAV9-turboRFP only, with the final injection mix at the same volume.
- both tibialis anterior muscles of 11-week old male C57BL/6 mice were each injected with AAV9-Cas9 N and AAV9-Cas9 c (2E12 vg each).
- AAV9-Cas9 N was injected with AAV9-Cas9 N and AAV9-Cas9 c (2E12 vg each).
- 4E12 of AAV9 vector control was injected per muscle.
- Vehicle (lx PBS + 35mM NaCl) injections were similarly performed.
- muscles were injected with AAV9-Cas9-VPR-gRNAs at 4E12 vg and AAV9- turboRFP at 1E11 vg, while control mouse muscles were injected with the same volume of vehicle and AAV9-turboRFP at 1E11 vg.
- qPCR Quantitative PCR
- AAV genomic copies in tissues Each qPCR reaction consists of lx FastStart Essential DNA Probes Master (Roche #06402682001), lOOnM of each hydrolysis probe (against the AAV ITR and the mouse Acvr2b locus), 340nM of AAV ITR reverse primer, ⁇ each for all other forward and reverse primers, and 2.5 ⁇ of input tissue lysate.
- a mastermix was first constituted before splitting 22.5 ⁇ into each well, after which tissue lysates were added. Thermocycling conditions were: [95°C 15 min.; 40 cycles of (95°C 1 min., 60°C 1 min.)]. FAM and HEX fluorescence were taken every cycle.
- AAV genomic copies per mouse diploid genome were calculated against standard curves. For each tissue sample, two repeated samplings were performed for qPCR and deep-sequencing, all on separate days, and the means plotted with s.e.m. qPCR false positive rate were calculated similarly from two vehicle-injected negative control mice, to which statistical tests were performed against.
- Lymphocytes were isolated from 2x inguinal lymph nodes and lx popliteal lymph node per bilaterally injected mouse.
- Lymph nodes were scored, and incubated for 30 min. in RPMI + 1 mg/ml collagenase at RT.
- Lymphocytes were released by meshing through 70 ⁇ nylon sieves, washed twice with lx
- RNA molecules were counted based on Unique Molecular Identifiers using MIGEC (Shugay, M. et al. Towards error-free profiling of immune repertoires. Nature methods 11, 653-655, doi: 10.1038/nmeth.2960 (2014)), aligned with MIXCR (Bolotin, D. A. et al. MiXCR: software for comprehensive adaptive immunity profiling. Nature methods 12, 380-381, doi: 10.1038/nmeth.3364 (2015)), and post-analysis performed with MATLAB (MathWorks). Morisita-Horn indices per exposure condition were calculated by pairwise comparisons among 4 mice (2 animals from electroporation dataset and 2 animals from AAV dataset).
- AAV9-specific IgM, IgG, and IgG2a from AAV9-treated mice were compared to that from vehicle-injected control mice.
- AAV9 viruses (1E9 vg) were coated on each well of a 96-well PVDF MaxiSorp plate for 1 hr in lx TBST, followed by 1 hr of blocking in lx TBST + 3% BSA. After 3 washes with lx TBST, 1 : 100 diluted mouse serum was applied at 25 ⁇ per well, for 1 hr.
- M13KE genome was amplified by PCR, with one end terminating with the pill peptidase cleavage signal, and the other end terminating with a 4xGly linker followed by the mature pill.
- Cas9 and AAV9 VPl capsid coding sequence PCR products were each randomly fragmented with NEBNext dsDNA Fragmentase until about 50-300 bp. Purified fragments were treated with NEBNext End- Repair Module. After DNA purification, fragments were blunted ligated into the M13KE PCR product overnight at 16 °C.
- the entire ligation reaction was purified, and transformed into ER2738 (Lucigen), at 200 ng per 25 ⁇ of bacteria, with electroporation conditions of 10 ⁇ , 600 ⁇ , and 1.8kV. After 30 min. recovery in SOC media, the culture was amplified by combining with 20 ml of early-log ER2738 culture. After 4 hrs, the culture supernatant was collected, and incubated to a final concentration of 3.33% PEG-8000 and 417 mM of NaCl, overnight at 4 °C. M13 phage was pelleted, and resuspended in 2 ml of TBS.
- Phage titers were determined by LB/IPTG/X-gal blue-white plague counting, averaging > 1E11 pfu / ⁇ .
- 20 ⁇ of each phage library was incubated with 5 ⁇ of mouse serum or titrated amount of purified antibody controls [7A9 (Novus Bio), Guide-IT (Clontech), bG15 (Santa Cruz), bS 18 (Santa Cruz), bD20 (Santa Cruz), non-binding mouse IgG isotype control (Santa Cruz)], and made up to 50 ⁇ with TBST, for 1 hr at RT.
- Protein A/G magnetic beads (Millipore PureProteome) was first washed twice with TBST, resuspended to 10 ⁇ , and added to the reaction for additional 30 min. incubation. The beads were then washed 5x with TBST, and captured Ig:phage eluted with 100 ⁇ of 200 mM glycine-HCl, pH 2.2, 1 mg/ml BSA for 8 min. The eluant was neutralized with 15 ⁇ of 1 M Tris-HCl, pH 8.5.
- RNA-sequencing 1 ⁇ g of TRIzol-extracted RNA from muscle tissues were enriched for polyA-tailed mRNA and processed with NEBNext Ultra Directional RNA
- TA muscle sections were blocked in lx PBST + 3% BSA for lhr at RT, immunostained with primary antibodies at RT for 1 hr, followed by 3x washes with PBS/T. Slides were then incubated with secondary antibodies at RT for 1 hr., followed by 3x washes with PBS/T. Anti-mouse IL-2 and perforin antibodies were used at 1 : 100 (Santa Cruz sc-7896 and sc-9105 respectively), followed by 1 :200 of secondary anti-rabbit CF633 (Biotium). Immunostained slides were mounted with mounting media containing DAPI (Vector Laboratories, H1500).
- FK506 was dissolved in 100% DMSO, and the stock solution further diluted 1 : 100 in vehicle for final concentrations of 1% DMSO, 10% Cremophor (Sigma-Aldrich, C5135), and lx PBS. Mice were injected daily with 5 mg/kg (body weight) of FK506, with the first injection commencing 1 day before in vivo electroporation.
- minicircle-SMVP-Cas9 was injected for Cas9-only injections, 15 ⁇ g of pCAG-GFP for GFP-only injections, and 30 ⁇ g of minicircle-SMVP-Cas9 and 15 ⁇ g of pCAG-GFP for Cas9+GFP injections. 4 mice were injected per condition.
- Epifluorescence images were taken with an Axio Observer D 1 (Carl Zeiss) or Axio Observer Zl (Carl Zeiss).
- pixels that contain both GFP and mCherry fluorescence intensities above the background thresholds were identified, and the lower intensity values from either channel were used to populate a merged image. All other pixels in the merged image were set to null.
- Cas9 orthologs such as those from S. aureus (Sa) (Ran, F. A. et al. In vivo genome editing using Staphylococcus aureus Cas9. Nature 520, 186-191, doi: 10.1038/naturel4299
- SpCas9 requires an NRG, NGR, or NGCG PAM
- SaCas9 requires an NNGRR or NNNRRT PAM (these are referred to as Sp* and Sa* respectively in FIG. 1A).
- Sp* and Sa* respectively in FIG. 1A.
- this is an underestimate of the current Sp*Cas9 targeting range, because SpCas9 fused with DNA-binding domains allows targeting of the NGC PAM (Bolukbasi, M. F. et al. DNA- binding-domain fusions enhance the targeting range and precision of Cas9. Nature methods 12, 1 150-1 156, doi: 10.1038/nmeth.3624 (2015)).
- the relaxed NGC PAM is not included in our analysis, in the spirit to maintain conservative comparison in the absence of such engineering conducted with any of the other Cas9 orthologs.
- the advantage of a relaxed PAM is exponential when multiple sites are targeted within a genome, where the probability of finding multiple suitable sites is a product of the PAM densities.
- CRISPR-Cas9 A useful application of multiplex CRISPR-Cas9 would be to generate genomic excisions, as we apply here.
- the PAM density also dictates the feasibility of widely used CRISPPv-Cas9 tools.
- specificity of CRISPR-Cas9 gene -targeting is significantly increased with the use of paired Cas9-nickases (Mali, P. et al. CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature biotechnology 31, 833-838, doi: 10.1038/nbt.2675 (2013); Ran, F. A. et al. Double nicking by RNA-guided CRISPR Cas9 for enhanced genome editing specificity.
- these approaches operate on the basis that endonucleolytic activity is constituted only when both Cas9-gRNA complexes are within a certain molecular distance from each other ( ⁇ 100 bp for offset nicking with Cas9-nickases; 15 bp or 25 bp for dCas9-FokI).
- Existence of two Cas9-gRNA target sites within these specific distances is hence necessary for function.
- the numbers of human (Fig. 1A) and mouse exonic sites that can be targeted with these specificity-enhancing approaches are orders of magnitude higher for SpCas9, compared to the other orthologs.
- StlCas9 generally underperfbrmed SpCas9 across > 1000 tested gRNAs (Chari, R., Mali, P., Moosburner, M. & Church, G. M. Unraveling CRISPR-Cas9 genome engineering parameters via a library-on-library approach. Nature methods 12, 823-826, doi: 10.1038/nmeth.3473 (2015)). Comprehensive comparisons between CRISPR-Cas9s and CRISPR-Cpfls are anticipated for these highly enticing systems.
- AAV-split-Cas9 allows domain fusions and compatibility with self-complementary AAVs
- the L2 domain is an appropriate split-site.
- PfAgo PfAgo
- the L2 domain lies E276-R363.
- Q347-L356 is less structured and might be most preferred.
- the less structured region at Y413-E443 might also be an appropriate split-site.
- TtAgo PB: 3DLH, 4N47
- the L2 domain lies E272-F338.
- D269-W283, R315-L321, and T504-P515 are less structured regions, and might be most preferred.
- NgAgo structure has not been determined, but based on the high structural conservation among orthologs between species and across prokaryotes to eukaryotes, a similar bilobal protein structure is likely. From homology alignment of NgAgo with PfAgo and TtAgo using HHPred (Soding, J., Biegert, A. & Lupas, A. N. The HHpred interactive server for protein homology detection and structure prediction. Nucleic Acids Res 33, W244-248, doi: 10.1093/nar/gki408 (2005)), Q417-A438, Y481-T502, and S696-Q707 are potential split-sites.
- AAV9-Cas9-gRNA biodistribution revealed edited cells across multiple tissue types and organs, enabled by the robustness of AAV9 for systemic delivery.
- this wide viral spread urges that careful monitoring and confinement of AAV-Cas9-gRNA would be prudent.
- the dual-AAVs format offers multi-tiered safeguards to restrict Cas9- gRNA activity to specific tissues of interest.
- the ability to use independent transcriptional and translational elements within the two AAVs would enable stricter tissue-specific regulation, such as by intersecting two or more tissue-specific elements.
- using independent AAV serotypes for each split-half and gRNA(s) would further confine Cas9- gRNA function to tissues where tropisms overlap.
- Enhancing tissue-level specificity complements the increased genome-level specificity that has been demonstrated with Cas9 engineering (Mali, P. et al. CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature biotechnology 31, 833-838, doi: 10.1038/nbt.2675 (2013); Ran, F. A. et al. Double nicking by RNA-guided CRISPR Cas9 for enhanced genome editing specificity. Cell 154, 1380-1389, doi: 10.1016/j .cell.2013.08.021 (2013); Tsai, S. Q. et al. Dimeric CRISPR RNA-guided Fokl nucleases for highly specific genome editing.
- intein insertions can render full-length SpCas9 conditionally inactive/active in response to small molecules, thereby also increasing genomic target-specificity (Davis, K. M., Pattanayak, V., Thompson, D. B., Zuris, J. A. & Liu, D. R. Small molecule-triggered Cas9 protein with improved genome -editing specificity. Nat Chem Biol 11, 316-318, doi: 10.1038/nchembio. l793 (2015)).
- none of the 15 tested intein-inserted Cas9 variants retained full Cas9 FL activity, potentially due to disruption of the Cas9 structure; furthermore, the coding sequences of these variants (5.4 kb) exceed the AAV payload limitation.
Landscapes
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Mycology (AREA)
- Medicinal Chemistry (AREA)
- Virology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Veterinary Medicine (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The invention provides methods of altering a target nucleic acid in a cell using the AAV split Cas9 platform. The methods comprise providing the cell an enzymatically active Cas9 and optionally a transcriptional regulator fused thereto and guide RNA having different spacer sequence lengths wherein the guide RNA directs the enzymatically active Cas9 and optionally a transcriptional regulator fused thereto to either cleave a target nucleic acid or regulate expression of a target nucleic acid.
Description
AAV SPLIT CAS9 GENOME EDITING AND TRANSCRIPTIONAL REGULATION
RELATED APPLICATION DATA
This application claims priority to U.S. Provisional Application No. 62/335,271 filed on May 12, 2016, which is hereby incorporated by reference in its entirety for all purposes.
STATEMENT OF GOVERNMENT INTERESTS
This invention was made with government support under Grant No. P50 HG005550 awarded by National Institutes of Health. The government has certain rights in the invention.
BACKGROUND
The CRISPR type II system is a recent development that has been efficiently utilized in a broad spectrum of species. See Friedland, A.E., et al., Heritable genome editing in C. elegans via a CRISPR-Cas9 system. Nat Methods, 2013. 10(8): p. 741-3, Mali, P., et al, RNA-guided human genome engineering via Cas9. Science, 2013. 339(6121): p. 823-6, Hwang, W.Y., et al., Efficient genome editing in zebrafish using a CRISPR-Cas system. Nat Biotechnol, 2013, Jiang, W., et al., RNA-guided editing of bacterial genomes using CRISPR- Cas systems. Nat Biotechnol, 2013, Jinek, M., et al., RNA-programmed genome editing in human cells, elife, 2013. 2: p. e00471, Cong, L., et al., Multiplex genome engineering using CRISPR Cas systems. Science, 2013. 339(6121): p. 819-23, Yin, H., et al, Genome editing with Cas9 in adult mice corrects a disease mutation and phenotype. Nat Biotechnol, 2014. 32(6): p. 551-3. CRISPR is particularly customizable because the active form consists of an invariant Cas9 protein and an easily programmable guide RNA (gRNA). See Jinek, M., et al., A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science, 2012. 337(6096): p. 816-21. Of the various CRISPR orthologs, the Streptococcus pyogenes (Sp) CRISPR is the most well-characterized and widely used. The Cas9-gRNA
complex first probes DNA for the protospacer-adjacent motif (PAM) sequence (-NGG for Sp Cas9), after which Watson-Crick base-pairing between the gRNA and target DNA proceeds in a ratchet mechanism to form an R-loop. Following formation of a ternary complex of Cas9, gRNA, and target DNA, the Cas9 protein generates two nicks in the target DNA, creating a blunt double-strand break (DSB) that is predominantly repaired by the non-homologous end joining (NHEJ) pathway or, to a lesser extent, template-directed homologous recombination (HR). CRISPR methods are disclosed in US 9,023,649 and US 8,697,359. See also, Fu et al., Nature Biotechnology, Vol. 32, Number 3, pp. 279-284 (2014). Additional references describing CRISPR-Cas9 systems including nuclease null variants (dCas9) and nuclease null variants functionalized with effector domains such as transcriptional activation domains or repression domains include J. D. Sander and J. K. Joung, Nature biotechnology 32 (4), 347 (2014); P. D. Hsu, E. S. Lander, and F. Zhang, Cell 157 (6), 1262 (2014); L. S. Qi, M. H. Larson, L. A. Gilbert et al, Cell 152 (5), 1173 (2013); P. Mali, J. Aach, P. B. Stranges et al., Nature biotechnology 31 (9), 833 (2013); M. L. Maeder, S. J. Linder, V. M. Cascio et al., Nature methods 10 (10), 977 (2013); P. Perez-Pinera, D. D. Kocak, C. M. Vockley et al., Nature methods 10 (10), 973 (2013); L. A. Gilbert, M. H. Larson, L. Morsut et al., Cell 154 (2), 442 (2013); P. Mali, K. M. Esvelt, and G. M. Church, Nature methods 10 ( 10), 957 (2013); and K. M. Esvelt, P. Mali, J. L. Braff et al, Nature methods 10 ( 11), 1116 (2013).
The CRISPR-Cas9 system enables facile genetic and epigenetic manipulations (Mali,
P. et al. RNA-guided human genome engineering via Cas9. Science 339, 823-826, doi: 10.1126/science.1232033 (2013); Cong, L. et al. Multiplex genome engineering using
CRISPR/Cas systems. Science 339, 819-823, doi: 10.1126/science.1231143 (2013); Jinek, M. et al. A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity.
Science 337, 816-821, doi: 10.1126/science.1225829 (2012)), and its simplicity and
robustness suggest that personalized genetic therapeutics may be within reach. As CRISPR- Cas9 approaches the clinic, efficacy and safety for the patient would be of paramount importance. Extensive efforts have been employed to deliver CRISPR-Cas9 with adeno- associated viruses (AAVs). AAVs are prevalent and serologically compatible with a large fraction of the human population (Gao, G. et al. Clades of Adeno-associated viruses are widely disseminated in human tissues. Journal of virology 78, 6381-6388, doi: 10.1128/JVI.78.12.6381-6388.2004 (2004); Boutin, S. et al. Prevalence of serum IgG and neutralizing factors against adeno-associated virus (AAV) types 1, 2, 5, 6, 8, and 9 in the healthy population: implications for gene therapy using AAV vectors. Hum Gene Ther 21, 704-712, doi: 10.1089/hum.2009.182 (2010)) and are generally not considered to be pathogenic. Furthermore, AAVs allow both programmable tissue-tropism and systemic delivery (Zincarelli, C, Soltys, S., Rengo, G. & Rabinowitz, J. E. Analysis of AAV serotypes 1-9 mediated gene expression and tropism in mice after systemic injection. Mol Ther 16, 1073-1080, doi: 10.1038/mt.2008.76 (2008)). The preclinical promise of AAV-CRISPR-Cas9 by correcting genetic defects in mice has been described (Ran, F. A. et al. In vivo genome editing using Staphylococcus aureus Cas9. Nature 520, 186-191, doi: 10.1038/nature l4299
(2015) ; Nelson, C. E. et al. In vivo genome editing improves muscle function in a mouse model of Duchenne muscular dystrophy. Science 351, 403-407, doi: 10.1126/science.aad5143
(2016) ; Tabebordbar, M. et al. In vivo gene editing in dystrophic mouse muscle and muscle stem cells. Science 351, 407-411, doi: 10.1126/science.aad5177 (2016); Long, C. et al. Postnatal genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy. Science 351, 400-403, doi: 10.1126/science.aad5725 (2016); Yang, Y. et al. A dual AAV system enables the Cas9-mediated correction of a metabolic liver disease in newborn mice. Nature biotechnology, doi: 10.1038/nbt.3469 (2016); Yin, H. et al. Therapeutic
genome editing by combined viral and non-viral delivery of CRISPR system components in vivo. Nature biotechnology, doi: 10.1038/nbt.3471 (2016)).
Further application of AAV-CRISPR-Cas9 for modulating postnatal chromatin status or gene expression would vest profound biological control, particularly in treating diseases resulting from epigenetic alterations irresolvable by genome-editing. However, this ability has yet to be realized, in part because the large Cas9 transgenes leave little space for additional function-conferring elements within current designs (AAV payload limit < 4.7 kb)
(Ran, F. A. et al. In vivo genome editing using Staphylococcus aureus Cas9. Nature 520,
186-191, doi: 10.1038/naturel4299 (2015); Nelson, C. E. et al. In vivo genome editing improves muscle function in a mouse model of Duchenne muscular dystrophy. Science 351,
403-407, doi: 10.1126/science.aad5143 (2016); Tabebordbar, M. et al. In vivo gene editing in dystrophic mouse muscle and muscle stem cells. Science 351, 407-411, doi: 10.1126/science.aad5177 (2016); Long, C. et al. Postnatal genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy. Science 351, 400-
403, doi: 10.1126/science.aad5725 (2016); Yang, Y. et al. A dual AAV system enables the
Cas9-mediated correction of a metabolic liver disease in newborn mice. Nature biotechnology, doi: 10.1038/nbt.3469 (2016); Yin, H. et al. Therapeutic genome editing by combined viral and non-viral delivery of CRISPR system components in vivo. Nature biotechnology, doi: 10.1038/nbt.3471 (2016); Senis, E. et al. CRISPR/Cas9-mediated genome engineering: an adeno-associated viral (AAV) vector toolbox. Biotechnology journal 9, 1402-
1412, doi: 10.1002/biot.201400046 (2014); Swiech, L. et al. In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9. Nature biotechnology 33, 102-106, doi: 10.1038/nbt.3055 (2015)). This obstacle is exacerbated with the most widely used, but larger, Streptococcous pyogenes Cas9 (SpCas9, 4.2 kb), which makes packaging of even the
minimum functional cassette extremely challenging (Long, C. et al. Postnatal genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy. Science 351, 400-403, doi: 10.1126/science.aad5725 (2016); Senis, E. et al. CRISPR/Cas9-mediated genome engineering: an adeno-associated viral (AAV) vector toolbox. Biotechnology journal 9, 1402-1412, doi: 10.1002/biot.201400046 (2014); Swiech, L. et al. In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9. Nature biotechnology 33, 102- 106, doi: 10.1038/nbt.3055 (2015)).
SUMMARY
Aspects of the present disclosure are directed to the use of split Cas9 to perform CRISPPv-based methods in cells. According to one aspect, two or more portions or segments of a Cas9 are provided to a cell, such as by being expressed from corresponding nucleic acids introduced into the cell. The two or more portions are combined within the cell to form the Cas9 which has an ability to colocalize with guide RNA at a target nucleic acid. It is to be understood that the Cas9 may have one or more modifications from a full length Cas9 known to those of skill in the art, yet still retain or have the capability of colocalizing with guide RNA at a target nucleic acid. Accordingly, the two or more portions or segments, when joined together, need only produce or result in a Cas9 which has an ability to colocalize with guide RNA at a target nucleic acid.
According to certain general aspects, when a foreign nucleic acid sequence or sequences are expressed by the cell, the two or more portions or segments of an RNA guided DNA binding protein, such as Cas9, are produced and joined together to produce the RNA guided DNA binding protein, such as Cas9. When a foreign nucleic acid sequence or sequences are expressed by the cell, one or more or a plurality of guide RNAs are produced.
The RNA guided DNA binding protein, such as Cas9, and a guide RNA produces a complex of the RNA guided DNA binding protein, the guide RNA and a double stranded DNA target sequence. In this aspect, the RNA is said to guide the DNA binding protein to the double stranded DNA target sequence for binding thereto. This aspect of the present disclosure may be referred to as co-localization of the RNA and DNA binding protein to or with the double stranded DNA.
DNA binding proteins within the scope of the present disclosure may include those which create a double stranded break (which may be referred to as a DNA binding protein nuclease), those which create a single stranded break (referred to as a DNA binding protein nickase) or those which have no nuclease activity (referred to as a nuclease null DNA binding protein) but otherwise bind to target DNA. In this manner, a DNA binding protein-guide RNA complex may be used to create a double stranded break at a target DNA site, to create a single stranded break at a target DNA site or to localize a transcriptional regulator or functional group, function-conferring protein or domain, which may be expressed by the cell, at a target DNA site so as to regulate expression of target DNA. According to certain aspects, the foreign nucleic acid sequence may encode one or more of a DNA binding protein nuclease, a DNA binding protein nickase or a nuclease null DNA binding protein. The foreign nucleic acid sequence may also encode one or more transcriptional regulator or functional group, function-conferring proteins or domains or one or more donor nucleic acid sequences that are intended to be inserted into the genomic DNA. According to one aspect, the foreign nucleic acid sequence encoding an RNA guided enzymatically active DNA binding protein further encodes the transcriptional regulator or functional group, function- conferring protein or domain fused to the RNA guided enzymatically active DNA binding protein.
Accordingly, expression of a foreign nucleic acid sequence by a cell may result in a double stranded break, a single stranded break and/or transcriptional activation or repression of the genomic DNA. Donor DNA may be inserted at the break site by cell mechanisms such as homologous recombination or nonhomologous end joining. It is to be understood that expression of a foreign nucleic acid sequence as described herein may result in a plurality of double stranded breaks or single stranded breaks at various locations along target genomic DNA, including one or more or a plurality of gene sequences, as desired.
Aspects of the present disclosure are directed to methods of using an enzymatically active Cas9, such as a Cas9 nuclease or nickase, optionally having a functional group attached thereto, and a guide RNA which is used to guide the enzymatically active Cas9 with the functional group attached thereto to a target nucleic acid. According to one aspect, when a functional group is attached to the enzymatically active Cas9, the functional group is directed to a target nucleic acid to perform the desired function on the target nucleic acid, such as transcriptional regulation. Also, it is to be understood that transcriptional regulation can also be accomplished according to methods described herein where an enzymatically active Cas9 is used without any attached functional group and transcriptional regulation is accomplished by inhibition of transcription due to the Cas9 forming a complex at the target nucleic acid and without cutting the target nucleic acid. According to one aspect, the guide
RNA includes a truncated spacer sequence having a length sufficient to bind to a target nucleic acid and form a complex with the enzymatically active Cas9 optionally with the functional group attached thereto, but insufficient for the enzymatically active Cas9 to function to cut or nick the target nucleic acid. Without wishing to be bound by scientific theory, based on the length of the spacer sequence of the guide RNA, the endonucleolytic activity of the enzymatically active Cas9 is blocked or prevented or otherwise inhibited, and
the otherwise enzymatically active Cas9 is effectively rendered a nuclease null Cas9. According to this aspect, the functional group when attached to the enzymatically active Cas9 performs the desired function of the functional group, as the enzymatically active Cas9 nuclease does not function to cut or nick the target nucleic acid. Without wishing to be bound by any scientific theory, the enzymatically active Cas9 optionally with the functional group attached thereto forms a co-localization complex with the guide RNA and the target nucleic acid, however, the length of the truncated spacer sequence of the guide RNA results in an inability of the Cas9 to cleave the target nucleic acid substrate.
According to another aspect, the present disclosure are directed to methods of using a enzymatically active Cas9, such as a Cas9 nuclease or nickase, optionally having a functional group attached thereto and a guide RNA with a spacer sequence having a length sufficient to bind to a target nucleic acid and to form a complex with the enzymatically active Cas9 optionally with the functional group attached thereto, and sufficient to allow the enzymatically active Cas9 to function as a nuclease or nickase with respect to the target nucleic acid. According to one aspect, the functional group when optionally attached to the enzymatically active Cas9 does not perform the desired function of the functional group, as the target nucleic acid is either cut or nicked by the enzymatically active Cas9.
Aspects of the present disclosure are directed to methods of using a enzymatically active Cas9, such as a Cas9 nuclease or nickase, optionally having a functional group attached thereto, a first guide RNA with a spacer sequence having a length sufficient to bind to a first target nucleic acid and form a complex with the enzymatically active Cas9 optionally having the functional group attached thereto, but insufficient to allow the enzymatically active Cas9 to function as a nuclease or nickase with respect to the first target nucleic acid, and a second guide RNA with a spacer sequence having a length sufficient to
bind to a second target nucleic acid and form a complex with the enzymatically active Cas9 optionally having the functional group attached thereto, such as a Cas9 nuclease or nickase, and sufficient to allow the enzymatically active Cas9 to function as a nuclease or nickase with respect to the second target nucleic acid. According to this aspect, the enzymatically active Cas9 when complexed with the first guide RNA at the first target nucleic acid will function as a nuclease null Cas9 to deliver a functional group if present to the first target nucleic acid and the enzymatically active Cas9 when complexed with the second guide RNA at the second target nucleic acid will also function as a nuclease or nickase to either cut or nick the second target nucleic acid.
Aspects of the present disclosure are directed to programmable genome editing as an enzymatically active Cas9 can be used to cut or nick a target nucleic acid by selection of a first guide RNA sequence and the same Cas9 can be effectively rendered nuclease null by selection of a second guide RNA sequence which allows the Cas9 to complex at the target nucleic acid sequence but not cut or nick the target nucleic acid sequence. Such complex formation can have an inhibitory effect on transcription and therefore can regulate gene expression without using a separate transcription regulator functional group.
Aspects of the present disclosure are directed to programmable genome editing and use of a functional group, such as a transcriptional regulator, using the same species of enzymatically active Cas9 having the functional group attached thereto. Methods described herein are directed to the use of a single species of enzymatically active Cas9 having a transcriptional regulator attached thereto which can be simultaneously used for genome editing of target nucleic acids and transcriptional regulation of genes, based on the spacer sequence length of the particular guide RNA. The length of the guide RNA spacer sequence determines the ability of the enzymatically active Cas9 species having a functional group
(such as a transcriptional regulator) attached thereto to either (1) function to deliver the functional group to a target nucleic acid so that the functional group can perform its desired function or (2) function as an enzyme to cut or nick a target nucleic acid.
According to certain aspects, the enzymatically active Cas9 optionally having a functional group attached thereto is present within a cell and two or more guide RNAs are provided to a cell in series or simultaneously wherein each guide RNA is designed to complex with the enzymatically active Cas9 optionally having a functional group attached thereto at respective target nucleic acid sites or sequences. Each guide RNA has a spacer sequence length that determines whether the enzymatically active Cas9 optionally having a functional group attached thereto will function as either an enzyme to cut or nick a nucleic acid or as a nuclease null Cas9 to form a complex at the target nucleic acid and deliver the functional group if present to a target nucleic acid so that the functional group may perform its function on a target nucleic acid. In this manner, enzymatically active Cas9 optionally having a functional group attached thereto may first be used to cut or nick a nucleic acid and then be used to deliver a functional group if present to a nucleic acid sequence so that the functional group may perform the function or vice versa. According to one aspect, a plurality of guide RNAs may be used to target the enzymatically active Cas9 optionally having a functional group attached thereto, such as a single species of an enzymatically active Cas9 optionally having a functional group attached thereto, to a plurality of different target nucleic acid sites to perform either cutting or nicking or functional group delivery.
When the enzymatically active Cas9 optionally having a functional group attached thereto is used for cutting or nicking a target nucleic acid, methods described herein contemplate the use of one or more donor nucleic acids that may be inserted into one or more cut or nick sites through homologous recombination or nonhomologous end joining.
Accordingly, methods described herein are directed to methods of genome editing using the enzymatically active Cas9 optionally having a functional group attached thereto and also methods of targeting a functional group when present to a target nucleic acid to perform the function of the functional group using the enzymatically active Cas9 having a functional group attached thereto. One of skill will readily understand that the utility of the enzymatically active Cas9 optionally having a functional group attached thereto is determined by the spacer sequence length of the guide RNA and whether the guide R A has a spacer sequence length that facilitates enzymatic activity of the enzymatically active Cas9 or not.
According to one aspect, a functional group may be any desired functional group as known to those of skill in the art. An exemplary functional group may be an effector domain, such as a transcriptional activator or transcriptional repressor, or a detectable group, such as fluorescent protein, or a binding functional group, such as an aptamer or a protein-protein binding domain, which can be used to bind to a desired functional group or a nuclear localization signal, which can be used to deliver the Cas9 to a nucleus.
According to certain aspects, a guide RNA that allows enzymatic activity of the enzymatically active Cas9 having a functional group attached thereto includes a spacer sequence having an exemplary nucleotide length of between about 25 and about 15 nucleotides, such as between about 20 and about 16 nucleotides. According to certain aspects, a guide RNA that inhibits enzymatic activity of the enzymatically active Cas9 optionally having a functional group attached thereto includes a spacer sequence having an exemplary nucleotide length of between about 8 and about 16 nucleotides. According to certain aspects, a guide RNA that inhibits enzymatic activity of the enzymatically active Cas9 optionally having a functional group attached thereto includes a spacer sequence having an
exemplary nucleotide length of between 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20 nucleotides. A truncated spacer sequence has a nucleotide length that is shorter than the full length spacer sequence of the corresponding guide R A.
According to certain aspects, a guide RNA includes a spacer sequence and a tracr mate sequence forming a crRNA, as is known in the art. According to certain aspects, a tracr sequence, as is known in the art, is also used in the practice of methods described herein. According to one aspect, the tracr sequence and the crRNA sequence may be separate or connected by the linker, as is known in the art.
According to one aspect, the present disclosure provides a method of altering a target nucleic acid in a cell including providing to the cell a first nucleic acid encoding a first portion of a Cas9 protein and a guide RNA (gRNA), providing to the cell a second nucleic acid encoding a second portion of the Cas9 protein and optionally a transcriptional regulator, wherein the cell expresses the first portion of the Cas9 protein, the gRNA and the second portion of the Cas9 protein or the second portion of the Cas9 and the transcriptional regulator fusion protein, and wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein, or the first portion of the Cas9 protein and the second portion of the Cas9 and the transcriptional regulator fusion protein are joined together to form the Cas9 protein or the Cas9 fusion protein, wherein the gRNA and the Cas9 protein, or the gRNA and the Cas9 fusion protein form a co-localization complex with the target nucleic acid and alter the expression of the target nucleic acid.
According to another aspect, the present disclosure provides a method of altering a target nucleic acid in a cell of a subject including delivering to the cell of the subject a first nucleic acid encoding a first portion of a Cas9 protein and a guide RNA (gRNA) wherein the
first nucleic acid is within a first vector, delivering to the cell of the subject a second nucleic acid encoding a second portion of the Cas9 protein and optionally a transcriptional regulator wherein the second nucleic acid is within a second vector, wherein the cell expresses the first portion of the Cas9 protein, the gRNA and the second portion of the Cas9 protein or the second portion of the Cas9 and the transcriptional regulator fusion protein, wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein, or the first portion of the Cas9 protein and the second portion of the Cas9 and the transcriptional regulator fusion protein are joined together to form the Cas9 protein or the Cas9 fusion protein, and wherein the gRNA and the Cas9 protein, or the gRNA and the Cas9 fusion protein form a co- localization complex with the target nucleic acid and alter the expression of the target nucleic acid.
According to still another aspect, the present disclosure provides a method of modulating a target gene expression in a cell including providing to the cell a first recombinant adeno-associated virus comprising a first nucleic acid encoding an N-terminal portion of the Cas9 protein (Cas9N) and a gRNA, providing to the cell a second recombinant adeno-associated virus comprising a second nucleic acid encoding a fusion protein comprising a C-terminal portion of the Cas9 protein (Cas9c) fused with a transcriptional regulator (TR), wherein the cell expresses the Cas9N protein and the Cas9c-TR fusion protein and join them to form a full length Cas9FL-TR fusion protein, and wherein the cell expresses the gRNA, and the gRNA directs the Cas9FL-TR fusion protein to the target gene and modulates target gene expression.
According to yet another aspect, the present disclosure provides a method of imaging a target nucleic acid in a cell including providing to the cell a first recombinant adeno- associated virus comprising a first nucleic acid encoding an N-terminal portion of the Cas9
protein (Cas9N) and a gRNA, providing to the cell a second recombinant adeno-associated virus comprising a second nucleic acid encoding a fusion protein comprising a C-terminal portion of the Cas9 protein (Cas9c) fused with a fluorescent protein, wherein the cell expresses the Cas9N protein and the Cas9c fluorescent fusion protein and join them to form a full length Cas9FL fluorescent fusion protein, and wherein the cell expresses the gRNA, and the gRNA directs the Cas9FL fluorescent fusion protein to the target nucleic acid and produces fluorescent imaging of the target nucleic acid.
Further features and advantages of certain embodiments of the present invention will become more fully apparent in the following description of embodiments and drawings thereof, and from the claims.
BRIEF DESCRIPTION OF THE DRAWINGS
The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee. The foregoing and other features and advantages of the present embodiments will be more fully understood from the following detailed description of illustrative embodiments taken in conjunction with the accompanying drawings in which:
FIGS. 1A-H depict that split-Cas9 retains full activity of Cas9FL and enables AAV packaging with fusion domains. (FIG. 1A) SpCas9 (canonical PAM: NGG) broadly targets the human exome and transcriptional start sites (TSS), while orthologs suffer from restrictive PAMs (Sa: NNGRRT; Stl : NNAGAAW; Nm: NNNNGATT). Sp* and Sa* denote engineered Cas9 variants and include non-canonical PAMs. (FIG. IB) Schematic of split-
Cas9 and AAV-Cas9. (FIG. 1C) Split-Cas9 achieves equivalent editing frequencies as Cas9FL (one-way ANOVA). Each data point depicts mean ± s.e.m. of 6 means (source data in Fig. 2C). (FIG. ID) AAV-Cas9-gRNAs gene-edited myotubes. At each functional Cas9N:Cas9c, mutation frequency increased with AAV dose (one-way ANOVA), but began to plateau at -6% (n.s., not significant between 1E11 and 1E12). (FIG. IE) AAV-Cas9- gRNAs (black) edited the Mstn gene in GC-1 spermatogonial cells, while AAV-Cas9-VPR- gRNAs (cyan) exhibited reduced endonucleolytic activity (Cas9N:Cas9c, 1 : 1) (n-way ANOVA). (FIG. IF) Schematic of genome-editing and transcriptional regulation within a single system. A nuclease-active Cas9 is fused to a transcriptional activator domain. Cas9- mediated endonucleolytic DNA cleavage is programmed with a full-length gRNA, whereas Cas9-mediated transcriptional activation is programmed with a truncated gRNA. (FIG. 1G) AAV-Cas9-VPR-gRNAs upregulated target genes, as assessed by qRT-PCR (top, GC-1 cells; bottom, C2C12 myotubes; one-way ANOVA). (FIG. 1H) Transcriptional activation levels correlate inversely with basal gene expression levels. Data from GC-1 cells in red, data from C2C12 myotubes in black; closed dots denote with single-gRNA, and open circles denote with dual-gRNAs. *, P < 0.05, ***, P < 0.001, ANOVA followed by Holm-Sidak test. Error bars denote s.e.m.
FIGS. 2A-D depict that split-Cas9 retains full biological activity of full-length Cas9.
(FIG. 2A) SpCas9 consists of a bi-lobed structure (PDB IDs: 4008 and 4CMP) (Nishimasu,
H. et al. Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell 156,
935-949, doi: 10.1016/j.cell.2014.02.001 (2014); Jinek, M. et al. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science 343, 1247997, doi: 10.1126/science. l247997 (2014)), with the N- and C- termini of the disordered linker indicated. Cas9 is shown bound to the gRNA (red ribbon) and target DNA (blue ribbon).
(FIG. 2B) Schematic of plasmids encoding split-Cas9. SMVP = promoter; IntN/IntC = split- inteins; NLS = nuclear localization signal; polyA = SV40 polyadenylation signal. (FIG. 2C) Split-Cas9 was tested against full-length Cas9 (Cas9FL) on three endogenous genes, with or without co-translating P2A-turboGFP, by transfecting C2C12 cells with equal total mass amounts of Cas9 plasmids. Mutation frequencies induced by split-Cas9 and Cas9FL are not significantly different across all three genes (one-way ANOVA) (400ng of total Cas9 plasmids and 400ng of total gRNAs plasmids). Left panels: Cas9 without P2A-turboGFP (n = 3 independent transfections); Right panels: Cas9 with P2A-turboGFP (n = 2 independent transfections). Error bars denote s.e.m. (FIG. 2D) Split-Cas9 targets Ai9 fibroblasts equivalently to Cas9FL, activating tdTomato fluorescence by excision of the 3xStop terminators cassette. Sparse tdTomato+ cells were observed with single-gRNA, or paired- gRNAs both targeting one side of 3xStop (n = 2). Td5 and TdL target 5' of 3xStop; Td3 and TdR target 3' of 3xStop. Gray = tdTomato. Scale bar, 200 μπι.
FIGS. 3A-D depict that transduction of AAV-Cas9-gRNAs directs gene-editing in differentiated myotubes and tail -tip fibroblasts. (FIG. 3A) Schematic of AAV-Cas9-gRNAs.
ITR = AAV inverted terminal repeat; SMVP and CASI = promoters; IntN/IntC = split-inteins;
NLS = nuclear localization signal; polyA = SV40 polyadenylation signal. (FIG. 3B)
Epifluorescence time course of AAV-Cas9c-P2A-turboGFP expression, with onset by 1-2 days post-transduction. (FIG. 3C) Both unpurified AAV-Cas9-gRNAs-containing lysates
(100 μΐ per well) or IE 10 (vg, vector genomes) of chloroform-ammonium sulfate purified
AAV-Cas9-gRNAs edited the targeted endogenous loci in differentiated C2C12 myotubes.
Cas9N:Cas9c ratio of 1 : 1 was used. Each dot represents the mutation frequency detected per transduction per condition (P-values, one-tailed Wilcoxon rank-sum against no-gRNA controls, Bonferroni corrected). Red lines denote means ± s.e.m. (FIG. 3D) Transduction of
Ai9 tail -tip fibroblasts with IE 12 (total vg) of AAV-Cas9-gRNAs targeting the 3xStop cassette induced excision-dependent fluorescence activation (n = 2 transductions). gRNA pairs and Cas9N:Cas9c-P2A-turboGFP ratios are indicated. Td5 and TdL target 5' of 3xStop; Td3 and TdR target 3' of 3xStop. TdTomato was not observed in negative controls transduced with 6.7E11 (total vg) of Cas9c-P2A-turboGFP only. Images were taken 7 days post- transduction. Scale bars, 500 μιη.
FIGS. 4A-D depict postnatal genome -editing with AAV9-Cas9-gRNAs and transcriptional activation with AAV9-Cas9-VPR-gRNAs. (FIG. 4A) AAV9-Cas9-gRNAs targeting the endogenous Mstn gene or the 3xStop cassette in neonatal mice. (FIG. 4B)
Mutation frequency correlates with AAV transduction efficiency (Pearson's R = 0.73,
Spearman's p = 0.74, P < 0.05) (n = 4 mice, 4E12 of AAV9-Cas9-gRNAsM3+M4). Horizontal dashed line = sequencing error rate; vertical dashed line = qPCR false positive rate. Error bars denote s.e.m. for sequencing and qPCR replicates. (FIG. 4C) AAV9-Cas9- gRNAsTdL+TdR-edited tdTomato+ cells were detected in multiple organs of Ai9 mice (2 upper rows) (n = 3 mice at 4E12), and absent in Ai9 mice injected with AAV9-Cas9-gRNAsM3+M4
(2 lower rows) (n = 4 mice at 4E12). Gray = tdTomato. Scale bar, 5 mm. (FIG. 4D) AAV9-
Cas9-VPR-gRNAs activated the target Pd-ll and Cd47 genes in adult mice (FDR = 0.05).
Volcano plot shows total mRNA-sequencing of the same muscle samples used for qRT-PCR in FIG. 4E (n = 3 mice per condition). (FIG. 4E) AAV9-Cas9-VPR-gRNAs activated the target Pd-ll and Cd47 genes in adult skeletal muscles, as assessed by qRT-PCR and calculated as 2~AACt (n = 3 mice per group). Fold-change in gene expression was quantified between AAV9-Cas9-VPR-gRNAs-treated samples that differed only in the gRNA spacer sequences (one-tailed t-test). Samples treated with AAV9-Cas9-VPR-gRNAs and AAV9- turboRFP showed transcriptional alterations against samples treated with AAV9-turboRFP
only, due to immunity-associated transcriptome perturbation. AAV-Cas9N-gRNAs:AAV- Cas9c-VPR ratio of 1 : 1 was used in all experiments. Error bars denote s.e.m.
FIGS. 5A-H depict that systemically delivered AAV9-Cas9-gR As genetically modify multiple organs, with editing frequency reflecting viral transduction efficiency. (FIG. 5A) Deep-sequencing of tissues indicates mean Mstn gene-targeting rates ranging from 7.8% to 0.25% (n = 4 mice, 4E12 of AAV9-Cas9-gRNAsM3+M4) (*, P < 0.05, Wilcoxon rank-sum, Bonferroni corrected). Error bars denote s.e.m. Black dashed line denotes sequencing error. (FIG. 5B) Putative off-target sites were assessed by deep-sequencing. The bona fide off- target locus (chrl6:+3906202) contains two mismatches (in red) against the on-target sequence, (n = 4 mice, 4E12 of AAV9-Cas9-gRNAsM3+M4; and n = 2 control mice, 4E12 of AAV9-Cas9-gR AsTdL+TdR for determination of baseline sequencing error rates). (FIG. 5C) Recombinase-activated tdTomato fluorescence by AAV9-GFP-Cre (n = 2, 2.5E11). Mean vg/dg shown. All examined cells within the liver, heart and muscle recombined, indicating -100% transduction efficiency within these organs. Within the testis, absence of tdTomato+ cells in the germline-residing seminiferous tubules argues against AAV9 transmission to the male germline. (FIG. 5D) Dual-AAV9s co-transduced multiple organs (n = 2, 2E12 each of AAV9-GFP and AAV9-mCherry). (FIG. 5E) Triple-AAV9s co-transduction generated double edits on the same chromatin (n = 4 mice co-injected with 2E12 of AAV9-Cas9c-P2A- turboGFP, 1E12 of AAV9-Cas9N-gRNAM3, and 1E12 of AAV9-Cas9N-gRNAM4). M3 or M4, single-site edits; M3+M4, double-site edits; Precise excision, subset of M3+M4 with deletions delimited by the Cas9-gRNAs cut-sites. (FIG. 5F) AAV9-Cas9-gRNAs preferentially transduced the liver, heart and skeletal muscle (gastrocnemius and diaphragm) (***, P < 0.001; Wilcoxon rank-sum, Bonferroni corrected) (n = 7, 4E12). Red, means ± s.e.m.; black dashed line with gray box, qPCR false positive rate (2.5 vg/dg) with s.d. (FIG.
5G) Transduction efficiency with 5E11 of AAV9-Cas9-gR As (**, P < 0.01; ***, P < 0.001; Wilcoxon rank-sum, Bonferroni corrected) (n = 9). (FIG. 5H) Correlation of gene-targeting rates with vg/dg is maintained at lower dosage (n = 2, 5E11 of AAV9-Cas9-gR AsM3+M4). Data from mice injected with 4E12 vg of AAV9-Cas9-gRNAsM3+M4, as shown in FIG. 4B, is reproduced here for comparison.
FIG. 6 depicts whole-mount epifluorescence images from neonatal Ai9 mice injected systemically with AAV9-Cas9-gR As (5E11 vg) targeting the 3xStop cassette and controls. Numerous tdTomato+ cells were observed in mice injected with AAV9-Cas9-gRNAs targeting the genomic 3xStop cassette, but not in negative control vehicle-injected mice, indicating that fluorescence activation resulted from 3xStop excision. TdTomato+ cells were also observed, at lower frequencies, in mice injected with AAV9s encoding two gRNAs both targeting one side of the 3xStop cassette (AAV9-Cas9-gRNAsTd5+TdL or AAV9-Cas9- gRNAsTd3+TdR), suggesting the introduction of large deletions that removed the 3xStop terminators. Gray = tdTomato.
FIGS. 7A-C depict that tissue sections from Ai9 mice injected with AAV9-Cas9- gRNAs. AAV9-Cas9-gRNAsTdL+TdR (4E12 vg) transduced multiple organs, excising the 3xStop genomic locus, as indicated by tdTomato activation in (FIG. 7A) liver, (FIG. 7B) heart, and (FIG. 7C) skeletal muscle. TdTomato+ cells were not detected in control mice injected with AAV9-Cas9-gRNAsM3+M4. Scale bars, 500 μιη.
FIGS. 8A-I depict that AAV9 and Cas9 activate immune responses. (FIG. 8A) Intramuscular Cas9-expression via AAV9-split-Cas9 injection or plasmid-Cas9FL electroporation. (FIG. 8B) Intramuscular Cas9 expression induces lymphocyte infiltration in the draining inguinal and popliteal lymph nodes (n = 4 mice per condition) (*, P < 0.05; n-
way ANOVA). Checkmarks denote injected vectors and conditions. (FIG. 8C) TCR-β CDR3 repertoires converged after Cas9-exposure, indicating Cas9-induced expansion of T-cell subsets (n = 4; 6 pair-wise comparisons) (Welch's t-test, Bonferroni corrected). (FIG. 8D) νβ16 CDR3 C AS SLDRGQDTQYF is a public Cas9-responsive T-cell clonotype (Welch's t- test). Numbers in parentheses denote clonotypic rank within each TCR-β CDR3 repertoire after Cas9 re -stimulation. (FIG. 8E) Epitope mapping by Ml 3 phage display (all Ig subclasses). (FIG. 8F) Cas9 epitopes from Cas9-exposed animals (top, n = 4 electroporated; bottom, n = 4 AAV9-delivered). Immunodominant epitopes reside in REC l and PI domains (vertical dotted lines), and represented on Cas9 structure (PDB ID: 4CMP). Red, immunodominant epitopes; Black, private epitopes; Cyan, REC l ; Pink, PI. P-values from Wald test, Benjamini-Hochberg adjusted for FDR = 0.1. (FIG. 8G) Capsid epitopes from AAV9-exposed animals (n = 8). Counts denote number of animals with capsid-specific antibodies, and red bars denote immunodominant epitopes. AAV9 capsid expresses as three isoforms (VP 1/2/3). (FIG. 8H) Capsid residues within identified epitopes preferentially confer loss of viral blood persistency when mutated (Adachi, K., Enoki, T., Kawano, Y., Veraz, M. & Nakai, H. Drawing a high-resolution functional map of adeno-associated virus capsid by massively parallel sequencing. Nat Commun 5, 3075, doi: 10.1038/ncomms4075 (2014)), suggesting their association with maintaining blood persistency. Each dot represents a double-alanine mutated AAV9 capsid variant, plotted according to its measured blood persistency and antigenicity of the residue. Red bar, mean. (FIG. 81) Capsid residues within identified epitopes preferentially de-targets the liver when mutated (Adachi, K., Enoki, T., Kawano, Y., Veraz, M. & Nakai, H. Drawing a high-resolution functional map of adeno- associated virus capsid by massively parallel sequencing. Nat Commun 5, 3075, doi: 10.1038/ncomms4075 (2014)), suggesting their association with hepatotropism. Each dot
represents a double-alanine mutated AAV9 capsid variant, plotted according to its measured tropism and antigenicity of the residue. Blue bar, mean liver transduction efficiency; Magenta bar, mean global transduction efficiency, excluding the liver. Antigenicity, ranging from 0 to 8, denotes number of animals in which a particular residue is part of a linear epitope.
FIGS. 9A-D depict additional data for epitope-mapping and recoding of AAV9- CRISPR-Cas9. (FIG. 9A) Mapped epitopes for monoclonal (mAb) and polyclonal (pAb) Cas9-specific antibodies titrated at 200, 20, and 2 μg ml"1. P-values from Wald test, Benjamini-Hochberg adjusted for FDR = 0.1. (FIG. 9B) Known functional variants of Cas9 (Jinek, M. et al. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science 343, 1247997, doi: 10.1126/science.1247997 (2014); Kleinstiver, B. P. et al. Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature 523, 481-485, doi: 10.1038/naturel4592 (2015)) can be combined to recode identified epitopes. Recoded Cas9 retains endonucleolytic function. Ai9 fibroblasts were lipofected with wild-type or variant Cas9-encoding plasmids, programmed with the indicated gRNAs, and genomic excision-dependent tdTomato fluorescence was assayed 4 days post-transfection. Deletion of the epitope (Δ1126-1135) abolishes Cas9 activity. Scale bar, 500 urn. (FIG. 9C) AAV9- specific antibodies were elicited by two weeks post-injection, as determined by fluorescent immunoassay (FIAX). Two groups of mice injected with 4E12 vg AAV9-Cas9-VPR-gRNAs are shown, differing only in the gRNA spacers employed (* *, P < 0.01; one-way ANOVA, followed by Dunnett's test against vehicle-injected mice). (FIG. 9D) AAV9 capsid-specific epitopes reside predominantly on the capsid surface. Red bar, mean. Antigenicity, ranging from 0 to 8, denotes number of animals in which a particular residue is part of a linear epitope.
FIGS. 10A-D depict that AAV-CRISPR-Cas9 does not induce effector cytolysis seen with DNA electroporation. (FIG. 10A) AAV9-Cas9-VPR-gRNAs treatment does not elicit intramuscular IL-2 secretion or perforin release (n = 3 mice per condition). Mice were targeted with 7 gRNAs against Mstn, Fst, PD-Ll and CD47 (gRNAs set 1) or with 3 gRNAs against Mstn and Fst (gRNAs set 2), all at 4E12 vg total of 1 : 1 AAV9-Cas9N-gRNAs:AAV- Cas9c-VPR. All injections included 1E1 1 vg of AAV9-turboRFP to demarcate transduction. (FIG. 10B) IL-2 and perforin protein levels were elevated in muscles electroporated with Cas9-encoding DNA (n = 3 mice per condition). (FIG. IOC) AAV9-Cas9-VPR-gRNAs did not induce detectable myofiber damage, as assessed by quantifying the fraction of centrally nucleated myofibers (n = 3 mice per condition) (one-way ANOVA, followed by Dunnett's test against mice injected with 1E11 vg of AAV9-turboRFP). (FIG. 10D) Cellular damage that causes myofiber degeneration and repair typically results in centrally nucleated myofibers under histological examination. Part of a histological section is shown to depict the quantification method. Delivery of minicircle-Cas9FL or pCAG-GFP via DNA electroporation induced an increase in the fraction of centrally nucleated myofibers, compared to controls electroporated with vehicle only. FK506 reduced but did not fully mitigate the elevated fraction of centrally nucleated myofibers (n = 4 mice per condition) (*, P < 0.05; * *, P < 0.01 ; * * *, P < 0.001 ; one-way ANOVA, followed by Tukey-Kramer test).
DETAILED DESCRIPTION
Embodiments of the present disclosure are directed to a method of altering a target nucleic acid in a cell. In one embodiment, the method includes providing to the cell a first nucleic acid encoding a first portion of a Cas9 protein and a guide RNA (gRNA), providing to the cell a second nucleic acid encoding a second portion of the Cas9 protein and optionally a transcriptional regulator, wherein the cell expresses the first portion of the Cas9 protein, the
gRNA and the second portion of the Cas9 protein or the second portion of the Cas9 and the transcriptional regulator fusion protein, wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein, or the first portion of the Cas9 protein and the second portion of the Cas9 and the transcriptional regulator fusion protein are joined together to form the Cas9 protein or the Cas9 fusion protein, and wherein the gRNA and the Cas9 protein, or the gRNA and the Cas9 fusion protein form a co-localization complex with the target nucleic acid and alter the expression of the target nucleic acid. In some embodiments, the Cas9 protein is enzymatically active and the enzymatically active Cas9 protein cleaves the target nucleic acid in a site specific manner. In other embodiments, the gRNA can have full length or truncated spacer sequence. In certain embodiments, the gRNA having a truncated spacer sequence guides the Cas9 protein or the Cas9 fusion protein to the target nucleic acid and regulate the expression of the target nucleic acid without cleaving the target nucleic acid.
In some embodiments, the first nucleic acid and the second nucleic acid are delivered to the cell by separate vectors. In one embodiment, the first nucleic acid is delivered to the cell by a plasmid or adeno-associated virus. In another embodiment, the second nucleic acid is delivered to the cell by a plasmid or an adeno-associated virus.
In soote end;;odnnems. the first nueieic acid enc de a t ' i pernors of the€as9 protesn ha ing h thxi spht-antein asnl here is the second naokoo acsd encod s a seooed postioss of the
€a 9 proieia having a second spsioi;ne;n οοη:φ;οη·ο;η&·γ to the firs sphi-antein and wnere;n the fi rst rt-on of the Ca.s9 grosest; and die second goition of die Cas9 protein are joined togesher to form the Ca,s9 proton; In other esnbodsnrents, the first nucleic acid encodes a first port- on of the Cas9 proreia having a " -spht-atiein rnafrPN and wherein the secoad rsuciesc acid encodes a second portion of toe Caso prosesn baling a Csspht-anteni Rroalntf: and wherein the first portion of the C'as9 ps-osens and the second porooo of the Cas9 proton; are
ionsed together to form the Ca-oP proteirs h certain erobodrneorrts, the first portion
prove;:;; n; the Noernisna] lobe of the Cas9 protein and the second peri.- n of the Cas9 protons is the G-hsrndnai oe of the Cas9 protein , to certain erohodiraenrs, the fi rst ρο?ΐ·οη of die Cas9 rotem is the N-tenn -nai iobe of the 9 Ps9 piotei o to annoo acsd '¥ 13 and do s cond pernor of the Cash proidrs is ti;e C-termmal iobe of the C'as9 protein beginning at D ? i a ,
Embodiments of the present disclosure are directed to a method of altering a target nucleic acid in a cell of a subject. In one embodiment, the method includes delivering to the cell of the subject a first nucleic acid encoding a first portion of a Cas9 protein and a guide
RNA (gRNA) wherein the first nucleic acid is within a first vector, delivering to the cell of the subject a second nucleic acid encoding a second portion of the Cas9 protein and optionally a transcriptional regulator wherein the second nucleic acid is within a second vector, wherein the cell expresses the first portion of the Cas9 protein, the gRNA and the second portion of the Cas9 protein or the second portion of the Cas9 and the transcriptional regulator fusion protein, wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein, or the first portion of the Cas9 protein and the second portion of the Cas9 and the transcriptional regulator fusion protein are joined together to form the Cas9 protein or the Cas9 fusion protein, and wherein the gRNA and the Cas9 protein, or the gRNA and the
Cas9 fusion protein form a co-localization complex with the target nucleic acid and alter the expression of the target nucleic acid. In certain embodiment, the Cas9 protein is enzymatically active and the enzymatically active Cas9 protein cleaves the target nucleic acid in a site specific manner. In some embodiments, the gRNA can have full length or truncated spacer sequence. In certain embodiments, the gRNA having a truncated spacer sequence guides the Cas9 protein or the Cas9 fusion protein to the target nucleic acid and regulate the expression of the target nucleic acid without cleaving the target nucleic acid.
In one embodim nt, the firs- vector is a phtsaud or adeiiomssoeiated vires, in another caiboduoenL the s c nd vector is a iasimd or adenomssociated virus.
In some embod iments, the b ob nucleic aosd encodes a first portion of the Casb protect having a fi rst spi iocntem aed where -n the second nucleic acid encodes a second portion of the Casb protein having a second splm-line ra corn pic nicntarv to the fhrst sphpentein and coherent Pie first portion of t e Casb protein and Use second it n of the Cash protect are j ned together to toon the Casb protect In other embodiments, the first nucleic acid encodes a fi rst portion of tbe Cash proton; having a N-ophtontel n Rrna nt and wherein the second nucleic acid encodes a second portion of the Casb protect having a ihemhocnteln RrnalntC and wherei n the first portion of the Cash protein and the second portion of the Casb protect arc joined together to toon hie Casb protein. In one en odl inene the first portion oi' the Casb protetn is the rC-terrmnal lobe of the Cash protei n and he second portion of Pie C asb protein ;s the C-teiTra cai lobe of the Casb protein . In another embodiment, the first portion of the Casb protein is the "Noter mal lobe of the Casb protein up to amino acid V 7 B and the second port-on of the Casb nrotent is the C "terminal lone of die Casb protein beginning at D714.
In some embodiments, the vectors are delivered to the cell of the subject via various routes known to a skilled in the art including systemic, local, intravenous, intraperitoneal, intramuscular routes or via injection or electroporation. The subject of the disclosure includes human, patients or an animal. No overt cellular or tissue damage is observed when the vectors are adeno-associated viruses.
Einbod irneiits of the present disclosure are directed to a method of modulating a target gene expression ;n a cell, in one entoodhnent tee ntethod includes providing to the cell a first, recombinant adeno-assoelated vi rus comprising a fi rst nucleic acid encoding ac Nbcrnti nai
p ri n of t e Cas9 protein fCas9 ) and a gRNA.. providing to the ceil a second svcombsiuuA sulciio-assooiated virus coinprisiag a second nucleic acid encoding a fusion protest: com rising a iAtemnnai portion or d;e €as9 p tem (Cas9°) fused with a transcriptional regulator (TRg wherein the cell expresses the Cas9 ptoteu; and the Ca b Alg f sion protem and som tben's to form a foil length Cas9-''L-Ax fusion protests, and wherein the cel ex resses the gRNA. and the gRNA directs the Cas9:':--TR fission protein to the target, gene and modulates target gene expression. fi; some ensbodiffients. die transcriptional regulator Is a transcrsptsonai acts skater or a "transcriptional repressor. Its one eaaSodsmerub the tsaaseriptionai activator is VpR. hs certain estiisodstoetits, tits ttaascriptioaal mgulator is a recruiter protein bsat recrasts epsgenedo modulators to the target gerse. R; exemplars- eruhodmseuts. the gRNA has traucated spacer sequence attd directs Cas9;L AfR fusion protein bsnd g to target DNA without cleavnrg the target. DNA .
Embodiments of the present disclosure are directed to a .method of imaging a target, itaeieic acid ;r; a ceil, R; one eruhodmseei, the snethod ;r;cb.;des providing to the cell a first reeombtmsstn adeno-assoclated virus comprising a first rstscloic acid ettcodmg att Nuermuud portion of hse€'as9 protein iCas9 ) and a gRNA.. providing to the cell a second recombinant adeno-assoeiated viras cornprissag a second nucleic acid encoding a fusion protest: comprising a iAtetrsunal portiot; of the Casv protein fCasbN fused with a fluorescent pmteiix wherein the ceil expresses the Cas9 protons and the Cas9;; fluorescent fosson protein and join them to form a full length Casd^- fluorescent fusion protein, and wherein the cell expresses die gRNA. and the gRNA directs the Ca h"'-- fluorescent fission protein to Use iarget nuciesc acid and produces fluorescent imaging of the target nucleic acid.
In an exemplary embodiment, the Cas9 is a Type II CRISPR system Cas9. In some embodiments, the Cas9 protein is an enzymatically active Cas9 protein, a Cas9 protein nickase or a nuclease null Cas9 protein.
by spirt is cus .
The cell according to some embodiments of the present disclosure is a eukaryotic cell or a prokaryotic cell. In certain embodiments, the cell is a bacteria cell, a yeast cell, a mammalian cell, a human cell, a plant cell or an animal cell. In some embodiments, the cell is in vitro, in vivo or ex vivo.
The split Cas9 methods described herein are useful in CRISPR-related methods where Cas9 and a guide RNA are used to colocalize the Cas9 and the guide RNA to a target nucleic acid sequence. Accordingly, embodiments of the present disclosure are based on the use of RNA guided DNA binding proteins, such as Cas9, to co-localize with guide RNA at a target DNA site. Such DNA binding proteins are readily known to those of skill in the art to bind to DNA for various purposes. Such DNA binding proteins may be naturally occurring. DNA binding proteins included within the scope of the present disclosure include those which may be guided by RNA, referred to herein as guide RNA. According to one aspect, the guide RNA is between about 10 to about 500 nucleotides. According to one aspect, the RNA is between about 20 to about 100 nucleotides. According to this aspect, the guide RNA and the RNA guided DNA binding protein form a co-localization complex at the DNA.
DNA binding proteins having nuclease activity are known to those of skill in the art, and include naturally occurring DNA binding proteins having nuclease activity, such as Cas9 proteins present, for example, in Type II CRISPR systems. Such Cas9 proteins and Type II
CRISPR systems are well documented in the art. See Makarova et al., Nature Reviews, Microbiology, Vol. 9, June 2011, pp. 467-477 including all supplementary information hereby incorporated by reference in its entirety. Exemplary Cas include S. pyogenes Cas9 (SpCas9), S. aureus Cas9 (SaCas9) and S. thermophilus Cas9 (StCas9). Additional exemplary CRISPR systems include Cpfl proteins for RNA-guided genome-editing. See Zetsche, B. et al. Cpfl is a single RNA-guided endonuclease of a class 2 CRISPR-Cas system. Cell, 2015, 163, 759-771. Additional exemplary nucleic-acid guided systems include argonaute proteins for DNA-guided genome-editing. See Gao F, Shen XZ, Jiang F, Wu Y, Han C, DNA-guided genome editing using the Natronobacterium gregoryi Argonaute, Nat Biotechnol, 2016 May 2. doi: 10.1038/nbt.3547 hereby incorporated by reference in its entirety.
Bacterial and archaeal CRISPR-Cas systems rely on short guide RNAs in complex with Cas proteins to direct degradation of complementary sequences present within invading foreign nucleic acid. See Deltcheva, E. et al. CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III. Nature 471, 602-607 (2011); Gasiunas, G., Barrangou,
R., Horvath, P. & Siksnys, V. Cas9-crRNA ribonucleoprotein complex mediates specific
DNA cleavage for adaptive immunity in bacteria. Proceedings of the National Academy of
Sciences of the United States of America 109, E2579-2586 (2012); Jinek, M. et al. A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science
337, 816-821 (2012); Sapranauskas, R. et al. The Streptococcus thermophilus CRISPR/Cas system provides immunity in Escherichia coli. Nucleic acids research 39, 9275-9282 (2011); and Bhaya, D., Davison, M. & Barrangou, R. CRISPR-Cas systems in bacteria and archaea: versatile small RNAs for adaptive defense and regulation. Annual review of genetics 45, 273-
297 (2011). A recent in vitro reconstitution of the S. pyogenes type II CRISPR system demonstrated that crRNA ("CRISPR RNA") fused to a normally trans-encoded tracrRNA
("trans-activating CRISPR RNA") is sufficient to direct Cas9 protein to sequence-specifically cleave target DNA sequences matching the crR A. Expressing a gRNA complementary to a target site results in Cas9 recruitment and degradation of the target DNA. See H. Deveau et al., Phage response to CPJSPR-encoded resistance in Streptococcus thermophilus. Journal of Bacteriology 190, 1390 (Feb, 2008).
Two classes of CRISPR systems are generally known and are referred to as class 1 and class 2. Class 1 systems can be further classified into types I, III, and IV, while class 2 systems can be further classified into type II and V. According to one aspect, a particular useful enzyme according to the present disclosure to cleave dsDNA is the single effector enzyme, Cas9, common to Type II. See K. S. Makarova et al, Evolution and classification of the CRISPR-Cas systems. Nature reviews. Microbiology 9, 467 (Jun, 201 1) hereby incorporated by reference in its entirety. Within bacteria, the Type II effector system consists of a long pre-crRNA transcribed from the spacer-containing CRISPR locus, the multifunctional Cas9 protein, and a tracrRNA important for gRNA processing. The tracrRNAs hybridize to the repeat regions separating the spacers of the pre-crRNA, initiating dsRNA cleavage by endogenous RNase III, which is followed by a second cleavage event within each spacer by Cas9, producing mature crRNAs that remain associated with the tracrRNA and Cas9. TracrRNA-crRNA fusions are contemplated for use in the present methods.
According to one aspect, the enzyme of the present disclosure, such as Cas9 unwinds the DNA duplex and searches for sequences matching the crRNA to cleave. Target recognition occurs upon detection of complementarity between a "protospacer" sequence in the target DNA and the remaining spacer sequence in the crRNA. Importantly, Cas9 cuts the
DNA only if a correct protospacer-adjacent motif (PAM) is also present at the 3 ' end.
According to certain aspects, different protospacer-adjacent motif can be utilized. For example, the S. pyogenes system requires an NGG sequence, where N can be any nucleotide. S. thermophilus Type II systems require NGGNG (see P. Horvath, R. Barrangou, CRISPR/Cas, the immune system of bacteria and archaea. Science 327, 167 (Jan 8, 2010) hereby incorporated by reference in its entirety and NNAGAAW (see H. Deveau et al. , Phage response to CRISPR-encoded resistance in Streptococcus thermophilus. Journal of bacteriology 190, 1390 (Feb, 2008) hereby incorporatd by reference in its entirety), respectively, while different S. mutans systems tolerate NGG or NAAR (see J. R. van der Ploeg, Analysis of CRISPR in Streptococcus mutans suggests frequent occurrence of acquired immunity against infection by M102-like bacteriophages. Microbiology 155, 1966 (Jun, 2009) hereby incorporated by reference in its entirety. Bioinformatic analyses have generated extensive databases of CRISPR loci in a variety of bacteria that may serve to identify additional useful PAMs and expand the set of CRISPR-targetable sequences (see M. Rho, Y. W. Wu, H. Tang, T. G. Doak, Y. Ye, Diverse CRISPRs evolving in human microbiomes. PLoS genetics 8, el002441 (2012) and D. T. Pride et al., Analysis of streptococcal CRISPRs from human saliva reveals substantial sequence diversity within and between subjects over time. Genome research 21, 126 (Jan, 2011); Kleinstiver BP, Prew MS, Tsai SQ, Topkar VV, Nguyen NT, Zheng Z, Gonzales AP, Li Z, Peterson RT, Yeh JR, Aryee MJ, Joung JK, Engineered CRISPR-Cas9 nucleases with altered PAM specificities, Nature. 2015 Jul 23;523(7561):481-5; Kleinstiver BP, Prew MS, Tsai SQ, Nguyen NT, Topkar VV, Zheng Z, Joung JK, Broadening the targeting range of Staphylococcus aureus CRISPR-Cas9 by modifying PAM recognition, Nat Biotechnol. 2015 Dec;33(12): 1293-1298, each of which are hereby incorporated by reference in their entireties. According to one aspect, a particular useful enzyme according to the present disclosure to cleave dsDNA is the single effector
enzyme, Cpfl, belonging to Type V. See Zetsche, B. et al. Cpfl is a single RNA-guided endonuclease of a class 2 CRISPR-Cas system. Cell, 20 5, 163, 759-771.
Exemplary DNA binding proteins having nuclease activity function to nick or cut double stranded DNA. Such nuclease activity may result from the DNA binding protein having one or more polypeptide sequences exhibiting nuclease activity. Such exemplary DNA binding proteins may have two separate nuclease domains with each domain responsible for cutting or nicking a particular strand of the double stranded DNA. Exemplary polypeptide sequences having nuclease activity known to those of skill in the art include the McrA-HNH nuclease related domain and the RuvC-like nuclease domain. Accordingly, exemplary DNA binding proteins are those that in nature contain one or more of the McrA- HNH nuclease related domain and the RuvC-like nuclease domain.
In S. pyogenes, Cas9 generates a blunt-ended double-stranded break 2-4bp upstream of the protospacer-adjacent motif (PAM) via a process mediated by two catalytic domains in the protein: an HNH domain that cleaves the complementary strand of the DNA and a RuvC- like domain that cleaves the non-complementary strand. See Jinek et al., Science 337, 816- 821 (2012) hereby incorporated by reference in its entirety. Cas9 proteins are known to exist in many Type II CRISPR systems including the following as identified in the supplementary information to Makarova et al, Nature Reviews, Microbiology, Vol. 9, June 2011, pp. 467- 477: Methanococcus maripaludis C7; Corynebacterium diphtheriae; Corynebacterium efficiens YS-314; Corynebacterium glutamicum ATCC 13032 Kitasato; Corynebacterium glutamicum ATCC 13032 Bielefeld; Corynebacterium glutamicum R; Corynebacterium kroppenstedtii DSM 44385; Mycobacterium abscessus ATCC 19977; Nocardia farcinica IFM10152; Rhodococcus erythropolis PR4; Rhodococcus jostii RHAl; Rhodococcus opacus
B4 uid36573; Acidothermus cellulolyticus 11B; Arthrobacter chlorophenolicus A6; Kribbella
flavida DSM 17836 uid43465; Thermomonospora curvata DSM 43183; Bifidobacterium dentium Bdl; Bifidobacterium longum DJO10A; Slackia heliotrinireducens DSM 20476; Persephonella marina EX HI; Bacteroides fragilis NCTC 9434; Capnocytophaga ochracea DSM 7271; Flavobacterium psychrophilum JIP02 86; Akkermansia muciniphila ATCC BAA 835; Roseiflexus castenholzii DSM 13941; Roseiflexus RSI; Synechocystis PCC6803; Elusimicrobium minutum Peil91; uncultured Termite group 1 bacterium phylotype Rs D17; Fibrobacter succinogenes S85; Bacillus cereus ATCC 10987; Listeria innocua;Lactobacillus casei; Lactobacillus rhamnosus GG; Lactobacillus salivarius UCC118; Streptococcus agalactiae A909; Streptococcus agalactiae NEM316; Streptococcus agalactiae 2603; Streptococcus dysgalactiae equisimilis GGS 124; Streptococcus equi zooepidemicus MGCS10565; Streptococcus gallolyticus UCN34 uid46061; Streptococcus gordonii Challis subst CHI; Streptococcus mutans NN2025 uid46353; Streptococcus mutans; Streptococcus pyogenes Ml GAS; Streptococcus pyogenes MGAS5005; Streptococcus pyogenes MGAS2096; Streptococcus pyogenes MGAS9429; Streptococcus pyogenes MGAS 10270; Streptococcus pyogenes MGAS6180; Streptococcus pyogenes MGAS315; Streptococcus pyogenes SSI-1; Streptococcus pyogenes MGAS 10750; Streptococcus pyogenes NZ131; Streptococcus thermophiles CNRZ1066; Streptococcus thermophiles LMD-9; Streptococcus thermophiles LMG 18311; Clostridium botulinum A3 Loch Maree; Clostridium botulinum B Eklund 17B; Clostridium botulinum Ba4 657; Clostridium botulinum F Langeland; Clostridium cellulolyticum H10; Finegoldia magna ATCC 29328; Eubacterium rectale ATCC 33656; Mycoplasma gallisepticum; Mycoplasma mobile 163K; Mycoplasma penetrans; Mycoplasma synoviae 53; Streptobacillus moniliformis DSM 12112; Bradyrhizobium BTAil; Nitrobacter hamburgensis X14; Rhodopseudomonas palustris BisB18; Rhodopseudomonas palustris BisB5; Parvibaculum lavamentivorans DS-1;
Dinoroseobacter shibae DFL 12; Gluconacetobacter diazotrophicus Pal 5 FAPERJ; Gluconacetobacter diazotrophicus Pal 5 JGI; Azospirillum B510 uid46085; Rhodo spirillum rubrum ATCC 11 170; Diaphorobacter TPSY uid29975; Verminephrobacter eiseniae EF01-2; Neisseria meningitides 053442; Neisseria meningitides alphal4; Neisseria meningitides Z2491 ; Desulfovibrio salexigens DSM 2638; Campylobacter jejuni doylei 269 97; Campylobacter jejuni 81 1 16; Campylobacter jejuni; Campylobacter lari RM2100; Helicobacter hepaticus; Wolinella succinogenes; Tolumonas auensis DSM 9187; Pseudoalteromonas atlantica T6c; Shewanella pealeana ATCC 700345; Legionella pneumophila Paris; Actinobacillus succinogenes 130Z; Pasteurella multocida; Francisella tularensis novicida U1 12; Francisella tularensis holarctica; Francisella tularensis FSC 198; Francisella tularensis tularensis; Francisella tularensis WY96-3418; and Treponema denticola ATCC 35405. The Cas9 protein may be referred by one of skill in the art in the literature as Csnl . An exemplary S. pyogenes Cas9 protein sequence is shown below. See Deltcheva et al., Nature 471, 602-607 (2011) hereby incorporated by reference in its entirety.
MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE
ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFG
NIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSD
VDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGN
LIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAI
LLSDILRWTEIT APLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYA
GYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELH
AILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPW FEE
VVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVY ELTKVKYWEGMRKPAFL
SGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKI
IKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWG
RLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSL
HEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRER
MKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDH
I QSFLKDDSIDNKVLTRSDKNRGKSDN SEEVVKKMKNYWRQLLNAKLITQRKFDNL
TK AERGGL SELDKAGFIKRQL VETRQITKH VAQILD SRMNTKYDENDKLIREVKVITLKS
KLVSDFRKDFQFYKVREIN YHHAHDAYLNAWGTALIKKYPKLESEFVYGDYKVYDVRK
MIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDF
ATVRKVLSMPQWIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVA
YSVLWAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPK
YSLFELENGPJ RMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVE
QHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGA
PAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD
According to one aspect, the specificity of gRNA-directed Cas9 cleavage is used as a mechanism for genome engineering. According to one aspect, hybridization of the gRNA need not be 100 percent in order for the enzyme to recognize the gRNA/DNA hybrid and affect cleavage. Some off-target activity could occur. For example, the S. pyogenes system tolerates mismatches in the first 6 bases out of the 20bp mature spacer sequence in vitro. According to one aspect, greater stringency may be beneficial in vivo when potential off- target sites matching (last 14 bp) NGG do not exist within the human reference genome for the gRNAs.
According to certain aspects, specificity may be improved. When interference is sensitive to the melting temperature of the gRNA-DNA hybrid, AT-rich target sequences may have fewer off-target sites. Carefully choosing target sites to avoid pseudo-sites with at least 14bp matching sequences elsewhere in the genome may improve specificity. According to certain aspect, the gRNAs can be designed to include 16-18 nucleotide spacers, which
increases specificity while retaining Cas9 endonucleolytic activity (Fu Y, Sander JD, Reyon D, Cascio VM, Joung JK, Improving CRISPR-Cas nuclease specificity using truncated guide RNAs, Nat Biotechnol , 2014 Mar;32(3):279-84, hereby incorporated by reference in its entirety). The use of a Cas9 variant requiring a longer PAM sequence may reduce the frequency of off-target sites. Directed evolution may improve Cas9 specificity to a level sufficient to completely preclude off-target activity, ideally requiring a perfect 20bp gRNA match with a minimal PAM. Accordingly, modification to the Cas9 protein is a representative embodiment of the present disclosure. CRISPR systems useful in the present disclosure are described in R. Barrangou, P. Horvath, CRISPR: new horizons in phage resistance and strain identification. Annual review of food science and technology 3, 143 (2012) and B. Wiedenheft, S. H. Sternberg, J. A. Doudna, RNA-guided genetic silencing systems in bacteria and archaea. Nature 482, 331 (Feb 16, 2012) each of which are hereby incorporated by reference in their entireties.
Guide RNAs useful in the disclosed methods include those having a spacer sequence, a tracr mate sequence and a tracr sequence, with the spacer sequence being between about 16 to about 20 nucleotides in length and with the tracr sequence being between about 60 to about 500 nucleotides in length and with a portion of the tracr sequence being hybridized to the tracr mate sequence and with the tracr mate sequence and the tracr sequence being linked by a linker nucleic acid sequence of between about 4 to about 6 nucleotides. crRNA-tracrRNA fusions are contemplated as exemplary guide RNA.
According to certain aspects, the DNA binding protein is altered or otherwise modified to inactivate the nuclease activity. Such alteration or modification includes altering one or more amino acids to inactivate the nuclease activity or the nuclease domain. Such modification includes removing the polypeptide sequence or polypeptide sequences
exhibiting nuclease activity, i.e. the nuclease domain, such that the polypeptide sequence or polypeptide sequences exhibiting nuclease activity, i.e. nuclease domain, are absent from the DNA binding protein. Other modifications to inactivate nuclease activity will be readily apparent to one of skill in the art based on the present disclosure. Accordingly, a nuclease- null DNA binding protein includes polypeptide sequences modified to inactivate nuclease activity or removal of a polypeptide sequence or sequences to inactivate nuclease activity. The nuclease-null DNA binding protein retains the ability to bind to DNA even though the nuclease activity has been inactivated. Accordingly, the DNA binding protein includes the polypeptide sequence or sequences required for DNA binding but may lack the one or more or all of the nuclease sequences exhibiting nuclease activity. Accordingly, the DNA binding protein includes the polypeptide sequence or sequences required for DNA binding but may have one or more or all of the nuclease sequences exhibiting nuclease activity inactivated.
According to one aspect, a DNA binding protein having two or more nuclease domains may be modified or altered to inactivate all but one of the nuclease domains. Such a modified or altered DNA binding protein is referred to as a DNA binding protein nickase, to the extent that the DNA binding protein cuts or nicks only one strand of double stranded DNA. When guided by RNA to DNA, the DNA binding protein nickase is referred to as an RNA guided DNA binding protein nickase.
An exemplary DNA binding protein is an RNA guided DNA binding protein nuclease of a Type II CRISPR System, such as a Cas9 protein or modified Cas9 or homolog of Cas9 or ortholog of Cas9. An exemplary DNA binding protein is an RNA guided DNA binding protein nuclease of a Type V CRISPR System, such as a Cpfl protein or modified Cpfl or homolog of Cpfl or ortholog of Cpfl . An exemplary DNA binding protein is a Cas9 protein nickase. An exemplary DNA binding protein is an RNA guided DNA binding protein of a
Type II CRISPR System which lacks nuclease activity. An exemplary DNA binding protein is a nuclease-null Cas9 protein. An exemplary DNA binding protein is an RNA guided DNA binding protein of a Type V CRISPR System which lacks nuclease activity. An exemplary DNA binding protein is a nuclease-null Cpfl protein.
According to one aspect, the Cas9 protein, Cas9 protein nickase or nuclease null Cas9 includes homologs and orthologs thereof which retain the ability of the protein to bind to the DNA and be guided by the RNA. According to one aspect, the Cas9 protein includes the sequence as set forth for naturally occurring Cas9 from S. pyogenes and protein sequences having at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98% or 99% homology thereto and being a DNA binding protein, such as an RNA guided DNA binding protein.
Ts S.Q., et al., Dimeric CRISPR RNA-guided Fokl nucleases for highly specific genome editing. Nat Biotechnol, 2014. 32(6): p. 569-76, and Guilinger, J.P., D.B. Thompson, and
D.R. Liu, Fusion of catalytically inactive Cas9 to Fokl nuclease improves the specificity of genome modification. Nat Biotechnol, 2014. 32(6): p. 577-82.), transcriptional regulators (see
Gilbert, L.A., et al, CRISPR-mediated modular RNA-guided regulation of transcription in eukaryotes. Cell, 2013. 154(2): p. 442-51, Mali, P., et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nat
Biotechnol, 2013. 31(9): p. 833-8, Perez-Pinera, P., et al., RNA-guided gene activation by
CRISPR-Cas9-based transcription factors. Nat Methods, 2013. 10(10): p. 973-6, and Cheng,
A.W., et al, Multiplexed activation of endogenous genes by CRISPR-on, an RNA-guided transcriptional activator system. Cell Res, 2013. 23(10): p. 1163-71), fluorescent proteins (see
Gilbert, L.A., et al, CRISPR-mediated modular RNA-guided regulation of transcription in
eukaryotes. Cell, 2013. 154(2): p. 442-51 and Chen, B., et al., Dynamic imaging of genomic loci in living human cells by an optimized CRISPR/Cas system. Cell, 2013. 155(7): p. 1479- 91), protein-protein interacting-domains (see Tanenbaum, M.E., et al, A protein-tagging system for signal amplification in gene expression and fluorescence imaging. Cell, 2014. 159(3): p. 635-46), nucleotide base editors (see Komor, A. C, Kim, Y. B., Packer, M. S., Zuris, J. A. & Liu, D. R. Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature, doi: 10.1038/nature 17946 (2016)), and degradation tags are attached to either the Cas9 protein or the gRNA or both for delivery to a target nucleic acid.
According to one aspect, the transcriptional regulator protein or domain upregulates expression of the target nucleic acid. According to one aspect, the transcriptional regulator protein or domain n; a fxHmicxi t oaal repressor. According to one aspect, the transcriptional regulator protein or domain downregulates expression of the target nucleic acid. Transcriptional activators and transcriptional repressors can be readily identified by one of skill in the art based on the present disclosure.
According to one aspect, two or more guide RNAs are provided with each guide RNA being complementary to an adjacent site in the DNA target nucleic acid. At least one RNA guided DNA binding protein nickase is provided and being guided by the two or more RNAs, wherein the at least one RNA guided DNA binding protein nickase co-localizes with the two or more RNAs to the DNA target nucleic acid and nicks the DNA target nucleic acid resulting in two or more adjacent nicks. According to certain aspects, the two or more adjacent nicks are on the same strand of the double stranded DNA. According to one aspect,
the two or more adjacent nicks are on the same strand of the double stranded DNA and result in homologous recombination. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA and create double stranded breaks. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA and create double stranded breaks resulting in nonhomologous end joining. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA and are offset with respect to one another. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA and are offset with respect to one another and create double stranded breaks. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA and are offset with respect to one another and create double stranded breaks resulting in nonhomologous end joining. According to one aspect, the two or more adjacent nicks are on different strands of the double stranded DNA and create double stranded breaks resulting in fragmentation of the target nucleic acid thereby preventing expression of the target nucleic acid.
According to certain aspects, binding specificity of the RNA guided DNA binding protein may be increased according to methods described herein. According to one aspect, off-set nicks are used in methods of genome-editing (see Mali, P. et al. CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature biotechnology, 31, 833-838, doi: 10.1038/nbt.2675 (2013) hereby incorporated by reference in its entirety). A large majority of nicks seldom result in NHEJ events, (see Certo et al, Nature Methods 8, 671-676 (201 1) hereby incorporated by reference in its entirety) thus minimizing the effects of off-target nicking. In contrast, inducing off-set
nicks to generate double stranded breaks (DSBs) is highly effective at inducing gene disruption. According to certain aspects, 5 ' overhangs generate more significant NHEJ events as opposed to 3' overhangs. Similarly, 3' overhangs favor HR over NHEJ events, although the total number of HR events is significantly lower than when a 5 ' overhang is generated. Accordingly, methods are provided for using nicks for homologous recombination and off-set nicks for generating double stranded breaks to minimize the effects of off-target Cas9-gRNA activity.
Target nucleic acids include any nucleic acid sequence to which a co-localization complex as described herein can be useful to either cut, nick, regulate or bind. Target nucleic acids include genes. For purposes of the present disclosure, DNA, such as double stranded
DNA, can include the target nucleic acid and a co-localization complex can bind to or otherwise co-localize with the DNA at or adjacent or near the target nucleic acid and in a manner in which the co-localization complex may have a desired effect on the target nucleic acid. Such target nucleic acids can include endogenous (or naturally occurring) nucleic acids and exogenous (or foreign) nucleic acids. One of skill based on the present disclosure will readily be able to identify or design guide RNAs and Cas9 proteins which co-localize to a
DNA including a target nucleic acid. One of skill will further be able to identify transcriptional regulator proteins or domains which likewise co-localize to a DNA including a target nucleic acid. DNA includes genomic DNA, mitochondrial DNA, viral DNA or exogenous DNA. CRISPR Cas9 system can also be programmed to target RNA (See,
O'Connell MR, Oakes BL, Sternberg SH, East-Seletsky A, Kaplan M, Doudna JA,
Programmable RNA recognition and cleavage by CRISPR/Cas9, Nature, 2014, Dec l l ;516(7530):263-6; Nelles DA, Fang MY, O'Connell M, Xu JL, Markmiller SJ, Doudna JA,
Yeo GW, Programmable RNA Tracking in Live Cells with CRISPR/Cas9, Cell, 2016, Apr
7; 165(2):488-96, each of which is hereby incorporated by reference in its entirety).
Foreign nucleic acids (i.e. those which are not part of a cell's natural nucleic acid composition) may be introduced into a cell using any method known to those skilled in the art for such introduction. Such methods include transfection, transduction, viral transduction, microinjection, electroporation, lipofection, nucleofection, nanoparticle bombardment, transformation, conjugation and the like. One of skill in the art will readily understand and adapt such methods using readily identifiable literature sources.
Tiaasciipboaaj regulator paAeies or domains w ic are irar-scripiuai-ai activators or aaiiscripdoiud repressors may be readily id ntifiable by those skilled in ibe art based on die present sclos re
Vectors used to deliver the nucleic acids to cells as described herein include vectors known to those of skill in the art and used for such purposes. C&nain exemplary vectors may be ps'asmnss or adenoaa:socaeed iruses k own to Parse or skill a; the art. AAVs are highly prevalent within the human population (see Gao, G., et al., Clades of Adeno-associated viruses are widely disseminated in human tissues. J Virol, 2004. 78(12): p. 6381-8, and Boutin, S., et al, Prevalence of semra gG and neatralioiag factors agaerst adeao-assocmied vims (AAV) types L 2:, 5. b, 8, and 9 in the healthy population, iirrpbeatnans tor gene aherapy ustng AAV vectors. Burn Gene T hese 201 G. 21 (6): p. 704- ; 2} and are use fa! as vneO vectors. Many serotypes exist, each with different tropism for tissue types (see Zincarelli, C, et al., Analysis of AAV serotypes 1-9 mediated gene expression and tropism in mice after systemic injection. Mol Ther, 2008. 16(6): p. 1073-80), which allows specific tissues to be preferentially targeted with appropriate pseudotyping. Some serotypes, such as serotypes 8, 9, and rhlO, transduce the mammalian body. See Zincarelli, C, et al., Analysis of AAV
serotypes 1-9 mediated gene expression and tropism in mice after systemic injection. Mol Ther, 2008. 16(6): p. 1073-80, Inagaki, K., et al., Robust systemic transduction with AAV9 vectors in mice: efficient global cardiac gene transfer superior to that of AAV8. Mol Ther, 2006. 14(1): p. 45-53, Keeler, A.M., et al., Long-term correction of very long-chain acyl-coA dehydrogenase deficiency in mice using AAV9 gene therapy. Mol Ther, 2012. 20(6): p. 1131-8, Gray, S.J., et al., Preclinical differences of intravascular AAV9 delivery to neurons and glia: a comparative study of adult mice and nonhuman primates. Mol Ther, 201 1. 19(6): p. 1058-69, Okada, H., et al, Robust Long-term Transduction of Common Marmoset Neuromuscular Tissue With rAAVl and rAAV9. Mol Ther Nucleic Acids, 2013. 2: p. e95, and Foust, K.D., et al, Intravascular AAV9 preferentially targets neonatal neurons and adult astrocytes. Nat Biotechnol, 2009. 27(1): p. 59-65. AAV9 has been demonstrated to cross the blood-brain barrier (see Foust, K.D., et al., Intravascular AAV9 preferentially targets neonatal neurons and adult astrocytes. Nat Biotechnol, 2009. 27(1): p. 59-65, and Rahim, A.A., et al, Intravenous administration of AAV2/9 to the fetal and neonatal mouse leads to differential targeting of CNS cell types and extensive transduction of the nervous system. FASEB J, 201 1. 25(10): p. 3505- 18) that is inaccessible to many viral vectors and biologies. Certain AAVs have a payload of 4.7-5.0kb (including viral inverted terminal repeats (ITRs), which are required in cis for viral packaging). See Wu, Z., H. Yang, and P. Colosi, Effect of genome size on AAV vector packaging. Mol Ther, 2010. 18(1): p. 80-6 and Dong, J.Y., P.D. Fan, and R.A. Frizzell, Quantitative analysis of the packaging capacity of recombinant adeno- associated virus. Hum Gene Ther, 1996. 7(17): p. 2101-12.
Delivery methods commonly used in research, such as lentiviruses, adenoviruses, or nucleic -acid-complexes, exhibit substantial immunogenic and cytotoxic properties, which can further compound the immunogenicity from ectopic transgene-expression. Furthermore, these
approaches generally lack the capacity for targeting of specific tissues and for robust full- body delivery. To si uksseoijid akaarrs e paOrok;g;eal arraaets ai?d enable j si&assc gerx;r«s edkiag, CRISPK ^as del ivered vi arkno-r socsated viruses (AAV a). AAVs are prevalent within human populations (see Gao, G., et al, Clades of Adeno-associated viruses are widely disseminated in human tissues. J Virol, 2004. 78(12): p. 6381-8), and there have been no established cases of pathology associated with AAV infection, making them one of the most promising vectors currently used in clinical trials. Moreover, tissue-targeting is easily accomplished by pseudotyping to AAV serotypes with suitable tropism. Of particular sH¾re^i k AAV serotype 9, which robustly transduces multiple cell types in the body (see Zincarelli, C, et al, Analysis of AAV serotypes 1-9 mediated gene expression and tropism in mice after systemic injection. Mol Ther, 2008. 16(6): p. 1073-80. and Foust, K.D., et al, Intravascular AAV9 preferentially targets neonatal neurons and adult astrocytes. Nat Biotechnol, 2009. 27( 1): p. 59-65.) and crosses endothelial barriers (e.g. blood-brain barrier, see Foust, K.D., et al., Intravascular AAV9 preferentially targets neonatal neurons and adult astrocytes. Nat Biotechnol, 2009. 27(1): p. 59-65 and Zhang, H. et al. Several rAAV vectors efficiently cross the blood-brain barrier and transduce neurons and astrocytes in the neonatal mouse central nervous system. Mol Ther, 201 1 19(8): p. 1440-1448) that block access by other delivery vectors. Together, AAV and CRISPR present an enticing combination for achieving systemic gene-editing, but a key obstacle has been the limited capacity of AAV for packaging exogenous sequences (< 4.7 kb). Dong, J.Y., P.D. Fan, and R.A. Frizzell, Quantitative analysis of the packaging capacity of recombinant adeno-associated virus. Hum Gene Ther, 1996. 7(17): p. 2101-12. Of the various Cas9 orthologs that have been co-opted for genome engineering (ST1, Nm, Sa) (see Ran, F. A. et al. In vivo genome editing using Staphylococcus aureus Cas9. Nature, 2015. 520: p. 186-91 and Esvelt, K.M., et al.,
Orthogonal Cas9 proteins for RNA-guided gene regulation and editing. Nat Methods, 2013. 10( 11): p. 11 16-21), Sp Cas9 has a least restrictive PAM and most consistent efficacy, but its size (4.2 kb) makes packaging into AAV challenging, necessitating use of a limited repertoire of compact regulatory elements (< 500 bp) (see Swiech, L., et al, In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9. Nat Biotechnol, 2014 and Senis, E. et al. CRISPR/Cas9-mediated genome engineering: an adeno-associated viral (AAV) vector toolbox. Biotechnology journal, 2014, 9: p. 1402-1412; Long C, Amoasii L, Mireault AA, McAnally JR, Li H, Sanchez-Ortiz E, Bhattacharyya S, Shelton JM, Bassel-Duby R, Olson EN, Postnatal genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy, Science, 2016 Jan 22;351(6271):400-3; Yang Y, Wang L, Bell P, McMenamin D, He Z, White J, Yu H, Xu C, Morizono H, Musunuru K, Batshaw ML, Wilson JM, A dual AAV system enables the Cas9-mediated correction of a metabolic liver disease in newborn mice, Nat Biotechnol., 2016, Mar;34(3):334-8; each of which are hereby incorporated by reference in its entirety), and precluding the fusion of function-conferring domains. The Cas9 protein was re-engineered to eliminate this obstacle.
According to certain aspects, two or more portions of a Cas9 protein are provided within a cell or are otherwise expressed within a cell and are combined together to form the
Cas9 protein. This structure-guided design is essential since splitting Cas9 at ordered protein regions significantly impacts function. See Nishimasu, H. et al. Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell 156, 935-949 (2014), Jinek, M. et al.
Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science
343, 1247997 (2014), Zetsche, B., Volz, S. E. & Zhang, F. A split-Cas9 architecture for inducible genome editing and transcription modulation. Nature biotechnology 33, 139- 142
(2015), Nihongaki, Y., Kawano, F., Nakajima, T. & Sato, M. Photoactivatable CRISPR-Cas9
for optogenetic genome editing. Nature biotechnology 33, 755-760 (2015), Nishimasu, H. et al. Crystal Structure of Staphylococcus aureus Cas9. Cell 162, 1113-1126 (2015), Truong, D. J. et al. Development of an intein-mediated split-Cas9 system for gene therapy. Nucleic Acids Res 43, 6450-6458, doi: 10.1093/nar/gkv601 (2015), and Fine, E. J. et al. Trans-spliced Cas9 allows cleavage of HBB and CCR5 genes in human cells using compact expression cassettes. Scientific reports 5, 10777 (2015).
According to one aspect, two portions of a Cas9 protein are provided within a cell or are otherwise expressed within a cell and are combined together to form the Cas9 protein. The two portions of the Cas9 protein are sufficient in length such that when they are combined into the Cas9 protein, the Cas9 protein has the function of co-localizing at a target nucleic acid with a guide RNA as described above. According to certain aspects, various methods known to those of skill in the art may be used to combine the two or more portions of a Cas9 protein together. Exemplary methods and linkers include split-intein protein trans- splicing for reconstituting the Cas9 protein as is known in the art and as described herein. Other methods include protein-protein interacting domains (see Zakeri, B., et al., Peptide tag forming a rapid covalent bond to a protein, through engineering a bacterial adhesion. Proc Natl Acad Sci U S A, 2012. 109(12): p. E690-7 and Fierer, J.O., G. Veggiani, and M. Howarth, SpyLigase peptide-peptide ligation polymerizes affibodies to enhance magnetic cancer cell capture. Proc Natl Acad Sci U S A, 2014. 111(13): p. El 176-81) or small molecule dependent interactions. See Los, G.V., et al, HaloTag: a novel protein labeling technology for cell imaging and protein analysis. ACS Chem Biol, 2008. 3(6): p. 373-82 and Keppler, A., et al., A general method for the covalent labeling of fusion proteins with small molecules in vivo. Nat Biotechnol, 2003. 21(1): p. 86-9; Mootz, H. D., Blum, E. S.,
Tyszkiewicz, A. B. & Muir, T. W. Conditional protein splicing: a new tool to control protein
structure and function in vitro and in vivo. J Am Chem Soc 125, 10561-10569, doi: 10.1021/ja0362813 (2003).
Embodiments of the present disclosure are directed to the use of a CRISPR/Cas system and, in particular, an enzymatically active Cas9 protein optionally having a functional group attached thereto, and one or more guide RNAs which includes a spacer sequence, a tracr mate sequence and a tracr sequence. According to certain aspects, a guide RNA which facilities enzymatic activity of the Cas9 protein has an exemplary spacer sequence including between 25 and 15 nucleotides in length. According to certain aspects, a guide RNA which inhibits enzymatic activity of the Cas9 protein has an exemplary spacer sequence including between 14 and 8 nucleotides in length. According to certain methods, two or more or a plurality of guide RNAs may be used in the practice of certain embodiments based on whether one of skill desires the species of enzymatically active Cas9 protein optionally having a functional group attached thereto to cut or nick a desired nucleic acid or to deliver the functional group to a desired nucleic acid so that the functional group can perform the function.
The term spacer sequence is understood by those of skill in the art and may include any polynucleotide having sufficient complementarity with a target nucleic acid sequence to hybridize with the target nucleic acid sequence and direct sequence-specific binding of a
CRISPR complex to the target sequence. A CRISPR complex may include the guide RNA and the Cas9 protein. The guide RNA may be formed from a spacer sequence covalently connected to a tracr mate sequence (which may be referred to as a crRNA) and a separate tracr sequence, wherein the tracr mate sequence is hybridized to a portion of the tracr sequence. According to certain aspects, the tracr mate sequence and the tracr sequence are connected or linked such as by covalent bonds by a linker sequence, which construct may be
referred to as a fusion of the tracr mate sequence and the tracr sequence. The linker sequence referred to herein is a sequence of nucleotides, referred to herein as a nucleic acid sequence, which connect the tracr mate sequence and the tracr sequence. Accordingly, a guide RNA may be a two component species (i.e., separate crRNA and tracr RNA which hybridize together) or a unimolecular species (i.e., a crRNA-tracr RNA fusion, often termed an sgRNA).
Tracr mate sequences and tracr sequences are known to those of skill in the art, such as those described in US 2014/0356958. The tracr mate sequence and tracr sequence used in the present disclosure is N20 or more to N8- gttttagagctagaaatagcaagttaaaataaggctagtccgttatcaactt^ with N20-8 being the number of nucleotides complementary to a target locus of interest.
According to certain aspects, the guide RNA spacer sequence length determines whether the enzymatically active Cas9 optionally having a functional group attached thereto will function to cut or nick the target nucleic acid or to act as a nuclease null Cas9 and deliver the functional group if present to the target nucleic acid so that the functional group can perform the desired function. A guide RNA having a spacer sequence length where the enzymatically active Cas9 will cut or nick the target nucleic acid may be termed an
"enzymatic guide RNA" to the extent that such a guide RNA facilitates enzymatic activity of the Cas9. An enzymatic guide RNA has an exemplary spacer sequence length of 25 to 15 nucleotides. A guide RNA having a spacer sequence length where the enzymatically active
Cas9 will function as a nuclease null Cas9 and may be termed a "nonenzymatic guide RNA" to the extent that such a guide RNA will inhibit enzymatic activity of the Cas9. A nonenzymatic guide RNA has an exemplary spacer sequence length of 16 to 8 nucleotides. It is to be understood that the enzymatically active Cas9 may still be referred to as such even
though it is used with a nonenzymatic guide RNA and where the enzymatically active Cas9 does not cut or nick the target nucleic acid. The enzymatically active Cas9 can be programmed to cut or operate as a nuclease null Cas9 based on the selected spacer sequence length. It is to be understood that for particular target nucleic acids, an exemplary enzymatic guide RNA length or an exemplary nonenzymatic guide RNA length may include 1 or two nucleotides outside of the exemplary ranges described herein.
According to certain aspects, the tracr mate sequence is between about 17 and about 27 nucleotides in length. According to certain aspects, the tracr sequence is between about 65 and about 75 nucleotides in length. According to certain aspects, the linker nucleic acid sequence is between about 4 and about 6.
The functional group or firaeiion conferring proiera or d main ay be joined, fused, corrected, hrked or therwise tethered , sach s by covale . beads , to the ercyn-aticaby active Casb protein using methods known to those of sbb ; as the an.
Frncdonai groups or function conferring proteins or dormers uath iu the scope of the present disclosure include transcriptional uusduhrhors or e free tor domains known to those of sb;h in ti;e art. Sui table transcriptional inodnkiors i acbke transcriptional achvaiors. According as one aspect, the oranseripdoaai regulator protein or donaan upissguiates expression of the target nucleic acid , Sui table transcriptional modulators include t.ranscnpt.-onal repressors . According as one aspect, the transcriptional regulator proton; or don-am dorwuv¾uk-tes expression of Use target aackic acid, boen -pkuy transcriptional activators taokke Y PS4, VF 16:. V P ; do, VF48,, V f>9n, pby . Rta, V PR. hsf p and p3 0 Suitable transcriptional repressors' n-elude ARAB . Transcriptional acti vators and iraascopboaai repressors cau be read dy identified by one of skid in the art based or Use
present, d sclosure
Faction l groups, function conferring proteins or domains within the scope of t.be present disclosure include detectable groups or markers or labels Sacb detectable groups or markers or labels can be delected or imaged usi ng methods known to those of skill in fee art to identify die location of toe targe nucleic acid sequence , indirect abaoho;ent of a detectable label or maker i conic in plated by aspects of die present disclosure. Detectable labels or markers can be readily identified by one of skill i n the ad based on the present disclosure . Detectable ro s incl ude fluorescent protei ns such as GFP, FP, FJFig FYFP, stCiFP. nreberryc i PPP, ci trine, atorange, cerulean, mturquotse, FB Fik BBFP2, Aeusfte, mKaiaiual. ECFP. CYFiilk mTurquoisea, YEP, Venus, and Y ei and d e like. Other useful detectable groups include sp ing, spycaicber, s a tags, biobn, sbepta idi.tr ami suniag arid d;e bke.
Functional groups, fis notion conferring proteins or doatairts lthm the scope of the present disclosure include binding functional groups hich may iunetion to bind to desired molecules. Such btndu-g rimctionai groups incl ude aniauiers tns2 to iVtCF, ppf to POh com to (too; binding protein, mtcins, IBkBP to FEB, pniAG to nblAG and Cry2 arid the like .
According to one aspect, embodiments described herein include guide RNA having a length including the sum of the lengths of a spacer sequence, tracr mate sequence, tracr sequence, and linker sequence (if present). Accordingly, such a guide RNA may be described by its total length which is a sum of its spacer sequence, tracr mate sequence, tracr sequence, and linker sequence. According to this aspect, all of the ranges for the spacer sequence, tracr mate sequence, tracr sequence, and linker sequence (if present) are incorporated herein by reference and need not be repeated. One of skill will readily be able
to sum each of the portions of a guide RNA to obtain the total length of the guide RNA sequence. Aspects of the present disclosure are directed to methods of making such guide RNAs as described herein by expressing constructs encoding such guide RNA using promoters and terminators and optionally other genetic elements as described herein.
According to certain aspects, the guide RNA and the enzymatically active Cas9 optionally having a functional group attached thereto which interacts with the guide RNA are foreign to the cell into which they are introduced or otherwise provided. According to this aspect, the guide RNA and the enzymatically active Cas9 optionally having a functional group attached thereto are nonnaturally occurring in the cell in which they are introduced, or otherwise provided. To this extent, cells may be genetically engineered or genetically modified to include the CRISPR /Cas systems described herein.
One such CRISPR/Cas system uses the S. pyogenes Cas9 nuclease (Sp. Cas9), an extremely high-affinity (see Sternberg, S.H., Redding, S., Jinek, M., Greene, E.C. & Doudna,
J.A. DNA interrogation by the CRISPR RNA-guided endonuclease Cas9. Nature 507, 62-67
(2014) hereby incorporated by reference in its entirety), programmable DNA-binding protein isolated from a type II CRISPR-associated system (see Garneau, J.E. et al. The CRISPR/Cas bacterial immune system cleaves bacteriophage and plasmid DNA. Nature 468, 67-71 (2010) and Jinek, M. et al. A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science 337, 816-821 (2012) each of which are hereby incorporated by reference in its entirety). The DNA locus targeted by Cas9 precedes a three nucleotide (nt)
5 '-NGG-3 ' "PAM" sequence, and matches a 15-22-nt guide or spacer sequence within a
Cas9-bound RNA cofactor, referred to herein and in the art as a guide RNA. Altering this guide RNA is sufficient to target Cas9 to a target nucleic acid. In a multitude of CRISPR- based biotechnology applications, the guide is often presented in a so-called sgRNA (single
guide RNA), wherein the two natural Cas9 RNA cofactors (crRNA and tracrRNA) are fused via an engineered loop.
Embodiments of the present disclosure are directed to a method of delivering a functional group or moiety attached to a enzymatically active Cas9 protein to a target nucleic acid in a cell comprising providing to the cell the enzymatically active Cas9 protein having the functional group or moiety attached thereto and a guide RNA having spacer sequence between 16 and 8 nucleotides in length wherein the guide RNA and the Cas9 protein form a co-localization complex with the target nucleic acid and where the enzymatically active Cas9 protein is rendered non-endonucleolytically active and where the functional group or moiety is delivered to the target nucleic acid. Methods described herein can be performed in vitro, in vivo or ex vivo. According to one aspect, the cell is a eukaryotic cell or a prokaryotic cell. According to one aspect, the cell is a bacteria cell, a yeast cell, a mammalian cell, a plant cell or an animal cell. According to one aspect, the Cas9 protein is an enzymatically active Cas9 protein, a Cas9 protein wild-type protein, or an enzymatically active Cas9 nickase. Additional xemplary Casd p o e ns a-ciade Cas9 protonis attach d to, bound to or fused with Fu-ca aal prolans such s tramcrip†.io?s¾l regulators, such as trar aprbor-al activators or ^p es r , VFtL a Fok-doinairj.. such as Fok L an aptaroor. a bird i protein FP?., MS2 and the like.
Embodiments of the present disclosure are directed to a method of delivering an enzymatically active Cas9 protein optionally having a functional group attached thereto to cells within a subject comprising administering to the subject, such as systemically administering to the subject, such as by intravenous administration or injection, intraperitoneal administration or injection, intramuscular administration or injection, intracranial administration or injection, intraocular administration or injection, subcutaneous
administration or injection, a enzymatically active Cas9 protein optionally having a functional group attached thereto or a nucleic acid encoding the enzymatically active Cas9 protein optionally having a functional group attached thereto.
Embodiments of the present disclosure are directed to a method of delivering a guide RNA to cells within a subject comprising administering to the subject, such as systemically administering to the subject, such as by intravenous administration or injection, intraperitoneal administration or injection, intramuscular administration or injection, intracranial administration or injection, intraocular administration or injection, subcutaneous administration or injection, a guide RNA or a nucleic acid encoding the guide RNA.
Embodiments of the present disclosure are directed to a method of delivering an enzymatically active Cas9 protein optionally having a functional group attached thereto and a guide RNA to cells within a subject comprising administering to the subject, such as systemically administering to the subject, such as by intravenous administration or injection, intraperitoneal administration or injection, intramuscular administration or injection, intracranial administration or injection, intraocular administration or injection, subcutaneous administration or injection, an enzymatically active Cas9 optionally having a functional group attached thereto or a nucleic acid encoding the enzymatically active Cas9 protein optionally having a functional group attached thereto and a guide RNA or a nucleic acid encoding the guide RNA.
Methods of non-viral delivery of nucleic acids or native DNA binding protein, native guide RNA or other native species include lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA. Lipofection is described in e.g., U.S.
Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., Transfectam™ and Lipofectin™). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91/17424; WO 91/16024. Delivery can be to cells (e.g. in vitro or ex vivo administration) or target tissues (e.g. in vivo administration). The term native includes the protein, enzyme or guide RNA species itself and not the nucleic acid encoding the species.
Regulatory elements are contemplated for use with the methods and constructs described herein. The term "regulatory element" is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences). Such regulatory elements are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). A tissue- specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal- dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific. Regulatory elements may also direct expression in an inducible manner, such as in a small-molecule dependent or light- dependent manner. In some embodiments, a vector may comprise one or more pol III promoter (e.g. 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1, 2,
3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g. 1, 2, 3, 4, 5, or more pol I
promoters), or combinations thereof. Examples of pol III promoters include, but are not limited to, U6 and HI promoters. Examples of pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) (see, e.g., Boshart et al, Cell, 41 :521-530 (1985)), the SV40 promoter, the dihydrofolate reductase promoter, the β-actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EFl a promoter and Pol II promoters described herein. Also encompassed by the term "regulatory element" are enhancer elements, such as WPRE; CMV enhancers; the R-U5 ' segment in LTR of HTLV-I (Mol. Cell. Biol, Vol. 8(1), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit β-globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31, 1981). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression desired, etc. A vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., clustered regularly interspersed short palindromic repeats (CRISPR) transcripts, proteins, enzymes, mutant forms thereof, fusion proteins thereof, etc.).
Aspects of the methods described herein may make use of terminator sequences. A terminator sequence includes a section of nucleic acid sequence that marks the end of a gene or operon in genomic DNA during transcription. This sequence mediates transcriptional termination by providing signals in the newly synthesized mRNA that trigger processes which release the mRNA from the transcriptional complex. These processes include the direct interaction of the mRNA secondary structure with the complex and/or the indirect activities of recruited termination factors. Release of the transcriptional complex frees RNA
polymerase and related transcriptional machinery to begin transcription of new mRNAs. Terminator sequences include those known in the art and identified and described herein.
Aspects of the methods described herein may make use of epitope tags and reporter gene sequences. Non-limiting examples of epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags. Examples of reporter genes include, but are not limited to, glutathione-S- transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, betaglucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP).
The following examples are set forth as being representative of the present disclosure. These examples are not to be construed as limiting the scope of the present disclosure as these and other equivalent embodiments will be apparent in view of the present disclosure, figures and accompanying claims.
EXAMPLES
CRISPR-Cas9 holds tremendous promise in correcting genetic defects, and its delivery by adeno-associated viruses (AAVs) is thought to be exceptionally safe. However, immunological reactions against encoded transgenes and/or the viral capsid have sometimes been observed (reviewed in Mays, L. E. & Wilson, J. M. The complex and evolving story of T cell activation to AAV vector-encoded transgene products. Mol Ther 19, 16-27, doi: 10.1038/mt.2010.250 (2011)). Hence, in this study, it has been sought to first establish a flexible AAV-CRiSPR-CasS? ίοηο that enables the wide spectrum of unrealized
applications in vivo. Second, the host response to the system has been tracked. This is important because the exogenous nature of AAV-CRISPR-Cas9 might incite detrimental host reactions against the encoded transgenes and/or viral capsid (reviewed in Mays, L. E. & Wilson, J. M. The complex and evolving story of T cell activation to AAV vector-encoded transgene products. Mol Ther 19, 16-27, doi: 10.1038/mt.2010.250 (201 1)). Understanding the host responses towards AAV-CRISPR-Cas9 would identify confounding factors that impact experimental rigor, highlight relevant considerations for clinical translation, and provide a roadmap for engineering efficient genome manipulation systems. Specifically, this example describes the immunogenicity of AAV-CRISPR-Cas9 in mice, specifically that of AAV-split- Cas9, a platform capable of postnatal genome-editing, transcriptional regulation, and further domain fusions. AAV elicits a humoral immune response, inducing antibodies targeting motifs associated with viral functions. Cas9 elicits both humoral and cellular immune responses, but its delivery by AAV mitigates overt tissue or cellular damage seen with alternative delivery methods. This study provides the first demonstration of postnatal CRISPR-Cas9 applications beyond genome-editing, and elucidates the AAV-CRISPR-Cas9 safety profile necessary for bringing it into the clinic.
Of the various CRISPR-Cas9 (Mali, P. et al. RNA -guided human genome engineering via Cas9. Science 339, 823-826, doi: 10.1 126/science.1232033 (2013); Cong, L. et al.
Multiplex genome engineering using CRISPR/Cas systems. Science 339, 819-823, doi: 10.1 126/science.123 1143 (2013); Jinek, M. et al. A programmable dual-RNA-guided
DNA endonuclease in adaptive bacterial immunity. Science 337, 816-821, doi: 10.1 126/science.1225829 (2012); Ran, F. A. et al. In vivo genome editing using
Staphylococcus aureus Cas9. Nature 520, 186-191, doi: 10.1038/nature 14299 (2015); Esvelt,
K. M. et al. Orthogonal Cas9 proteins for RNA-guided gene regulation and editing. Nature
methods 10, 1116-1121, doi: 10.1038/nmeth.2681 (2013)) and recently characterized CRISPR-Cpfl (Zetsche, B. et al. Cpfl is a single RNA-guided endonuclease of a class 2 CRISPR-Cas system. Cell 163, 759-771, doi: 10.1016/j .cell.2015.09.038 (2015)) on o gs, this caaraple ehose to exaaooe th Strept' coccotiS p o en Gis9 (SpCda A} due to ana tip ie attractive features. SpCas9 has the least restrictive protospacer adjacent motif (PAM) requirement, which fundamentally dictates the density of possible target sites per given genome (FIG. 1A). Conversely, more restrictive PAM requirements (e.g., Stl (Esvelt, K. M. et al. Orthogonal Cas9 proteins for RNA-guided gene regulation and editing. Nature methods 10, 1116-1121, doi: 10.1038/nmeth.2681 (2013)); Nm (Esvelt, K. M. et al. Orthogonal Cas9 proteins for RNA-guided gene regulation and editing. Nature methods 10, 1116-1121, doi: 10.1038/nmeth.2681 (2013)); and Sa (Ran, F. A. et al. In vivo genome editing using Staphylococcus aureus Cas9. Nature 520, 186-191, doi: 10.1038/nature 14299 (2015)) Cas9s; As and Lb Cpfls (Zetsche, B. et al. Cpfl is a single RNA-guided endonuclease of a class 2 CRISPR-Cas system. Cell 163, 759-771, doi: 10.1016/j .cell.2015.09.038 (2015)) render significant numbers of target sites inaccessible. Combining SpCas -wit AAV is oeace highly eatasng to ccess the broadest targeting range a? v?v; . Pardieaaore. the army of 0 !SP -'Cas9 apphca aons bes ond genon-a-edding has yet to be reabsed .; ? vivo, ir? pari dae to the large sizes of Cash aaiisgenes that leave hrbe spaee far additional finetson'-conierraig elements aathu? earrent A.A.V deslgas (Ran, F. A. et al. In vivo genome editing using Staphylococcus aureus Cas9. Nature 520, 186-191, doi: 10.1038/nature 14299 (2015); Nelson, C. E. et al. In vivo genome editing improves muscle function in a mouse model of Duchenne muscular dystrophy. Science 351, 403-407, doi: 10.1126/science.aad5143 (2016); Tabebordbar, M. et al. In vivo gene editing in dystrophic mouse muscle and muscle stem cells. Science 351, 407-411, doi: 10.1126/science.aad5177 (2016); Long, C. et al. Postnatal
genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy. Science 351, 400-403, doi: 10.1126/science.aad5725 (2016); Yang, Y. et al. A dual AAV system enables the Cas9-mediated correction of a metabolic liver disease in newborn mice. Nature biotechnology, doi: 10.1038/nbt.3469 (2016); Yin, H. et al. Therapeutic genome editing by combined viral and non-viral delivery of CRISPR system components in vivo. Nature biotechnology, doi: 10.1038/nbt.3471 (2016); Senis, E. et al. CRISPR/Cas9-mediated genome engineering: an adeno-associated viral (AAV) vector toolbox. Biotechnology journal 9, 1402-1412, doi: 10.1002/biot.201400046 (2014); Swiech, L. et al. In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9. Nature biotechnology 33, 102- 106, doi: 10.1038/nbt.3055 (2015)) (payload limit 4.7 kb). This obstacle ;··· ^acerbated wnh mnnnn?8¾ foBctio& i cassette challenging (Long, C. et al. Postnatal genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy. Science 351, 400- 403, doi: 10.1126/science.aad5725 (2016); Senis, E. et al. CRISPR/Cas9-mediated genome engineering: an adeno-associated viral (AAV) vector toolbox. Biotechnology journal 9, 1402- 1412, doi: 10.1002/biot.201400046 (2014); Swiech, L. et al. In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9. Nature biotechnology 33, 102-106, doi: 10.1038/nbt.3055 (2015)). Resolving this challenge would enable novel applications currently unachievable.
Hence, in this example, it is sought to firstly, combine AAV, SpCas9, and fusion domains for a platform capable of postnatal genome -editing and epigenetic modulation, and secondly, to investigate the immunogenicity of the therapeutic modality.
To date, determined structures of Cas9 and Cpf 1 proteins generally adopt a bi-lobed architecture (SpCas9 (Nishimasu, H. et al. Crystal structure of Cas9 in complex with guide
RNA and target DNA. Cell 156, 935-949, doi: 10.1016/j .cell.2014.02.001 (2014); Jinek, M. et al. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science 343, 1247997, doi: 10.1126/science.1247997 (2014)), SaCas9 (Nishimasu, H. et al. Crystal Structure of Staphylococcus aureus Cas9. Cell 162, 1113-1126, doi: 10.1016/j .cell.2015.08.007 (2015)), AnaCas9 (Jinek, M. et al. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science 343, 1247997, doi: 10.1126/science.1247997 (2014)), LbCpfl (Dong D, Ren K, Qiu X, Zheng J, Guo M, Guan X, Liu H, Li N, Zhang B, Yang D, Ma C, Wang S, Wu D, Ma Y, Fan S, Wang J, Gao N, Huang Z, The crystal structure of Cpfl in complex with CRISPR RNA, Nature, 2016 Apr 28;532(7600):522-6) AsCpfl (Yamano T, Nishimasu H, Zetsche B, Hirano H, Slaymaker IM, Li Y, Fedorova I, Nakane T, Makarova KS, Koonin EV, Ishitani R, Zhang F, Nureki O, Crystal Structure of Cpfl in Complex with Guide RNA and Target DNA, Cell, 2016 May 5; 165(4):949-62), but not FnCas9 (Hirano, H. et al. Structure and Engineering of Francisella novicida Cas9. Cell 164, 950-961, doi: 10.1016/j.cell.2016.01.039 (2016))), offering &e clue
(Nishimasu, H. et al. Crystal Structure of Staphylococcus aureus Cas9. Cell 162, 1113-1126, doi: 10.1016/j .cell.2015.08.007 (2015); Zetsche, B., Volz, S. E. & Zhang, F. A split-Cas9 architecture for inducible genome editing and transcription modulation. Nature biotechnology 33, 139-142, doi: 10.1038/nbt.3149 (2015); Wright, A. V. et al. Rational design of a split- Cas9 enzyme complex. Proceedings of the National Academy of Sciences of the United States of America 112, 2984-2989, doi: 10.1073/pnas. l501698112 (2015); Nihongaki, Y., Kawano, F., Nakajima, T. & Sato, M. Photoactivatable CRISPR-Cas9 for optogenetic genome editing. Nature biotechnology 33, 755-760, doi: 10.1038/nbt.3245 (2015); Truong, D. J. et al.
Development of an intein-mediated split-Cas9 system for gene therapy. Nucleic Acids Res 43, 6450-6458, doi: 10.1093/nar/gkv601 (2015); Fine, E. J. et al. Trans-spliced Cas9 allows cleavage of HBB and CCR5 genes in human cells using compact expression cassettes. Scientific reports 5, 10777, doi: 10.1038/srep 10777 (2015)). This exaa-p describes as an exeag:ban; b dsmem where SpCasV s speeb/kahy split ax its disordered iavker bet eea io-acid residues V70 and D? ; , hypoihesiaiag that this iaaiataais groaeai folding for each lobe, such that fhe fihl-heogih Casd ((has9 :-L} car; be reeoosapited searrdessiy as vivo by spiiMmem proreai tram-spliciag (Li, J., Sun, W., Wang, B., Xiao, X. & Liu, X. Q. Protein trans-splicing as a means for viral vector-mediated in vivo gene therapy. Hum Gene Ther 19, 958-964, doi: 10.1089/hum.2008.009 (2008)) (FIG. IB). Thus, the Cas9 N-terminal lobe is fused with the Rhodothermus marinus N-split-intein (Cas9N) (2.5 kb), and the C-terminal lobe is fused with C-split-intein (Cas9c) (2.2 kb) (FIGS. 2A and 2B), and each is designed to be individually packaged into a separate AAV vector (FIG. 3A), thereby liberating > 2 kb within each AAV vector for additional elements. In transfected cells, split-Cas9 was fully active, targeting all endogenous genes tested at efficiencies 85% to 115% of Cas9FL (FIG. 1C and FIGS. 2C and 2D). Full activity from structure-guided split-intein reconstitution (Truong, D. J. et al. Development of an intein-mediated split-Cas9 system for gene therapy. Nucleic Acids Res 43, 6450-6458, doi: 10.1093/nar/gkv601 (2015)) contrasts with sub-optimal activity from non-covalent heterodimerization (Nishimasu, H. et al. Crystal Structure of Staphylococcus aureus Cas9. Cell 162, 1113-1126, doi: 10.1016/j.cell.2015.08.007 (2015); Zetsche, B., Volz, S. E. & Zhang, F. A split-Cas9 architecture for inducible genome editing and transcription modulation. Nature biotechnology 33, 139-142, doi: 10.1038/nbt.3149 (2015); Wright, A. V. et al. Rational design of a split-Cas9 enzyme complex. Proceedings of the National Academy of Sciences of the United States of America 112, 2984-2989,
doi: 10.1073/pnas. l501698112 (2015); Nihongaki, Y., Kawano, F., Nakajima, T. & Sato, M. Photoactivatable CRISPR-Cas9 for optogenetic genome editing. Nature biotechnology 33, 755-760, doi: 10.1038/nbt.3245 (2015)), suggesting that scarless protein ligation preserves Cas9 structure and function. Next, Cas9c-P2A-turboGFP and Cas9N-U6-gRNAs were packaged into AAV serotype DJ (AAV-Cas9-gRNAs) (FIG. 3A) and the viruses were to cultured cells. AAV-Cas9-gRNAs modified all targeted genes in differentiated myotubes (FIG. ID, FIGS. 3B and 3C), tail-tip fibroblasts (FIG. 3D) and spermatogonial cells (FIG. IE), demonstrating robustness in three distinct cell types of proliferative and terminally differentiated states. 1'¾ereios:¾, spiiC-Casd reta;:as f ll activuy of €as9':';- and opens the spectrasn of A AVAlRISPK bbacV a lic tions previously unatgaaable sacb as the progrannnalde iargetnig of ras-o dors l tovvams D A.
CRISPR-Cas9-mediated epigenetic regulation has not been demonstrated in mice, but this ability would address a whole spectrum of human epigenetic diseases irresolvable by genome-editing. He:ace: the next fo enmer . cap.it.ali. sad on the extra viral capacity of A.AV- spbi-Ca.s9 to ^corp rate O"ai«cnpdoio cd vator tbsion domains (1 .6 kb t -pardie VF (Chavez, A. et al. Highly efficient Cas9-mediated transcriptional programming. Nature methods 12, 326-328, doi: 10.1038/nmeth.3312 (2015))) for gene expression upregulation (AAV-Cas9-VPR). This experiment further harnessed the findings that nuclease-active Cas9 can be programmed with truncated gRNAs to bind genomic loci without inducing DNA breaks, thereby allowing a single Cas9 fusion protein to simultaneously effect genome- editing and epigenetic regulation (Kiani, S. et al. Cas9 gRNA engineering for genome editing, activation and repression. Nature methods 12, 1051-1054, doi: 10.1038/nmeth.3580 (2015); Dahlman, J. E. et al. Orthogonal gene knockout and activation with a catalytically active Cas9 nuclease. Nature biotechnology 33, 1159-1161, doi: 10.1038/nbt.3390 (2015))
(FIG. IF). Following transduction, nuclease-active AAV-Cas9-VPR programmed with truncated gRNAs (14-15 nt spacers) upregulated gene expression of the targeted PD-L1, FST, and CD47 genes (FIG. 1G). As with nuclease-inactive 'dead' Cas9FL (dCas9)-activators (Chavez, A. et al. Highly efficient Cas9-mediated transcriptional programming. Nature methods 12, 326-328, doi: 10.1038/nmeth.3312 (2015); Konermann, S. et al. Genome-scale transcriptional activation by an engineered CRISPR-Cas9 complex. Nature 517, 583-588, doi: 10.1038/nature l4136 (2015)), gene activation by AAVAAaA-A'PR in versely correlated with the basal expression levels of the target genes (FIG. 1H). It \% acted that ¾½s programmed wi h nbbleagdi gRN As, A A V AAS9- VFR docs nor retaia fab eruioaacRohydc fiiectioy; of AA VAArsv (FKb Ϊ Ε) ibeace . spbt-(bis9 enables hbsso:a of Ae ctioa w-oe errngg doa -aars vvi lbn AAVs, am untethered spbrbba b offers; oiore robasi DNA -deavage . i por&r^i.y. A AVR.'as9hi desi ns as rev ousl descri ed arc enable to aceotootodare the i k b V pR doraaia fasaon.
To deroo:asts:s,tc faocboaab y in vivo, AAV'-Ca V-gR As targeting Ms in svas eext psendoeyped io sero y e 9
at;d systern -caby deliv red die vira es
(SE i 'l or a'B i o vector genoraes, vg) OHO neoaatai ra -ce by agraperboocal opecooo (FIG.
4A). All AAV experiments in vivo were conducted in a randomized and double -blind fashion.
Deep-sequencing of whole tissues from injected mice revealed a range of editing frequencies
(up to 10.9%), similar to those observed in cell culture (plasmid, up to 10.7%; AAV, up to
6.3-24.6%). It was observed that editing frequencies exhibited inter-tissue bias for both on- target {Mstn) and off-target (chrl6:+3906202) sites (FIGS. 5A and 5B), which suggests either absence of transduction in some cells, or that most cells were transduced but at different efficiencies. Infection assays argue against the first scenario, because the AAV9 dosage used was in excess to transduce all examined cells within the liver, heart, and skeletal
muscle (FIG. 5C). Moreover, dual AAV9s co-transduced across most cells (FIG. 5D), suggesting that gRNAs and split-Cas9 co-deliver, and further supports the feasibility of applications involving multiple gRNAs (FIG. 5E) and Cas9 proteins. The second scenario was then tested by measuring viral concentration per cell, using qPCR to quantify AAV vector genomes (vg) per mouse diploid genome (dg). Consistent with prior findings (Zincarelli, C, Soltys, S., Rengo, G. & Rabinowitz, J. E. Analysis of AAV serotypes 1-9 mediated gene expression and tropism in mice after systemic injection. Mol Ther 16, 1073- 1080, doi: 10.1038/mt.2008.76 (2008)), AAV9 showed preferential tropism for liver, heart and skeletal muscle (vg/dg of 850, 370, 140, respectively), while lower vg/dg were detected in the brain and gonads (FIG. 5F). Strikingly, gene-editing frequencies correlated strongly with AAV vector copies (FIG. 4B, FIGS. 5G and 5H), indicating that delivery efficiency dictates mutation rate. Therefore, despite sufficiency in infecting most cells, higher AAV9- Cas9-gRNA copies per cell continue to increase editing rates.
Next, to demarcate its spatial biodistribution, AAV9-Cas9-gRNAs activity was tracked at single-cell resolution, using the Ai9 mouse line (Madisen, L. et al. A robust and high-throughput Cre reporting and characterization system for the whole mouse brain. Nat Neurosci 13, 133-140, doi: 10.1038/nn.2467 (2010)) that accurately couples genomic excision of a 3xStop cassette with tdTomato fluorescence activation. Systemic delivery of AAV9- Cas9-gRNAsTdL+TdR (5E1 1 or 4E12 vg) targeting the 3xStop cassette generated excision- dependent tdTomato+ cells in all examined organs (FIG. 4C and FIG. 6). Targeted cells were widespread in the liver, heart and skeletal muscle (FIG. 7), arguing against clonal descent and suggesting multiple independent targeting events. Gene-edited cell clusters were detected infrequently in the brain and gonad (< 0.001% of cells) (FIG. 4C), at a rate that evades detection with deep-sequencing of bulk samples (sensitivity limits -0.2%). Hence,
AAV9-Cas9-gR As is robust in mice, and its widespread biodistribution also highlights that evaluation of CRISPR-Cas9 tissue-level off-targeting should complement that at the genomic-level, which has so far been the primary focus.
Furthermore, the platform enables transcriptional regulation in vivo. Mice were intramuscularly injected with the same dosage oi AAV9 -Cas9- VPE gR As: var ing only the spacer sequences to target different sets of genes. The targeted PD-L1 and CD47 genes were activated by 2-fold and 1.6-fold respectively, as determined by qRT-PCR and total mRNA- sequencing (FIGS. 4D and 4E). This demonstrates, for the first time, postnatal transcriptional regulation with CRISPR-Cas9.
Having validated the AAV-split-Cas9 platform, it was next to examine its immunogenicity, comparing it in parallel with intramuscular DNA electroporation. Following expression of Cas9 in the adult tibialis anterior muscle (FIG. 8A), the draining lymph nodes enlarged with increased cell counts (FIG. 8B). Cellular infiltration was largely absent in the lymph nodes of mice administered the same vectors without the Cas9 coding sequence, indicating a Cas9-driven immune response. T-cells orchestrate antigen-specific immune responses, with each clonal lineage expressing a unique T-cell receptor β-chain (TCR-β)
CDR3 motif that mediates most of the antigen-contact. To identify T-cell(s) mediating the cellular response, the TCR-β repertoires of lymphocytes infiltrating the draining lymph nodes were sequenced. It was observed that Cas9-exposure stimulated skewed expansion of T-cell clonotypic subsets (FIG. 8C), which implies antigen-specific T-cell activation and proliferation. Four TCR-β clonotypes were common to all Cas9-experienced animals (n = 4) and undetected in all unexposed animals (n = 8). Because bona fide T-cells would proliferate with antigen recall, it was sought to confirm antigen-specific T-cell expansion by challenging extracted lymphocytes with purified Cas9 protein. Of the four initial clonotypes, one was
narrowed down on (νβ16, CDR3 : CASSLDRGQDTQYF) as a true Cas9-responsive T-cell clonotype, which proliferated according to Cas9 protein restimulation (FIG. 8D). Hence, Cas9 elicits cellular immunogenicity, with an antigen-specific T-cell clonotype common among injected mice (i.e., public response), and with the remaining T-cell infiltrates largely dissimilar between individuals (i.e., private response).
To map Cas9 antibody epitopes, serum from each animal was co-incubated with M13 phage display libraries tiling the Cas9 transgene, and antibody targets were determined by Ig:phage pull-down (FIG. 8E, FIG. 9A). Epitope mapping shows that individual Cas9- experienced animals exhibit an antibody repertoire targeting unique residues of Cas9; but three linear epitopes were observed more than once (FIG. 8F). 1352-ITGLYETRI-1360 consists of residues recognizing gRNA stem loop 2 (Nishimasu, H. et al. Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell 156, 935-949, doi: 10.1016/j .cell.2014.02.001 (2014)); 122-IVDEVAYHEKYP- 133 resides in the REC 1 domain also contributing to Cas9:gRNA interactions, but do not cover residues mediating the contact (Nishimasu, H. et al. Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell 156, 935-949, doi: 10.1016/j .cell.2014.02.001 (2014)); 1 126-WDPKKYGGFD- 1135 resides in the PAM-binding loop and contains conserved residues, but maintains wild- type Cas9 endonucleolytic function when selectively mutated ( 1 125-DWD→AAA (Jinek, M. et al. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science 343, 1247997, doi: 10.1 126/science.1247997 (2014)), or D 1 135E (Kleinstiver, B. P. et al. Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature 523, 481- 485, doi: 10.1038/nature 14592 (2015)) for increasing Cas9 specificity). Combining these residue changes retain Cas9 activity (FIG. 9B). This result demonstrates that identified antigenic protein regions can be altered away from the original immunogenic amino acid
sequences. Future large-scale functional variant profiling could reveal more residues amenable to epitope-recoding, so as to derive less immunogenic Cas9 and Cpfl proteins.
Unlike that with Cas9, AAV9 elicited capsid-specific antibodies (FIG. 9C) against epitopes that were shared among injected animals at surprisingly high degrees (FIG. 8G), reminiscent of a public response to viruses recently observed also in humans (Xu, G. J. et al. Viral immunology. Comprehensive serological profiling of human populations using a synthetic human virome. Science 348, aaa0698, doi: 10.1126/science.aaa0698 (2015)). Epitope -mapping provides intriguing support that AAV9 antigenicity derives from biophysical and functional aspects, instead of purely sequence-level motifs. The metastable VPl unique and VP 1/2 common regions are antigenic, suggesting their extemalization from the viral interior for antigen capture. Immunodominant epitopes in VP3 lie predominantly on the capsid surface (FIG. 9D). Notably, while many of these residues can be separately double-alanine mutated without disrupting viral assembly (Adachi, K., Enoki, T., Kawano, Y., Veraz, M. & Nakai, H. Drawing a high-resolution functional map of adeno-associated virus capsid by massively parallel sequencing. Nat Commun 5, 3075, doi: 10.1038/ncomms4075 (2014)), they are predominantly implicated (Adachi, K., Enoki, T., Kawano, Y., Veraz, M. & Nakai, H. Drawing a high-resolution functional map of adeno- associated virus capsid by massively parallel sequencing. Nat Commun 5, 3075, doi: 10.1038/ncomms4075 (2014)) in maintaining viral blood persistency (FIG. 8H) and liver-selective tropism (FIG. 81). Together, the immunodominant VP3 epitopes (372- FMIPQYGYLTLNDGSQAVG-390, 436-MNPLIDQYLY-445, and 494-
TQNNNSEFAWPG-505) cover 12/18 of these residues associated with AAV9 hepatotropism. Hence, AAV9 elicits humoral immunogenicity that overlaps among all animals, across substantial regions of the capsid protein that modulate viral biodistribution.
To obtain a better understanding of the immunological reaction, mRNA-sequencing was next conducted on tissues from AAV9-Cas9-VPR-gR As and AAV9-turboRFP treated mice (4E12 and IE 11 vg), and the whole transcriptomes were compared against those from mice treated with AAV9-turboRFP only (IE 11 vg). Consistent with a change in tissue composition following immune cell infiltration, differentially expressed genes are significantly enriched for immunological gene ontology processes. CD8+ T-cells are particular intriguing, because they effect tissue damage by cytolysis. However, a closer look at genes encoding key differentiation signals (e.g. IL-12, Ifn-α/β, IL-2) and cytolytic effector proteins (e.g. Prfl, Gmzb, FasL) revealed that these were not altered at statistically significant levels. This led to examining functional readouts more sensitively by intra-tissue immunofluorescence and histology.
Interleukin-2 (IL-2) is pivotal for cytolytic T-cell differentiation (Pipkin, M. E. et al.
Interleukin-2 and inflammation induce distinct transcriptional programs that promote the differentiation of effector cytolytic T cells. Immunity 32, 79-90, doi: 10.1016/j .immuni.2009.11.012 (2010)). Downstream, perforin (Prfl) is the essential pore-forming protein released by cytolytic T lymphocytes and NK cells to destroy target cells. In line with mRNA-sequencing, immunofluorescence indicated minimal IL-2 or perforin protein secretion within AAV9-Cas9-VPR-gRNAs-injected muscles (FIG. 10A).
Absence of elevated perforin release suggests minimal downstream cytolysis. Consistent with this, there was an absence of overt histological damage (FIG. IOC), in stark contrast to that seen with DNA electroporation. IL-2 and perforin were both strongly elevated in muscles electroporated with Cas9-encoding DNA and myofiber degeneration-repair clearly visible
(FIGS. 10B and 10D). This cellular damage is not due to simple physical disruptions from
DNA electroporation, because IL2 and perforin levels and myofiber cellular damage were
significantly increased over that in vehicle-electroporated muscles and could be alleviated by the administration of immunosuppressant (FK506), indicating an immunological basis. Hence, although AAV-CRISPR-Cas9 activates the host immune system, it does not trigger overt cellular damage observed with alternative delivery methods.
CRISPR-Cas9 allows user-defined DNA-RNA-protein interactions, driving a wide range of applications that includes epigenetic regulation and protein-complex recruitment. The use of CRISPR-Cas9 in vivo has the potential not just to correct genetic defects, but also to modulate the epigenome. Sph†.--Cas9 shortens the coding sequenc s below that of ah aceo nxxkie there current, forms (Ran, F. A. et al. In vivo genome editing using
Staphylococcus aureus Cas9. Nature 520, 186-191, doi: 10.1038/nature 14299 (2015); Nelson,
C. E. et al. In vivo genome editing improves muscle function in a mouse model of Duchenne muscular dystrophy. Science 351, 403-407, doi: 10.1126/science.aad5143 (2016);
Tabebordbar, M. et al. In vivo gene editing in dystrophic mouse muscle and muscle stem cells. Science 351, 407-411, doi: 10.1126/science.aad5177 (2016); Long, C. et al. Postnatal genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy. Science 351, 400-403, doi: 10.1126/science.aad5725 (2016); Yang, Y. et al. A dual
AAV system enables the Cas9-mediated correction of a metabolic liver disease in newborn mice. Nature biotechnology, doi: 10.1038/nbt.3469 (2016); Yin, H. et al. Therapeutic genome editing by combined viral and non-viral delivery of CRISPR system components in vivo.
Nature biotechnology, doi: 10.1038/nbt.3471 (2016); Senis, E. et al. CRISPR/Cas9-mediated genome engineering: an adeno-associated viral (AAV) vector toolbox. Biotechnology journal
9, 1402-1412, doi: 10.1002/biot.201400046 (2014); Swiech, L. et al. In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9. Nature biotechnology 33, 102-
106, doi: 10.1038/nbt.3055 (2015)). This platform enables in vivo applications including and beyond that of genome-editing, which has so far only begin to demonstrate the power of CRISPR-Cas9 in manipulating live mammals.
The fundamental consideration for clinical implementation of AAV-CRISPR-Cas9 lies in its safety. Alternative delivery methods such as DNA electroporation and adenoviruses (Wang, D. et al. Adenovirus-Mediated Somatic Genome Editing of Pten by CRISPR/Cas9 in Mouse Liver in Spite of Cas9-Specific Immune Responses. Hum Gene Ther 26, 432-442, doi: 10.1089/hum.2015.087 (2015)) cause severe inflammation and immunological reactions within the host. Inherently benign delivery vectors are hence particularly attractive. Precedents of immune evasion/tolerance by viruses have been documented in experimental and endogenous settings, mediated by processes ranging through insufficient activation, subthreshold inflammatory milieu, and/or active immunosuppression (Mays, L. E. & Wilson, J. M. The complex and evolving story of T cell activation to AAV vector-encoded transgene products. Mol Ther 19, 16-27, doi : 10.1038/mt.2010.250 (201 1); Zajac, A. J. et al. Viral immune evasion due to persistence of activated T cells without effector function. J Exp Med 188, 2205-2213 (1998); Curtsinger, J. M., Lins, D. C. & Mescher, M. F. Signal 3 determines tolerance versus full activation of naive CD8 T cells: dissociating proliferation and development of effector function. J Exp Med 197, 1 141-1 151, doi: 10.1084/jem.20021910 (2003)). This example shows that AAV-CRISPR-Cas9 activates immune responses without overt cellular damage. This attests to its comparatively favorable safety profile, both for use in research models and ultimately human patients.
Constructs and sequences. U6-driven gRNA plasmids were constructed as described
(Mali, P. et al. RNA-guided human genome engineering via Cas9. Science 339, 823-826, doi: 10.1 126/science.1232033 (2013)). AAV plasmid backbone was derived from pZac2.1-
CASI-EGFP-RGB, a gift from Luk Vandenberghe. Minicircles parental plasmids were cloned in ZYCY10P3S2T, and minicircles were generated as described (Kay, M. A., He, C. Y. & Chen, Z. Y. A robust system for production of minicircle DNA vectors. Nature biotechnology 28, 1287-1289, doi: 10.1038/nbt. l708 (2010)). AAV plasmids were cloned in Stbl3 (Life Technologies C7373-03). All other plasmids were cloned in DH5a (NEB C2987H). Protein transgenes were expressed from ubiquitous hybrid promoters: SMVP promoter (generated by fusing SV40enhancer-CMV-promoter-chimeric intron), CASI promoter (Balazs, A. B. et al. Antibody-based protection against HIV infection by vectored immunoprophylaxis. Nature 481, 81-84, doi: 10.1038/nature 10660 (2012)), or CAG promoter (Matsuda, T. & Cepko, C. L. Electroporation and RNA interference in the rodent retina in vivo and in vitro. Proceedings of the National Academy of Sciences of the United States of America 101, 16-22, doi: 10.1073/pnas.2235688100 (2004)). SMVP plasmid was derived from pMAXGFP (Lonza). pCAG-GFP was a gift from Connie Cepko (Addgene plasmid # 11150). pAAV- CMV-HI-EGFP-Cre-WPRE-SV40pA was obtained from the University of Pennsylvania Vector Core.
AAV packaging and purification. AAVs were packaged via the triple-transfection method (Grieger, J. C, Choi, V. W. & Samulski, R. J. Production and characterization of adeno-associated viral vectors. Nat Protoc 1, 1412-1428, doi: 10.1038/nprot.2006.207 (2006);
Zolotukhin, S. et al. Recombinant adeno-associated virus purification using novel methods improves infectious titer and yield. Gene Ther 6, 973-985, doi: 10.1038/sj .gt.3300938 (1999)).
HEK293 cells (Cell Biolabs AAV- 100 or Agilent 240073) were plated in growth media consisting of DMEM+glutaMAX+pyruvate+10%FBS (Life Technologies), supplemented with lx MEM non-essential amino acids (Gibco). Confluency at transfection was between
70-90%. Media was replaced with fresh pre-warmed growth media before transfection. For
each 15 -cm dish, 20 ug of pHelper (Cell Biolabs), 10 μg of pRepCap [encoding capsid proteins for AAV-DJ (Cell Biolabs) or AAV9 (UPenn Vector Core)], and 10 ug of pAAV were mixed in 500 μΐ of DMEM, and 200 ug of PEI "MAX" (Polysciences) (40 kDa, 1 mg/ml in H2O, pH 7.1) added for PELDNA mass ratio of 5 : 1. The mixture was incubated for 15 min., and transferred drop-wise to the cell media. For large-scale AAV production, HYPERFlask 'M' (Corning) were used, and the transfection mixture consisted of 200 μg of pHelper, 100 ug of pRepCap, 100 ug of pAAV, and 2 mg of PEIMAX. The day after transfection, media was changed to DMEM+glutamax+pyruvate+2%FBS. Cells were harvested 48-72 hrs after transfection by scrapping or dissociation with lxPBS (pH7.2) + 5 mM EDTA, and pelleted at 1500 g for 12 min. Cell pellets were resuspended in 1-5 ml of lysis buffer (Tris HC1 pH 7.5 + 2 mM MgCl + 150 mM NaCl), and freeze-thawed 3x between dry-ice-ethanol bath and 37 °C water bath. Cell debris was clarified via 4000 g for 5 min., and the supernatant collected. Downstream processing differed depending on applications.
For preparation of AAV-containing lysates, the collected supernatant was treated with 50 U/ml of Benzonase ( Sigma- Aldrich) and 1 U/ml of Riboshredder (Epicentre) for 30 min. at 37 °C to remove unpackaged nucleic acids, filtered through a 0.45 μπι PVDF filter (Millipore), and used directly on cells or stored in -80 °C.
For purification of AAV via chloroform-ammonium sulfate precipitation, 1/10th volume of chloroform and NaCl ( 1 M final concentration) was added to the lysate and shaken vigorously. After centrifugation, the supernatant was incubated with PEG-8000 ( 10% final w/v) on ice for > 1 hr or overnight. PEG-precipitated virions were centrifuged (4000 g, 30 min., 4 °C), and resuspended in 50 mM HEPES buffer (pH8). 50 U/ml of Benzonase (Sigma-
Aldrich) and 1 U/ml of Riboshredder (Epicentre) were added and incubated for 30 min. at 37
°C. An equal volume of chloroform was then added, and vigorously vortexed. After
centrifugation, the aqueous phase was collected and residual chloroform evaporated for 30 min. Ammonium sulfate precipitation of AAVs were performed with a 0.5 M - 2 M cut-off. AAVs were then resuspended and dialyzed in lx PBS + 35 mM NaCl, quantified for viral titers, and stored in -80 °C.
All experiments with purified AAVs utilized the iodixanol density gradient ultracentrifugation purification method (Grieger, J. C, Choi, V. W. & Samulski, R. J. Production and characterization of adeno-associated viral vectors. Nat Protoc 1, 1412-1428, doi: 10.1038/nprot.2006.207 (2006); Zolotukhin, S. et al. Recombinant adeno-associated virus purification using novel methods improves infectious titer and yield. Gene Ther 6, 973-985, doi: 10.1038/sj .gt.3300938 (1999)), unless otherwise stated. The collected AAV supernatant was first treated with 50 U/ml Benzonase and 1 U/ml Riboshredder for 30 min. at 37 °C. After incubation, the lysate was concentrated to <3 ml by ultrafiltration with Amicon Ultra- 15 (50 kDa MWCO) (Millipore), and loaded on top of a discontinuous density gradient consisting of 2 ml each of 15%, 25%, 40%, 60% Optiprep (Sigma-Aldrich) in an 11.2 ml Optiseal polypropylene tube (Beckman-Coulter). The tubes were ultracentrifuged at 58000 rpm, at 18 °C, for 1.5 hr, on an NVT65 rotor. The 40% fraction was extracted, and dialyzed with IxPBS (pH 7.2) supplemented with 35 mM NaCl, using Amicon Ultra-15 (50 kDa or 100 kDa MWCO) (Millipore). The purified AAVs were quantified for viral titers, and stored in -80 °C.
AAV2/9-CMV-HI-EGFP-Cre-WPRE-SV40 (Lot V4565MI-R), AAV2/9-CB7-CI- EGFP-WPRE-rBG [Lot CS0516(293)], AAV2/9-CB7-CI-mCheny-WPRE-rBG (Lot V4571MI-R), and AAV2/9-CMV-turboRFP-WPRE-rBG (Lot V4528MI-R-DL) were obtained from the University of Pennsylvania Vector Core.
AAV titers (vector genomes) were quantified via hydrolysis-probe qPCR (Aurnhammer, C. et al. Universal real-time PCR for the detection and quantification of adeno-associated virus serotype 2-derived inverted terminal repeat sequences. Human gene therapy methods 23, 18-28, doi: 10.1089/hgtb.2011.034 (2012)) against standard curves generated from linearized parental AAV plasmids.
Table 1. A list of gRNA spacer sequences used in this study.
gRNAs set (for
Sp gRNAs Spacer sequence, including 5' G from U6 promoter
AAV9-Cas9-VPR)
Acvr2b B1 GGGCCATGTGGACATCCATGAGGTGAGACAGTGCCAGCGT
Acvr2b B3 GGCCTGAAGCCACTACAGCTGCTGGAGATCAAGGCTCG
Acvr2a A3 GGCCCTAGCATCTAAGTTCTCGCAGGC
Acvr2a A4 GGTCATTCCATCTCAGCTGTGACAGCAGCGCAGAA
Mstn M3 GTCAAGCCCAAAGTCTCTCCGGGACCTCTT 1 and 2
Mstn M4 GGAATCCCGGTGCTGCCGCTACCCCCTCA 1 and 2
Ai9 Td5 GCTAGAGAATAGGAACTTCTT
Ai9 TdL GAAAGAATTGATTTGATACCG
Ai9 Td3 GATCCCCATCAAGCTGATC
Ai9 TdR GGTATGCTATACGAAGTTATT
PD-L1 P1 GCTCGAGATAAGACC 1
PD-L1 P2 GCTAAAGTCATCCGC 1
FST F1 GGTTCTTATTTGCGT
FST F2 GGAAATCAAAGCGGC and
CD47 C1 GAAGGAGTTCCTCGG 1
CD47 C2 GAGGAGGTCCACTTC 1
Table 2. A list of locus-specific genotyping primers for deep-sequencing used in this study.
Sequence
CTTTCCCTACACGACGCTCTTCCGATCTNNNNNNCTGGAGTGTTAGAGTGGGCG GGAGTTCAGACGTGTGCTCTTCCGATCTGACTGCCCCATGGAAAGACA CTTTCCCTACACGACGCTCTTCCGATCTNNNNNNGGGCCATGAAAGGAAAAATGAAGT GGAGTTCAGACGTGTGCTCTTCCGATCTGCCTCTGGGGTTTGCTTGGT CTTTCCCTACACGACGCTCTTCCGATCTNNNNNNGAGATATAAGCTGAATAAGGCCAATGACATACT GGAGTTCAGACGTGTGCTCTTCCGATCTCTACTGCTCTTTCCTGCCGA
Table 3. A list of qPCR probes and primers used in this study.
Target locus Sequence
Acvr2b F GCCTACTCGCTGCTGCCCATT
Acvr2b R CCTGGAGACCCCCAAAAGCTC
Acvr2b probe /5HEX/AGATCT+TC+CC+AC+TT+CA+GGT/3IABkFQ/ AAV ITR F GGAACCCCTAGTGATGGAGTT AAV ITR R CGGCCTCAGTGAGCGA
AAV ITR probe /56-FAM/CACTCCCTCTCTGCGCGCTCG/3BH
Coding sequences of split-Cas9.
Coding sequence for SpCas9N -RmalntN.
MAPKKKRKVGIHGVPAADKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNR
ICYLQEI FSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYP IYHLRKKLVDSTDKADLRLIYLALAH IKFRGHFLIEG
DLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQL
SKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSAS IKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYA
GYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGP
LARGNSRFAW TRKSEETITPWNFEEWDKGASAQSFIER TNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEG RKPAFLSGEQKKAI
VDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDRE IEERLKTYAHL
FDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNF QLIHDDSLTFKEDIQKAQVCJAGCr ir AC-a¾VPIRE VS
QQNFSVWALNPQTYKLEBARVSBAFCTGIKPVYRLTTRLGRSIBATANHKFLTPQGaKRVDELQPGDYLALPKRIPTAS.
ATGGCCCCAAAGAAGAAGCGGAAGGTCGGTATCCACGGAGTCCCAGCAGCCGACAAGAAGTACTCCATTGGGCTCGATAT
CGGCACAAACAGCGTCGGCTGGGCCGTCATTACGGACGAGTACAAGGTGCCGAGCAAAAAATTCAAAGTTCTGGGCAATA
CCGATCGCCACAGCATAAAGAAGAACCTCATTGGCGCCCTCCTGTTCGACTCCGGGGAAACGGCCGAAGCCACGCGGCT
CAAAAGAACAGCACGGCGCAGATATACCCGCAGAAAGAATCGGATCTGCTACCTGCAGGAGATCTTTAGTAATGAGATGG
CTAAGGTGGATGACTCTTTCTTCCATAGGCTGGAGGAGTCCTTTTTGGTGGAGGAGGATAAAAAGCACGAGCGCCACCCA
ATCTTTGGCAATATCGTGGACGAGGTGGCGTACCATGAAAAGTACCCAACCATATATCATCTGAGGAAGAAGCTTGTAGAC
AGTACTGATAAGGCTGACTTGCGGTTGATCTATCTCGCGCTGGCGCATATGATCAAATTTCGGGGACACTTCCTCATCGAG
GGGGACCTGAACCCAGACAACAGCGATGTCGACAAACTCTTTATCCAACTGGTTCAGACTTACAATCAGCTTTTCGAAGAG
AACCCGATCAACGCATCCGGAGTTGACGCCAAAGCAATCCTGAGCGCTAGGCTGTCCAAATCCCGGCGGCTCGAAAACCT
CATCGCACAGCTCCCTGGGGAGAAGAAGAACGGCCTGTTTGGTAATCTTATCGCCCTGTCACTCGGGCTGACCCCCAACT
TTAAATCTAACTTCGACCTGGCCGAAGATGCCAAGCTTCAACTGAGCAAAGACACCTACGATGATGATCTCGACAATCTGC
TGGCCCAGATCGGCGACCAGTACGCAGACCTTTTTTTGGCGGCAAAGAACCTGTCAGACGCCATTCTGCTGAGTGATATT
CTGCGAGTGAACACGGAGATCACCAAAGCTCCGCTGAGCGCTAGTATGATCAAGCGCTATGATGAGCACCACCAAGACTT
GACTTTGCTGAAGGCCCTTGTCAGACAGCAACTGCCTGAGAAGTACAAGGAAATTTTCTTCGATCAGTCTAAAAATGGCTA
CGCCGGATACATTGACGGCGGAGCAAGCCAGGAGGAATTTTACAAATTTATTAAGCCCATCTTGGAAAAAATGGACGGCAC
CGAGGAGCTGCTGGTAAAGCTTAACAGAGAAGATCTGTTGCGCAAACAGCGCACTTTCGACAATGGAAGCATCCCCCACC
AGATTCACCTGGGCGAACTGCACGCTATCCTCAGGCGGCAAGAGGATTTCTACCCCTTTTTGAAAGATAACAGGGAAAAGA
TTGAGAAAATCCTCACATTTCGGATACCCTACTATGTAGGCCCCCTCGCCCGGGGAAATTCCAGATTCGCGTGGATGACTC
GCAAATCAGAAGAGACCATCACTCCCTGGAACTTCGAGGAAGTCGTGGATAAGGGGGCCTCTGCCCAGTCCTTCATCGAA
AGGATGACTAACTTTGATAAAAATCTGCCTAACGAAAAGGTGCTTCCTAAACACTCTCTGCTGTACGAGTACTTCACAGTTT
ATAACGAGCTCACCAAGGTCAAATACGTCACAGAAGGGATGAGAAAGCCAGCATTCCTGTCTGGAGAGCAGAAGAAAGCT
ATCGTGGACCTCCTCTTCAAGACGAACCGGAAAGTTACCGTGAAACAGCTCAAAGAAGACTATTTCAAAAAGATTGAATGTT
TCGACTCTGTTGAAATCAGCGGAGTGGAGGATCGCTTCAACGCATCCCTGGGAACGTATCACGATCTCCTGAAAATCATTA
AAGACAAGGACTTCCTGGACAATGAGGAGAACGAGGACATTCTTGAGGACATTGTCCTCACCCTTACGTTGTTTGAAGATA
GGGAGATGATTGAAGAACGCTTGAAAACTTACGCTCATCTCTTCGACGACAAAGTCATGAAACAGCTCAAGAGGCGCCGAT
ATACAGGATGGGGGCGGCTGTCAAGAAAACTGATCAATGGGATCCGAGACAAGCAGAGTGGAAAGACAATCCTGGATTTT
CTTAAGTCCGATGGATTTGCCAACCGGAACTTCATGCAGTTGATCCATGATGACTCTCTCACCTTTAAGGAGGACATCCAG
AAAGCACAAGJJTGTCTGGCTGGCGA TA CTCTCA TTACCCTGGCCGA TGGA CGACGA GTGCCTA TTA GA GAA CTGGTGT
CA CA GCA GAA TTTTTCCGTGTGGGCTCTGAA TCCTCA GACTTACCGCCTGGAGAGGGCTAGA GTGA GTA GAGCTTTCTG
TACCGGCA TCAAA CCTGTGTA CCGCCTCA CCACTA GA CTGGGGA GA TCCA TTA GGGCCA CTGCCAA CCACCGA TTTCTC
ACACCTCA GGGCTGGAAA CGA GTCGA TGAA CTCCA GCCTGGA GA TTA CCTGGCTCTGCCTA GGA GAA TCCCTACTGCCT
CCTGA
Coding sequence for Rmalnt -SpCas9c-P2A-turboGFP:
MAAACPELRQLAQSDVYWDPIVSIEPDGVEEVFDLTVPGPHNFVANDIIAHNSGQGDSLHEHIANLAGS PAIKKGILQTVKWDELVKVMGRHK
PENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKD DSIDNKVLTRSDKNRGKSDNVPSEEWKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKY DENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAWGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYF FYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKY GGFDSPTVAYSVLWAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNE LALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLG APAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSRADPKKKRKVSRAGSGATNFSLLKQAGDVEENPGP PAMKIECR ITGTLNGVEFELVGGGEGTPEQGRMT KMKSTKGALTFSPYLLSHVMGYGFYHFGTYPSGYENPFLHAI NGGYTNTRIEKYEDGGVLHVSFSY RYEAGRVIGDFKWGTGFPEDSVIFTDKIIRSNATVEHLHPMGDNVLVGSFARTFSLRDGGYYSFWDSHMHFKSAIHPSILQNGGPMFAFRRV EELHSNTELGIVEYQHAFKTPIAFARSRAR.
ATGGCGGCGGCGTGCCCGGAA CTGCGTCA GCTGGCGCA GAGCGA TGTGTA TTGGGA TCCGA TTGTGA GCA TTGAA CCG GA TGGCGTGGAA GAA GTGTTTGA TCTGACCGTGCCGGGCCCGCA TAA CTTTGTGGCGAA CGA TA TTA TTGCGCA TAA CT
CTGGCCAGGGGGACAGTCTTCACGAGCACATCGCTAATCTTGCAGGTAGCCCAGCTATCAAAAAGGGAATACTGCAGACC
GTTAAGGTCGTGGATGAACTCGTCAAAGTAATGGGAAGGCATAAGCCCGAGAATATCGTTATCGAGATGGCCCGAGAGAA
CCAAACTACCCAGAAGGGACAGAAGAACAGTAGGGAAAGGATGAAGAGGATTGAAGAGGGTATAAAAGAACTGGGGTCCC
AAATCCTTAAGGAACACCCAGTTGAAAACACCCAGCTTCAGAATGAGAAGCTCTACCTGTACTACCTGCAGAACGGCAGGG
ACATGTACGTGGATCAGGAACTGGACATCAATCGGCTCTCCGACTACGACGTGGATCATATCGTGCCCCAGTCTTTTCTCA
AAGATGATTCTATTGATAATAAAGTGTTGACAAGATCCGATAAAAATAGAGGGAAGAGTGATAACGTCCCCTCAGAAGAAGT
TGTCAAGAAAATGAAAAATTATTGGCGGCAGCTGCTGAACGCCAAACTGATCACACAACGGAAGTTCGATAATCTGACTAA
GGCTGAACGAGGTGGCCTGTCTGAGTTGGATAAAGCCGGCTTCATCAAAAGGCAGCTTGTTGAGACACGCCAGATCACCA
AGCACGTGGCCCAAATTCTCGATTCACGCATGAACACCAAGTACGATGAAAATGACAAACTGATTCGAGAGGTGAAAGTTA
TTACTCTGAAGTCTAAGCTGGTCTCAGATTTCAGAAAGGACTTTCAGTTTTATAAGGTGAGAGAGATCAACAATTACCACCA
TGCGCATGATGCCTACCTGAATGCAGTGGTAGGCACTGCACTTATCAAAAAATATCCCAAGCTTGAATCTGAATTTGTTTAC
GGAGACTATAAAGTGTACGATGTTAGGAAAATGATCGCAAAGTCTGAGCAGGAAATAGGCAAGGCCACCGCTAAGTACTTC
TTTTACAGCAATATTATGAATTTTTTCAAGACCGAGATTACACTGGCCAATGGAGAGATTCGGAAGCGACCACTTATCGAAA
CAAACGGAGAAACAGGAGAAATCGTGTGGGACAAGGGTAGGGATTTCGCGACAGTCCGGAAGGTCCTGTCCATGCCGCA
GGTGAACATCGTTAAAAAGACCGAAGTACAGACCGGAGGCTTCTCCAAGGAAAGTATCCTCCCGAAAAGGAACAGCGACA
AGCTGATCGCACGCAAAAAAGATTGGGACCCCAAGAAATACGGCGGATTCGATTCTCCTACAGTCGCTTACAGTGTACTGG
TTGTGGCCAAAGTGGAGAAAGGGAAGTCTAAAAAACTCAAAAGCGTCAAGGAACTGCTGGGCATCACAATCATGGAGCGA
TCAAGCTTCGAAAAAAACCCCATCGACTTTCTCGAGGCGAAAGGATATAAAGAGGTCAAAAAAGACCTCATCATTAAGCTTC
CCAAGTACTCTCTCTTTGAGCTTGAAAACGGCCGGAAACGAATGCTCGCTAGTGCGGGCGAGCTGCAGAAAGGTAACGAG
CTGGCACTGCCCTCTAAATACGTTAATTTCTTGTATCTGGCCAGCCACTATGAAAAGCTCAAAGGGTCTCCCGAAGATAATG
AGCAGAAGCAGCTGTTCGTGGAACAACACAAACACTACCTTGATGAGATCATCGAGCAAATAAGCGAATTCTCCAAAAGAG
TGATCCTCGCCGACGCTAACCTCGATAAGGTGCTTTCTGCTTACAATAAGCACAGGGATAAGCCCATCAGGGAGCAGGCA
GAAAACATTATCCACTTGTTTACTCTGACCAACTTGGGCGCGCCTGCAGCCTTCAAGTACTTCGACACCACCATAGACAGA
AAGCGGTACACCTCTACAAAGGAGGTCCTGGACGCCACACTGATTCATCAGTCAATTACGGGGCTCTATGAAACAAGAATC
GACCTCTCTCAGCTCGGTGGAGACAGCAGGGCTGACCCCAAGAAGAAGAGGAAGGTGTCTCGAGCTGGATCCGGAGCCA
CGAACTTCTCTCTGTTAAAGCAAGCAGGGGACGTGGAAGAAAACCCCGGTCCTATGCCCGCCATGAAGATCGAGTGCC
GCATCACCGGCACCCTGAACGGCGTGGAGTTCGAGCTGGTGGGCGGCGGAGAGGGCACCCCCGAGCAGGGCCGCAT
GACCAACAAGATGAAGAGCACCAAAGGCGCCCTGACCTTCAGCCCCTACCTGCTGAGCCACGTGATGGGCTACGGCTT
CTACCACTTCGGCACCTACCCCAGCGGCTACGAGAACCCCTTCCTGCACGCCATCAACAACGGCGGCTACACCAACAC
CCGCATCGAGAAGTACGAGGACGGCGGCGTGCTGCACGTGAGCTTCAGCTACCGCTACGAGGCCGGCCGCGTGATCG
GCGACTTCAAGGTGGTGGGCACCGGCTTCCCCGAGGACAGCGTGATCTTCACCGACAAGATCATCCGCAGCAACGCCA
CCGTGGAGCACCTGCACCCCATGGGCGATAACGTGCTGGTGGGCAGCTTCGCCCGCACCTTCAGCCTGCGCGACGGC
GGCTACTACAGCTTCGTGGTGGACAGCCACATGCACTTCAAGAGCGCCATCCACCCCAGCATCCTGCAGAACGGGGGC
CCCATGTTCGCCTTCCGCCGCGTGGAGGAGCTGCACAGCAACACCGAGCTGGGCATCGTGGAGTACCAGCACGCCTTC
AAGACCCCCATCGCCTTCGCCAGATCTCGAGCTCGATGA
Coding sequence for RmaIntC-SOCas9c-\FR:
MAAACPELRQLAQSDVYWDPIVSIEPDGVEEVFDLTVPGPHNFVANDIIAHNSGQGDSLHEHIANLAGS PAIKKGILQTVKWDELVKVMGRHK
PENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKD DSIDNKVLTRSDKNRGKSDNVPSEEWKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKY DENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAWGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYF FYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKY GGFDSPTVAYSVLWAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNE LALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLG APAAFKYFDTTIDRKRYTSTKEVLDATLIHQS ITGLYETRIDLSQLGGDSRADPKKKRKVSPGIRRLDALISTSLYKKAGYKEASGSGRADALD DFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLINSRSSGSPKK RKVGSQYLPDTDDRHRIEEKE¾KRTYETFKSIMKKSP FSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVP VLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVT GAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLGSGSGSRDSREGMFLPKPEAGSAISDVFEGREVCQPKRIRPFHPPGSPWA RP LPASLAPTPTGPVHEPVGSLTPAPVPQPLDPAPAVTPEASHLLEDPDEETSQAVKALREMADTVIPQKEEAAICGQ DLSHPPPRGHLDELTTT LESMTEDLNLDSPLTPEL EILDTFL DECLLHAMHISTGLSIFDTSLF .
ATGGCGGCGGCGTGCCCGGAACTGCGTCAGCTGGCGCAGAGCGATGTGTATTGGGATCCGATTGTGAGCATTGAACCG GA TGGCGTGGAA GAA GTGTTTGA TCTGACCGTGCCGGGCCCGCA TAA CTTTGTGGCGAA CGA TA TTA TTGCGCA TAA CT
CTGGCCAGGGGGACAGTCTTCACGAGCACATCGCTAATCTTGCAGGTAGCCCAGCTATCAAAAAGGGAATACTGCAGACC
GTTAAGGTCGTGGATGAACTCGTCAAAGTAATGGGAAGGCATAAGCCCGAGAATATCGTTATCGAGATGGCCCGAGAGAA
CCAAACTACCCAGAAGGGACAGAAGAACAGTAGGGAAAGGATGAAGAGGATTGAAGAGGGTATAAAAGAACTGGGGTCCC
AAATCCTTAAGGAACACCCAGTTGAAAACACCCAGCTTCAGAATGAGAAGCTCTACCTGTACTACCTGCAGAACGGCAGGG
ACATGTACGTGGATCAGGAACTGGACATCAATCGGCTCTCCGACTACGACGTGGATCATATCGTGCCCCAGTCTTTTCTCA
AAGATGATTCTATTGATAATAAAGTGTTGACAAGATCCGATAAAAATAGAGGGAAGAGTGATAACGTCCCCTCAGAAGAAGT
TGTCAAGAAAATGAAAAATTATTGGCGGCAGCTGCTGAACGCCAAACTGATCACACAACGGAAGTTCGATAATCTGACTAA
GGCTGAACGAGGTGGCCTGTCTGAGTTGGATAAAGCCGGCTTCATCAAAAGGCAGCTTGTTGAGACACGCCAGATCACCA
AGCACGTGGCCCAAATTCTCGATTCACGCATGAACACCAAGTACGATGAAAATGACAAACTGATTCGAGAGGTGAAAGTTA
TTACTCTGAAGTCTAAGCTGGTcTCAGATTTCAGAAAGGACTTTCAGTTTTATAAGGTGAGAGAGATCAACAATTACCACCAT
GCGCATGATGCCTACCTGAATGCAGTGGTAGGCACTGCACTTATCAAAAAATATCCCAAGCTTGAATCTGAATTTGTTTACG
GAGACTATAAAGTGTACGATGTTAGGAAAATGATCGCAAAGTCTGAGCAGGAAATAGGCAAGGCCACCGCTAAGTACTTCT
TTTACAGCAATATTATGAATTTTTTCAAGACCGAGATTACACTGGCCAATGGAGAGATTCGGAAGCGACCACTTATCGAAAC
AAACGGAGAAACAGGAGAAATCGTGTGGGACAAGGGTAGGGATTTCGCGACAGTCCGGAAGGTCCTGTCCATGCCGCAG
GTGAACATCGTTAAAAAGACCGAAGTACAGACCGGAGGCTTCTCCAAGGAAAGTATCCTCCCGAAAAGGAACAGCGACAA
GCTGATCGCACGCAAAAAAGATTGGGACCCCAAGAAATACGGCGGATTCGATTCTCCTACAGTCGCTTACAGTGTACTGGT
TGTGGCCAAAGTGGAGAAAGGGAAGTCTAAAAAACTCAAAAGCGTCAAGGAACTGCTGGGCATCACAATCATGGAGCGAT
CAAGCTTCGAAAAAAACCCCATCGACTTTCTCGAGGCGAAAGGATATAAAGAGGTCAAAAAAGACCTCATCATTAAGCTTC
CCAAGTACTCTCTCTTTGAGCTTGAAAACGGCCGGAAACGAATGCTCGCTAGTGCGGGCGAGCTGCAGAAAGGTAACGAG
CTGGCACTGCCCTCTAAATACGTTAATTTCTTGTATCTGGCCAGCCACTATGAAAAGCTCAAAGGGTCtCCCGAAGATAATG
AGCAGAAGCAGCTGTTCGTGGAACAACACAAACACTACCTTGATGAGATCATCGAGCAAATAAGCGAATTCTCCAAAAGAG
TGATCCTCGCCGACGCTAACCTCGATAAGGTGCTTTCTGCTTACAATAAGCACAGGGATAAGCCCATCAGGGAGCAGGCA
GAAAACATTATCCACTTGTTTACTCTGACCAACTTGGGCGCGCCTGCAGCCTTCAAGTACTTCGACACCACCATAGACAGA
AAGCGGTACACCTCTACAAAGGAGGTCCTGGACGCCACACTGATTCATCAGTCAATTACGGGGCTCTATGAAACAAGAATC
GACCTCTCTCAGCTCGGTGGAGACAGCAGGGCTGACCCCAAGAAGAAGAGGAAGGTGTCGCCAGGGATCCGTCGACTTG
ACGCGTTGATATCAACAAGTTTGTACAAAAAAGCAGGCTACAAAGAGGCCAGCGGTTCCGGACGGGCTGACGCATTGG
ACGATTTTGATCTGGATATGCTGGGAAGTGACGCCCTCGATGATTTTGACCTTGACATGCTTGGTTCGGATGCCCTTGAT
GACTTTGACCTCGACATGCTCGGCAGTGACGCCCTTGATGATTTCGACCTGGACATGCTGATTAACTCTAGAAGTTCCG
GATCTCCGAAAAAGAAACGCAAAGTTGGTAGCCAGTACCTGCCCGACACCGACGACCGGCACCGGATCGAGGAAAAG
CGGAAGCGGACCTACGAGACATTCAAGAGCATCATGAAGAAGTCCCCCTTCAGCGGCCCCACCGACCCTAGACCTCCA
CCTAGAAGAATCGCCGTGCCCAGCAGATCCAGCGCCAGCGTGCCAAAACCTGCCCCCCAGCCTTACCCCTTCACCAGC
AGCCTGAGCACCATCAACTACGACGAGTTCCCTACCATGGTGTTCCCCAGCGGCCAGATCTCTCAGGCCTCTGCTCTGG
CTCCAGCCCCTCCTCAGGTGCTGCCTCAGGCTCCTGCTCCTGCACCAGCTCCAGCCATGGTGTCTGCACTGGCTCAGGC
ACCAGCACCCGTGCCTGTGCTGGCTCCTGGACCTCCACAGGCTGTGGCTCCACCAGCCCCTAAACCTACACAGGCCGG
CGAGGGCACACTGTCTGAAGCTCTGCTGCAGCTGCAGTTCGACGACGAGGATCTGGGAGCCCTGCTGGGAAACAGCAC
CGATCCTGCCGTGTTCACCGACCTGGCCAGCGTGGACAACAGCGAGTTCCAGCAGCTGCTGAACCAGGGCATCCCTGT
GGCCCCTCACACCACCGAGCCCATGCTGATGGAATACCCCGAGGCCATCACCCGGCTCGTGACAGGCGCTCAGAGGC
CTCCTGATCCAGCTCCTGCCCCTCTGGGAGCACCAGGCCTGCCTAATGGACTGCTGTCTGGCGACGAGGACTTCAGCTC
TATCGCCGATATGGATTTCTCAGCCTTGCTGGGCTCTGGCAGCGGCAGCCGGGATTCCAGGGAAGGGATGTTTTTGCCG
AAGCCTGAGGCCGGCTCCGCTATTAGTGACGTGTTTGAGGGCCGCGAGGTGTGCCAGCCAAAACGAATCCGGCCATTT
CATCCTCCAGGAAGTCCATGGGCCAACCGCCCACTCCCCGCCAGCCTCGCACCAACACCAACCGGTCCAGTACATGAG
CCAGTCGGGTCACTGACCCCGGCACCAGTCCCTCAGCCACTGGATCCAGCGCCCGCAGTGACTCCCGAGGCCAGTCAC
CTGTTGGAGGATCCCGATGAAGAGACGAGCCAGGCTGTCAAAGCCCTTCGGGAGATGGCCGATACTGTGATTCCCCAG
AAGGAAGAGGCTGCAATCTGTGGCCAAATGGACCTTTCCCATCCGCCCCCAAGGGGCCATCTGGATGAGCTGACAACC
ACACTTGAGTCCATGACCGAGGATCTGAACCTGGACTCACCCCTGACCCCGGAATTGAACGAGATTCTGGATACCTTCC
TGAACGACGAGTGCCTCTTGCATGCCATGCATATCAGCACAGGACTGTCCATCTTCGACACATCTCTGTTTTGA
Cell culture transfection and transduction. All cells were incubated at 37 °C and
C2C12 cells were obtained from the American Tissue Collection Center (ATCC, Manassas, VA), and grown in growth media (DMEM+glutaMAX+10% FBS). Cells were split with TypLE Express (Invitrogen) every 2-3 days and before reaching 80% confluency, to prevent terminal differentiation. Passage number was kept below 15. For transfection of C2C12 myoblasts, 105 cells were plated per well in a 24-well plate, in 500 μΐ of growth media. The following day, fresh media was replaced, and 800ng of total plasmid DNA was transfected with 2.4 μΐ of Lipofectamine 2000 (Life Technologies). 1 : 1 mass ratio of vectors encoding Cas9:gRNA(s) was used. Media was replaced with differentiation media (DMEM+glutaMAX+2% donor horse serum) on the 1st and 3rd days post-lipofection.
For differentiation of C2C12 into myotubes, 2xl04 cells were plated per well in a 96- well plate, in 100 μΐ of growth media. At confluency, 1-2 day(s) after plating, media was replaced with fresh differentiation media (DMEM+glutaMAX+2% donor horse serum), and further incubated for 4 days. Fresh differentiation media was replaced before transduction
with AAVs. Culture media was replaced with fresh differentiation media Id after transduction, and cells incubated for stated durations.
The 3xStop-tdTomato reporter cell line was derived from tail-tip fibroblasts of Ai9 (Madisen, L. et al. A robust and high-throughput Cre reporting and characterization system for the whole mouse brain. Nat Neurosci 13, 133-140, doi: 10.1038/nn.2467 (2010)) mouse (JAX 007905), and immortalized with lentiviruses encoding the large SV40 T-antigen (GenTarget Inc, LVP016-Puro). Cells were cultured in DMEM+pyruvate+glutaMAX+10%FBS. Lipofectamine 2000 (Life Technologies) was used for transfection of plasmids, and images were taken 5 days after transfection. For transduction with AAVs, cells were plated at 2xl04 per well in a 96-well plate, in 100 μΐ of growth media. AAV-containing lysates or purified AAVs were applied at confluency of 70- 90%. Culture media was replaced with fresh growth media the next day, and cells incubated for stated durations.
The GC-1 spg mouse spermatogonial cell line (CRL-2053) was obtained from ATCC. Cells were cultured and transduced similarly to the 3xStop-tdTomato cell line, with a Cas9N:Cas9c of 1 : 1.
Animals. All animal procedures were approved by the Harvard University Institutional Animal Care and Use Committee.
Ai9 (Madisen, L. et al. A robust and high-throughput Cre reporting and characterization system for the whole mouse brain. Nat Neurosci 13, 133-140, doi: 10.1038/nn.2467 (2010)) mice (JAX No. 007905) were used for tdTomato activation, and for systemic AAV9-Cas9-gRNAs and AAV9-GFP-Cre experiments. C57BL/6 male mice were used for in vivo electroporation and intramuscular AAV injections.
All animals were randomly allocated to treatment groups and handled equally.
In vivo electroporation. Animals were anesthetized using isoflurane and injected with 50 μΐ of 2mg/ml hyaluronidase (Sigma-Aldrich, H4272) in the tibialis anterior muscle. After 1 hr, plasmids in vehicle (10 mM Tris-HCl pH 8.0) were injected into the muscle, followed by electroporation (Aihara, H. & Miyazaki, J. Gene transfer into muscle by electroporation in vivo. Nature biotechnology 16, 867-870, doi: 10.1038/nbt0998-867 (1998)) (10 pulses of 20 ms at 100 V/cm with 100 ms intervals) using an ECM 830 Electro Square Porator (BTX Harvard Apparatus) and a two-needle array.
For conditions with immunosuppression, FK506 (Sigma-Aldrich, F4679) was administered daily at 5mg/kg (body weight), commencing 1 day before electroporation.
For Cas9-specific T-cell clonotyping and antibody epitope-mapping, both tibialis anterior muscles of 11-week old male C57BL/6 mice were each electroporated with 30 μg of pSMVP-Cas9FL. Control mice were electroporated with 30 μg of plasmid vector control (consisting of the same plasmid with Cas9 coding sequence removed) per muscle. Vehicle electroporations were similarly performed. For intramuscular IL-2 and perforin immunofluorescence staining and centrally nucleated myofiber quantification, 30 μg of DNA minicircles vectors encoding SpCas9FL, 30 μg total of pCRII-U6-gR A, and/or 15 μg of pCAG-GFP were used as indicated.
Genotyping and analysis. C2C12 cells were harvested 4 days post-lipofection, with 100 μΐ of QuickExtract DNA Extraction Solution (Epicentre) per well of a 24-well plate; and C2C12 myotubes were harvested 7 days post- AAV transduction, with 20 μΐ of DNA QuickExtract per well of a 96-well plate. Cell lysates were heated at 65 °C for 10 min., 95 °C for 8 min., and stored at -20 °C. Each locus was amplified from 0.5 μΐ of cell culture lysate
per 25 μΐ PCR reaction, for 20-25 cycles.
Bulk tissues were each placed in 100 μΐ of QuickExtract DNA Extraction Solution, and heated at 65 °C for 15 min., 95 °C for 10 min. 0.5 μΐ of lysate was used per 25 μΐ PCR reaction, and thermocycled for 25 cycles.
For barcoding for deep sequencing, 1 μΐ of each unpurified PCR reaction was added to 20 μΐ of barcoding PCR reaction, and thermocycled [95 °C for 3 min., and 10 cycles of (95 °C for 10 s, 72 °C for 65 s)]. Amplicons were pooled, the whole sequencing library purified with self-made SPRI beads (9% PEG final concentration), and sequenced on a Miseq (Illumina) for 2x251 cycles. FASTQ were analyzed with BLAT (Kent, W. J. BLAT—the BLAST-like alignment tool. Genome Res 12, 656-664, doi: 10.1101/gr.229202 (2002)) (with parameters -t=dna -q=dna -tileSize=l l -stepSize=5 -oneOff=l -repMatch= 10000000 - minMatch=4 -minldentity=90 -maxGap=3 -noHead) and post-alignment analyses performed with MATLAB (MathWorks). Alignments due to primer dimers were excluded by filtering off sequence alignments that did not extend >2 bp into the loci from the locus-specific primers. To minimize the impact of sequencing errors, conservative variant calling was performed by ignoring base substitutions, and calling only variants that overlap with a ±30 bp window from the designated Cas9-gRNA cut sites. Negative controls were equally analyzed for baseline sequencing error rates, to which statistical tests were performed against.
Off-target sites for Mstn gRNAs were predicted using the online CRISPR Design Tool (Hsu, P. D. et al. DNA targeting specificity of RNA-guided Cas9 nucleases. Nature biotechnology 31, 827-832, doi: 10.1038/nbt.2647 (2013)) (world wide website crispr.mit.edu). Off-target sites were ranked by number of mismatches to the on-target sequence, and deep sequencing performed on top hits. Sequencing reads were analyzed
equally between experimental samples (AAV9-Cas9-gRNAsM3+M4) and control samples (AAV9-Cas9-gRNAsTdL+TdR) using BLAT. Variant calls were performed for insertions and deletions that lie within a ±15 bp window from potential off-target cut-sites.
Quantitative reverse-transcription PCR (qRT-PCR) for gene expression. Cells were processed with Taqman Cells-to-Ct kits (Thermo Fisher Scientific #4399002) as per manufacturer's instructions, with the modification that each qRT-PCR reaction was scaled down to 25 μΐ. Taqman hydrolysis probes (Thermo Fisher Scientific) used: PD-L1 (Mm00452054_ml), FST (Mm00514982_ml), CD47 (Mm0049501 l_ml), and housekeeping gene Abl l (Mm00802029_ml). Gene expression from targeted genes were normalized to that of Abll (ACt) and fold-changes were calculated against AAV-Cas9c-VPR- only controls (no-gRNA) (2"ΔΔα). Basal gene expression percentiles for C2C 12 myotubes and GC-1 spermatogonial cells (type B spermatogonia) were retrieved from the Gene Expression Omnibus (GEO) repository (GDS2412 and GDS2390 respectively).
Total RNA from skeletal muscle tissues was extracted via TRIzol. Reverse transcription was conducted with High-Capacity cDNA Reverse Transcription Kit (Applied Biosystems #4368814), and 5 μΐ of each reaction was used for qRT-PCR in lx FastStart Essential DNA Probes Master (Roche #06402682001). Gene expression from targeted genes were normalized to that of Abl l (ACt) and fold-changes were calculated against AAV9- turboRFP-only controls (2"ΔΔα).
AAV administration in mice. AAV and control experiments were conducted in a randomized and double-blind fashion. The allocation code was unblinded only after analyses were completed. AAV9-Cas9-gRNAs injections utilized AAV9-Cas9N-gRNA:AAV9-Cas9c- P2A-turboGFP ratio of 1 : 1.
3-day old neonates were each intraperitoneally injected with 4E12, 5E11, or 2.5E11 vector genomes (vg) of total AAV9. Vector volumes were kept at 100 μΐ. Animals were euthanized via CO2 asphyxia and cervical dislocation 3 weeks following injections. For AAV9-GFP and AAV9-mCherry co-transduction experiments, animals were euthanized 9 days after injection. For qPCR and deep sequencing of whole tissues, samples were taken from the heart body wall, liver, gastrocnemius muscle, olfactory bulb, ovary, testis, and diaphragm.
AAV9-Cas9-VPR-gRNAs were intramuscularly injected at AAV9-Cas9N- gRNAs:AAV9-Cas9c-VPR ratio of 1: 1, at a total of 4E12 vg. To demarcate transduced tissues, 1E11 of AAV9-turboRFP was coadministered in the same mix. Controls mice were injected with 1E11 of AAV9-turboRFP only, with the final injection mix at the same volume.
For determining AAV9- and Cas9- specific T-cell clonotypes and antibody epitopes, both tibialis anterior muscles of 11-week old male C57BL/6 mice were each injected with AAV9-Cas9N and AAV9-Cas9c (2E12 vg each). For control mice, 4E12 of AAV9 vector control (consisting of the same AAV genome with the Cas9 coding sequence removed) was injected per muscle. Vehicle (lx PBS + 35mM NaCl) injections were similarly performed. For IL-2 and perforin immunofluorescence staining and centrally nucleated myofiber quantification, muscles were injected with AAV9-Cas9-VPR-gRNAs at 4E12 vg and AAV9- turboRFP at 1E11 vg, while control mouse muscles were injected with the same volume of vehicle and AAV9-turboRFP at 1E11 vg.
Quantitative PCR (qPCR) for AAV genomic copies in tissues. Each qPCR reaction consists of lx FastStart Essential DNA Probes Master (Roche #06402682001), lOOnM of each hydrolysis probe (against the AAV ITR and the mouse Acvr2b locus), 340nM of AAV
ITR reverse primer, ΙΟΟηΜ each for all other forward and reverse primers, and 2.5 μΐ of input tissue lysate. A mastermix was first constituted before splitting 22.5 μΐ into each well, after which tissue lysates were added. Thermocycling conditions were: [95°C 15 min.; 40 cycles of (95°C 1 min., 60°C 1 min.)]. FAM and HEX fluorescence were taken every cycle. AAV genomic copies per mouse diploid genome were calculated against standard curves. For each tissue sample, two repeated samplings were performed for qPCR and deep-sequencing, all on separate days, and the means plotted with s.e.m. qPCR false positive rate were calculated similarly from two vehicle-injected negative control mice, to which statistical tests were performed against.
Cas9 re-stimulation and TCR-β repertoire sequencing. Lymphocytes were isolated from 2x inguinal lymph nodes and lx popliteal lymph node per bilaterally injected mouse.
Lymph nodes were scored, and incubated for 30 min. in RPMI + 1 mg/ml collagenase at RT.
Lymphocytes were released by meshing through 70 μπι nylon sieves, washed twice with lx
PBS+5 mM EDTA, and resuspended in 500 μΐ of growth media (RPMI 1640+10%
FBS+lxPen/Strep/AmphoB+50 μΜ 2-βΜΕ). Cell counting was performed on a Countess device (Life Technologies). For Cas9 restimulation experiments, 2.5 μg of recombinant Cas9
(NEB) was incubated with > 106 cells in 500 μΐ of growth media for 3 days. Non-restimulated wells were conducted in parallel without Cas9. Cellular RNA was extracted using
QIAshredder and RNeasy micro (Qiagen). Reverse transcription was performed with
SMARTscribe (Clontech), using SMARTNNN template-switching adapter as described
(Mamedov, I. Z. et al. Preparing unbiased T-cell receptor and antibody cDNA libraries for the deep next generation sequencing profiling. Frontiers in immunology 4, 456, doi: 10.3389/fimmu.2013.00456 (2013)). KAPA HiFi polymerase was used for PCR
Individual RNA molecules were counted based on Unique Molecular Identifiers using
MIGEC (Shugay, M. et al. Towards error-free profiling of immune repertoires. Nature methods 11, 653-655, doi: 10.1038/nmeth.2960 (2014)), aligned with MIXCR (Bolotin, D. A. et al. MiXCR: software for comprehensive adaptive immunity profiling. Nature methods 12, 380-381, doi: 10.1038/nmeth.3364 (2015)), and post-analysis performed with MATLAB (MathWorks). Morisita-Horn indices per exposure condition were calculated by pairwise comparisons among 4 mice (2 animals from electroporation dataset and 2 animals from AAV dataset).
Fluorescent immunoassay. To determine antibody specificity and class-switching, serum levels of AAV9-specific IgM, IgG, and IgG2a from AAV9-treated mice were compared to that from vehicle-injected control mice. AAV9 viruses (1E9 vg) were coated on each well of a 96-well PVDF MaxiSorp plate for 1 hr in lx TBST, followed by 1 hr of blocking in lx TBST + 3% BSA. After 3 washes with lx TBST, 1 : 100 diluted mouse serum was applied at 25 μΐ per well, for 1 hr. After 3 washes with lx TBST, 1 :200 diluted anti- mouse secondary antibodies were added [goat anti-mouse IgG-CF633 (Biotium 20120), goat anti-mouse IgG2a-CF594 (Biotium 20259) and goat anti-mouse IgM-Dy550 (Pierce PISA510151)], and incubated for 1 hr. Wells were then washed 5x with lx TBST, and fluorescence readings in 100 μΐ of lx TBS were taken via a plate reader. All steps were conducted at RT. To account for autofluorescence from sera, fluorescence readings were normalized against that from wells treated similarly except for the exclusion of secondary antibodies.
Epitope mapping by M13 phage display. M13KE genome was amplified by PCR, with one end terminating with the pill peptidase cleavage signal, and the other end terminating with a 4xGly linker followed by the mature pill. Cas9 and AAV9 VPl capsid coding sequence PCR products were each randomly fragmented with NEBNext dsDNA
Fragmentase until about 50-300 bp. Purified fragments were treated with NEBNext End- Repair Module. After DNA purification, fragments were blunted ligated into the M13KE PCR product overnight at 16 °C. The entire ligation reaction was purified, and transformed into ER2738 (Lucigen), at 200 ng per 25 μΐ of bacteria, with electroporation conditions of 10 μΡ, 600 Ω, and 1.8kV. After 30 min. recovery in SOC media, the culture was amplified by combining with 20 ml of early-log ER2738 culture. After 4 hrs, the culture supernatant was collected, and incubated to a final concentration of 3.33% PEG-8000 and 417 mM of NaCl, overnight at 4 °C. M13 phage was pelleted, and resuspended in 2 ml of TBS. Phage titers were determined by LB/IPTG/X-gal blue-white plague counting, averaging > 1E11 pfu / μΐ. For Ig:phage pull-down, 20 μΐ of each phage library was incubated with 5 μΐ of mouse serum or titrated amount of purified antibody controls [7A9 (Novus Bio), Guide-IT (Clontech), bG15 (Santa Cruz), bS 18 (Santa Cruz), bD20 (Santa Cruz), non-binding mouse IgG isotype control (Santa Cruz)], and made up to 50 μΐ with TBST, for 1 hr at RT. For each reaction, 25 μΐ of Protein A/G magnetic beads (Millipore PureProteome) was first washed twice with TBST, resuspended to 10 μΐ, and added to the reaction for additional 30 min. incubation. The beads were then washed 5x with TBST, and captured Ig:phage eluted with 100 μΐ of 200 mM glycine-HCl, pH 2.2, 1 mg/ml BSA for 8 min. The eluant was neutralized with 15 μΐ of 1 M Tris-HCl, pH 8.5. 5 μΐ of captured phage display eluant was used per PCR reaction, with 20 cycles of spacer amplification and 10 cycles of barcoding, and sequenced on a Miseq (Illumina). Each serum sample was processed for technical replication on separate days. Differential binding of phage was determined using DESeq2 (Love, M. I., Huber, W. & Anders, S. Moderated estimation of fold change and dispersion for RNA-seq data with DESeq2. Genome biology 15, 550, doi: 10.1186/sl3059-014-0550-8 (2014)) in R (Team, R. C. (ISBN 3-900051-07-0, 2014)), with all Cas9-unexposed (n = 16 animals) or AAV-
unexposed (n = 16 animals) samples as appropriate controls for non-specific binding. Alignments and further analyses were performed with MATLAB (MathWorks). Visualization of epitopes on Cas9 (PBD ID: 4CMP, chain A) and AAV9 VP3 (PBD ID: 3UX1) structures was conducted with Pymol. Phenotypic data of double-alanine AAV9 mutants were obtained from Adachi, K., Enoki, T., Kawano, Y., Veraz, M. & Nakai, H. Drawing a high-resolution functional map of adeno-associated virus capsid by massively parallel sequencing. Nat Commun 5, 3075, doi: 10.1038/ncomms4075 (2014), with mutant viral blood persistency calculated as the difference in blood viral levels 72 hr. and 10 min. post-injection (both normalized to that of wildtype AAV9, with 0 denoting wildtype phenotype, and negative values denoting loss of blood persistency). Mutant tropism represented by 'Phenotypic Difference' values as described in Adachi, K., Enoki, T., Kawano, Y., Veraz, M. & Nakai, H. Drawing a high-resolution functional map of adeno-associated virus capsid by massively parallel sequencing. Nat Commun 5, 3075, doi: 10.1038/ncomms4075 (2014). Solvent- accessibility surface area (sasa) ratios for AAV9 capsid (PDB ID: 3UX1) were first calculated as described in Mandell, D. J. et al. Biocontainment of genetically modified organisms by synthetic protein design. Nature 518, 55-60, doi: 10.1038/naturel4121 (2015), and the final sasa ratio per residue calculated as the mean from a ± 5 bp sliding window centered on the residue.
Total niRNA-sequencing. 1 μg of TRIzol-extracted RNA from muscle tissues were enriched for polyA-tailed mRNA and processed with NEBNext Ultra Directional RNA
Library Prep Kit (New England Biolabs), followed by sequencing on a NextSeq sequencer
(Illumina), giving -30 million reads per sample. Reads were aligned to the mm 10 reference genome and FPKM quantified with the Cufflinks workflow (Trapnell, C. et al. Transcript assembly and quantification by RNA-Seq reveals unannotated transcripts and isoform
switching during cell differentiation. Nature biotechnology 28, 51 1-515, doi: 10.1038/nbt. l621 (2010)), with differential expression tested with Cuffdiff (Trapnell, C. et al. Differential analysis of gene regulation at transcript resolution with RNA-seq. Nature biotechnology 31, 46-53, doi: 10.1038/nbt.2450 (2013)). GO-terms network was visualized with ClueGO (Bindea, G. et al. ClueGO: a Cytoscape plug-in to decipher functionally grouped gene ontology and pathway annotation networks. Bioinformatics 25, 1091-1093, doi: 10.1093/bioinformatics/btpl01 (2009)) Cytoscape (Shannon, P. et al. Cytoscape: a software environment for integrated models of biomolecular interaction networks. Genome Res 13, 2498-2504, doi: 10.1101/gr. l239303 (2003)) plug-in.
Histology and immunofluorescence staining. Mouse organs and tissue samples were dissected, fixed in 4% paraformaldehyde in lx DPBS for 1.5 hr, followed by 3x 5min. washes with lx DPBS. Samples were immersed in 30% sucrose until submersion, embedded in O.C.T. compound (Tissue-Tek), frozen in liquid-nitrogen-cold isopentane, and cryosectioned on a Microm HM550 (Thermo Scientific). Skeletal muscles were sectioned to a thickness of 12 μπι, while the liver and heart were sectioned at 20 um.
For immunofluorescence, TA muscle sections were blocked in lx PBST + 3% BSA for lhr at RT, immunostained with primary antibodies at RT for 1 hr, followed by 3x washes with PBS/T. Slides were then incubated with secondary antibodies at RT for 1 hr., followed by 3x washes with PBS/T. Anti-mouse IL-2 and perforin antibodies were used at 1 : 100 (Santa Cruz sc-7896 and sc-9105 respectively), followed by 1 :200 of secondary anti-rabbit CF633 (Biotium). Immunostained slides were mounted with mounting media containing DAPI (Vector Laboratories, H1500).
Western blot. Muscles were harvested 2 weeks after AAV injections or plasmid
electroporation. -10 mm3 tissue clippings were flash-frozen in liquid nitrogen, followed by lysis in 300-500 μΐ of T-PER Tissue Protein Extraction Solution (Thermo Scientific) supplemented with lx Complete Protease Inhibitor (Roche), and homogenized in gentleMACS M tubes (Miltenyi Biotec). 10-15 μΐ of each tissue lysate was ran on 8 % Bolt Bis-Tris Plus gels (Life Technologies) in lx Bolt MOPS SDS running buffer at 165 V for 50 min. Protein transfer was performed with iBlot (Life Technologies) onto PVDF membranes, using program 3 for 13 min. Western blots were conducted with 1 :200 of anti-Cas9 Guide-IT polyclonal antibody (Clontech 632607), 1 :400 of anti-GAPDH polyclonal antibody (Santa Cruz sc-25778), and 1 :2500 of anti-rabbit IgG-HRP secondary antibody (Santa Cruz sc- 2004), using an iBind device (Life Technologies). Stained membranes were developed with SuperSignal West Femto Maximum Sensitivity Substrate (Thermo Scientific) and imaged on Chemidoc MP (Bio-Rad). Band intensities were quantified with Image J (NIH).
Immunosuppression. FK506 was dissolved in 100% DMSO, and the stock solution further diluted 1 : 100 in vehicle for final concentrations of 1% DMSO, 10% Cremophor (Sigma-Aldrich, C5135), and lx PBS. Mice were injected daily with 5 mg/kg (body weight) of FK506, with the first injection commencing 1 day before in vivo electroporation.
30 μg of minicircle-SMVP-Cas9 was injected for Cas9-only injections, 15 μg of pCAG-GFP for GFP-only injections, and 30 μg of minicircle-SMVP-Cas9 and 15 μg of pCAG-GFP for Cas9+GFP injections. 4 mice were injected per condition.
Imaging and analyses. Confocal images were taken using a Zeiss LSM780 inverted microscope. For live cell-imaging, each image consists of 3x z-stacks (7 um intervals) and 2x2 tiles. For muscle sections, 3x z-stacks (7 μπι intervals) were used. For liver and heart sections, 4x z-stacks (10 μπι intervals) were used. For imaging of all tissue sections, tiling to
cover entire samples were used, followed by stitching. Stacked fluorescence images were projected by maximum intensity with Zen 2011 (Carl Zeiss).
Epifluorescence images were taken with an Axio Observer D 1 (Carl Zeiss) or Axio Observer Zl (Carl Zeiss).
For co-transduction analysis after AAV9-GFP and AAV9-mCherry administration, pixels that contain both GFP and mCherry fluorescence intensities above the background thresholds were identified, and the lower intensity values from either channel were used to populate a merged image. All other pixels in the merged image were set to null.
Whole organ images were taken on a SMZ1500 (Nikon) fluorescence dissection stereomicroscope equipped with a SPOT RT3 camera (Diagnostic Instruments), for an imaging area of 16 mm by 12 mm, with 3 s exposure for the liver and 4 s exposure for the heart, muscle, brain and gonads. All images were acquired with a gain setting of 8 using the SPOT imaging software (Diagnostic Instruments, Sterling Heights, MI). Images for each organ were inverted and thresholded equally across animals.
Images were analyzed with ImageJ (NIH), CellProfiler (Carpenter, A. E. et al. CellProfiler: image analysis software for identifying and quantifying cell phenotypes. Genome biology 7, R100, doi: 10.1186/gb-2006-7-10-rl00 (2006)) and MATLAB (MathWorks).
Cas9 orthologs and applications of AAV-split-Cas9
Targeting range of Cas9 orthologs (FIG. 1A)
Cas9 orthologs, such as those from S. aureus (Sa) (Ran, F. A. et al. In vivo genome editing using Staphylococcus aureus Cas9. Nature 520, 186-191, doi: 10.1038/naturel4299
(2015)), S. thermophilus (Stl) (Esvelt, K. M. et al. Orthogonal Cas9 proteins for RNA-guided
gene regulation and editing. Nature methods 10, 1 1 16-1 121, doi: 10.1038/nmeth.2681 (2013)) and N meningitides (Nm) (Esvelt, K. M. et al. Orthogonal Cas9 proteins for R A-guided gene regulation and editing. Nature methods 10, 1 1 16-1 121, doi: 10.1038/nmeth.2681 (2013)), present exciting and complementary ways to manipulate the genome. However, with more restrictive PAM requirements, these orthologs are biologically unable to recognize the large spectrum of genomic sites accessible by SpCas9. This diminishes the key attractiveness of CPJSPR-Cas9 in facile DNA-addressing. PAM requirements can be altered by artificially evolving Cas9s, which significantly broadens the targeting ranges (Kleinstiver, B. P. et al. Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature 523, 481-485, doi: 10.1038/nature l4592 (2015); Kleinstiver, B. P. et al. Broadening the targeting range of Staphylococcus aureus CRISPR-Cas9 by modifying PAM recognition. Nature biotechnology, doi: 10.1038/nbt.3404 (2015)). Considering canonical, non-canonical and altered PAMs, SpCas9 requires an NRG, NGR, or NGCG PAM, while SaCas9 requires an NNGRR or NNNRRT PAM (these are referred to as Sp* and Sa* respectively in FIG. 1A). We note that this is an underestimate of the current Sp*Cas9 targeting range, because SpCas9 fused with DNA-binding domains allows targeting of the NGC PAM (Bolukbasi, M. F. et al. DNA- binding-domain fusions enhance the targeting range and precision of Cas9. Nature methods 12, 1 150-1 156, doi: 10.1038/nmeth.3624 (2015)). The relaxed NGC PAM is not included in our analysis, in the spirit to maintain conservative comparison in the absence of such engineering conducted with any of the other Cas9 orthologs. We also note that in the context of AAV delivery, in order to harness the SpCas9-fusion variants for enhancing targeting range and specificity, a split-Cas9 approach would be necessary. Together, these engineering efforts further increase the gap between Sp* and Sa* Cas9s against the other orthologs, with Sp* Cas9 retaining the broadest targeting range.
The advantage of a relaxed PAM is exponential when multiple sites are targeted within a genome, where the probability of finding multiple suitable sites is a product of the PAM densities. A useful application of multiplex CRISPR-Cas9 would be to generate genomic excisions, as we apply here. The PAM density also dictates the feasibility of widely used CRISPPv-Cas9 tools. For example, specificity of CRISPR-Cas9 gene -targeting is significantly increased with the use of paired Cas9-nickases (Mali, P. et al. CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature biotechnology 31, 833-838, doi: 10.1038/nbt.2675 (2013); Ran, F. A. et al. Double nicking by RNA-guided CRISPR Cas9 for enhanced genome editing specificity. Cell 154, 1380-1389, doi: 10.1016/j .cell.2013.08.021 (2013)) or dCas9-FokI (Tsai, S. Q. et al. Dimeric CRISPR RNA-guided Fokl nucleases for highly specific genome editing. Nature biotechnology 32, 569-576, doi: 10.1038/nbt.2908 (2014); Tsai, S. Q. et al. Dimeric CRISPR RNA-guided Fokl nucleases for highly specific genome editing. Nature biotechnology 32, 569-576, doi: 10.1038/nbt.2908 (2014)), which requires proximal binding of two Cas9-gRNA complexes to effect double-strand breaks. Importantly, these approaches operate on the basis that endonucleolytic activity is constituted only when both Cas9-gRNA complexes are within a certain molecular distance from each other (< 100 bp for offset nicking with Cas9-nickases; 15 bp or 25 bp for dCas9-FokI). Existence of two Cas9-gRNA target sites within these specific distances is hence necessary for function. The numbers of human (Fig. 1A) and mouse exonic sites that can be targeted with these specificity-enhancing approaches are orders of magnitude higher for SpCas9, compared to the other orthologs.
Activity of Cas9 orthologs
While SpCas9 has been successfully employed to target a myriad of genomic sites across a broad spectrum of species, it is now well-documented that individual gRNAs can
exhibit variable targeting efficiencies. Likewise, there are hints that the other orthologs exhibit similar variability. For example, in the first demonstration of SaCas9 for gene-editing in the liver (Ran, F. A. et al. In vivo genome editing using Staphylococcus aureus Cas9. Nature 520, 186-191, doi: 10.1038/nature 14299 (2015)), Pcsk9 was targeted at -40%, while Apob at 0% to 8.9%.
It would hence be illuminating to compare activities of various orthologs on a global scale, to determine if putative target sites can be edited, and how efficiently if so. For example, StlCas9 generally underperfbrmed SpCas9 across > 1000 tested gRNAs (Chari, R., Mali, P., Moosburner, M. & Church, G. M. Unraveling CRISPR-Cas9 genome engineering parameters via a library-on-library approach. Nature methods 12, 823-826, doi: 10.1038/nmeth.3473 (2015)). Comprehensive comparisons between CRISPR-Cas9s and CRISPR-Cpfls are anticipated for these highly enticing systems.
AAV-split-Cas9 allows domain fusions and compatibility with self-complementary AAVs
Split-Cas9 shortens the coding sequences significantly below all known Cas9 orthologs, which liberates the severely limited AAV capacity for the many exciting applications with CRISPR-Cas9. Since Cas9 and Cpfl proteins generally adopt a bi-lobed structure (Nishimasu, H. et al. Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell 156, 935-949, doi: 10.1016/j .cell.2014.02.001 (2014); Jinek, M. et al. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science 343, 1247997, doi: 10.1126/science.1247997 (2014); Nishimasu, H. et al. Crystal Structure of Staphylococcus aureus Cas9. Cell 162, 1113-1126, doi: 10.1016/j.cell.2015.08.007 (2015); Hirano, H. et al. Structure and Engineering of Francisella novicida Cas9. Cell 164, 950-961,
doi: 10.1016/j .cell.2016.01.039 (2016)), it is foreseen this split-reconstitution engineering framework to be generically applicable, even for orthologs yet to be characterized, which would likely be necessary when novel Cas9 and Cpf 1 domain fusions are to be made (such as with more specific and efficient nucleolytic domains, epigenetic effectors, protein complex recruiters, inducible domains, nucleotide base editors, and the like). These protein domains generally range in the hundreds to thousands of base-pairs. For comparison, the all-in-one AAV-SpCas9FL-gR A (Senis, E. et al. CRISPR/Cas9-mediated genome engineering: an adeno-associated viral (AAV) vector toolbox. Biotechnology journal 9, 1402-1412, doi: 10.1002/biot.201400046 (2014)) and AAV-SaCas9FL-gRNA (Ran, F. A. et al. In vivo genome editing using Staphylococcus aureus Cas9. Nature 520, 186-191, doi: 10.1038/naturel4299 (2015)) designs as described are > 4.8 kb, and would not be able to accommodate additional elements in their current forms.
Furthermore, we show here that genome-editing frequency is highly dependent on delivery efficiency. The split-reconstitution paradigm could also grant compatibility of Cas9s and Cpf Is with self-complementary AAV (payload limit of 2.4-3.3 kb), which confers transduction efficiency often superior to conventional single -stranded AAVs (McCarty, D. M. Self-complementary AAV vectors; advances and applications. Mol Ther 16, 1648-1656, doi: 10.1038/mt.2008.171 (2008)).
Split-Cpfl and split-Ago
On a similar design principle as our approach, splitting Cpfl orthologs at sites that maximize the likelihood for proper folding of each lobe might be attempted. Structures for Cpfl proteins have been determined (Dong D, Ren K, Qiu X, Zheng J, Guo M, Guan X, Liu H, Li N, Zhang B, Yang D, Ma C, Wang S, Wu D, Ma Y, Fan S, Wang J, Gao N, Huang Z,
The crystal structure of Cpfl in complex with CRISPR R A, Nature, 2016 Apr 28;532(7600):522-6; Yamano T, Nishimasu H, Zetsche B, Hirano H, Slaymaker IM, Li Y, Fedorova I, Nakane T, Makarova KS, Koonin EV, Ishitani R, Zhang F, Nureki O, Crystal Structure of Cpfl in Complex with Guide RNA and Target DNA, Cell, 2016 May 5; 165(4):949-62). From the LbCpfl structure (PDB ID: 5ID6), the less structured linkers at V280-E292, Q513-K520, and N803-F810 might be appropriate split-sites. From the AsCpfl structure (PDB ID: 5B43), the less structured linkers between S31 1-S325, T522-K530, M795-E804, and N878-K887 might be appropriate split-sites. Because both structures were determined from nucleic-acid(s) bound Cpfl proteins, free Cpfl apoenzyme structures might reveal more of such potential split-sites.
Similarly, previously determined protein structures show that Argonaute proteins are also bilobal, and hence would be appropriate for the current approach. The long prokaryotic argonautes comprise of an N-terminal PAZ lobe and a C-terminal ΡΓν\Τ lobe, connected by Linker 2 (L2) (See Swarts, D. C. et al. The evolutionary journey of Argonaute proteins. Nature structural & molecular biology 21, 743-753, doi: 10.1038/nsmb.2879 (2014); Song, J. J., Smith, S. K., Hannon, G. J. & Joshua-Tor, L. Crystal structure of Argonaute and its implications for RISC slicer activity. Science 305, 1434-1437, doi: 10.1 126/science. H02514 (2004); Wang, Y., Sheng, G., Juranek, S., Tuschl, T. & Patel, D. J. Structure of the guide- strand-containing argonaute silencing complex. Nature 456, 209-213, doi: 10.1038/nature07315 (2008); Sheng, G. et al. Structure-based cleavage mechanism of Thermus thermophilus Argonaute DNA guide strand-mediated DNA target cleavage. Proceedings of the National Academy of Sciences of the United States of America 111, 652- 657, doi: 10.1073/pnas.13210321 1 1 (2014)). This conserved bilobal architecture suggests that the L2 domain is an appropriate split-site. For PfAgo (PDB: 1U04), the L2 domain lies
E276-R363. Within the L2, Q347-L356 is less structured and might be most preferred. Based on the PfAgo structure, the less structured region at Y413-E443 might also be an appropriate split-site. For TtAgo (PDB: 3DLH, 4N47), the L2 domain lies E272-F338. Based on the TtAgo structure, D269-W283, R315-L321, and T504-P515 are less structured regions, and might be most preferred. NgAgo structure has not been determined, but based on the high structural conservation among orthologs between species and across prokaryotes to eukaryotes, a similar bilobal protein structure is likely. From homology alignment of NgAgo with PfAgo and TtAgo using HHPred (Soding, J., Biegert, A. & Lupas, A. N. The HHpred interactive server for protein homology detection and structure prediction. Nucleic Acids Res 33, W244-248, doi: 10.1093/nar/gki408 (2005)), Q417-A438, Y481-T502, and S696-Q707 are potential split-sites.
AAV-Cas9-gRNA for homologous recombination (HR)
The significantly increased space granted by AAV-split-Cas9 and evidence of efficient AAV co-transduction are particularly relevant for applications demanding template- directed HR. To accomplish HR, donor DNA templates have to be co-delivered into the cell with Cas9-gRNA. Even when using the smaller Cas9 orthologs (-3.3 kb), the incorporation of viral ITRs (0.3 kb), generic transcriptional regulators (-0.8 kb) and a single polIII promoter-gRNA cassette (0.4kb) would already push the payload (-4.8 kb) to the limit of AAV capacity, precluding the incorporation of a HR donor sequence. This implies that to accomplish HR-directed genome-editing, employing dual AAVs would be necessary (Y ang, Y. et al. A dual AAV system enables the Cas9-mediated correction of a metabolic liver disease in newborn mice. Nature biotechnology, doi: 10.1038/nbt.3469 (2016)), in line with the approach undertaken in this study.
Secondly, both non-homologous end-joining (NHEJ) and HR are processes downstream of dsDNA cleavage, and editing frequencies via either mechanism would depend on and reflect the extent of Cas9-mediated dsDNA cleavage. Hence, editing via NHEJ could serve as a first proxy for potential HR. We characterize the first steps in this process, showing the direct dependence of NHEJ frequency with delivery efficiency across organs. This suggests that HR efficiency would likely also depend on delivery efficiency. Subsequent investigations into developmental stage, cell states and types, and donor sequence properties will be necessary to pinpoint and optimize the parameters underlying competence for HR following systemic delivery of Cas9-gRNA.
Tissue-specificity and small-molecule regulation of AAV-Cas9-gRNA
In this study, we demonstrate use of an excision-dependent fluorescence reporter mouse line (Madisen, L. et al. A robust and high-throughput Cre reporting and characterization system for the whole mouse brain. Nat Neurosci 13, 133-140, doi: 10.1038/nn.2467 (2010)) for detecting Cas9-gRNA activity in situ. Demarcation of
AAV9-Cas9-gRNA biodistribution revealed edited cells across multiple tissue types and organs, enabled by the robustness of AAV9 for systemic delivery. On the other hand, this wide viral spread urges that careful monitoring and confinement of AAV-Cas9-gRNA would be prudent. Enticingly, the dual-AAVs format offers multi-tiered safeguards to restrict Cas9- gRNA activity to specific tissues of interest. The ability to use independent transcriptional and translational elements within the two AAVs would enable stricter tissue-specific regulation, such as by intersecting two or more tissue-specific elements. In addition, using independent AAV serotypes for each split-half and gRNA(s) would further confine Cas9- gRNA function to tissues where tropisms overlap. Enhancing tissue-level specificity complements the increased genome-level specificity that has been demonstrated with Cas9
engineering (Mali, P. et al. CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature biotechnology 31, 833-838, doi: 10.1038/nbt.2675 (2013); Ran, F. A. et al. Double nicking by RNA-guided CRISPR Cas9 for enhanced genome editing specificity. Cell 154, 1380-1389, doi: 10.1016/j .cell.2013.08.021 (2013); Tsai, S. Q. et al. Dimeric CRISPR RNA-guided Fokl nucleases for highly specific genome editing. Nature biotechnology 32, 569-576, doi: 10.1038/nbt.2908 (2014); Guilinger, J. P., Thompson, D. B. & Liu, D. R. Fusion of catalytically inactive Cas9 to Fokl nuclease improves the specificity of genome modification. Nature biotechnology 32, 577-582, doi: 10.1038/nbt.2909 (2014); Slaymaker, I. M. et al. Rationally engineered Cas9 nucleases with improved specificity. Science, doi: 10.1126/science.aad5227 (2015)). For example, intein insertions can render full-length SpCas9 conditionally inactive/active in response to small molecules, thereby also increasing genomic target-specificity (Davis, K. M., Pattanayak, V., Thompson, D. B., Zuris, J. A. & Liu, D. R. Small molecule-triggered Cas9 protein with improved genome -editing specificity. Nat Chem Biol 11, 316-318, doi: 10.1038/nchembio. l793 (2015)). However, none of the 15 tested intein-inserted Cas9 variants retained full Cas9FL activity, potentially due to disruption of the Cas9 structure; furthermore, the coding sequences of these variants (5.4 kb) exceed the AAV payload limitation. To capitalize on the increased targeting specificity of small-molecule inducible Cas9, it is foreseen that combining inducible split-inteins (Mootz, H. D., Blum, E. S., Tyszkiewicz, A. B. & Muir, T. W. Conditional protein splicing: a new tool to control protein structure and function in vitro and in vivo. J Am Chem Soc 125, 10561- 10569, doi: 10.1021/ja0362813 (2003)) and structure-guided engineered AAV-split-Cas9 (this study) would confer exquisite functional regulation in vivo.
Claims
1. A method of altering a target nucleic acid in a cell comprising
providing to the cell a first nucleic acid encoding a first portion of a Cas9 protein and a guide R A (gRNA),
providing to the cell a second nucleic acid encoding a second portion of the Cas9 protein and optionally a transcriptional regulator,
wherein the cell expresses the first portion of the Cas9 protein, the gRNA and the second portion of the Cas9 protein or the second portion of the Cas9 and the transcriptional regulator fusion protein,
wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein, or the first portion of the Cas9 protein and the second portion of the Cas9 and the transcriptional regulator fusion protein are joined together to form the Cas9 protein or the Cas9 fusion protein, and
wherein the gRNA and the Cas9 protein, or the gRNA and the Cas9 fusion protein form a co-localization complex with the target nucleic acid and alter the expression of the target nucleic acid.
2. The method of claim 1, wherein the first nucleic acid encodes a first portion of the Cas9 protein having a N-split-intein RmalntN and wherein the second nucleic acid encodes a second portion of the Cas9 protein having a C-split-intein RmalntC and wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein are joined together to form the Cas9 protein.
3. The method of claim 1, wherein the first portion of the Cas9 protein is the N- terminal lobe of the Cas9 protein up to amino acid V713 and the second portion of the Cas9 protein is the C-terminal lobe of the Cas9 protein beginning at D714.
4. The method of claim 3, wherein the gRNA having a truncated spacer sequence guides the Cas9 protein or the Cas9 fusion protein to the target nucleic acid and regulate the expression of the target nucleic acid without cleaving the target nucleic acid.
5. The method of claim 1, wherein the first nucleic acid and the second nucleic
acid are delivered to the cell by separate vectors.
6. The method of claim 1, wherein the first nucleic acid is delivered to the cell by a plasmid or adeno-associated virus.
7. The method of claim 1, wherein the second nucleic acid is delivered to the cell by a plasmid or an adeno-associated virus.
8. The method of claim 1, wherein the Cas9 is a Type II CRISPR system Cas9 and the transcriptional regulator is VPR.
9. The method of claim 1, wherein the first nucleic acid encodes a first portion of the Cas9 protein having a first split-intein and wherein the second nucleic acid encodes a second portion of the Cas9 protein having a second split-intein complementary to the first split-intein and wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein are joined together to form the Cas9 protein.
10. The method of claim 1, wherein the Cas9 protein is enzymatically active and the enzymatically active Cas9 protein cleaves the target nucleic acid in a site specific manner.
1 1. The method of claim 1, wherein the first portion of the Cas9 protein is the N- terminal lobe of the Cas9 protein and the second portion of the Cas9 protein is the C-terminal lobe of the Cas9 protein.
12. The method of claim 1, wherein the gRNA can have full length or truncated spacer sequence.
13. The method of claim 1, wherein the cell is a eukaryotic cell or a prokaryotic cell.
14. The method of claim 1, wherein the cell is a bacteria cell, a yeast cell, a mammalian cell, a human cell, a plant cell or an animal cell.
15. The method of claim 1, wherein the cell is in vitro, in vivo or ex vivo.
16. The method of claim 1, wherein the Cas9 protein is an enzymatically active Cas9 protein or a Cas9 protein nickase.
17. A method of altering a target nucleic acid in a cell of a subject comprising delivering to the cell of the subject a first nucleic acid encoding a first portion of a
Cas9 protein and a guide RNA (gR A) wherein the first nucleic acid is within a first vector, delivering to the cell of the subject a second nucleic acid encoding a second portion of the Cas9 protein and optionally a transcriptional regulator wherein the second nucleic acid is within a second vector,
wherein the cell expresses the first portion of the Cas9 protein, the gRNA and the second portion of the Cas9 protein or the second portion of the Cas9 and the transcriptional regulator fusion protein,
wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein, or the first portion of the Cas9 protein and the second portion of the Cas9 and the transcriptional regulator fusion protein are joined together to form the Cas9 protein or the Cas9 fusion protein, and
wherein the gRNA and the Cas9 protein, or the gRNA and the Cas9 fusion protein form a co-localization complex with the target nucleic acid and alter the expression of the target nucleic acid.
18. The method of claim 17, wherein the first nucleic acid encodes a first portion of the Cas9 protein having a N-split-intein RmalntN and wherein the second nucleic acid encodes a second portion of the Cas9 protein having a C-split-intein RmalntC and wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein are joined together to form the Cas9 protein.
19. The method of claim 17, wherein the first portion of the Cas9 protein is the N- terminal lobe of the Cas9 protein up to amino acid V713 and the second portion of the Cas9 protein is the C-terminal lobe of the Cas9 protein beginning at D714.
20. The method of claim 19, wherein the gR A having a truncated spacer sequence guides the Cas9 protein or the Cas9 fusion protein to the target nucleic acid and regulate the expression of the target nucleic acid without cleaving the target nucleic acid.
21. The method of claim 17, wherein the first vector is a plasmid or adeno- associated virus.
22. The method of claim 17, wherein the second vector is a plasmid or adeno- associated virus.
23. The method of claim 17, wherein the Cas9 is a Type II CRISPR system Cas9 and wherein the transcriptional regulator is VPR.
24. The method of claim 17, wherein the first nucleic acid encodes a first portion of the Cas9 protein having a first split-intein and wherein the second nucleic acid encodes a second portion of the Cas9 protein having a second split-intein complementary to the first split-intein and wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein are joined together to form the Cas9 protein.
25. The method of claim 17, wherein the Cas9 protein is enzymatically active and the enzymatically active Cas9 protein cleaves the target nucleic acid in a site specific manner.
26. The method of claim 17, wherein the first portion of the Cas9 protein is the N- terminal lobe of the Cas9 protein and the second portion of the Cas9 protein is the C-terminal lobe of the Cas9 protein.
27. The method of claim 17, wherein the gRNA can have full length or truncated spacer sequence.
28. The method of claim 17, wherein the Cas9 protein is an enzymatically active Cas9 protein or a Cas9 protein nickase.
29. The method of claim 17, wherein the vectors are delivered to the cell of the subject systemically or locally.
30. The method of claim 17, wherein the vectors are delivered to the cell of the subject intravenously, intraperitoneally or intramuscularly.
31. The method of claim 17, wherein the vectors are delivered to the cell of the subject via injection or electroporation.
32. The method of claim 17, wherein the subject is a human or an animal.
33. The method of claim 32, wherein the subject is a human patient.
34. The method of claim 17, wherein no overt tissue or cellular damage is observed when the vectors are adeno-associated viruses.
35. A method of modulating a target gene expression in a cell comprising providing to the cell a first recombinant adeno-associated virus comprising a first nucleic acid encoding an N-terminal portion of the Cas9 protein (Cas9N) and a gR A,
providing to the cell a second recombinant adeno-associated virus comprising a second nucleic acid encoding a fusion protein comprising a C-terminal portion of the Cas9 protein (Cas9c) fused with a transcriptional regulator (TR),
wherein the cell expresses the Cas9N protein and the Cas9c-TR fusion protein and joins them to form a full length Cas9FL-TR fusion protein, and
wherein the cell expresses the gRNA, and the gRNA directs the Cas9FL-TR fusion protein to the target gene and modulates target gene expression.
36. The method of claim 35, wherein the Cas9 is a Type II CRISPR system Cas9 and the transcriptional regulator is VPR.
37. The method of claim 35, wherein the first nucleic acid encodes the N-terminal
portion of the Cas9 protein (Cas9N) having a N-split-intein RmalntN and wherein the second nucleic acid encodes the fusion protein comprising a C-terminal portion of the Cas9 protein (Cas9c) fused with a transcriptional regulator (TR) and having a C-split-intein RmalntC and wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein are joined together to form the Cas9 protein.
38. The method of claim 35, wherein the cell is a eukaryotic cell or prokaryotic cell.
39. The method of claim 35, wherein the cell is a bacteria cell, yeast cell, a mammalian cell, a human cell, a plant cell or an animal cell.
40. The method of claim 35, wherein the cell is in vitro, in vivo or ex vivo.
41. The method of claim 35, wherein the Cas9 protein is an enzymatically active Cas9 protein or a Cas9 protein nickase.
42. The method of claim 35, wherein the transcriptional regulator is a transcriptional activator or a transcriptional repressor.
43. The method of claim 35, wherein the N-terminal portion of the Cas9 protein (Cas9N) is the N-terminal lobe of the Cas9 protein up to amino acid V713 and the C-terminal portion of the Cas9 protein is the C-terminal lobe of the Cas9 protein beginning at D714.
44. The method of claim 35, wherein the transcriptional regulator is a recruiter protein that recruits epigenetic modulators to the target gene.
45. The method of claim 35, wherein the gRNA has truncated spacer sequence and directs Cas9FL-TR fusion protein binding to target DNA without cleaving the target DNA.
46. A method of imaging a target nucleic acid in a cell comprising
providing to the cell a first recombinant adeno-associated virus comprising a first nucleic acid encoding an N-terminal portion of the Cas9 protein (Cas9N) and a gR A,
providing to the cell a second recombinant adeno-associated virus comprising a second nucleic acid encoding a fusion protein comprising a C-terminal portion of the Cas9 protein (Cas9c) fused with a fluorescent protein,
wherein the cell expresses the Cas9N protein and the Cas9c fluorescent fusion protein and joins them to form a full length Cas9FL fluorescent fusion protein, and
wherein the cell expresses the gRNA, and the gRNA directs the Cas9FL fluorescent fusion protein to the target nucleic acid and produces fluorescent imaging of the target nucleic acid.
47. The method of claim 46, wherein the N-terminal portion of the Cas9 protein (Cas9N) is the N-terminal lobe of the Cas9 protein up to amino acid V713 and the C-terminal portion of the Cas9 protein is the C-terminal lobe of the Cas9 protein beginning at D714.
48. The method of claim 46, wherein the first nucleic acid encodes the N-terminal portion of the Cas9 protein (Cas9N) having a N-split-intein RmalntN and wherein the second nucleic acid encodes the fusion protein comprising a C-terminal portion of the Cas9 protein (Cas9c) fused with a transcriptional regulator (TR) and having a C-split-intein RmalntC and wherein the first portion of the Cas9 protein and the second portion of the Cas9 protein are joined together to form the Cas9 protein.
49. The method of claim 46, wherein the cell is a eukaryotic cell or prokaryotic cell.
50. The method of claim 46, wherein the cell is a bacteria cell, yeast cell, a mammalian cell, a human cell, a plant cell or an animal cell.
51. The method of claim 46, wherein the cell is in vitro, in vivo or ex vivo.
52. The method of claim 46, wherein the Cas9 protein is an enzymatically active Cas9 protein, a Cas9 protein nickase or a nuclease null Cas9 protein.
53. The method of claim 46, wherein the guide RNA has truncated spacer sequence and directs Cas9FL fluorescent fusion protein binding to target nucleic acid without cleaving the target nucleic acid.
54. The method of claim 46, wherein the Cas9 is a Type II CRISPR system Cas9.
55. A nucleic acid sequence encoding an N-terminal portion of a Cas9 protein terminating at amino acid V713.
56. The nucleic acid sequence of claim 55 wherein the N-terminal portion of a Cas9 comprises an N-split-intein RmalntN.
57. A nucleic acid sequence encoding a C-terminal portion of a Cas9 protein beginning at D714.
58. The nucleic acid sequence of claim 57 wherein the C-terminal portion of a Cas9 protein comprises a C-split-intein RmalntC.
59. The nucleic acid sequence of claim 57 wherein the C-terminal portion of a Cas9 protein comprises a C-split-intein RmalntC and a transcriptional regulator (TR).
60. The nucleic acid sequence of claim 59 wherein the transcriptional regulator (TR) is VPR.
61. The nucleic acid sequence of claim 57 wherein the C-terminal portion of a Cas9 protein comprises a C-split-intein RmalntC and a fluorescent protein.
62. A recombinant adeno-associated virus comprising a nucleic acid encoding an N-terminal portion of the Cas9 protein (Cas9N) and a gRNA.
63. The recombinant adeno-associate virus of claim 62 wherein the N-terminal
portion a Cas9 comprises an N-split-intein RmalntN.
64. A recombinant adeno-associated virus comprising a nucleic acid encoding a fusion protein comprising a C-terminal portion of the Cas9 protein (Cas9c) fused with a transcriptional regulator.
65. The recombinant adeno-associated virus of claim 64 wherein the transcriptional regulator is VPR.
66. The recombinant adeno-associated virus of claim 64 wherein the C-terminal portion of the Cas9 protein further comprises a C-split-intein RmalntC.
67. A recombinant adeno-associated virus comprising a nucleic acid encoding a fusion protein comprising a C-terminal portion of the Cas9 protein (Cas9c) fused with a fluorescent protein.
68. The recombinant adeno-associated virus of claim 67 wherein the C-terminal portion of the Cas9 protein further comprises a C-split-intein RmalntC.
69. An N-terminal portion of a Cas9 protein terminating at amino acid V713.
70. The N-terminal portion of a Cas9 protein of claim 69 wherein the N-terminal portion of a Cas9 comprises an N-split-intein RmalntN.
71. A C-terminal portion of a Cas9 protein beginning at D714.
72. The C-terminal portion of a Cas9 protein of claim 71 comprising a C-split- intein RmalntC.
73. The C-terminal portion of a Cas9 protein of claim 71 comprising a C-split- intein RmalntC and a transcriptional regulator (TR).
74. The C-terminal portion of a Cas9 protein of claim 73 wherein the transcriptional regulator (TR) is VPR.
75. The C-terminal portion of a Cas9 protein of claim 71 comprising a C-split- intein RmalntC and a fluorescent protein.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/099,828 US20190345483A1 (en) | 2016-05-12 | 2017-05-12 | AAV Split Cas9 Genome Editing and Transcriptional Regulation |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662335271P | 2016-05-12 | 2016-05-12 | |
| US62/335,271 | 2016-05-12 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017197238A1 true WO2017197238A1 (en) | 2017-11-16 |
Family
ID=60268054
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/032362 Ceased WO2017197238A1 (en) | 2016-05-12 | 2017-05-12 | Aav split cas9 genome editing and transcriptional regulation |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US20190345483A1 (en) |
| WO (1) | WO2017197238A1 (en) |
Cited By (72)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9999671B2 (en) | 2013-09-06 | 2018-06-19 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| WO2018169983A1 (en) * | 2017-03-13 | 2018-09-20 | President And Fellows Of Harvard College | Methods of modulating expression of target nucleic acid sequences in a cell |
| US10113163B2 (en) | 2016-08-03 | 2018-10-30 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10323236B2 (en) | 2011-07-22 | 2019-06-18 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US10465176B2 (en) | 2013-12-12 | 2019-11-05 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US10508298B2 (en) | 2013-08-09 | 2019-12-17 | President And Fellows Of Harvard College | Methods for identifying a target site of a CAS9 nuclease |
| US10597679B2 (en) | 2013-09-06 | 2020-03-24 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US10704062B2 (en) | 2014-07-30 | 2020-07-07 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
| WO2020191242A1 (en) * | 2019-03-19 | 2020-09-24 | The Broad Institute, Inc. | Methods and compositions for editing nucleotide sequences |
| WO2020236982A1 (en) * | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Aav delivery of nucleobase editors |
| CN112041451A (en) * | 2018-02-28 | 2020-12-04 | 匹兹堡大学联邦系统高等教育 | AAV-based modular gene and protein delivery system |
| US10858639B2 (en) | 2013-09-06 | 2020-12-08 | President And Fellows Of Harvard College | CAS9 variants and uses thereof |
| US11046948B2 (en) | 2013-08-22 | 2021-06-29 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| EP3730616A4 (en) * | 2017-12-18 | 2021-09-08 | East China Normal University | FRAGMENTED SINGLE-BASED GENE EDITING SYSTEMS AND RELATED APPLICATION |
| US11208640B2 (en) | 2017-07-21 | 2021-12-28 | Arizona Board Of Regents On Behalf Of Arizona State University | Modulating human Cas9-specific host immune response |
| US11214780B2 (en) | 2015-10-23 | 2022-01-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| WO2022060841A2 (en) | 2020-09-15 | 2022-03-24 | Research Institute At Nationwide Children's Hospital | Aav-mediated homology-independent targeted integration gene editing for correction of diverse dmd mutations in patients with muscular dystrophy |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11345932B2 (en) | 2018-05-16 | 2022-05-31 | Synthego Corporation | Methods and systems for guide RNA design and use |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| WO2022175381A1 (en) * | 2021-02-17 | 2022-08-25 | Helmholtz Zentrum Muenchen - Deutsches Forschungszentrum Für Gesundheit Und Umwelt (Gmbh) | Crispr/cas9-mediated means and methods for cell reprogramming |
| WO2022187571A1 (en) | 2021-03-04 | 2022-09-09 | Research Institute At Nationwide Children's Hospital | Products and methods for treatment of dystrophin-based myopathies using crispr-cas9 to correct dmd exon duplications |
| WO2022225978A1 (en) * | 2021-04-21 | 2022-10-27 | The Regents Of The University Of California | Use of a split dcas fusion protein system for epigenetic editing |
| US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| WO2023010133A2 (en) | 2021-07-30 | 2023-02-02 | Tune Therapeutics, Inc. | Compositions and methods for modulating expression of frataxin (fxn) |
| WO2023010135A1 (en) | 2021-07-30 | 2023-02-02 | Tune Therapeutics, Inc. | Compositions and methods for modulating expression of methyl-cpg binding protein 2 (mecp2) |
| US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
| US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| WO2023250511A2 (en) | 2022-06-24 | 2023-12-28 | Tune Therapeutics, Inc. | Compositions, systems, and methods for reducing low-density lipoprotein through targeted gene repression |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| WO2024015881A2 (en) | 2022-07-12 | 2024-01-18 | Tune Therapeutics, Inc. | Compositions, systems, and methods for targeted transcriptional activation |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| WO2024040254A2 (en) | 2022-08-19 | 2024-02-22 | Tune Therapeutics, Inc. | Compositions, systems, and methods for regulation of hepatitis b virus through targeted gene repression |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| WO2024064642A2 (en) | 2022-09-19 | 2024-03-28 | Tune Therapeutics, Inc. | Compositions, systems, and methods for modulating t cell function |
| US12031129B2 (en) | 2018-08-28 | 2024-07-09 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12037602B2 (en) | 2020-03-04 | 2024-07-16 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| WO2024163683A2 (en) | 2023-02-01 | 2024-08-08 | Tune Therapeutics, Inc. | Systems, compositions, and methods for modulating expression of methyl-cpg binding protein 2 (mecp2) and x-inactive specific transcript (xist) |
| WO2024163678A2 (en) | 2023-02-01 | 2024-08-08 | Tune Therapeutics, Inc. | Fusion proteins and systems for targeted activation of frataxin (fxn) and related methods |
| US12110545B2 (en) | 2017-01-06 | 2024-10-08 | Editas Medicine, Inc. | Methods of assessing nuclease cleavage |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US12201699B2 (en) | 2014-10-10 | 2025-01-21 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| WO2025029835A1 (en) | 2023-07-31 | 2025-02-06 | Tune Therapeutics, Inc. | Compositions and methods for modulating il-2 gene expression |
| WO2025029840A1 (en) | 2023-07-31 | 2025-02-06 | Tune Therapeutics, Inc. | Compositions and methods for multiplexed activation and repression of t cell gene expression |
| WO2025038494A1 (en) | 2023-08-11 | 2025-02-20 | Tune Therapeutics, Inc. | Compositions, systems, and methods for lymphoid cell differentiation using targeted gene activation |
| WO2025059073A1 (en) | 2023-09-11 | 2025-03-20 | Tune Therapeutics, Inc. | Epigenetic editing methods and systems for differentiating stem cells |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12286727B2 (en) | 2016-12-19 | 2025-04-29 | Editas Medicine, Inc. | Assessing nuclease cleavage |
| EP4341419A4 (en) * | 2021-05-14 | 2025-04-30 | Salk Institute for Biological Studies | Methods and compositions for expression of editing proteins |
| US12338436B2 (en) | 2018-06-29 | 2025-06-24 | Editas Medicine, Inc. | Synthetic guide molecules, compositions and methods relating thereto |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US12448636B2 (en) | 2019-03-29 | 2025-10-21 | Salk Institute For Biological Studies | High-efficiency reconstitution of RNA molecules |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| WO2026015647A1 (en) | 2024-07-09 | 2026-01-15 | Tune Therapeutics, Inc. | Compositions, systems, and methods for cell differentiation using targeted gene activation of dll4 and/or vcam1 |
| WO2026064753A1 (en) | 2024-09-23 | 2026-03-26 | Tune Therapeutics, Inc. | Dna methyltransferase-like protein (dnmt3l) or dna methyltransferase 3a (dnmt3a) repressor systems for epigenetic editing |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111117985B (en) * | 2020-01-23 | 2022-07-26 | 中山大学 | A method for splitting Cas9 and its application |
| CN116568803A (en) * | 2020-10-08 | 2023-08-08 | 基恩科雷有限责任公司 | Engineered guide RNAs comprising U-rich tails for increasing the efficiency of the CRISPR/Cas12f1 system and uses thereof |
| WO2022114815A1 (en) * | 2020-11-25 | 2022-06-02 | 연세대학교 산학협력단 | Composition for prime editing comprising trans-splicing adeno-associated virus vector |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014204726A1 (en) * | 2013-06-17 | 2014-12-24 | The Broad Institute Inc. | Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy |
| US20150191744A1 (en) * | 2013-12-17 | 2015-07-09 | University Of Massachusetts | Cas9 effector-mediated regulation of transcription, differentiation and gene editing/labeling |
| US20150197734A1 (en) * | 2012-08-01 | 2015-07-16 | The Ohio State University | Reversible regulation of intein activity through engineered new zinc binding domain |
| US20160102324A1 (en) * | 2013-05-29 | 2016-04-14 | Cellectis | New compact scaffold of cas9 in the type ii crispr system |
-
2017
- 2017-05-12 WO PCT/US2017/032362 patent/WO2017197238A1/en not_active Ceased
- 2017-05-12 US US16/099,828 patent/US20190345483A1/en not_active Abandoned
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20150197734A1 (en) * | 2012-08-01 | 2015-07-16 | The Ohio State University | Reversible regulation of intein activity through engineered new zinc binding domain |
| US20160102324A1 (en) * | 2013-05-29 | 2016-04-14 | Cellectis | New compact scaffold of cas9 in the type ii crispr system |
| WO2014204726A1 (en) * | 2013-06-17 | 2014-12-24 | The Broad Institute Inc. | Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy |
| US20150191744A1 (en) * | 2013-12-17 | 2015-07-09 | University Of Massachusetts | Cas9 effector-mediated regulation of transcription, differentiation and gene editing/labeling |
Non-Patent Citations (3)
| Title |
|---|
| CHAVEZ ET AL.: "Highly-efficient Cas9-mediated transcriptional programming", NATURE METHODS, vol. 12, no. 4, 2 March 2015 (2015-03-02), pages 326 - 328, XP055371318 * |
| TRUONG ET AL.: "Development of an intein-mediated split-Cas9 system for gene therapy", NUCLEIC ACIDS RESEARCH, 27 July 2015 (2015-07-27), pages 6450 - 6458, XP002758945 * |
| WRIGHT ET AL.: "Rational design of a split-Cas9 enzyme complex", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES USA, vol. 112, no. 10, 23 February 2015 (2015-02-23), pages 2984 - 2989, XP055283739 * |
Cited By (124)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12006520B2 (en) | 2011-07-22 | 2024-06-11 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US10323236B2 (en) | 2011-07-22 | 2019-06-18 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US10508298B2 (en) | 2013-08-09 | 2019-12-17 | President And Fellows Of Harvard College | Methods for identifying a target site of a CAS9 nuclease |
| US10954548B2 (en) | 2013-08-09 | 2021-03-23 | President And Fellows Of Harvard College | Nuclease profiling system |
| US11920181B2 (en) | 2013-08-09 | 2024-03-05 | President And Fellows Of Harvard College | Nuclease profiling system |
| US11046948B2 (en) | 2013-08-22 | 2021-06-29 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| US9999671B2 (en) | 2013-09-06 | 2018-06-19 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US10682410B2 (en) | 2013-09-06 | 2020-06-16 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| US10912833B2 (en) | 2013-09-06 | 2021-02-09 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| US11299755B2 (en) | 2013-09-06 | 2022-04-12 | President And Fellows Of Harvard College | Switchable CAS9 nucleases and uses thereof |
| US12584118B2 (en) | 2013-09-06 | 2026-03-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US12559737B2 (en) | 2013-09-06 | 2026-02-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US10858639B2 (en) | 2013-09-06 | 2020-12-08 | President And Fellows Of Harvard College | CAS9 variants and uses thereof |
| US10597679B2 (en) | 2013-09-06 | 2020-03-24 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US10465176B2 (en) | 2013-12-12 | 2019-11-05 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US11053481B2 (en) | 2013-12-12 | 2021-07-06 | President And Fellows Of Harvard College | Fusions of Cas9 domains and nucleic acid-editing domains |
| US11124782B2 (en) | 2013-12-12 | 2021-09-21 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US12215365B2 (en) | 2013-12-12 | 2025-02-04 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US10704062B2 (en) | 2014-07-30 | 2020-07-07 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US11578343B2 (en) | 2014-07-30 | 2023-02-14 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US12398406B2 (en) | 2014-07-30 | 2025-08-26 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US12201699B2 (en) | 2014-10-10 | 2025-01-21 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
| US11214780B2 (en) | 2015-10-23 | 2022-01-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US12043852B2 (en) | 2015-10-23 | 2024-07-23 | President And Fellows Of Harvard College | Evolved Cas9 proteins for gene editing |
| US12344869B2 (en) | 2015-10-23 | 2025-07-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
| US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US12049651B2 (en) | 2016-04-13 | 2024-07-30 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US11999947B2 (en) | 2016-08-03 | 2024-06-04 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10947530B2 (en) | 2016-08-03 | 2021-03-16 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11702651B2 (en) | 2016-08-03 | 2023-07-18 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10113163B2 (en) | 2016-08-03 | 2018-10-30 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US12084663B2 (en) | 2016-08-24 | 2024-09-10 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| US12286727B2 (en) | 2016-12-19 | 2025-04-29 | Editas Medicine, Inc. | Assessing nuclease cleavage |
| US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
| US11820969B2 (en) | 2016-12-23 | 2023-11-21 | President And Fellows Of Harvard College | Editing of CCR2 receptor gene to protect against HIV infection |
| US12110545B2 (en) | 2017-01-06 | 2024-10-08 | Editas Medicine, Inc. | Methods of assessing nuclease cleavage |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US12516308B2 (en) | 2017-03-09 | 2026-01-06 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US12435331B2 (en) | 2017-03-10 | 2025-10-07 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11674138B2 (en) | 2017-03-13 | 2023-06-13 | President And Fellows Of Harvard College | Methods of modulating expression of target nucleic acid sequences in a cell |
| WO2018169983A1 (en) * | 2017-03-13 | 2018-09-20 | President And Fellows Of Harvard College | Methods of modulating expression of target nucleic acid sequences in a cell |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US11098297B2 (en) | 2017-06-09 | 2021-08-24 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US12297466B2 (en) | 2017-06-09 | 2025-05-13 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| US12084691B2 (en) | 2017-07-21 | 2024-09-10 | Arizona Board Of Regents On Behalf Of Arizona State University | Modulating human Cas9-specific host immune response |
| US11208640B2 (en) | 2017-07-21 | 2021-12-28 | Arizona Board Of Regents On Behalf Of Arizona State University | Modulating human Cas9-specific host immune response |
| US12359218B2 (en) | 2017-07-28 | 2025-07-15 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11932884B2 (en) | 2017-08-30 | 2024-03-19 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| EP3730616A4 (en) * | 2017-12-18 | 2021-09-08 | East China Normal University | FRAGMENTED SINGLE-BASED GENE EDITING SYSTEMS AND RELATED APPLICATION |
| US12421525B2 (en) | 2018-02-28 | 2025-09-23 | University of Pittsburgh—of the Commonwealth System of Higher Education | Conjugates comprising AAVs and CAS9 polypeptides |
| CN112041451A (en) * | 2018-02-28 | 2020-12-04 | 匹兹堡大学联邦系统高等教育 | AAV-based modular gene and protein delivery system |
| CN112041451B (en) * | 2018-02-28 | 2024-03-08 | 匹兹堡大学联邦系统高等教育 | AAV-based modular system for gene and protein delivery |
| US11345932B2 (en) | 2018-05-16 | 2022-05-31 | Synthego Corporation | Methods and systems for guide RNA design and use |
| US11802296B2 (en) | 2018-05-16 | 2023-10-31 | Synthego Corporation | Methods and systems for guide RNA design and use |
| US11697827B2 (en) | 2018-05-16 | 2023-07-11 | Synthego Corporation | Systems and methods for gene modification |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US12338436B2 (en) | 2018-06-29 | 2025-06-24 | Editas Medicine, Inc. | Synthetic guide molecules, compositions and methods relating thereto |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| US12031129B2 (en) | 2018-08-28 | 2024-07-09 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12398392B2 (en) | 2018-08-28 | 2025-08-26 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US11795452B2 (en) | 2019-03-19 | 2023-10-24 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12281303B2 (en) | 2019-03-19 | 2025-04-22 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12624353B2 (en) | 2019-03-19 | 2026-05-12 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12624354B2 (en) | 2019-03-19 | 2026-05-12 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| WO2020191242A1 (en) * | 2019-03-19 | 2020-09-24 | The Broad Institute, Inc. | Methods and compositions for editing nucleotide sequences |
| US12570972B2 (en) | 2019-03-19 | 2026-03-10 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12509680B2 (en) | 2019-03-19 | 2025-12-30 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11643652B2 (en) | 2019-03-19 | 2023-05-09 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12448636B2 (en) | 2019-03-29 | 2025-10-21 | Salk Institute For Biological Studies | High-efficiency reconstitution of RNA molecules |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| WO2020236982A1 (en) * | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Aav delivery of nucleobase editors |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US12065669B2 (en) | 2020-03-04 | 2024-08-20 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12565666B2 (en) | 2020-03-04 | 2026-03-03 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12037602B2 (en) | 2020-03-04 | 2024-07-16 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12031126B2 (en) | 2020-05-08 | 2024-07-09 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| WO2022060841A2 (en) | 2020-09-15 | 2022-03-24 | Research Institute At Nationwide Children's Hospital | Aav-mediated homology-independent targeted integration gene editing for correction of diverse dmd mutations in patients with muscular dystrophy |
| WO2022175381A1 (en) * | 2021-02-17 | 2022-08-25 | Helmholtz Zentrum Muenchen - Deutsches Forschungszentrum Für Gesundheit Und Umwelt (Gmbh) | Crispr/cas9-mediated means and methods for cell reprogramming |
| WO2022187571A1 (en) | 2021-03-04 | 2022-09-09 | Research Institute At Nationwide Children's Hospital | Products and methods for treatment of dystrophin-based myopathies using crispr-cas9 to correct dmd exon duplications |
| WO2022225978A1 (en) * | 2021-04-21 | 2022-10-27 | The Regents Of The University Of California | Use of a split dcas fusion protein system for epigenetic editing |
| EP4341419A4 (en) * | 2021-05-14 | 2025-04-30 | Salk Institute for Biological Studies | Methods and compositions for expression of editing proteins |
| WO2023010135A1 (en) | 2021-07-30 | 2023-02-02 | Tune Therapeutics, Inc. | Compositions and methods for modulating expression of methyl-cpg binding protein 2 (mecp2) |
| WO2023010133A2 (en) | 2021-07-30 | 2023-02-02 | Tune Therapeutics, Inc. | Compositions and methods for modulating expression of frataxin (fxn) |
| WO2023250511A2 (en) | 2022-06-24 | 2023-12-28 | Tune Therapeutics, Inc. | Compositions, systems, and methods for reducing low-density lipoprotein through targeted gene repression |
| US12098399B2 (en) | 2022-06-24 | 2024-09-24 | Tune Therapeutics, Inc. | Compositions, systems, and methods for epigenetic regulation of proprotein convertase subtilisin/kexin type 9 (PCSK9) gene expression |
| WO2024015881A2 (en) | 2022-07-12 | 2024-01-18 | Tune Therapeutics, Inc. | Compositions, systems, and methods for targeted transcriptional activation |
| US12252692B2 (en) | 2022-08-19 | 2025-03-18 | Tune Therapeutics, Inc. | Compositions, systems, and methods for regulation of hepatitis B virus through targeted gene repression |
| US12325857B2 (en) | 2022-08-19 | 2025-06-10 | Tune Therapeutics, Inc. | Compositions, systems, and methods for regulation of Hepatitis b virus through targeted gene repression |
| US12398394B2 (en) | 2022-08-19 | 2025-08-26 | Tune Therapeutics, Inc. | Compositions, systems, and methods for regulation of Hepatitis B virus through targeted gene repression |
| WO2024040254A2 (en) | 2022-08-19 | 2024-02-22 | Tune Therapeutics, Inc. | Compositions, systems, and methods for regulation of hepatitis b virus through targeted gene repression |
| US12221608B2 (en) | 2022-08-19 | 2025-02-11 | Tune Therapeutics, Inc. | Compositions, systems, and methods for regulation of hepatitis b virus through targeted gene repression |
| US12325858B1 (en) | 2022-08-19 | 2025-06-10 | Tune Therapeutics, Inc. | Compositions, systems, and methods for regulation of Hepatitis B virus through targeted gene repression |
| WO2024064642A2 (en) | 2022-09-19 | 2024-03-28 | Tune Therapeutics, Inc. | Compositions, systems, and methods for modulating t cell function |
| WO2024163683A2 (en) | 2023-02-01 | 2024-08-08 | Tune Therapeutics, Inc. | Systems, compositions, and methods for modulating expression of methyl-cpg binding protein 2 (mecp2) and x-inactive specific transcript (xist) |
| WO2024163678A2 (en) | 2023-02-01 | 2024-08-08 | Tune Therapeutics, Inc. | Fusion proteins and systems for targeted activation of frataxin (fxn) and related methods |
| WO2025029840A1 (en) | 2023-07-31 | 2025-02-06 | Tune Therapeutics, Inc. | Compositions and methods for multiplexed activation and repression of t cell gene expression |
| WO2025029835A1 (en) | 2023-07-31 | 2025-02-06 | Tune Therapeutics, Inc. | Compositions and methods for modulating il-2 gene expression |
| WO2025038494A1 (en) | 2023-08-11 | 2025-02-20 | Tune Therapeutics, Inc. | Compositions, systems, and methods for lymphoid cell differentiation using targeted gene activation |
| WO2025059073A1 (en) | 2023-09-11 | 2025-03-20 | Tune Therapeutics, Inc. | Epigenetic editing methods and systems for differentiating stem cells |
| WO2026015647A1 (en) | 2024-07-09 | 2026-01-15 | Tune Therapeutics, Inc. | Compositions, systems, and methods for cell differentiation using targeted gene activation of dll4 and/or vcam1 |
| WO2026064753A1 (en) | 2024-09-23 | 2026-03-26 | Tune Therapeutics, Inc. | Dna methyltransferase-like protein (dnmt3l) or dna methyltransferase 3a (dnmt3a) repressor systems for epigenetic editing |
Also Published As
| Publication number | Publication date |
|---|---|
| US20190345483A1 (en) | 2019-11-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20190345483A1 (en) | AAV Split Cas9 Genome Editing and Transcriptional Regulation | |
| JP7649046B2 (en) | RNA-guided gene editing and gene regulation | |
| JP7379447B2 (en) | Peptides and nanoparticles for intracellular delivery of genome editing molecules | |
| Chew et al. | A multifunctional AAV–CRISPR–Cas9 and its host response | |
| US20230257723A1 (en) | Crispr/cas9 therapies for correcting duchenne muscular dystrophy by targeted genomic integration | |
| US20240026352A1 (en) | Targeted gene regulation of human immune cells with crispr-cas systems | |
| AU2014361784A1 (en) | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for HBV and viral diseases and disorders | |
| US20240141341A1 (en) | Systems and methods for genome-wide annotation of gene regulatory elements linked to cell fitness | |
| US20190380314A1 (en) | Methods of Genetic Modification of a Cell | |
| WO2016112242A1 (en) | Split cas9 proteins | |
| US20230349888A1 (en) | A high-throughput screening method to discover optimal grna pairs for crispr-mediated exon deletion | |
| WO2024081937A2 (en) | Cas12a fusion proteins and methods of using same | |
| WO2018169983A1 (en) | Methods of modulating expression of target nucleic acid sequences in a cell | |
| CN121586577A (en) | Genome editing compositions and methods of use | |
| US20250332287A1 (en) | Identification of tissue-specific extragenic safe harbors for gene therapy approaches | |
| US20240216544A1 (en) | Methods and compositions for expression of editing proteins | |
| Moghadam | Developing safe and controllable Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)-based therapies with design principles of synthetic biology | |
| WO2025030130A1 (en) | Methods and compositions comprising dnmt3a-binding antibodies | |
| WO2025155753A2 (en) | Improved gene editing system, guides, and methods | |
| HK40071050B (en) | Rna-guided gene editing and gene regulation |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17796918 Country of ref document: EP Kind code of ref document: A1 |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 17796918 Country of ref document: EP Kind code of ref document: A1 |