WO2017192697A1 - Immunogenic peptide containing a b cell epitope of tumor associated antigen l6 - Google Patents
Immunogenic peptide containing a b cell epitope of tumor associated antigen l6 Download PDFInfo
- Publication number
- WO2017192697A1 WO2017192697A1 PCT/US2017/030805 US2017030805W WO2017192697A1 WO 2017192697 A1 WO2017192697 A1 WO 2017192697A1 US 2017030805 W US2017030805 W US 2017030805W WO 2017192697 A1 WO2017192697 A1 WO 2017192697A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- peptide
- cancer
- tal6
- cells
- cpg
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4748—Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55561—CpG containing adjuvants; Oligonucleotide containing adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55566—Emulsions, e.g. Freund's adjuvant, MF59
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- Tumor associated antigen L6 is a cell surface protein of the transmembrane-4 superfamily (TM4SF), also known as TM4SF1.
- TM4SF proteins are over-expressed in different types of human cancers including lung, breast, colon, prostate and liver cancer.
- TM4SF1-, TM4SF4- and TM4SF5-specific monoclonal antibodies can inhibit colon cancer growth, indicating that TM4SF proteins are crucial targets for cancer therapy.
- TAL6 is over- expressed in more than 80 % of human lung, breast, colon and ovarian tumors but not normal tissues. Recently, TAL6 was found to play critical roles in cancer cell motility, invasion, metastasis and angiogenesis.
- an HLA-A2-restricted CTL epitope, A2-5, of TAL6 is capable of inducing CTL responses against cancer cells that express TAL6.
- the induced-CTL responses can be adoptively transferred to inhibit human lung cancer growth in immunocompromised mice.
- an immunogenic peptide that contains the sequence of CLDSLGQWN (SEQ ID NO: 2), wherein the peptide has 100 or fewer amino.
- the peptide has the sequence of X 1 X 2 3 X 4 X 5 X 6 X 7 CLDSLGQWNX 8 9 X 10 11 (SEQ ID NO: 3), wherein Xi to Xn, individually, is an amino acid (e.g., one of the 20 standard amino acids).
- the peptide can include the sequence of
- the peptide further includes a cytotoxic T lymphocyte (CTL) epitope of TAL6 or a helper T cell (Th) epitope.
- CTL cytotoxic T lymphocyte
- Th helper T cell
- the peptide includes the sequence of
- AKFVAAWTLKAAAAAALLMLLPAFVAAAGLAEGPLCLDSLGQWNYTFA SEQ ID NO: 9.
- this disclosure includes a nucleic acid molecule containing a sequence that encodes the immunogenic peptide described herein.
- an immunogenic composition containing the immunogenic peptide.
- the immunogenic composition can further include an adjuvant.
- the adjuvant can be selected from the group consisting of incomplete Freund's adjuvant (IF A), DOTAP, PELC, and unmethylated CpG-containing oligodeoxynucleotides (CpG).
- the CpG is a Toll-like receptor 9 (TL 9) agonist.
- the immunogenic composition includes both PELC and the CpG.
- a method of treating a cancer in a subject in need thereof includes administering to the subject the immunogenic composition described herein.
- FIG. 1 includes (A) a scheme showing the overlapping peptides that cover the extracellular domains of TAL6: ELI (residues 31 to 46 of SEQ ID NO: 1); EL2 (residues 114 to 164 of SEQ ID NO: 1); EP1 (SEQ ID NO: 4); EP2 (SEQ ID NO: 17); EP3 (SEQ ID NO: 18); and EP4 (SEQ ID NO: 19); and (B) a graph showing binding of the peptides to anti-
- TAL6 antibodies A 96-well plate was coated with the indicated peptides (10 pg/ml) in each well. Three anti-TAL6 antibodies (1: 500) were used to detect these peptides. CP: Control peptide.
- FIG. 2 is a set of graphs showing that immunization of WT mice with the EP1 peptide induced anti-tumor immunity.
- EP1 or positive control MCF-7/TAL6 cells formulated with incomplete Freund's adjuvant (IF A) were administered to mice twice at a two-week interval.
- IF A incomplete Freund's adjuvant
- A Anti-TAL6 antibody titers were determined by using cell-based ELISA. Antigen- specific antibody was calculated as: EL4-L6 (O.D.) - EL4 (O.D.).
- B TAL6-specific ADCC was determined in a Cr 51 release assay. The lysis percentage was calculated as: immunized serum (lysis %) - naive serum (lysis%). ***P ⁇ 0.001.
- FIG. 3 is a set of graphs showing that immunization of WT mice with the EP1 peptide induced anti-tumor immunity.
- EP1 or positive control MCF-7/TAL6 cells formulated with incomplete Freund's adjuvant (IF A) were administered to mice twice at a two-week interval.
- IF A incomplete Freund's adjuvant
- B16-L6 (2xl0 4 ) cells were inoculated subcutaneously. Tumor growth was monitored 2-3 times per week.
- B The survival rate of the mice was determined.
- FIG. 4 is a set of graphs showing that EP1 formulated with PELC/CpG induced antitumor effects.
- mice were immunized with 50 mg of EP1 formulated with the indicated adjuvants twice at a 14-day interval.
- B Mouse survival rate was monitored. Results are expressed as means ⁇ SD (*P ⁇ 0.05.**P ⁇ 0.01).
- FIG. 5 is a set of graphs showing that the combination of T and B cell epitopes induced anti-tumor activity in HLA-A2 mice.
- Peptides 50 ⁇ g per mouse
- IF A Fruend's adjuvant
- FIG. 6 is a set of graphs showing that immunization with PELC/CpG/Th-A2-5-EPl induced high levels of humoral and cellular immunity in HLA-A2 mice.
- the Th-A2-5-EPl peptide was formulated with different adjuvants.
- HLA-A2 transgenic mice were immunized with the different formulations twice at a 2- week interval.
- IFN- ⁇ - secreting cells were determined using IFN- ⁇ ELISpot assay. Results are expressed as mean SD. ***P ⁇ 0.001.
- FIG. 7 is a graph showing that immunization with Th-A2-5-EPl induced anti-tumor activity in HLA-A2 transgenic mouse.
- HLA-A2 transgenic mice were immunized with the Th-A2-5-EPl peptide formulated in different adjuvants twice at a two-week interval.
- 2 x 10 4 of B 16/TAL6/HLA-A2 cells were injected subcutaneously. Each group contained 6 mice. Tumor growth was monitored 2-3 times per week. Results are expressed as mean SD.
- FIG. 8 is a graph showing that sera from immunized mice inhibited cancer cell migration.
- FIG. 9 is a set of graphs showing that peptide formulated with different adjuvants induced antibody-dependent cellular cytotoxicity (ADCC) against human cancer cells.
- Mice were immunized with peptide Th-EPl-A2-5 in various adjuvants twice at a two-week interval. Sera were collected at 6 weeks for ADCC assay.
- A Lung cancer cell line H2981 was used as a target.
- B Human breast cancer cell lines MCF7 and MCF7-TAL6 were used as targets. TAL6-specific ADCC was determined by Cr 51 release assay. The lysis percentage was calculated as: immunized serum (lysis %) - naive serum (lysis%) ***p ⁇ 0.001.
- FIG. 10 is a graph showing identification of residues in EP1 that are important for antibody binding using alanine scanning.
- the amino acid residues in EP1 were individually replaced with alanine to generate EPl-1 to EP1-20 peptides.
- Monoclonal antibody L6 was used to detect these peptides.
- EP1 is a positive control and EP-3 is a negative control.
- TAL6 contains a B cell epitope that can induce antibody-dependent cellular cytotoxicity (ADCC) and anti-tumor effects in vivo.
- ADCC antibody-dependent cellular cytotoxicity
- TAL6 contains two extracellular loops, i.e., ELI (a. a. 31 - a.a. 46 of SEQ ID NO: 1) and EL2 (a.a. 114 - a.a. 164 of SEQ ID NO: 1).
- a B cell epitope is located within EL2.
- an immunogenic peptide that includes the epitope, which contains the sequence of CLDSLGQWN (SEQ ID NO: 2).
- the immunogenic peptide can have 100 or fewer amino acids (e.g., 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids).
- the peptide can have the sequence of X 1 2 X 3 X 4 X 5 6 X 7 CLDSLGQWNX 8 9 X io 1 1 (SEQ ID NO: 3), in which Xi to Xn, individually, is an amino acid.
- amino acid refers to any of the 20 standard amino acids (i.e., alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, praline, serine, threonine, tryptophan, tyrosine, and valine).
- the term can also refer to a non-standard, non-pro teinogenic, or chemically-modified amino acid, or an amino acid analog.
- the immunogenic peptide has the sequence of
- GLAEGPLCLDSLGQWNYTFA SEQ ID NO: 4
- the immunogenic peptide can be a chimeric peptide that contains the above-described
- the chimeric peptide can further contain an epitope of a non-TAL6 antigen or a helper T cell-stimulating epitope, or both.
- the chimeric peptide can also contain another epitope of TAL6 (e.g., another B cell epitope or a T cell epitope). Exemplary epitopes of TAL6 are described in U.S. Patent No. 8,465,756.
- peptide moieties that can be present in the chimeric peptide include one or more of an affinity tag (e.g., FLAG, poly-His, Myc, HA, CBP, HBH, or V5), a signal sequence (e.g., aleader sequence or a localization signal), a targeting peptide (for targeting the chimeric peptide to specific cells, cellular locations, or tissues), a ligand (e.g., a receptor ligand), and a therapeutic peptide.
- an affinity tag e.g., FLAG, poly-His, Myc, HA, CBP, HBH, or V5
- signal sequence e.g., aleader sequence or a localization signal
- targeting peptide for targeting the chimeric peptide to specific cells, cellular locations, or tissues
- ligand e.g., a receptor ligand
- the chimeric peptide contains the sequence of SEQ ID NO: 2, 3, or 4, and one or both of a cytotoxic T lymphocyte (CTL) epitope of TAL6 and a helper T cell (Th) epitope.
- CTL epitope can be LLMLLPAFV (SEQ ID NO: 5) or RFVWFFSGI (SEQ ID NO: 6).
- the Th epitope can be the PADRE peptide, e.g., AKFVAAWTLKAAA (SEQ ID NO: 7), or a peptide from tetanus toxoid, e.g., AQYIKANS KFIGITEL (SEQ ID NO: 8).
- One exemplary chimeric peptide has the sequence of
- AKFVAAWTLKAAAAAALLMLLPAFVAAAGLAEGPLCLDSLGQWNYTFA SEQ ID NO: 9.
- the epitopes in the chimeric peptides can be arranged in any order.
- a linker e.g., a flexible linker containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids, can link two adjacent peptide moieties in the chimeric peptide.
- a skilled practitioner would be able to design suitable linkers.
- Conventional methods e.g., chemical synthesis or recombinant technology, can be used to make the immunogenic peptide.
- the immunogenic peptide can also be conjugated to one or more non-peptide moieties to form an immunogenic peptide conjugate.
- non-peptide moieties include nucleic acid molecules, antibodies, proteins, carbohydrates, detectable labels (e.g., fluorescent, radioactive, or enzymatic labels), small molecule drugs, polymers (e.g., polyethylene glycol), solid supports (e.g., beads or nanoparticles), plant extract components, and microbial components.
- detectable labels e.g., fluorescent, radioactive, or enzymatic labels
- small molecule drugs e.g., polyethylene glycol
- solid supports e.g., beads or nanoparticles
- plant extract components e.g., microbial components.
- Other modifications such as modifications to side chains, amino acid substitutions, incorporation of unnatural amino acids and/or their derivatives during peptide synthesis can also be employed to, for example, increase the immunogenic peptide's stability and/or in vivo efficacy.
- immunogenic peptide includes a B cell epitope of TAL6, a cancer antigen
- it can be used for enhancing immune responses (e.g., antibody-dependent cellular cytotoxicity responses) against a TAL6-positive cancer, e.g., lung cancer, colon cancer, breast cancer, ovarian carcinoma, gastric cancer, Kaposi's sarcoma, hepatoma, pancreatic cancer, cervical cancer, endometrial cancer, head and neck cancer, ovarian cancer, or prostate cancer.
- a TAL6-positive cancer e.g., lung cancer, colon cancer, breast cancer, ovarian carcinoma, gastric cancer, Kaposi's sarcoma, hepatoma, pancreatic cancer, cervical cancer, endometrial cancer, head and neck cancer, ovarian cancer, or prostate cancer.
- the immunogenic peptide or an expression vector capable of expressing the immunogenic peptide can be mixed with a pharmaceutically acceptable carrier to form an immunogenic composition.
- the composition can be administered to a subject in need thereof to treat cancer or enhance immune responses.
- composition can be formulated with a pharmaceutically acceptable carrier such as a phosphate buffered saline, a bicarbonate solution, and/or an adjuvant.
- a pharmaceutically acceptable carrier such as a phosphate buffered saline, a bicarbonate solution, and/or an adjuvant.
- Suitable pharmaceutical carriers and diluents, as well as pharmaceutical necessities for their use, are known in the art.
- This composition may be prepared as an injectable, liquid solution, emulsion, or another suitable formulation.
- adjuvants include, but are not limited to, alum-precipitate, Freund's complete adjuvant, Freund's incomplete adjuvant, monophosphoryl-lipid A/trehalose dicorynomycolate adjuvant, water in oil emulsion containing Corynebacterium parvum and tRNA, and other substances that accomplish the task of increasing immune response by mimicking specific sets of evolutionarily conserved molecules including liposomes, lipopoly saccharide (LPS), molecular cages for antigen, components of bacterial cell walls, and endocytosed nucleic acids such as double-stranded RNA, single-stranded DNA, and unmethylated CpG dinucleotide-containing DNA.
- LPS lipopoly saccharide
- Other examples include cholera toxin, E. coli heat-labile enterotoxin, liposome, immune- stimulating complex (ISCOM),
- the composition can also include a polymer that facilitates in vivo delivery.
- the adjuvant is incomplete Freund's adjuvant (IFA), DOTAP or a DOTAP salt, PELC (an emulsion-type adjuvant containing a bioresorbable polymer, Span®85, and squalene), or unmethylated CpG-containing oligodeoxynucleotide (CpG), e.g., a toll-like receptor 9 (TLR9) agonist.
- IFA incomplete Freund's adjuvant
- DOTAP or a DOTAP salt
- PELC an emulsion-type adjuvant containing a bioresorbable polymer, Span®85, and squalene
- CpG unmethylated CpG-containing oligodeoxynucleotide
- TLR9 toll-like receptor 9
- TLR9 CpG agonists include, but are not limited to, 5'-tcgtcgttttgtcgttttgtcgttt-3 ' (SEQ ID NO: 10), 5 ' -ggGGGACG ATCGTCgggggg-3 ' (SEQ ID NO: 11), 5' - gggGACGACGTCGTGgggggg-3 ' (SEQ ID NO: 12), 5'-tcgcgacgttcgcccgacgttcggta-3 ' (SEQ ID NO: 13), 5'-tcgtcgttttcggcgcgcgcg-3' (SEQ ID NO: 14), 5' -tcgtcgttcgaacgacgttgat-3' (SEQ ID NO: 15), and 5'-tcgcgaacgttcgcgcgttegaacgcgg-3' (SEQ ID NO: 10
- an effective amount of the immunogenic composition may be administered parenterally, e.g., subcutaneous injection or intramuscular injection.
- binders and carriers may include, for example, polyalkalene glycols or triglycerides.
- Oral formulations may include normally employed incipients such as pharmaceutical grades of saccharine, cellulose, magnesium carbonate and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders.
- a B cell epitope of tumor-associated antigen L6 was identified that could induce antibody -dependent cellular cytotoxicity (ADCC) in vivo.
- the B cell epitope was combined with a cytotoxic T lymphocyte (CTL) and a helper T (Th) epitope to form a chimeric peptide.
- CTL cytotoxic T lymphocyte
- Th helper T
- the chimeric peptide was formulated with different adjuvants to immunize HLA-A2 transgenic mice and its immunogenicity was evaluated.
- the chimeric peptide formulated with an emulsion type nanoparticle (PELC) adjuvant and a toll-like receptor 9 agonist i.e., an unmethylated CpG-containing oligodeoxynucleotide (CpG)
- a toll-like receptor 9 agonist i.e., an unmethylated CpG-containing oligodeoxynucleotide (CpG)
- the induced anti-tumor immunity inhibited the growth of TAL6-positive cancer cells.
- immunization with the chimeric peptide inhibited cancer cell migration in vitro and metastasis in vivo.
- the EP1 peptide or MCF-7/L6 cells were formulated with IFA/Th and administered to C57BL/6 mice. Sera from immunized mice were collected and the anti- TAL6 antibody titers were analyzed using cell-based ELISA. The sera (1:500) of mice immunized with EP1 or MCF-7/L6 cells had significantly higher amount of antibody than mice immunized with vehicle (PBS). See Fig. 2, A. Whether EP1 immunization could induce antibody -dependent cellular cytotoxicity (ADCC) was also investigated.
- ADCC antibody -dependent cellular cytotoxicity
- mice immunized with either EP1 or MCF-7/L6 cells could kill TAL6-expressed EL4 (EL4/L6) cells but not EL4 parental cells (61.82% + 6.12% v.s. 0.36 % + 0.96% and 65.54 % ⁇ 1.77% v.s. 11.41 % ⁇ 3.094%).
- EL4/L6 TAL6-expressed EL4
- EL4 parental cells 61.82% + 6.12% v.s. 0.36 % + 0.96% and 65.54 % ⁇ 1.77% v.s. 11.41 % ⁇ 3.094%.
- the EPl peptide was formulated with different adjuvants. Mice were immunized with 50 mg of the formulations twice at a 14-day interval. At 7 days after the second immunization, 2 x 10 4 B16/TAL6 cells were injected subcutaneously to the mice. Tumor growth was monitored 2-3 times per week. EPl exhibited an anti-tumor effect. See Fig. 4, A. The survival rates are shown in Fig. 4, B. A chimeric peptide containing B and T cells epitopes induced greater anti-tumor activity than B or T cell epitopes alone
- EP1, and Th-A2-5-EPl were generated. See Table 1.
- the peptides were formulated with incomplete Fruend's adjuvant (IF A) and used to immunize HLA-A2 transgenic (Tg) mice. Seven days after the final immunization, mice were subcutaneously injected with 2xl0 4 B 16- L6-A2 cells. Tumor growth was monitored 2-3 times per week. Immunization with the chimeric Th-A2-5-EPl peptide strongly inhibited tumor growth. See Fig. 5. The induction of both humoral and cellular immunity using chimeric peptide may synergize the anti-tumor activity.
- Th AKFVAAWTLKAAA SEQ ID NO: 7
- Th-A2-5-EPl AKFVAAWTLKAAAAAALLMLLPAFVAAAGLAEGPLCLDSLGQWNYTFA
- Th-SCC AKFVAAWTLKAAASSCSSCPLSKI (SEQ ID NO: 22)
- Th-A2-5-EPl chimeric peptide can induce A2-5-specific T cell responses
- IFN- ⁇ ELISPOT and CTL activity assays were performed.
- Th-A2-5-EPl formulated with different adjuvants was administered to HLA-A2 transgenic mice twice at two weeks interval.
- Th-A2-5-EPl formulated with PELC/CpG induced higher numbers of spots (368.5 +40.42) than the peptide in other adjuvant formulations. See Fig. 6, A. A significant increase in the number of spots as compared to control mice were detected when Th-A2-5-EPl peptide was formulated with DOTAP (60.5 +7.85), CpG (107.2 + 23.89) or DOTAP/CpG (112.5 + 33.18) but not PELC (16.7 + 4.74) or IFA(18 + 9.75).
- Th-A2-5-EP formulated with PELC/CpG is capable of inducing strong A2-5-specific T cell responses.
- the number of CD107a + CD8 + T cells was analyzed. Splenocytes from the mice were stimulated with irradiated EL4-L6-A2 or EL4-L6 cells for 2 hours in the presence of anti-CD107a and anti-CD8 antibodies.
- Th-A2-5-EPl formulated with PELC/CpG induced higher numbers of CD107a + CD8 + T cells (6.69 ⁇ 0.49%) than did the other adjuvant formulations. See Fig. 6, B.
- Th-A2-5-EPl peptide formulated with PELC containing CpG induced the highest IgG antibody amount against EPl (O.D. 1.41 + 0.04).
- the PELC adjuvant induced higher antibody than the IFA adjuvant (O.D. 1.01 + 0.24 v.s. 0.622 + 0.183).
- Th-A2-5-EPl peptide formulated with DOTAP liposomes, DOTAP/CpG or CpG alone produced similar level of antibody (O.D. 0.454+0.025, 0.46 + 0.02 and 0.54 + 0.02, respectively).
- Th-A2-5-EPl peptide formulated with PELC alone did not induce significant numbers of ⁇ - ⁇ -secreting cells. See Fig, 6, B.
- EP1 peptide formulated with PELC/CpG induced the highest level of ADCC. See Fig. 6, D.
- the Th-A2-5-EPl peptide formulated in the PELC adjuvant induced the second highest ADCC activity.
- HLA-A2 transgenic mice were immunized with the formulations twice at a two-week interval. The mice were challenged with B16/L6/A2 cells (2 x 10 4 ) at 7 days after the second immunization. Tumor growth was monitored 2-3 times per week. Th-A2-5-EP peptide formulated with PELC/CpG significantly inhibited tumor growth as compared to the other formulations. See Fig. 7. Th-A2-5-EP peptide formulated with IFA, DOTAP, PELC, CpG or DOTAP/CpG displayed moderate anti-tumor activity. See Fig. 7. The data demonstrated that a chimeric peptide containing Th, Tc and B cells epitopes formulated with PELC/CpG could induce strong humoral and cellular immunity against cancer.
- Inhibition of cancer cell migration suggested that cancer cell metastasis might also be inhibited by immunization with a chimeric peptide.
- the anti-metastasis activity of the peptide was examined in a B16-L6 metastasis mouse model.
- the Th-A2-5-EPl peptide formulated with PELC, CpG, or PELC/CpG was used to immunize HLA-A2 transgenic mice twice at a two week interval. Seven days after the second immunization, B16-L6 cells (5xl0 5 ) were injected intravenously. At 22 days after cell inoculation, the mice were sacrificed and lung tissues were collected for analysis.
- Th-A2-5-EPl formulated with PELC, CpG, or PELC/CpG dramatically reduced tumor nodule formation in lungs (data not shown).
- Th-A2-5-EP1 peptide formulated with PELC/CpG could inhibit cancer cell lung metastasis.
- mice were immunized with Th-A2-5-EPl formulated with different adjuvants twice at a two- week interval. Sera was collected at 6 weeks for ADCC assay. Human lung cancer cell line H2981, as well as breast cancer cell lines MCF7 and MCF7-TAL6 were used as target cells. TAL6-specific ADCC was determined by Cr51 release assay. The lysis percentage was calculated by subtracting the lysis percentage of immunization serum from that of naive serum. As shown in Fig. 9, Th-A2-5-EPl formulated with PELC/CpG had the strongest cytotoxicity against the cancer cells. Antibody-binding region of EP1 was identified using alanine scanning
- Amino acid residues 1-20 in EP1 were individually replaced with alanine to generate EPl-1 to EP1-20 peptides.
- Monoclonal antibody L6 was used to detect these peptides.
- mice Female 6-week-old C57BL/6 mice were obtained from the National Laboratory Animal Center, Taiwan.
- the HLA-A2 transgenic mice were kindly provided by Dr. Show-Li Chen (National Taiwan University, Taiwan) and housed in the Laboratory Animal Center of the National Health Research Institutes, Taiwan. All animal experiments were performed in specific pathogen-free (SPF) conditions under protocols approved by the Animal Committee of the National Health Research Institutes (NHRI).
- SPF pathogen-free
- the B16F1 cells stably expressed TAL6 (B16-L6), and then were transfected with the HLA-A2 gene to generate a stable cell line B 16-L6-A2.
- the B16-L6-A2 and MCF-7-TAL6 cells were cultured in DMEM medium supplemented with 10% fetal bovine serum (FBS), 50 units/mL penicillin/streptomycin, 0.5 mM sodium pyruvate, 20 mM HEPES (Biological industries, Beit Haemek, Israel) at 37°C in 5% C0 2. See Tu et al., Journal of immunotherapy, 35 (2012) 235-244.
- the EL4-L6-A2 and EL4-L6 cells were cultured in RPMI-1640 medium supplemented with 10% FBS.
- Hybridoma producing anti-TAL6 antibody (L6) was obtained from the American Type Culture Collection. 1F4 and 9C7 anti-TAL6 monoclonal antibodies were generated from B ALB/c mice immunized with human TAL6 plasmid DNA as described. Monoclonal antibodies were purified by Protein A affinity chromatography using high salt conditions as described. See Chang et al., Int J Cancer, 116 (2005) 243-252.
- Antibody concentrations were determined by Micro BCA protein Assay Kit
- L6, 9C7 and 1F4 Mabs were assayed by ELISA.
- antisera were collected from the mice immunized with EPl peptide, and the titers of the specific antibodies were assayed by ELISA.
- the 96 well assay plates were coated with peptide (1 ⁇ g/ml) or cell (2xl0 6 ). After blocking with 5% BSA-PBS, the antisera (1:1000 v/v) were diluted with 5% BSA-PBS and added to the plate for 1 hour.
- HRP-conjugated goat anti-mouse IgG (1:4000 v/v) was used to detect EPl antibody titer.
- the TMB peroxidase EIA substrate was added, which was stopped with IN H2SO4. Absorbance was measured at 450 nm. Animal study
- HLA-A2 Tg mice were injected subcutaneously (s.c.) twice at a 2-week interval with peptide formulated in IFA, alum, DOTAP liposome, PELC nanoparticles, or TLR9 agonist CpG.
- ADCC Antibody dependent cell-mediated cytotoxicity
- mice spleen cells were used as effector cells for the ADCC assay. Spleen cells were adj sted to a concentration of 8 xlO 6 cells/ml in LCM medium. Cells were added in tubes and then divided into aliquots (100 ul/ well in 96-well plates). EL4-L6 or EL-4 target cells (2 xl0 7 /ml) were labeled with 100 ⁇ of 51 C (Na 2 51 Cr04, PerkinElmer, MA) at 37°C for 1 nr.
- 51 C Na 2 51 Cr04, PerkinElmer, MA
- the 51 Cr-labelled EL4-L6 or EL4 cells were adjusted to a concentration of 2 x 10 5 cells / ml in LCM medium and then TAL6 antiserum or naive mouse serum (1:10) was added. After 6 hr, supernatants were harvested to measure the radioactivity using a gamma counter.
- Spleen cells (5xl0 5 ) were mixed with 10 ⁇ / ⁇ of the indicated peptide and added to a 96-well PVDF-membrane plate coated with anti-IFN-y antibody. The plates were then incubated in a humidified atmosphere of 5% CO 2 in air at 37°C for 48 hours. After incubation, cells were removed by washing the plates 6 times with 0.05% (w/v) tween 20 in PBS. A 50 ⁇ aliquot of biotinylated secondary anti-IFN-j' antibody (clone R46A2;
- HLA-A2 Tg mice were injected s.c. twice with the indicated peptides (50 ⁇ ml) emulsified in IFA, DOTAP or PELC in the absence or presence of CpG ODN (10 ⁇ mouse).
- splenocytes were harvested and then resuspended to 2xl0 7 cell/ml in medium that contained 10 ug/ml of the indicated peptides (50 ⁇ g/ml) or cells (2xl0 6 cell/ml) and PE-conjugated anti-mouse CD107a antibody (1 :100) in 96-well round- bottom plates.
- brefeldin A 10 ⁇ g/ml
- monensin (0.66 ⁇ g/ml) were added for another 2-6 hours.
- the plates were washed with PBS containing 0.1% FBS, and anti-mouse Fc antibody (1:100) was added for 5 minutes, followed by addition of the FITC-conjugated anti-mouse CD8 antibody (1: 100) for 30 minutes.
- the cytotoxic factor 10 ⁇ g/ml
- monensin 0.66 ⁇ g/ml
- CD107a + CD8 + cells were analyzed on a fluorescence-activated cell sorter (FACS calibur, BD Bioscience).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Organic Chemistry (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Mycology (AREA)
- General Chemical & Material Sciences (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Toxicology (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Zoology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Described herein are an immunogenic peptide containing the sequence of CLDSLGQWN (SEQ ID NO:2) and a method of using the peptide for treating cancer.
Description
IMMUNOGENIC PEPTIDE CONTAINING A B CELL EPITOPE OF TUMOR
ASSOCIATED ANTIGEN L6
BACKGROUND
Tumor associated antigen L6 (TAL6) is a cell surface protein of the transmembrane-4 superfamily (TM4SF), also known as TM4SF1. TM4SF proteins are over-expressed in different types of human cancers including lung, breast, colon, prostate and liver cancer. TM4SF1-, TM4SF4- and TM4SF5-specific monoclonal antibodies can inhibit colon cancer growth, indicating that TM4SF proteins are crucial targets for cancer therapy. TAL6 is over- expressed in more than 80 % of human lung, breast, colon and ovarian tumors but not normal tissues. Recently, TAL6 was found to play critical roles in cancer cell motility, invasion, metastasis and angiogenesis. It was previously demonstrated that an HLA-A2-restricted CTL epitope, A2-5, of TAL6 is capable of inducing CTL responses against cancer cells that express TAL6. In addition, the induced-CTL responses can be adoptively transferred to inhibit human lung cancer growth in immunocompromised mice.
SUMMARY
In one aspect, described herein in an immunogenic peptide that contains the sequence of CLDSLGQWN (SEQ ID NO: 2), wherein the peptide has 100 or fewer amino. In one embodiment, the peptide has the sequence of X1X2 3X4X5X6X7CLDSLGQWNX8 9X10 11 (SEQ ID NO: 3), wherein Xi to Xn, individually, is an amino acid (e.g., one of the 20 standard amino acids). For example, the peptide can include the sequence of
GLAEGPLCLDSLGQWNYTFA (SEQ ID NO: 4). In one embodiment, the peptide further includes a cytotoxic T lymphocyte (CTL) epitope of TAL6 or a helper T cell (Th) epitope. In yet another embodiment, the peptide includes the sequence of
AKFVAAWTLKAAAAAALLMLLPAFVAAAGLAEGPLCLDSLGQWNYTFA (SEQ ID NO: 9).
In another aspect, this disclosure includes a nucleic acid molecule containing a sequence that encodes the immunogenic peptide described herein.
In yet another aspect, described herein is an immunogenic composition containing the immunogenic peptide. The immunogenic composition can further include an adjuvant. The adjuvant can be selected from the group consisting of incomplete Freund's adjuvant (IF A),
DOTAP, PELC, and unmethylated CpG-containing oligodeoxynucleotides (CpG). In one embodiment, the CpG is a Toll-like receptor 9 (TL 9) agonist. In one embodiment, the immunogenic composition includes both PELC and the CpG.
In one aspect, a method of treating a cancer in a subject in need thereof is described herein. The method includes administering to the subject the immunogenic composition described herein.
The details of one or more embodiments are set forth in the accompanying drawing and the description below. Other features, objects, and advantages of the embodiments will be apparent from the description and drawing, and from the claims.
BRIEF DESCRIPTION OF DRAWINGS FIG. 1 includes (A) a scheme showing the overlapping peptides that cover the extracellular domains of TAL6: ELI (residues 31 to 46 of SEQ ID NO: 1); EL2 (residues 114 to 164 of SEQ ID NO: 1); EP1 (SEQ ID NO: 4); EP2 (SEQ ID NO: 17); EP3 (SEQ ID NO: 18); and EP4 (SEQ ID NO: 19); and (B) a graph showing binding of the peptides to anti-
TAL6 antibodies. A 96-well plate was coated with the indicated peptides (10 pg/ml) in each well. Three anti-TAL6 antibodies (1: 500) were used to detect these peptides. CP: Control peptide.
FIG. 2 is a set of graphs showing that immunization of WT mice with the EP1 peptide induced anti-tumor immunity. EP1 or positive control MCF-7/TAL6 cells formulated with incomplete Freund's adjuvant (IF A) were administered to mice twice at a two-week interval. (A) Anti-TAL6 antibody titers were determined by using cell-based ELISA. Antigen- specific antibody was calculated as: EL4-L6 (O.D.) - EL4 (O.D.). (B) TAL6-specific ADCC was determined in a Cr51 release assay. The lysis percentage was calculated as: immunized serum (lysis %) - naive serum (lysis%). ***P< 0.001.
FIG. 3 is a set of graphs showing that immunization of WT mice with the EP1 peptide induced anti-tumor immunity. EP1 or positive control MCF-7/TAL6 cells formulated with incomplete Freund's adjuvant (IF A) were administered to mice twice at a two-week interval. (A) At 7 days after the final immunization, B16-L6 (2xl04) cells were inoculated subcutaneously. Tumor growth was monitored 2-3 times per week. (B) The survival rate of the mice was determined.
FIG. 4 is a set of graphs showing that EP1 formulated with PELC/CpG induced antitumor effects. Mice were immunized with 50 mg of EP1 formulated with the indicated adjuvants twice at a 14-day interval. (A) At 7 days after the second immunization, 2xl04of B 16/TAL6 cells were injected subcutaneously. Tumor growth was monitored 2-3 times per week. Results obtained are expressed as mean SD (n=6). (B) Mouse survival rate was monitored. Results are expressed as means ± SD (*P<0.05.**P<0.01).
FIG. 5 is a set of graphs showing that the combination of T and B cell epitopes induced anti-tumor activity in HLA-A2 mice. Peptides (50 μg per mouse) formulated with incomplete Fruend's adjuvant (IF A) were used to immunize HLA-A2 mice twice at a two- week interval. At 7 days after the final immunization, B16/L6/A2 cells (2xl04) were injected subcutaneously. Tumor size was monitored 2-3 times per week. Tumor volume= length x width x width/2. Each line in each graph corresponds to one animal (n=5-6).
FIG. 6 is a set of graphs showing that immunization with PELC/CpG/Th-A2-5-EPl induced high levels of humoral and cellular immunity in HLA-A2 mice. The Th-A2-5-EPl peptide was formulated with different adjuvants. HLA-A2 transgenic mice were immunized with the different formulations twice at a 2- week interval. (A) IFN-γ- secreting cells were determined using IFN-γ ELISpot assay. Results are expressed as mean SD. ***P< 0.001. (B) Irradiated EL4-TAL6-A2 or EL4-TAL6 cells (2xl04) were used to stimulate splenocytes for 2 hr in the presence of anti-CD107a and anti-CD8 antibodies. ***P< 0.001. (C) Ten mg/ml of the EP1 peptide was coated on a 96- well ELISA plate and anti-sera from immunized mice (1:500) were added. *P< 0.05. ***P< 0.001. (D) TAL6-specific ADCC was determined by Cr51 release assay. The lysis percentage was calculated as: immunized serum (lysis %) - nai've serum (lysis ) ***P< 0.001.
FIG. 7 is a graph showing that immunization with Th-A2-5-EPl induced anti-tumor activity in HLA-A2 transgenic mouse. HLA-A2 transgenic mice were immunized with the Th-A2-5-EPl peptide formulated in different adjuvants twice at a two-week interval. At 7 days after the final immunization, 2 x 104 of B 16/TAL6/HLA-A2 cells were injected subcutaneously. Each group contained 6 mice. Tumor growth was monitored 2-3 times per week. Results are expressed as mean SD.
FIG. 8 is a graph showing that sera from immunized mice inhibited cancer cell migration. B16-L6 cells were cultured in a 24-well plate that contained one Culture- Insert (500 μηι) in each well. After 24 h, the Culture-Inserts were removed and 100 ml of medium
with or without antisera (1: 100, v/v) from immunized mice was added. Images were acquired at 0, 24 and 48 h in vitro. L6 mAb (10 mg/ml) was used as a positive control. Cell migration into the defined cell free gap was observed at the indicated times under a microscope. Data are shown as mean + SD (n=5). Migration (%) = gap area at 48 hr /gap at 0 hr x 100%. ***P< 0.001.
FIG. 9 is a set of graphs showing that peptide formulated with different adjuvants induced antibody-dependent cellular cytotoxicity (ADCC) against human cancer cells. Mice were immunized with peptide Th-EPl-A2-5 in various adjuvants twice at a two-week interval. Sera were collected at 6 weeks for ADCC assay. (A) Lung cancer cell line H2981 was used as a target. (B) Human breast cancer cell lines MCF7 and MCF7-TAL6 were used as targets. TAL6-specific ADCC was determined by Cr51 release assay. The lysis percentage was calculated as: immunized serum (lysis %) - naive serum (lysis%) ***p< 0.001.
FIG. 10 is a graph showing identification of residues in EP1 that are important for antibody binding using alanine scanning. The amino acid residues in EP1 were individually replaced with alanine to generate EPl-1 to EP1-20 peptides. Monoclonal antibody L6 was used to detect these peptides. EP1 is a positive control and EP-3 is a negative control.
DETAILED DESCRIPTION
It was unexpectedly discovered that TAL6 contains a B cell epitope that can induce antibody-dependent cellular cytotoxicity (ADCC) and anti-tumor effects in vivo.
Shown below is an amino acid sequence of TAL6 (SEQ ID NO: 1):
MCYGKCARCI GHSLVGLALL CIAANILLYF PNGETKYASE NHLSRFVWFF
SGIVGGGLLM LLPAFVFIGL EQDDCCGCCG HENCGKRCAM LSSVLAALIG
IAGSGYCVIV AALGLAEGPL CLDSLGQWNY TFASTEGQYL LDTSTWSECT EPKHIVEWNV SLFSILLALG GIEFILCLIQ VINGVLGGIC GFCCSHQQQY DC
TAL6 contains two extracellular loops, i.e., ELI (a. a. 31 - a.a. 46 of SEQ ID NO: 1) and EL2 (a.a. 114 - a.a. 164 of SEQ ID NO: 1). A B cell epitope is located within EL2.
Accordingly, described herein is an immunogenic peptide that includes the epitope, which contains the sequence of CLDSLGQWN (SEQ ID NO: 2). The immunogenic peptide can have 100 or fewer amino acids (e.g., 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids).
The peptide can have the sequence of X 1 2X3X4X5 6X7CLDSLGQWNX8 9X io 11 (SEQ ID NO: 3), in which Xi to Xn, individually, is an amino acid. The term "amino acid" refers to any of the 20 standard amino acids (i.e., alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, praline, serine, threonine, tryptophan, tyrosine, and valine). The term can also refer to a non-standard, non-pro teinogenic, or chemically-modified amino acid, or an amino acid analog.
In one embodiment, the immunogenic peptide has the sequence of
GLAEGPLCLDSLGQWNYTFA (SEQ ID NO: 4).
The immunogenic peptide can be a chimeric peptide that contains the above-described
B cell epitope of TAL6 and one or more other peptide moieties. For example, the chimeric peptide can further contain an epitope of a non-TAL6 antigen or a helper T cell-stimulating epitope, or both. The chimeric peptide can also contain another epitope of TAL6 (e.g., another B cell epitope or a T cell epitope). Exemplary epitopes of TAL6 are described in U.S. Patent No. 8,465,756.
Other peptide moieties that can be present in the chimeric peptide include one or more of an affinity tag (e.g., FLAG, poly-His, Myc, HA, CBP, HBH, or V5), a signal sequence (e.g., aleader sequence or a localization signal), a targeting peptide (for targeting the chimeric peptide to specific cells, cellular locations, or tissues), a ligand (e.g., a receptor ligand), and a therapeutic peptide.
In one embodiment, the chimeric peptide contains the sequence of SEQ ID NO: 2, 3, or 4, and one or both of a cytotoxic T lymphocyte (CTL) epitope of TAL6 and a helper T cell (Th) epitope. The CTL epitope can be LLMLLPAFV (SEQ ID NO: 5) or RFVWFFSGI (SEQ ID NO: 6). The Th epitope can be the PADRE peptide, e.g., AKFVAAWTLKAAA (SEQ ID NO: 7), or a peptide from tetanus toxoid, e.g., AQYIKANS KFIGITEL (SEQ ID NO: 8). One exemplary chimeric peptide has the sequence of
AKFVAAWTLKAAAAAALLMLLPAFVAAAGLAEGPLCLDSLGQWNYTFA (SEQ ID NO: 9). The epitopes in the chimeric peptides can be arranged in any order.
A linker, e.g., a flexible linker containing 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids, can link two adjacent peptide moieties in the chimeric peptide. A skilled practitioner would be able to design suitable linkers.
Conventional methods, e.g., chemical synthesis or recombinant technology, can be used to make the immunogenic peptide.
The immunogenic peptide can also be conjugated to one or more non-peptide moieties to form an immunogenic peptide conjugate. Such non-peptide moieties include nucleic acid molecules, antibodies, proteins, carbohydrates, detectable labels (e.g., fluorescent, radioactive, or enzymatic labels), small molecule drugs, polymers (e.g., polyethylene glycol), solid supports (e.g., beads or nanoparticles), plant extract components, and microbial components. Other modifications such as modifications to side chains, amino acid substitutions, incorporation of unnatural amino acids and/or their derivatives during peptide synthesis can also be employed to, for example, increase the immunogenic peptide's stability and/or in vivo efficacy.
As the above-described immunogenic peptide includes a B cell epitope of TAL6, a cancer antigen, it can be used for enhancing immune responses (e.g., antibody-dependent cellular cytotoxicity responses) against a TAL6-positive cancer, e.g., lung cancer, colon cancer, breast cancer, ovarian carcinoma, gastric cancer, Kaposi's sarcoma, hepatoma, pancreatic cancer, cervical cancer, endometrial cancer, head and neck cancer, ovarian cancer, or prostate cancer.
The immunogenic peptide or an expression vector capable of expressing the immunogenic peptide can be mixed with a pharmaceutically acceptable carrier to form an immunogenic composition. The composition can be administered to a subject in need thereof to treat cancer or enhance immune responses.
The composition can be formulated with a pharmaceutically acceptable carrier such as a phosphate buffered saline, a bicarbonate solution, and/or an adjuvant. Suitable pharmaceutical carriers and diluents, as well as pharmaceutical necessities for their use, are known in the art. This composition may be prepared as an injectable, liquid solution, emulsion, or another suitable formulation.
Examples of adjuvants include, but are not limited to, alum-precipitate, Freund's complete adjuvant, Freund's incomplete adjuvant, monophosphoryl-lipid A/trehalose dicorynomycolate adjuvant, water in oil emulsion containing Corynebacterium parvum and tRNA, and other substances that accomplish the task of increasing immune response by mimicking specific sets of evolutionarily conserved molecules including liposomes, lipopoly saccharide (LPS), molecular cages for antigen, components of bacterial cell walls,
and endocytosed nucleic acids such as double-stranded RNA, single-stranded DNA, and unmethylated CpG dinucleotide-containing DNA. Other examples include cholera toxin, E. coli heat-labile enterotoxin, liposome, immune- stimulating complex (ISCOM),
immunostimulatory sequences oligodeoxynucleotide, and aluminum hydroxide. The composition can also include a polymer that facilitates in vivo delivery.
In one embodiment, the adjuvant is incomplete Freund's adjuvant (IFA), DOTAP or a DOTAP salt, PELC (an emulsion-type adjuvant containing a bioresorbable polymer, Span®85, and squalene), or unmethylated CpG-containing oligodeoxynucleotide (CpG), e.g., a toll-like receptor 9 (TLR9) agonist. A combination of one or more adjuvants can be included in the immunogenic composition.
TLR9 CpG agonists include, but are not limited to, 5'-tcgtcgttttgtcgttttgtcgtt-3 ' (SEQ ID NO: 10), 5 ' -ggGGGACG ATCGTCgggggg-3 ' (SEQ ID NO: 11), 5' - gggGACGACGTCGTGgggggg-3 ' (SEQ ID NO: 12), 5'-tcgcgacgttcgcccgacgttcggta-3 ' (SEQ ID NO: 13), 5'-tcgtcgttttcggcgcgcgccg-3' (SEQ ID NO: 14), 5' -tcgtcgtcgttcgaacgacgttgat-3' (SEQ ID NO: 15), and 5'-tcgcgaacgttcgccgcgttegaacgcgg-3' (SEQ ID NO: 16). Bases in upper case letters are phosphodiesters. Bases in lower case letters are phosphorothioates.
An effective amount of the immunogenic composition may be administered parenterally, e.g., subcutaneous injection or intramuscular injection. Alternatively, other modes of administration including suppositories and oral formulations may be desirable. For suppositories, binders and carriers may include, for example, polyalkalene glycols or triglycerides. Oral formulations may include normally employed incipients such as pharmaceutical grades of saccharine, cellulose, magnesium carbonate and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders.
The specific example below is to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. Without further elaboration, it is believed that one skilled in the art can, based on the description herein, utilize the present disclosure to its fullest extent. All publications cited herein are herein incorporated by reference in their entirety.
Example: Antigenic peptides for cancer therapy
A B cell epitope of tumor-associated antigen L6 (TAL6) was identified that could induce antibody -dependent cellular cytotoxicity (ADCC) in vivo. The B cell epitope was combined with a cytotoxic T lymphocyte (CTL) and a helper T (Th) epitope to form a chimeric peptide. The chimeric peptide was formulated with different adjuvants to immunize HLA-A2 transgenic mice and its immunogenicity was evaluated. The chimeric peptide formulated with an emulsion type nanoparticle (PELC) adjuvant and a toll-like receptor 9 agonist (i.e., an unmethylated CpG-containing oligodeoxynucleotide (CpG)) induced the greatest ADCC and CTL responses. The induced anti-tumor immunity inhibited the growth of TAL6-positive cancer cells. Moreover, immunization with the chimeric peptide inhibited cancer cell migration in vitro and metastasis in vivo. These data suggest that a chimeric peptide containing both B and T cell epitopes of TAL6 formulated with PELC/CpG adjuvant can be used for cancer immunotherapy.
Identification of B cell epitopes of TAL6
Three purified anti-TAL6 monoclonal antibodies (1F4, 9C7, L6) were used to detect the surface expression TAL6 on EL-4 (EL-4/L6) cells. See Chang et al., Int J Cancer, 116 (2005) 243-252. Serial diluted monoclonal antibodies bound EL-4/L6 cells but not negative control EL-4 cells (data not shown), confirming that these three monoclonal antibodies recognize an extracellular domain of TAL6. To further map the antibody-binding epitopes, five peptides (ELI and EP1-4) that cover the ELI and EL2 extracellular loops were used to determine the linear B cell epitopes using ELISA. See Fig. 1, A. Monoclonal antibody 1F4 and 9C7 did not recognize these peptides. By contrast, the EP1 peptide could be detected by L6 mAb. See Fig. 1, B
To test whether the EP1 peptide could raise antibodies that bind native TAL6, the EP1 peptide or MCF-7/L6 cells (as positive control) were formulated with IFA/Th and administered to C57BL/6 mice. Sera from immunized mice were collected and the anti- TAL6 antibody titers were analyzed using cell-based ELISA. The sera (1:500) of mice immunized with EP1 or MCF-7/L6 cells had significantly higher amount of antibody than mice immunized with vehicle (PBS). See Fig. 2, A. Whether EP1 immunization could induce antibody -dependent cellular cytotoxicity (ADCC) was also investigated. Sera (1 :100) from mice immunized with either EP1 or MCF-7/L6 cells could kill TAL6-expressed EL4
(EL4/L6) cells but not EL4 parental cells (61.82% + 6.12% v.s. 0.36 % + 0.96% and 65.54 % ± 1.77% v.s. 11.41 % ± 3.094%). See Fig. 2, B. To investigate if the EPl peptide could induce an ti- tumor activity, mice were immunized with EPl peptide and then challenged with B16-L6 cells (2 x 104/mouse) at 7 days after the final immunization.
Immunization of mice with either EPl or MCF-7/L6 cells significantly inhibited tumor growth. See Fig. 3, A. The survival rates of mice are shown in Fig. 3, B. The data demonstrate that the EPl peptide is a linear B cell epitope of TAL6 that has antitumor activity against cancer cells that express TAL6.
The EPl peptide induced anti-tumor effect in mice model
The EPl peptide was formulated with different adjuvants. Mice were immunized with 50 mg of the formulations twice at a 14-day interval. At 7 days after the second immunization, 2 x 104 B16/TAL6 cells were injected subcutaneously to the mice. Tumor growth was monitored 2-3 times per week. EPl exhibited an anti-tumor effect. See Fig. 4, A. The survival rates are shown in Fig. 4, B. A chimeric peptide containing B and T cells epitopes induced greater anti-tumor activity than B or T cell epitopes alone
To investigate whether incorporation of a cytotoxic T cells (Tc) epitope can enhance the anti-tumor effects of B-cell epitope-based approaches, synthetic peptides Th-A2-5, Th-
EP1, and Th-A2-5-EPl were generated. See Table 1. The peptides were formulated with incomplete Fruend's adjuvant (IF A) and used to immunize HLA-A2 transgenic (Tg) mice. Seven days after the final immunization, mice were subcutaneously injected with 2xl04 B 16- L6-A2 cells. Tumor growth was monitored 2-3 times per week. Immunization with the chimeric Th-A2-5-EPl peptide strongly inhibited tumor growth. See Fig. 5. The induction of both humoral and cellular immunity using chimeric peptide may synergize the anti-tumor activity.
Table 1. Synthetic peptides
Name Sequence
A2-5 LLMLLPAFV (SEQ ID NO:5)
EP1 GLAEGPLCLDSLGQWNYTFA (SEQ ID N0:4)
Th AKFVAAWTLKAAA (SEQ ID NO: 7)
Th-A2-5 AKFVAAWTLKAAAAAALLMLLPAFV (SEQ ID NO: 20)
Th-EPl AKFVAAWTLKAAAAAAGLAEGPLCLDSLGQWNYTFA (SEQ ID NO: 21)
Th-A2-5-EPl AKFVAAWTLKAAAAAALLMLLPAFVAAAGLAEGPLCLDSLGQWNYTFA
(SEQ ID NO: 9)
Th-SCC AKFVAAWTLKAAASSCSSCPLSKI (SEQ ID NO: 22)
Chimeric peptide formulated with PELC/CpG induced strong humoral and cellular anti-tumor immunity
To investigate whether the Th-A2-5-EPl chimeric peptide can induce A2-5-specific T cell responses, IFN-γ ELISPOT and CTL activity assays were performed. Th-A2-5-EPl formulated with different adjuvants was administered to HLA-A2 transgenic mice twice at two weeks interval.
IFN-y-secreting cells from the mice were determined using the IFN-γ ELISPOT assay. Th-A2-5-EPl formulated with PELC/CpG induced higher numbers of spots (368.5 +40.42) than the peptide in other adjuvant formulations. See Fig. 6, A. A significant increase in the number of spots as compared to control mice were detected when Th-A2-5-EPl peptide was formulated with DOTAP (60.5 +7.85), CpG (107.2 + 23.89) or DOTAP/CpG (112.5 + 33.18) but not PELC (16.7 + 4.74) or IFA(18 + 9.75). We conclude that Th-A2-5-EP formulated with PELC/CpG is capable of inducing strong A2-5-specific T cell responses.
To further determine if the PELC/CpG formulation can induce cytotoxic activity, the number of CD107a+CD8+ T cells was analyzed. Splenocytes from the mice were stimulated with irradiated EL4-L6-A2 or EL4-L6 cells for 2 hours in the presence of anti-CD107a and anti-CD8 antibodies. Th-A2-5-EPl formulated with PELC/CpG induced higher numbers of CD107a+CD8+ T cells (6.69 ± 0.49%) than did the other adjuvant formulations. See Fig. 6, B. These results demonstrated that Th-A2-5-EPl formulated with PELC/CpG could induce strong and specific CTL responses.
Anti-sera from the mice were tested against EPl -coated 96-well ELISA plate. The Th-A2-5-EPl peptide formulated with PELC containing CpG induced the highest IgG antibody amount against EPl (O.D. 1.41 + 0.04). See Fig. 6, C. The PELC adjuvant induced higher antibody than the IFA adjuvant (O.D. 1.01 + 0.24 v.s. 0.622 + 0.183). See Fig. 6, C. Th-A2-5-EPl peptide formulated with DOTAP liposomes, DOTAP/CpG or CpG alone produced similar level of antibody (O.D. 0.454+0.025, 0.46 + 0.02 and 0.54 + 0.02, respectively). See Fig. 6, C. In contrast to the antibody titer data, Th-A2-5-EPl peptide formulated with PELC alone did not induce significant numbers of ΓΕΝ- γ -secreting cells. See Fig, 6, B.
Sera from the immunized mice were used to evaluate ADCC activity. The Th-A2-5-
EP1 peptide formulated with PELC/CpG induced the highest level of ADCC. See Fig. 6, D. The Th-A2-5-EPl peptide formulated in the PELC adjuvant induced the second highest ADCC activity. These results correlated with the antibody titer data.
To evaluate the anti-tumor effects of Th-A2-5-EP in different adjuvant formulations, HLA-A2 transgenic mice were immunized with the formulations twice at a two-week interval. The mice were challenged with B16/L6/A2 cells (2 x 104) at 7 days after the second immunization. Tumor growth was monitored 2-3 times per week. Th-A2-5-EP peptide formulated with PELC/CpG significantly inhibited tumor growth as compared to the other formulations. See Fig. 7. Th-A2-5-EP peptide formulated with IFA, DOTAP, PELC, CpG or DOTAP/CpG displayed moderate anti-tumor activity. See Fig. 7. The data demonstrated that a chimeric peptide containing Th, Tc and B cells epitopes formulated with PELC/CpG could induce strong humoral and cellular immunity against cancer.
Chimeric peptide Th-A2-5-EPl formulated with PELC/CpG inhibited tumor migration and metastasis
Whether sera from Th-A2-5-EPl immunized mice could inhibit cancer cell migration was examined. A chambers wound assay was performed to evaluate the inhibition of cell migration. B 16-L6 cell were cultured in 24-well plate with a Culturelnsert (500 μηι) for 24 hours. The Culture-Insert was then removed and 100 μΐ of medium, sera (1 : 100, v/v), or a positive control (L6 mAb) were added. Images acquired at 0, 24 and 48 hours showed inhibition of cancer cell migration after treatment with either L6 or serum from mice immunized with Th-A2-5-EPl and PELC/CpG (data not shown). Quantification of the cell-
free gap in three independent experiments revealed that sera from mice immunized with Th- A2-5-EP1 formulated with CpG alone (72.97 % ± 5.97) or PELC/CpG (43.04 % ± 15.47) significantly inhibited B16-L6 cell migration. See Fig. 8. Migration inhibition was not due to differences in cell proliferation (data not shown).
Inhibition of cancer cell migration suggested that cancer cell metastasis might also be inhibited by immunization with a chimeric peptide. The anti-metastasis activity of the peptide was examined in a B16-L6 metastasis mouse model. The Th-A2-5-EPl peptide formulated with PELC, CpG, or PELC/CpG was used to immunize HLA-A2 transgenic mice twice at a two week interval. Seven days after the second immunization, B16-L6 cells (5xl05) were injected intravenously. At 22 days after cell inoculation, the mice were sacrificed and lung tissues were collected for analysis. Th-A2-5-EPl formulated with PELC, CpG, or PELC/CpG dramatically reduced tumor nodule formation in lungs (data not shown).
Interestingly, almost no tumor nodules were observed in mice immunized with the Th-A2-5- EP1 peptide formulated with PELC/CpG. The data demonstrated that Th-A2-5-EPl formulated with PELC/CpG could inhibit cancer cell lung metastasis.
Chimeric peptide Th-A2-5-EPl formulated with PELC/CpG induced antibody-mediated cellular cytotoxicity against human cancer cells
Mice were immunized with Th-A2-5-EPl formulated with different adjuvants twice at a two- week interval. Sera was collected at 6 weeks for ADCC assay. Human lung cancer cell line H2981, as well as breast cancer cell lines MCF7 and MCF7-TAL6 were used as target cells. TAL6-specific ADCC was determined by Cr51 release assay. The lysis percentage was calculated by subtracting the lysis percentage of immunization serum from that of naive serum. As shown in Fig. 9, Th-A2-5-EPl formulated with PELC/CpG had the strongest cytotoxicity against the cancer cells. Antibody-binding region of EP1 was identified using alanine scanning
Amino acid residues 1-20 in EP1 were individually replaced with alanine to generate EPl-1 to EP1-20 peptides. Monoclonal antibody L6 was used to detect these peptides.
Certain residues, when replaced with alanine, reduced antibody binding. See Fig. 10. The data showed that these residues are important for antibody binding.
Animals and cell lines
Female 6-week-old C57BL/6 mice were obtained from the National Laboratory Animal Center, Taiwan. The HLA-A2 transgenic mice were kindly provided by Dr. Show-Li Chen (National Taiwan University, Taiwan) and housed in the Laboratory Animal Center of the National Health Research Institutes, Taiwan. All animal experiments were performed in specific pathogen-free (SPF) conditions under protocols approved by the Animal Committee of the National Health Research Institutes (NHRI).
The B16F1 cells stably expressed TAL6 (B16-L6), and then were transfected with the HLA-A2 gene to generate a stable cell line B 16-L6-A2. The B16-L6-A2 and MCF-7-TAL6 cells were cultured in DMEM medium supplemented with 10% fetal bovine serum (FBS), 50 units/mL penicillin/streptomycin, 0.5 mM sodium pyruvate, 20 mM HEPES (Biological industries, Beit Haemek, Israel) at 37°C in 5% C02. See Tu et al., Journal of immunotherapy, 35 (2012) 235-244. The EL4-L6-A2 and EL4-L6 cells were cultured in RPMI-1640 medium supplemented with 10% FBS. Preparation of monoclonal antibodies
Hybridoma producing anti-TAL6 antibody (L6) was obtained from the American Type Culture Collection. 1F4 and 9C7 anti-TAL6 monoclonal antibodies were generated from B ALB/c mice immunized with human TAL6 plasmid DNA as described. Monoclonal antibodies were purified by Protein A affinity chromatography using high salt conditions as described. See Chang et al., Int J Cancer, 116 (2005) 243-252.
Antibody concentrations were determined by Micro BCA protein Assay Kit
(PIERCE).
ELISA
For antibody epitope mapping, L6, 9C7 and 1F4 Mabs were assayed by ELISA. For assaying EPl titers of the specific antibodies, antisera were collected from the mice immunized with EPl peptide, and the titers of the specific antibodies were assayed by ELISA. The 96 well assay plates were coated with peptide (1 μg/ml) or cell (2xl06). After blocking with 5% BSA-PBS, the antisera (1:1000 v/v) were diluted with 5% BSA-PBS and added to the plate for 1 hour. HRP-conjugated goat anti-mouse IgG (1:4000 v/v) was used to detect EPl antibody titer. The TMB peroxidase EIA substrate was added, which was stopped with IN H2SO4. Absorbance was measured at 450 nm.
Animal study
HLA-A2 Tg mice were injected subcutaneously (s.c.) twice at a 2-week interval with peptide formulated in IFA, alum, DOTAP liposome, PELC nanoparticles, or TLR9 agonist CpG. Seven days after the second immunization, the B16-L6-A2 or B16-L6 cells (2xl04) were inoculated s.c. on the opposite site of the peptide injection. Tumor sizes were measure 2-3 times per week. Tumor volume was calculated using the formula: tumor volume=length x width x width/2.
Antibody dependent cell-mediated cytotoxicity (ADCC)
Mice spleen cells were used as effector cells for the ADCC assay. Spleen cells were adj sted to a concentration of 8 xlO6 cells/ml in LCM medium. Cells were added in tubes and then divided into aliquots (100 ul/ well in 96-well plates). EL4-L6 or EL-4 target cells (2 xl07/ml) were labeled with 100 μθί of 51C (Na2 51Cr04, PerkinElmer, MA) at 37°C for 1 nr. The 51Cr-labelled EL4-L6 or EL4 cells were adjusted to a concentration of 2 x 105 cells / ml in LCM medium and then TAL6 antiserum or naive mouse serum (1:10) was added. After 6 hr, supernatants were harvested to measure the radioactivity using a gamma counter.
Spontaneous release was measured in wells containing target cells alone. Triton X-100 (2 %) was used to lyse the target cells to estimate maximal release. Percent cytotoxicity was determined according to the formula: percent lysis = 100 x (experimental 51Cr release - spontaneous 51Cr release)/(maximal 51Cr release- spontaneous 51Cr release). ELISPOT assay
Spleen cells (5xl05) were mixed with 10 μβ/ηιΐ of the indicated peptide and added to a 96-well PVDF-membrane plate coated with anti-IFN-y antibody. The plates were then incubated in a humidified atmosphere of 5% CO2 in air at 37°C for 48 hours. After incubation, cells were removed by washing the plates 6 times with 0.05% (w/v) tween 20 in PBS. A 50 μΐ aliquot of biotinylated secondary anti-IFN-j' antibody (clone R46A2;
eBioscience, San Diego, CA) was added to each well. After 2 hours, the plate was washed and streptavidin-HRP (eBioscience) was added. Spots were developed using a 3-amine-9- efhyl carbazole (AEC, Sigma) solution. The reaction was stopped after 4-6 minutes by running the plate under tap water. The spots were then counted using an ELISPOT reader (Cellular Technology Ltd., Shaker Heights, OH).
CD107a Cytotoxicity assay
HLA-A2 Tg mice were injected s.c. twice with the indicated peptides (50 μ ml) emulsified in IFA, DOTAP or PELC in the absence or presence of CpG ODN (10 μ mouse). On day 7 after the second immunization, splenocytes were harvested and then resuspended to 2xl07 cell/ml in medium that contained 10 ug/ml of the indicated peptides (50 μg/ml) or cells (2xl06 cell/ml) and PE-conjugated anti-mouse CD107a antibody (1 :100) in 96-well round- bottom plates. After 2 hours at 37°C, brefeldin A (10 μg/ml) and monensin (0.66 μg/ml) were added for another 2-6 hours. The plates were washed with PBS containing 0.1% FBS, and anti-mouse Fc antibody (1:100) was added for 5 minutes, followed by addition of the FITC-conjugated anti-mouse CD8 antibody (1: 100) for 30 minutes. The cytotoxic
CD107a+ CD8+ cells were analyzed on a fluorescence-activated cell sorter (FACS calibur, BD Bioscience).
Wound Healing Assay
Wound healing was investigated using a Culture- Insert (500 μπι) (Ibidi). A 100 μΐ suspension of B16-L6 cells in DMEM-10% FBS (5 x 106 cells/ml) was seeded into each well of the insert. After cell attachment for 24 h, the culture inserts were removed and the cells were incubated with antiserum (1:100 v/v) in DMEM-10% FBS. The cell migration into the defined cell free gap was observed for 48 hr as indicated under an inverted microscope. For assay analysis, cells were tracked using the manual tracking software component of the ImageJ programmer.
Statistical analysis
The statistical significance of differences between the mean values of the experimental groups was determined using the student t test and ANOVA. The differences were considered statistically significant if the P value was < 0.05.
OTHER EMBODIMENTS
All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.
From the above description, one skilled in the art can easily ascertain the essential characteristics of the described embodiments, and without departing from the spirit and scope thereof, can make various changes and modifications of the embodiments to adapt it to various usages and conditions. Thus, other embodiments are also within the claims.
Claims
1. An immunogenic peptide, comprising the sequence of CLDSLGQWN, wherein the peptide has 100 or fewer amino.
2. The peptide of claim 1, wherein the peptide has the sequence of X1X2X3X4X5X6X7CLDSLGQWNX8X9X10X11, in which Xj to Xu, individually, is an ammo acid.
3. The peptide of claim 2, wherein ¾ is proline.
4. The peptide of claim 2 or 3, wherein Xs is threonine.
5. The peptide of claim 3 or 4, wherein the peptide includes the sequence of GLAEGPLCLDSLGQWNYTFA.
6. The peptide of any of claims 1-5, further comprising (i) a cytotoxic T lymphocyte (CTL) epitope of TAL6, and/or (ii) a helper T cell (Th) epitope.
7. The peptide of claim 6, wherein the CTL epitope is LLMLLPAFV or
RFVWFFSGI.
8. The peptide of claim 6 or 7, wherein the Th epitope is AKFVAAWTLKAAA or QYIKANSKFIGITEL.
9. The peptide of any of claims 6-8, further comprising a linker sequence between two of the epitopes.
10. The peptide of claim 9, wherein the peptide contains the sequence of AKFVAAWTLKAAAAAALLMLLPAFVAAAGLAEGPLCLDSLGQWNYTFA.
11. A nucleic acid molecule comprising a sequence that encodes the peptide of any of claims 1-10.
12. The nucleic acid molecule of claim 11, wherein the nucleic acid molecule is an expression vector capable of expressing the peptide.
13. An immunogenic composition comprising the peptide of any of claims 1-10.
14. The immunogenic composition of claim 13, further comprising an adjuvant.
15. The immunogenic composition of claim 14, wherein the adjuvant is selected from the group consisting of incomplete Freund' s adjuvant (IF A), DOTAP, PELC, and unmethylated CpG-containing oligodeoxynucleotides (CpG).
16. The immunogenic composition of claim 15, wherein the composition contains
PELC and CpG, and the peptide has the sequence of
AKFVAAWTLKAAAAAALLMLLPAFVAAAGLAEGPLCLDSLGQWNYTFA.
17. An immunogenic composition comprising the nucleic acid molecule of claim 11 or 12.
18. The immunogenic composition of claim 17, further comprising an adjuvant.
19. A method of treating a cancer in a subject, the method comprising administering to a subject in need thereof the immunogenic composition of any of claims 13- 18.
20. The method of claim 19, wherein the cancer has cells that express TAL6.
21. The method of claim 20, wherein the cancer is lung cancer, colon cancer, breast cancer, ovarian carcinoma, gastric cancer, Kaposi's sarcoma, hepatoma, pancreatic cancer, cervical cancer, endometrial cancer, head and neck cancer, ovarian cancer, or prostate cancer.
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/098,735 US10995126B2 (en) | 2016-05-04 | 2017-05-03 | Immunogenic peptide containing a b cell epitope of tumor associated antigen L6 |
| CN201780027926.1A CN110022890A (en) | 2016-05-04 | 2017-05-03 | B cell antigen comprising tumor associated antigen L6 determines that the immunogene of position wins peptide |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662331698P | 2016-05-04 | 2016-05-04 | |
| US62/331,698 | 2016-05-04 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017192697A1 true WO2017192697A1 (en) | 2017-11-09 |
Family
ID=60203717
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/030805 Ceased WO2017192697A1 (en) | 2016-05-04 | 2017-05-03 | Immunogenic peptide containing a b cell epitope of tumor associated antigen l6 |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US10995126B2 (en) |
| CN (1) | CN110022890A (en) |
| TW (1) | TWI675843B (en) |
| WO (1) | WO2017192697A1 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10987420B2 (en) * | 2003-12-12 | 2021-04-27 | City Of Hope | Synthetic conjugate of CpG DNA and T-help/CTL peptide |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070032413A1 (en) * | 1999-03-12 | 2007-02-08 | Rosen Craig A | Human secreted proteins |
| US8465756B2 (en) * | 2009-08-12 | 2013-06-18 | National Health Research Institutes | Immunogenic peptides of tumor associated antigen L6 and uses thereof in cancer therapy |
| WO2015054427A1 (en) * | 2013-10-10 | 2015-04-16 | Beth Israel Deaconess Medical Center, Inc. | Tm4sf1 binding proteins and methods of using same |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL84285A (en) | 1986-10-27 | 1993-03-15 | Int Genetic Engineering | Chimeric antibody with specificity to human tumor antigen |
| US5200508A (en) | 1989-05-04 | 1993-04-06 | The State Of Oregon Acting By And Through The State Board Of Higher Education On Behalf Of Oregon Health Sciences University | Cell surface antigen that binds with L6 monoclonal antibody |
| US5314995A (en) | 1990-01-22 | 1994-05-24 | Oncogen | Therapeutic interleukin-2-antibody based fusion proteins |
| US5597707A (en) | 1993-04-15 | 1997-01-28 | Bristol-Myers Squibb Company | Tumor associated antigen recognized by the murine monoclonal antibody L6, its oligonucleotide sequence and methods for their use |
| CN102590531A (en) * | 2012-03-24 | 2012-07-18 | 广西壮族自治区肿瘤防治研究所 | Ovarian cancer related antigen autoantibody repertoire liquid chip detection kit and preparation method thereof |
-
2017
- 2017-05-03 US US16/098,735 patent/US10995126B2/en not_active Expired - Fee Related
- 2017-05-03 CN CN201780027926.1A patent/CN110022890A/en active Pending
- 2017-05-03 WO PCT/US2017/030805 patent/WO2017192697A1/en not_active Ceased
- 2017-05-04 TW TW106114845A patent/TWI675843B/en active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070032413A1 (en) * | 1999-03-12 | 2007-02-08 | Rosen Craig A | Human secreted proteins |
| US8465756B2 (en) * | 2009-08-12 | 2013-06-18 | National Health Research Institutes | Immunogenic peptides of tumor associated antigen L6 and uses thereof in cancer therapy |
| WO2015054427A1 (en) * | 2013-10-10 | 2015-04-16 | Beth Israel Deaconess Medical Center, Inc. | Tm4sf1 binding proteins and methods of using same |
Non-Patent Citations (2)
| Title |
|---|
| MARKEN ET AL.: "Cloning and expression of the tumor-associated antigen L6", PROC NATL ACAD SCI USA, vol. 89, no. 8, 15 April 1992 (1992-04-15), pages 3503 - 3507, XP002069464 * |
| SHER ET AL.: "A HLA-A2-restricted CTL epitope induces anti-tumor effects against human lung cancer in mouse xenograft model", ONCOTARGET, vol. 7, no. 1, 26 November 2015 (2015-11-26), pages 671 - 683, XP055438240 * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10987420B2 (en) * | 2003-12-12 | 2021-04-27 | City Of Hope | Synthetic conjugate of CpG DNA and T-help/CTL peptide |
Also Published As
| Publication number | Publication date |
|---|---|
| CN110022890A (en) | 2019-07-16 |
| TW201803898A (en) | 2018-02-01 |
| US20190135883A1 (en) | 2019-05-09 |
| US10995126B2 (en) | 2021-05-04 |
| TWI675843B (en) | 2019-11-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7190528B2 (en) | A novel conjugate comprising a cell-penetrating peptide, a cargo, and a TLR peptide agonist for treating glioblastoma | |
| AU2013316679B2 (en) | Cell penetrating peptides | |
| US10189885B2 (en) | Non-hemolytic LLO fusion proteins and methods of utilizing same | |
| EP2623121A1 (en) | Pharmaceutical composition comprising a polymeric carrier cargo complex and an antigen | |
| US20250018029A1 (en) | Methods to alter the tumor microenvironment for effective cancer immunotherapy | |
| US12280109B2 (en) | Nano-particles that contain synthetic variants of GM3 ganglioside as adjuvants in vaccines | |
| Lin et al. | Chimeric peptide containing both B and T cells epitope of tumor-associated antigen L6 enhances anti-tumor effects in HLA-A2 transgenic mice | |
| CA3091414A1 (en) | Pd-1 peptide inhibitors | |
| US10995126B2 (en) | Immunogenic peptide containing a b cell epitope of tumor associated antigen L6 | |
| US20180264093A1 (en) | Immunogenic glycopeptide compounds, pharmaceutical compositions and uses thereof | |
| WO2015153883A1 (en) | Vaccination using plant virus particles linked to her2 antigens | |
| US20110038894A1 (en) | Immunogenic Peptides of Tumor Associated Antigen L6 and Uses Thereof in Cancer Therapy | |
| Wang et al. | Protective antitumor immunity induced by tumor cell lysates conjugated with diphtheria toxin and adjuvant epitope in mouse breast tumor models | |
| Zhang et al. | Adjuvant Delivery Method and Nanoparticle Charge Influence Peptide Amphiphile Micelle Vaccine Bioactivity | |
| HK40020716A (en) | Nano-particles that contain synthetic variants of gm3 ganglioside as adjuvants in vaccines | |
| Zhang | LAH4: A novel cell-penetrating peptide for application in tumor immunotherapy | |
| EA042396B1 (en) | NANOPARTICLES CONTAINING SYNTHETIC VARIANTS OF GANGLIOSIDE GM3 AS ADJUVANTS IN VACCINES | |
| EA049338B1 (en) | A NEW COMPLEX CONTAINING A CELL-PENETRATING PEPTIDE, A CARGO MOLECULE AND A PEPTIDE TLR AGONIST |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17793237 Country of ref document: EP Kind code of ref document: A1 |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 17793237 Country of ref document: EP Kind code of ref document: A1 |