WO2017192459A1 - Hiv peptide vaults and methods of making and using thereof - Google Patents
Hiv peptide vaults and methods of making and using thereof Download PDFInfo
- Publication number
- WO2017192459A1 WO2017192459A1 PCT/US2017/030442 US2017030442W WO2017192459A1 WO 2017192459 A1 WO2017192459 A1 WO 2017192459A1 US 2017030442 W US2017030442 W US 2017030442W WO 2017192459 A1 WO2017192459 A1 WO 2017192459A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- hiv
- hiv peptide
- vault
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/646—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the entire peptide or protein drug conjugate elicits an immune response, e.g. conjugate vaccines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
- A61K47/6901—Conjugates being cells, cell fragments, viruses, ghosts, red blood cells or viral vectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
- C07K14/08—RNA viruses
- C07K14/15—Retroviridae, e.g. bovine leukaemia virus, feline leukaemia virus human T-cell leukaemia-lymphoma virus
- C07K14/155—Lentiviridae, e.g. human immunodeficiency virus [HIV], visna-maedi virus or equine infectious anaemia virus
- C07K14/16—HIV-1 ; HIV-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/735—Fusion polypeptide containing domain for protein-protein interaction containing a domain for self-assembly, e.g. a viral coat protein (includes phage display)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16111—Human Immunodeficiency Virus, HIV concerning HIV env
- C12N2740/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16211—Human Immunodeficiency Virus, HIV concerning HIV gagpol
- C12N2740/16222—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16311—Human Immunodeficiency Virus, HIV concerning HIV regulatory proteins
- C12N2740/16322—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- the present invention relates to vaccines against human immunodeficiency virus.
- the present invention provides an HIV peptide vault which comprises a vault particle comprising a complex of MVP proteins and at least one HIV peptide bound or genetically linked to at least one MVP protein or packaged within an internal cavity of the vault particle.
- the at least one HIV peptide is an HIV epitope and/or has a sequence that is a consensus sequence, an ancestral sequence, or a mosaic sequence.
- the at least one HIV peptide is a conserved region of a human immunodeficiency virus.
- the at least one HIV peptide is a conserved region of Gag, a conserved region of Env, or a conserved region of Nef of a human immunodeficiency virus.
- the at least one HIV peptide is a consensus sequence, an ancestral sequence, or a mosaic sequence of a conserved region of a human immunodeficiency virus, such as a conserved region of Gag, a conserved region of Env, or a conserved region of Nef of a human immunodeficiency virus.
- an HIV peptide vault comprises two or more different HIV peptides.
- the HIV peptide comprises a sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16.
- the HIV peptide consists of a sequence having at least 90%>, at least 95%>, at least 96%>, at least 97%), at least 98%>, or at least 99%> sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16.
- the HIV peptide consists of a sequence having SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, or SEQ ID NO: 16.
- the HIV peptide is selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16.
- the HIV peptide is bound to the N-terminus of the at least one MVP protein.
- the HIV peptide is genetically linked to the at least one MVP protein or to a mINT domain.
- the HIV peptide is genetically linked to the N-terminus of the at least one MVP protein. In some embodiments, the HIV peptide is genetically linked to the at least one MVP protein via a flexible linker. In some embodiments, the HIV peptide is packaged within the internal cavity of the vault particle by, for example, the method according to WO 2016/049122, which is herein incorporated by reference in its entirety.
- the present invention provides a composition comprising at least one HIV peptide vault as described herein, e.g., paragraph [0012].
- the composition comprises two or more different types of HIV peptide vaults.
- the composition comprises the at least one HIV peptide vault in an immunogenic amount.
- the composition comprises the at least one HIV peptide vault in a therapeutically effective amount.
- the composition further comprises a pharmaceutically acceptable carrier. In some embodiments, the composition further comprises an adjuvant. In some
- the composition is a pharmaceutical composition. In some embodiments, the composition is a vaccine.
- the present invention provides a method of inducing an immune response in a subject, which comprises administering to the subject an
- the present invention provides a method for treating or inhibiting an HIV infection in a subject, which comprises administering to the subject a therapeutically effective amount or an immunogenic amount of one or more HIV peptide vaults as described herein, e.g., paragraph [0012], or a composition according to the present invention, e.g., as described in paragraph [0013].
- the therapeutically effective amount or the immunogenic amount is administered as single dose.
- the therapeutically effective amount or the immunogenic amount is administered as a series of several doses, e.g., two or more vaccinations separated by a given span of time. In some embodiments, the therapeutically effective amount or the immunogenic amount is administered as three vaccinations, each two weeks apart.
- the route of administration is by subcutaneous injection. In some embodiments, the route of administration is by intranasal instillation.
- a subject is treated before becoming infected by or exposed to an HIV virus. In some embodiments, the subject to be treated is at risk of being infected by an HIV virus. A subject at risk of being infected by an HIV infection is one who may be or has been exposed to an HIV virus.
- the subject to be treated has been infected with an HIV virus.
- the HIV virus is HIV-1.
- the subject is a non-human primate.
- the subject is a human.
- the subject is administered one or more antiretroviral therapeutic such as Abacavir (ZIAGEN), Atazanavir (REYATAZ), ATRIPLA (efavirenz, FTC, tenofovir), Darunavir (PREZISTA), DESCOVY (tenofovir alafenamide, emtricitabine), Dolutegravir (TIVICAY), Efavirenz (SUSTIVA), Elvitegravir (VITEKTA), Emtricitabine (FTC, EMTRIVA), Etravirine (INTELENCE), EVIPLERA (rilpivirine, emtricitabine, and tenofovir), EVOTAZ (atazanavir and cobicistat), Fosamprenavir (T
- Abacavir ZIAGEN
- KiVEXA KiVEXA
- Rezolsta darunavir, cobicistat
- Rilpivirine EDURANT
- Ritonavir NDVIR
- STRIBILD elvitegravir, emtricitabine, tenofovir disoproxil, cobicistat
- Tenofovir VlREAD
- Triumeq dilutegravir, abacavir, lamivudine
- Truvada tenofovir, FTC
- Zidovudine AZT, RETROVIR
- Figure 1 is a micrograph of vault particles composed of human MVP proteins
- FIG. 2 schematically shows the structure of a vault shell, comprised of the major vault protein (MVP) in 78 repeating units, with N-termini facing inside the vault particle at the waist, and C-termini at the outer poles.
- MVP major vault protein
- the line through the first N drawn to the second N indicates a genetically linked extension of the N-terminus with an antigenic peptide.
- Figure 3 shows four conserved regions and three exemplary mosaic representations of each conserved region.
- the three exemplary mosaic versions (generated using all curated HIV-1 M-group sequences and the Mosaic Vaccine Tool at the Los Alamos National Laboratory HIV Database) are aligned against reference clade B consensus sequences. Numbering is per the HXB2 location.
- sequences from top to bottom are: SEQ ID NO: 1 (reference subtype B consensus HIV-1 sequence for a conserved Gag region (cGagl)), SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 (reference subtype B consensus HIV-1 sequence for a second conserved Gag region (cGag2)), SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9 (reference subtype B consensus HIV-1 sequence for an Env conserved region (cEnv)), SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13 (reference subtype B consensus HIV-1 sequence for a Nef conserved region (cNef)), SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16.
- Mosaic methods in the art could be used to make one or more mosaic sequences for these conserved regions or others.
- Figure 4 shows electron micrographs of vaults containing conserved regions of
- HIV-1 The indicated HIV peptides were genetically linked to the N-terminus of human major vault protein (MVP) via a linker sequence (GGGGS GGGGS GGGGS , SEQ ID NO: 17).
- MVP human major vault protein
- GGGGS GGGGS GGGGS linker sequence
- SEQ ID NO: 17 The linker sequence encoding the HIV-MVP fusion proteins were delivered via baculovirus vector to Sf9 insect cells for expression and the engineered vault particles were purified from cell lysates using sucrose gradient purification methods known in the art. From left to right, these vaults contain SEQ ID NO: 1, SEQ ID NO: 4, SEQ ID NO: 7, SEQ ID NO: 10 bound to the N-termini of their MVP proteins.
- Figure 5 are graphs showing the uptake of fluorescent labeled recombinant human unmodified vaults by antigen-presenting cells. These were added to human peripheral blood mononuclear cells (PBMCs) for 2 hours, followed by flow cytometry. Microscopy showed endosomal uptake and rapid escape into cytoplasm (not shown).
- PBMCs peripheral blood mononuclear cells
- Figure 6 to Figure 8 are graphs evidencing that vault particles having HIV-1
- mice C57BL6 were given subcutaneous injections (SC) or intranasal instillations (IN) of human recombinant vaults (100 ⁇ g) with or without the cGag-1 sequence (SEQ ID NO: 2) at weeks 0, 2, and 4, followed by harvesting of splenic and mesenteric T cells at week 6.
- Figure 6 is an example of intracellular cytokine staining flow cytometry after stimulation of mesenteric CD8 + T cells with overlapping 15-mer peptides spanning the stretch in Gag.
- Figure 7 is a graph showing the percentages of CD4 + and CD8 + T cells producing interferon- ⁇ in response to these HIV-1 peptides plotted as means and standard deviations (three mice per group).
- Figure 8 is a graph showing the percentages of CD4 + and CD8 + T cells producing interferon- ⁇ and interleukin-2 in response to these HIV-1 peptides plotted as means and standard deviations (three mice per group).
- Figure 9 are plots comparing the results from subcutaneous injection versus
- Figure 10 are graphs showing the percent of cells responding to Gag-1 vaults in response to subcutaneous and intranasal vaccination. These plots show an experiment where mice were vaccinated with different doses of Gag-1 vaults, 3, 10, and 30 ⁇ g doses each two weeks apart. The graphs indicate the percentage of cells responding to Gag-1 measured by interferon gamma and IL-2 co-production. Each point is the mean of 3 mice after the third dose; error bars are 1 S.D. The results show that maximal effect is probably achieved between 3 and 10 ⁇ g dose per mouse.
- Figure 11 are graphs showing that the percent of responding cells in response to vaccination dose numbers. These plots show an experiment where mice were vaccinated with different numbers of doses each two weeks apart, from one to three doses. Each point is the mean of three mice at two weeks after the last dose; error bars are 1 S.D.
- FIG. 12 schematically shows the protocol for a vaccine immunogenicity and safety test of the Gag-1 vault in macaques that is underway.
- Gag-1 vaults and empty vaults (control) have been purified by FIPLC.
- a test group of three animals will receive the Gag-1 vaults and a control group of three animals will receive control (control vaults).
- the vaults will be administered subcutaneously to animals in three doses, two weeks apart each, and each dose will be 3 mg (proportional to 10 ⁇ g dose in a mouse) of vault. Then the animals belonging to the control group will be vaccinated with the Gag-1 vaults, two orally and one intranasally.
- compositions including
- HIV-1 or HIV-2 Human Immunodeficiency Virus types 1 or 2
- HIV-1 or HIV-2 Human Immunodeficiency Virus types 1 or 2
- compositions according to the present invention are a vaccine directed against HIV-1. In some embodiments, the pharmaceutical composition according to the present invention is a vaccine directed against HIV-2.
- compositions according to the present invention comprise a vault particle having at least one HIV peptide bound or genetically linked to at least one MVP protein of the vault particle or packaged within its internal cavity.
- an "HIV peptide vault” refers to a vault particle having at least one HIV peptide bound or genetically linked to at least one MVP protein of the vault particle or packaged within its internal cavity. In some embodiments, the at least one HIV peptide is bound or genetically linked to the N- terminus of the at least one MVP protein.
- the at least one HIV peptide is packaged within the internal cavity of the vault particle cell-free methods known in the art.
- the at least one HIV peptide is indirectly bound to the at least one MVP protein by being genetically linked to a mINT domain that interacts with the at least one MVP protein.
- the at least one HIV peptide is genetically linked, either directly or through a linker, to the at least one MVP protein, preferably at its N-terminus.
- the linker is a flexible linker known in the art.
- the HIV peptide is an HIV-1 peptide or an HIV-2 peptide, preferably the HIV peptide is an HIV-1 peptide.
- an "HIV peptide” includes HIV-1 peptides and HIV-2 peptides and refers a protein encoded by an HIV nucleotide sequence and includes peptides from any proteomic region of HIV such as conserved regions, in versions such as consensus, ancestral, or mosaic sequences.
- Mosaic sequences may be obtained using methods known in the art. See, e.g., Fischer, et al. (2007) Nat Med 13(1): 100-106, which is herein incorporated by reference in its entirety.
- the HIV nucleotide sequence is obtained or derived from nucleic acids of HIV-1.
- the HIV nucleotide sequence is obtained or derived from nucleic acids of HIV-2.
- the HIV nucleotide sequence is obtained or derived from an HIV type 1 virus. In some embodiments, the HIV nucleotide sequence is obtained or derived from an HIV type 2 virus. HIV peptides encoded by HIV nucleotide sequences obtained or derived from nucleic acids of HIV-1 and/or HIV-1 viruses are "HIV-1 peptides”. HIV peptides encoded by HIV nucleotide sequences obtained or derived from nucleic acids of HIV-2 and/or HIV-2 viruses are "HIV-2 peptides”.
- the HIV peptide is a fragment of a Gag protein ⁇ e.g., Gag-1 or Gag-2), an Env (gpl60) protein, or a Nef protein of HIV.
- the HIV peptide is a consensus sequence, an ancestral sequence, or a mosaic sequence of the fragment.
- the HIV peptide comprises or consists of a sequence selected from the group consisting of:
- RQDILDLWVYHTQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPV (SEQ ID NO: 13) ;
- RQEILDLWVYHTQGFFPDWQNYTPGPGIRYPLTFGWCYKLVPV SEQ ID NO: 14
- RQDILDLWVYHTQGYFPDWQNYTPGPGVRYPLTFGWCFELVPV (SEQ ID NO: 16) .
- the HIV peptide comprises or consists of a sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16.
- the HIV peptide comprises or consist of a sequence having at least 90%, at least 95%, at least 96%), at least 97%, at least 98%, or at least 99% sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16.
- the HIV peptide comprises or consists of a sequence having at least 90%, at least 95%, at least 96%), at least 97%, at least 98%, or at least 99% sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 9, and SEQ ID NO: 13.
- percent sequence "identity” refers to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection. Depending on the application, the percent “identity" can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
- sequence comparison typically one sequence acts as a reference sequence to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, PNAS USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and
- TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by visual inspection.
- BLAST algorithm One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al, J. Mol. Biol. 215:403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information
- HIV epitope refers to an antigenic determinant of a human immunodeficiency virus and includes those known in the art.
- FIG. 1 shows a micrograph of representative HIV peptide vaults according to the present invention and Figure 2 schematically shows the structure of an HIV peptide vault.
- a "vault particle” refers to a complex of MVP proteins arranged to form a structure having ovoid shape and an internal cavity.
- the vault particles additionally comprise one or more VPARP proteins, one or more TEPl proteins, and/or RNA.
- an "MVP protein” refers to a protein that has 90-100%, preferably 95-100%, sequence identity to a major vault protein and is capable of forming a part of a vault.
- Examples of major vault proteins are provided in the NCBI protein database (available on the Internet, ncbi.nlm.nih.gov/protein) and include GI: 41055865 (rat), GI: 239052674 (mouse), and GI: 15990478 (human).
- MVP proteins can be synthetic, mutated, modified, human, animal (e.g., rat MVP), etc.
- the one or more MVP proteins of the vault particles according to the present invention have 90-100%), 95-100%), 97-99%), or 100% sequence identity to GI: 15990478 (human).
- a "VPARP protein” refers to a protein that has 90-100%), preferably 95-100%), sequence identity to a vault poly ADP-ribose polymerase and is capable of forming a part of a vault.
- VPARP proteins are provided in the NCBI protein database (available on the Internet,
- VPARP proteins can be synthetic, mutated, modified, human, animal (e.g., rat VPARP), etc.
- the one or more VPARP proteins of the vault particles according to the present invention have 90-100%), 95-100%), 97-99%), or 100% sequence identity to GI: 1 12789550 (human).
- a "TEP1 protein” refers to a protein that has 90-100%), preferably 95-100%), sequence identity to a telomerase/vault associated protein 1 and is capable of forming a part of a vault.
- TEP1 proteins are provided in the NCBI protein database (available on the Internet, ncbi.nlm.nih.gov/protein) and include GI: 12018250 (rat), GI: 6678285 (mouse), and GI: 21536371 (human). TEP1 proteins can be synthetic, mutated, modified, human, animal (e.g., rat TEP1), etc. In some embodiments, the one or more TEP1 proteins of the vault particles according to the present invention have 90-100%), 95-100%), 97-99%), or 100%) sequence identity to GI: 21536371 (human).
- mINT domain refers to the major vault protein interaction domain (mINT) of a VPARP protein or portion thereof that is capable of interacting with MVP proteins of naturally occurring vaults.
- the vault particles may be made using cell-based methods or cell-free methods known in the art. In some embodiments, the vault particles are made using cell-free methods, see, for example, WO 2016/049122, which is herein incorporated by reference in its entirety.
- compositions of the present invention may include one type of HIV peptide vault or two or more different types of HIV peptide vaults, e.g., HIV peptide vaults having different HIV peptides, or HIV peptide vaults having the same HIV peptide but some having the HIV peptide genetically linked to the MVP proteins and some having the HIV peptide genetically linked to mINT domains, etc.
- composition refers to a composition suitable for oral delivery.
- a pharmaceutical composition generally comprises an effective amount of an active agent, e.g., an HIV peptide vault according to the present invention, and a pharmaceutically acceptable carrier, e.g., a buffer, adjuvant, and the like.
- an active agent e.g., an HIV peptide vault according to the present invention
- a pharmaceutically acceptable carrier e.g., a buffer, adjuvant, and the like.
- effective amount refers to a dosage or amount sufficient to produce a desired result.
- the desired result may comprise an objective or subjective improvement in the recipient of the dosage or amount, e.g., long-term survival, decrease in viremia, effective prevention of a disease state, and the like.
- HIV peptide vaults may be any suitable HIV peptide vaults according to the present invention.
- compositions administered, preferably in the form of pharmaceutical compositions, to a subject.
- the subject is mammalian, more preferably, the subject is human.
- Preferred pharmaceutical compositions are those comprising at least one HIV peptide vault in an immunogenic amount or a therapeutically effective amount, and a pharmaceutically acceptable vehicle.
- Vaccines according to the present invention provide a protective immune response when administered to a subject.
- a "vaccine” according to the present invention is a pharmaceutical composition that comprises an immunogenic amount of at least one HIV peptide vault and provides a protective immune response when
- the protective immune response may be complete or partial, e.g., a reduction in symptoms as compared with an unvaccinated subject.
- an "immunogenic amount” is an amount that is sufficient to elicit an immune response in a subject and depends on a variety of factors such as the immunogenicity of the given HIV peptide vault, the manner of administration, the general state of health of the subject, and the like.
- the typical immunogenic amounts for initial and boosting immunizations for therapeutic or prophylactic administration may range from about 120 ⁇ g to 8 mg per kilogram of body weight of a subject.
- the typical immunogenic amount for initial and boosting immunization for therapeutic or prophylactic administration for a human subject of 70 kg body weight ranges from about 8.4 mg to about 560 mg, preferably about 10-100 mg, more preferably about 10-20 mg, per about 65-70 kg body weight of a subject.
- suitable immunization protocols include an initial immunization injection (time 0), followed by booster injections at 4, and/or 8 weeks, which these initial immunization injections may be followed by further booster injections at 1 or 2 years if needed.
- a "therapeutically effective amount” refers to an amount that may be used to treat, prevent, or inhibit a given condition, such as an HIV infection, in a subject as compared to a control. Again, the skilled artisan will appreciate that certain factors may influence the dosage required to effectively treat a subject, including the degree of exposure to HIV, previous treatments, the general health and age of the subject, and the like. A therapeutically effective amount may be readily determined by
- treatment of a subject with a therapeutically effective amount or an immunogenic amount may be administered as a single dose or as a series of several doses.
- compositions of the present invention may include an adjuvant. As used herein,
- an “adjuvant” refers to any substance which, when administered with or before a pharmaceutically active agent, such as a HIV peptide vault according to the present invention, aids the pharmaceutically active agent in its mechanism of action.
- a pharmaceutically active agent such as a HIV peptide vault according to the present invention
- an adjuvant in a vaccine according to the present invention is a substance that aids the at least one HIV peptide vault in eliciting an immune response.
- Suitable adjuvants include incomplete Freund's adjuvant, alum, aluminum phosphate, aluminum hydroxide, N- acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor-muramyl-L-alanyl- D-isoglutamine (CGP 11637, nor-MDP), N-acetylmuramyl-Lalanyl-D-isoglutaminyl-L- alanine-2-( -2'-dipa-lmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine (CGP 19835 A, MTP-PE), and RIBI, which comprise three components extracted from bacteria, monophosphoryl lipid A, trehalose dimycolate and cell wall skeleton ( PL+TDM+CWS) in a 2% squalene/Tween 80 emulsion.
- compositions of the present invention may be formulated for the intended route of delivery, including intravenous, intramuscular, intra peritoneal, subcutaneous, intraocular, intrathecal, intraarticular, intrasynovial, cisternal, intrahepatic, intralesional injection, intracranial injection, infusion, and/or inhaled routes of
- compositions according to the present invention may include one or more of the following: pH buffered solutions, adjuvants (e.g., preservatives, wetting agents, emulsifying agents, and dispersing agents), liposomal formulations, nanoparticles, dispersions, suspensions or emulsions as well as sterile powders for reconstitution into sterile injectable solutions or dispersions.
- adjuvants e.g., preservatives, wetting agents, emulsifying agents, and dispersing agents
- liposomal formulations e.g., nanoparticles, dispersions, suspensions or emulsions as well as sterile powders for reconstitution into sterile injectable solutions or dispersions.
- the compositions and formulations of the present invention may be optimized for increased stability and efficacy using methods in the art. See, e.g., Carra et al. (2007) Vaccine 25:4149-4158, which is herein incorporated by reference.
- compositions of the present invention may be administered to a subject by any suitable route including oral, transdermal, subcutaneous, intranasal, inhalation, intramuscular, and intravascular administration. It will be appreciated that the preferred route of administration and pharmaceutical formulation will vary with the condition and age of the subject, the nature of the condition to be treated, the therapeutic effect desired, and the particular polypeptide, polynucleotide, or antibody used.
- a "pharmaceutically acceptable vehicle” or “pharmaceutically acceptable carrier” are used interchangeably and refer to and include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration and comply with the applicable standards and regulations, e.g., the pharmacopeial standards set forth in the United States Pharmacopeia and the National Formulary (USP-NF) book, for pharmaceutical administration.
- unsterile water is excluded as a pharmaceutically acceptable carrier for, at least, intravenous administration.
- Pharmaceutically acceptable vehicles include those known in the art. See, e.g.,
- compositions of the present invention may be provided in dosage unit forms.
- dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a
- predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutically acceptable carrier.
- the specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
- Toxicity and therapeutic efficacy of the HIV peptide vaults according to the instant invention and compositions thereof can be determined by standard pharmaceutical procedures in cell cultures or experimental animals. For example, one may determine the lethal dose, LC50 (the dose expressed as concentration x exposure time that is lethal to 50% of the population) or the LD50 (the dose lethal to 50% of the population), and the ED50 (the dose therapeutically effective in 50% of the population) by conventional methods in the art. The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50. HIV peptide vaults which exhibit large therapeutic indices are preferred. While HIV peptide vaults that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
- the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
- the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
- a therapeutically effective amount and/or dose can be estimated initially from cell culture assays.
- a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture.
- IC50 i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms
- levels in plasma may be measured, for example, by high performance liquid chromatography.
- a suitable dosage for a given subject can be determined by an attending physician or other qualified medical personnel, based on various clinical factors.
- kits which comprise one or more HIV peptide vaults, optionally in a composition or in combination with one or more additional therapeutic agents such as an antiretroviral therapeutic, packaged together with one or more reagents or drug delivery devices for preventing, inhibiting, reducing, or treating an HIV infection in a subject.
- additional therapeutic agents such as an antiretroviral therapeutic
- kits include a carrier, package, or container that may be compartmentalized to receive one or more containers, such as vials, tubes, and the like.
- the kits optionally include an identifying description or label or instructions relating to its use.
- kits comprise the one or more HIV peptide vaults, optionally in one or more unit dosage forms, packaged together as a pack and/or in drug delivery device, e.g., a pre-filled syringe.
- the kits include information prescribed by a governmental agency that regulates the manufacture, use, or sale of compounds and compositions according to the present invention.
- SEQ ID NO:2 was used as the exemplary HIV peptide for the
- any peptide that results in an antibody response against HIV by itself or with a vault particle as an HIV peptide vault may be used in accordance with the invention.
- HIV peptide vaults consisting of human MVP proteins having the HIV peptides
- Figure 3 recombinantly linked to the N-terminus via a flexible linker
- FIG. 17 shows electron micrographs of the HIV peptide vaults.
- Uptake and processing of proteins by antigen presenting cells is crucial for generating new immune responses, particularly T cell responses.
- APCs antigen presenting cells
- the HIV peptide vaults were taken up by human peripheral blood mononuclear cells.
- the uptake of the HIV peptide vaults was assessed using fluorescent labels and flow cytometry. As shown in Figure 5, the uptake was remarkably efficient in activated CD4 + T cells and myeloid dendritic cells, approaching 100% in a 2 hour incubation.
- the term "subject” includes humans and non-human animals.
- the term “non-human animal” includes all vertebrates, e.g., mammals and non-mammals, such as non-human primates, horses, sheep, dogs, cows, pigs, chickens, and other veterinary subjects and test animals.
- the phrase "comprises or consists of is used as a tool to avoid excess page and translation fees and means that in some embodiments the given thing at issue comprises something, and in some embodiments the given thing at issue consists of something.
- the sentence "In some embodiments, the composition comprises or consists of a A" is to be interpreted as if written as the following two separate sentences: "In some embodiments, the composition comprises A. In some embodiments, the composition consists of A.”
- sentence reciting a string of alternates is to be interpreted as if a string of sentences were provided such that each given alternate was provided in a sentence by itself.
- the sentence "In some embodiments, the composition comprises A, B, or C" is to be interpreted as if written as the following three separate sentences: ""In some embodiments, the composition comprises A. In some embodiments, the composition comprises B. In some embodiments, the composition comprises C.”
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- AIDS & HIV (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Hematology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Cell Biology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Abstract
Disclosed herein are compositions comprising HIV peptide vaults, which are vault particles comprising complexes of MVP proteins and one or more HIV peptides bound or genetically linked to one or more MVP proteins or packaged within the internal cavities of the vault particles and methods of using thereof.
Description
HIV PEPTIDE VAULTS AND METHODS OF MAKING AND USING THEREOF
[0001] REFERENCE TO A SEQUENCE LISTING SUBMITTED VIA EFS-WEB
[0002] The content of the ASCII text file of the sequence listing named
"20160429_034044_164Pl_seq_ST25" which is 1 1.3 kb in size was created on April 25, 2016, and electronically submitted via EFS-Web herewith the application is incorporated herein by reference in its entirety.
[0003] ACKNOWLEDGEMENT OF GOVERNMENT SUPPORT
[0004] This invention was made with Government support under Grant Number
All 06528, awarded by the National Institutes of Health. The Government has certain rights in the invention.
[0005] BACKGROUND OF THE INVENTION
[0006] 1. FIELD OF THE INVENTION
[0007] The present invention relates to vaccines against human immunodeficiency virus.
[0008] 2. DESCRIPTION OF THE RELATED ART
[0009] To date, vaccine designs to elicit CTL responses (predominately other viruses modified as vectors to deliver HIV-1 protein genes) have failed in human trials. They have either been weakly immunogenic for CTLs (e.g., canarypox vectors) or otherwise modestly immunogenic for responses that fail to prevent infection or reduce viremia in people who got infected after vaccination (e.g., recombinant adenovirus-5 vectors). To date, all of the HIV-1 vaccine designs that have advanced to human efficacy trials have failed. At least four problems explain these failures: 1) interference with developing immune responses against the delivered HIV-1 antigens due to competition by immune responses against the vector, 2) poorly efficient delivery of HIV-1 antigens, 3) inability to generate CTL responses at the mucosal surfaces where HIV-1 transmission occurs, and 4) mutational escape of HIV-1 from the CTL responses generated by the vaccine.
[0010] Thus, a need still exists for effective vaccines against HIV-1.
[0011] SUMMARY OF THE INVENTION
[0012] In some embodiments, the present invention provides an HIV peptide vault which comprises a vault particle comprising a complex of MVP proteins and at least one HIV peptide bound or genetically linked to at least one MVP protein or packaged within an internal cavity of the vault particle. In some embodiments, the at least one HIV peptide is an HIV epitope and/or has a sequence that is a consensus sequence, an ancestral sequence,
or a mosaic sequence. In some embodiments, the at least one HIV peptide is a conserved region of a human immunodeficiency virus. In some embodiments, the at least one HIV peptide is a conserved region of Gag, a conserved region of Env, or a conserved region of Nef of a human immunodeficiency virus. In some embodiments, the at least one HIV peptide is a consensus sequence, an ancestral sequence, or a mosaic sequence of a conserved region of a human immunodeficiency virus, such as a conserved region of Gag, a conserved region of Env, or a conserved region of Nef of a human immunodeficiency virus. In some embodiments, an HIV peptide vault comprises two or more different HIV peptides. In some embodiments, the HIV peptide comprises a sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16. In some embodiments, the HIV peptide consists of a sequence having at least 90%>, at least 95%>, at least 96%>, at least 97%), at least 98%>, or at least 99%> sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16. In some embodiments, the HIV peptide consists of a sequence having SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, or SEQ ID NO: 16. In some embodiments, the HIV peptide is selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16. In some embodiments, the HIV peptide is bound to the N-terminus of the at least one MVP protein. In some embodiments, the HIV peptide is genetically linked to the at least one MVP protein or to a mINT domain. In some embodiments, the HIV peptide is genetically linked to the N-terminus of the at least one MVP protein. In some embodiments, the HIV peptide is genetically linked to the at least one MVP protein via a flexible linker. In some embodiments, the HIV peptide is packaged within the internal cavity of the vault particle
by, for example, the method according to WO 2016/049122, which is herein incorporated by reference in its entirety.
[0013] In some embodiments, the present invention provides a composition comprising at least one HIV peptide vault as described herein, e.g., paragraph [0012]. In some embodiments, the composition comprises two or more different types of HIV peptide vaults. In some embodiments, the composition comprises the at least one HIV peptide vault in an immunogenic amount. In some embodiments, the composition comprises the at least one HIV peptide vault in a therapeutically effective amount. In some
embodiments, the composition further comprises a pharmaceutically acceptable carrier. In some embodiments, the composition further comprises an adjuvant. In some
embodiments, the composition is a pharmaceutical composition. In some embodiments, the composition is a vaccine.
[0014] In some embodiments, the present invention provides a method of inducing an immune response in a subject, which comprises administering to the subject an
immunogenic amount of one or more HIV peptide vaults as described herein, e.g., paragraph [0012], or a composition according to the present invention, e.g., as described in paragraph [0013]. In some embodiments, the present invention provides a method for treating or inhibiting an HIV infection in a subject, which comprises administering to the subject a therapeutically effective amount or an immunogenic amount of one or more HIV peptide vaults as described herein, e.g., paragraph [0012], or a composition according to the present invention, e.g., as described in paragraph [0013]. In some embodiments, the therapeutically effective amount or the immunogenic amount is administered as single dose. In some embodiments, the therapeutically effective amount or the immunogenic amount is administered as a series of several doses, e.g., two or more vaccinations separated by a given span of time. In some embodiments, the therapeutically effective amount or the immunogenic amount is administered as three vaccinations, each two weeks apart. In some embodiments, the route of administration is by subcutaneous injection. In some embodiments, the route of administration is by intranasal instillation. In some embodiments, a subject is treated before becoming infected by or exposed to an HIV virus. In some embodiments, the subject to be treated is at risk of being infected by an HIV virus. A subject at risk of being infected by an HIV infection is one who may be or has been exposed to an HIV virus. In some embodiments, the subject to be treated has been infected with an HIV virus. In some embodiments, the HIV virus is HIV-1. In some embodiments, the subject is a non-human primate. In some embodiments, the subject is a
human. In some embodiments, the subject is administered one or more antiretroviral therapeutic such as Abacavir (ZIAGEN), Atazanavir (REYATAZ), ATRIPLA (efavirenz, FTC, tenofovir), Darunavir (PREZISTA), DESCOVY (tenofovir alafenamide, emtricitabine), Dolutegravir (TIVICAY), Efavirenz (SUSTIVA), Elvitegravir (VITEKTA), Emtricitabine (FTC, EMTRIVA), Etravirine (INTELENCE), EVIPLERA (rilpivirine, emtricitabine, and tenofovir), EVOTAZ (atazanavir and cobicistat), Fosamprenavir (TELZIR), GENVOYA
(elvitegravir, cobicistat, emtricitabine, tenofovir alafenamide (TAF)), KiVEXA
(abacavir/3TC), KIVEXA (lamivudine, abacavir), Lamivudine (3TC, EPIVIR), KALETRA (lopinavir, ritonavir), Maraviroc (CELSENTRI), Nevirapine (VIRAMUNE), Odefsey
(rilpivirine, emtricitabine, tenofovir alafenamide (TAF)), Raltegravir (ISENTRESS),
Rezolsta (darunavir, cobicistat), Rilpivirine (EDURANT), Ritonavir (NORVIR), STRIBILD (elvitegravir, emtricitabine, tenofovir disoproxil, cobicistat), Tenofovir (VlREAD), Triumeq (dolutegravir, abacavir, lamivudine), Truvada (tenofovir, FTC), Zidovudine (AZT, RETROVIR), and the like.
[0015] DESCRIPTION OF THE DRAWINGS
[0016] This invention is further understood by reference to the drawings wherein:
[0017] Figure 1 is a micrograph of vault particles composed of human MVP proteins
having an HIV-1 antigenic peptide genetically linked to the N-terminus of the MVP proteins.
[0018] Figure 2 schematically shows the structure of a vault shell, comprised of the major vault protein (MVP) in 78 repeating units, with N-termini facing inside the vault particle at the waist, and C-termini at the outer poles. The line through the first N drawn to the second N indicates a genetically linked extension of the N-terminus with an antigenic peptide.
[0019] Figure 3 shows four conserved regions and three exemplary mosaic representations of each conserved region. For each conserved region, the three exemplary mosaic versions (generated using all curated HIV-1 M-group sequences and the Mosaic Vaccine Tool at the Los Alamos National Laboratory HIV Database) are aligned against reference clade B consensus sequences. Numbering is per the HXB2 location. As shown, the sequences from top to bottom are: SEQ ID NO: 1 (reference subtype B consensus HIV-1 sequence for a conserved Gag region (cGagl)), SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 (reference subtype B consensus HIV-1 sequence for a second conserved Gag region (cGag2)), SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9 (reference subtype B consensus HIV-1 sequence for an Env conserved region
(cEnv)), SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13 (reference subtype B consensus HIV-1 sequence for a Nef conserved region (cNef)), SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16. Mosaic methods in the art could be used to make one or more mosaic sequences for these conserved regions or others.
[0020] Figure 4 shows electron micrographs of vaults containing conserved regions of
HIV-1. The indicated HIV peptides were genetically linked to the N-terminus of human major vault protein (MVP) via a linker sequence (GGGGS GGGGS GGGGS , SEQ ID NO: 17). These nucleotide sequences encoding the HIV-MVP fusion proteins were delivered via baculovirus vector to Sf9 insect cells for expression and the engineered vault particles were purified from cell lysates using sucrose gradient purification methods known in the art. From left to right, these vaults contain SEQ ID NO: 1, SEQ ID NO: 4, SEQ ID NO: 7, SEQ ID NO: 10 bound to the N-termini of their MVP proteins.
[0021] Figure 5 are graphs showing the uptake of fluorescent labeled recombinant human unmodified vaults by antigen-presenting cells. These were added to human peripheral blood mononuclear cells (PBMCs) for 2 hours, followed by flow cytometry. Microscopy showed endosomal uptake and rapid escape into cytoplasm (not shown).
[0022] Figure 6 to Figure 8 are graphs evidencing that vault particles having HIV-1
peptides bound thereto yield systemic and mucosal polyfunctional T cell responses. Mice (C57BL6) were given subcutaneous injections (SC) or intranasal instillations (IN) of human recombinant vaults (100 μg) with or without the cGag-1 sequence (SEQ ID NO: 2) at weeks 0, 2, and 4, followed by harvesting of splenic and mesenteric T cells at week 6. Figure 6 is an example of intracellular cytokine staining flow cytometry after stimulation of mesenteric CD8+ T cells with overlapping 15-mer peptides spanning the stretch in Gag. Figure 7 is a graph showing the percentages of CD4+ and CD8+ T cells producing interferon-γ in response to these HIV-1 peptides plotted as means and standard deviations (three mice per group). Figure 8 is a graph showing the percentages of CD4+ and CD8+ T cells producing interferon-γ and interleukin-2 in response to these HIV-1 peptides plotted as means and standard deviations (three mice per group).
[0023] Figure 9 are plots comparing the results from subcutaneous injection versus
intranasal instillation vaccination methods. These plots show data from 4 separate experiments where Gag-1 vaults were given as subcutaneous injection (first column) or intranasal vaccinations (second column) in doses ranging from 1 to 100 μg to C57B6 mice as before (three vaccinations separated by 2 weeks each). Each point is the mean response of 3 mice at two weeks after the third dose. Three readouts are shown in terms of cytokine
production in response to Gag-1 peptides (three rows: interferon gamma alone, interleukin 2 alone, or production of both). Solid dots indicate CD4+ T cells and open triangles indicated CD8+ T cells responding to Gag-1. In each plot, the percentage of responding cells is indicated for mesenteric lymph nodes (Y axis) and spleen (X axis).
[0024] Figure 10 are graphs showing the percent of cells responding to Gag-1 vaults in response to subcutaneous and intranasal vaccination. These plots show an experiment where mice were vaccinated with different doses of Gag-1 vaults, 3, 10, and 30 μg doses each two weeks apart. The graphs indicate the percentage of cells responding to Gag-1 measured by interferon gamma and IL-2 co-production. Each point is the mean of 3 mice after the third dose; error bars are 1 S.D. The results show that maximal effect is probably achieved between 3 and 10 μg dose per mouse.
[0025] Figure 11 are graphs showing that the percent of responding cells in response to vaccination dose numbers. These plots show an experiment where mice were vaccinated with different numbers of doses each two weeks apart, from one to three doses. Each point is the mean of three mice at two weeks after the last dose; error bars are 1 S.D.
[0026] Figure 12 schematically shows the protocol for a vaccine immunogenicity and safety test of the Gag-1 vault in macaques that is underway. Gag-1 vaults and empty vaults (control) have been purified by FIPLC. A test group of three animals will receive the Gag-1 vaults and a control group of three animals will receive control (control vaults). The vaults will be administered subcutaneously to animals in three doses, two weeks apart each, and each dose will be 3 mg (proportional to 10 μg dose in a mouse) of vault. Then the animals belonging to the control group will be vaccinated with the Gag-1 vaults, two orally and one intranasally.
[0027] DETAILED DESCRIPTION OF THE INVENTION
[0028] The present invention is directed to pharmaceutical compositions, including
vaccines, for preventing, treating, inhibiting, or reducing by a Human Immunodeficiency Virus types 1 or 2 (HIV-1 or HIV-2, respectively). In some embodiments, the
pharmaceutical composition according to the present invention is a vaccine directed against HIV-1. In some embodiments, the pharmaceutical composition according to the present invention is a vaccine directed against HIV-2. As disclosed herein, compositions according to the present invention comprise a vault particle having at least one HIV peptide bound or genetically linked to at least one MVP protein of the vault particle or packaged within its internal cavity. As used herein, an "HIV peptide vault" refers to a vault particle having at least one HIV peptide bound or genetically linked to at least one
MVP protein of the vault particle or packaged within its internal cavity. In some embodiments, the at least one HIV peptide is bound or genetically linked to the N- terminus of the at least one MVP protein. In some embodiments, the at least one HIV peptide is packaged within the internal cavity of the vault particle cell-free methods known in the art. In some embodiments, the at least one HIV peptide is indirectly bound to the at least one MVP protein by being genetically linked to a mINT domain that interacts with the at least one MVP protein. In some embodiments, the at least one HIV peptide is genetically linked, either directly or through a linker, to the at least one MVP protein, preferably at its N-terminus. In some embodiments, the linker is a flexible linker known in the art. In some embodiments, the HIV peptide is an HIV-1 peptide or an HIV-2 peptide, preferably the HIV peptide is an HIV-1 peptide.
As used herein, an "HIV peptide" includes HIV-1 peptides and HIV-2 peptides and refers a protein encoded by an HIV nucleotide sequence and includes peptides from any proteomic region of HIV such as conserved regions, in versions such as consensus, ancestral, or mosaic sequences. Mosaic sequences may be obtained using methods known in the art. See, e.g., Fischer, et al. (2007) Nat Med 13(1): 100-106, which is herein incorporated by reference in its entirety. In some embodiments, the HIV nucleotide sequence is obtained or derived from nucleic acids of HIV-1. In some embodiments, the HIV nucleotide sequence is obtained or derived from nucleic acids of HIV-2. In some embodiments, the HIV nucleotide sequence is obtained or derived from an HIV type 1 virus. In some embodiments, the HIV nucleotide sequence is obtained or derived from an HIV type 2 virus. HIV peptides encoded by HIV nucleotide sequences obtained or derived from nucleic acids of HIV-1 and/or HIV-1 viruses are "HIV-1 peptides". HIV peptides encoded by HIV nucleotide sequences obtained or derived from nucleic acids of HIV-2 and/or HIV-2 viruses are "HIV-2 peptides". In some embodiments, the HIV peptide is a fragment of a Gag protein {e.g., Gag-1 or Gag-2), an Env (gpl60) protein, or a Nef protein of HIV. In some embodiments, the HIV peptide is a consensus sequence, an ancestral sequence, or a mosaic sequence of the fragment. In some embodiments, the HIV peptide comprises or consists of a sequence selected from the group consisting of:
• SPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAA EWDR (SEQ ID NO: 1 ) ;
• TPRTLNAWVKVVEEKAFSPEVIPMFTALSEGATPSDLNTMLNTIGGHQAAMQMLKDTINEEAA EWDR (SEQ ID NO: 2 ) ;
• SARTLNAWVKVVEEKGFNPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAA EWDR (SEQ ID NO: 3) ;
• SPRTLNAWVKVIEEKAFSPEVIPMFSALAEGATPQDLNMMLNIVGGHQAAMQMLKDTINDEAA EWDR (SEQ ID NO: 4 ) ;
• NPPIPVGEIYKRWI ILGLNKIVRMYSP SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKN WMTETLLVQNANPDCKTILKALG (SEQ ID NO: 5 ) ;
• NPPIPVGDIYKRWI ILGLDKIVRMYSPTSILDIRQGPKEPFRDYVDRFFKVLRAEQATQDVKN WMTDTLLVQNANPDCKTILRALG (SEQ ID NO: 6 ) ;
• NPPVPVGEIYKRWIVLGLNKIVRMYSPVSILDIRQGPKESFRDYVDRFYKTLRAEQASQDVKN WMTETLLVQNSNPDCKTILKALG (SEQ ID NO: 7);
• NPPIPVGEIYKRWI ILGLNKIVRMYSPVSILDIKQGPKEPFRDYVDRFFKTLRAEQATQEVKN WMTETLLVQNANPDCKSILKALG (SEQ ID NO: 8 ) ;
• GFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAV ERYLKDQQLLGIWGCSGKLICTT (SEQ ID NO: 9 ) ;
• GFLGVAGSTMGAASITLTVQARQLLSGIVQQQSNLLRAIEAQQHLLKLTVWGIKQLQTRVLAI ERYLKDQQLLGLWGCSGKLICPT (SEQ ID NO: 10);
• GFLGTAGSTMGAASLTLTVQARQVLSGIVQQQNNLLRAIEAQQHMLQLTVWGIKQLQARVLAV ERYLKDQQLLGIWGCSGKIICTT (SEQ ID NO: 11);
• GFLGAAGSTMGAASMTLTVQARLLLSGIVQQQSNLLKAIEAQQHLLQLTVWGIKQLQARILAV ERYLRDQQLLGIWGCSGKLICTT (SEQ ID NO: 12);
RQDILDLWVYHTQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPV (SEQ ID NO: 13) ;
RQEILDLWVYHTQGFFPDWQNYTPGPGIRYPLTFGWCYKLVPV (SEQ ID NO: 14) ;
RKDILDLWVYNTQGYFPDWHNYTPGPGTRFPLTFGWCFKLVPV (SEQ ID NO: 15) ; and
RQDILDLWVYHTQGYFPDWQNYTPGPGVRYPLTFGWCFELVPV (SEQ ID NO: 16) .
In some embodiments, the HIV peptide comprises or consists of a sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16. In some embodiments, the HIV peptide comprises or consist of a sequence having at least 90%, at least 95%, at least 96%), at least 97%, at least 98%, or at least 99% sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16. In some embodiments, the HIV peptide comprises or consists of a sequence having at least 90%, at least 95%, at least 96%), at least 97%, at least 98%, or at least 99% sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 5, SEQ ID NO: 9, and SEQ ID NO: 13.
[0030] As used herein, the term percent sequence "identity" refers to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection. Depending on the application, the percent "identity" can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
[0031] For sequence comparison, typically one sequence acts as a reference sequence to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
[0032] Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, PNAS USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and
TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by visual inspection.
[0033] One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al, J. Mol. Biol. 215:403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information
(ncbi.nlm.nih.gov).
[0034] As used herein, an "HIV epitope" refers to an antigenic determinant of a human immunodeficiency virus and includes those known in the art.
[0035] Figure 1 shows a micrograph of representative HIV peptide vaults according to the present invention and Figure 2 schematically shows the structure of an HIV peptide vault. As used herein, a "vault particle" refers to a complex of MVP proteins arranged to form a structure having ovoid shape and an internal cavity. The vault particles additionally comprise one or more VPARP proteins, one or more TEPl proteins, and/or RNA. As used
herein, an "MVP protein" refers to a protein that has 90-100%, preferably 95-100%, sequence identity to a major vault protein and is capable of forming a part of a vault. Examples of major vault proteins are provided in the NCBI protein database (available on the Internet, ncbi.nlm.nih.gov/protein) and include GI: 41055865 (rat), GI: 239052674 (mouse), and GI: 15990478 (human). MVP proteins can be synthetic, mutated, modified, human, animal (e.g., rat MVP), etc. In some embodiments, the one or more MVP proteins of the vault particles according to the present invention have 90-100%), 95-100%), 97-99%), or 100% sequence identity to GI: 15990478 (human). As used herein, a "VPARP protein" refers to a protein that has 90-100%), preferably 95-100%), sequence identity to a vault poly ADP-ribose polymerase and is capable of forming a part of a vault. Examples of VPARP proteins are provided in the NCBI protein database (available on the Internet,
ncbi.nlm.nih.gov/protein) and include GI: 149064059 (rat), GI: 281485553 (mouse), and GI: 1 12789550 (human). VPARP proteins can be synthetic, mutated, modified, human, animal (e.g., rat VPARP), etc. In some embodiments, the one or more VPARP proteins of the vault particles according to the present invention have 90-100%), 95-100%), 97-99%), or 100% sequence identity to GI: 1 12789550 (human). As used herein, a "TEP1 protein" refers to a protein that has 90-100%), preferably 95-100%), sequence identity to a telomerase/vault associated protein 1 and is capable of forming a part of a vault.
Examples of TEP1 proteins are provided in the NCBI protein database (available on the Internet, ncbi.nlm.nih.gov/protein) and include GI: 12018250 (rat), GI: 6678285 (mouse), and GI: 21536371 (human). TEP1 proteins can be synthetic, mutated, modified, human, animal (e.g., rat TEP1), etc. In some embodiments, the one or more TEP1 proteins of the vault particles according to the present invention have 90-100%), 95-100%), 97-99%), or 100%) sequence identity to GI: 21536371 (human). As used herein, a "mINT domain" refers to the major vault protein interaction domain (mINT) of a VPARP protein or portion thereof that is capable of interacting with MVP proteins of naturally occurring vaults. The vault particles may be made using cell-based methods or cell-free methods known in the art. In some embodiments, the vault particles are made using cell-free methods, see, for example, WO 2016/049122, which is herein incorporated by reference in its entirety.
As disclosed herein, HIV peptide vaults are highly immunogenic and result in systemic and mucosal immunity in subjects when administered thereto. Therefore, the present invention provides immunogenic compositions and vaccine compositions which comprise a vault particle having at least one HIV peptide bound to at least one MVP protein of the vault particle.
[0037] Compositions of the present invention, including pharmaceutical compositions and vaccines, may include one type of HIV peptide vault or two or more different types of HIV peptide vaults, e.g., HIV peptide vaults having different HIV peptides, or HIV peptide vaults having the same HIV peptide but some having the HIV peptide genetically linked to the MVP proteins and some having the HIV peptide genetically linked to mINT domains, etc.
[0038] The term "pharmaceutical composition" refers to a composition suitable for
pharmaceutical use in a subject. A pharmaceutical composition generally comprises an effective amount of an active agent, e.g., an HIV peptide vault according to the present invention, and a pharmaceutically acceptable carrier, e.g., a buffer, adjuvant, and the like. The term "effective amount" refers to a dosage or amount sufficient to produce a desired result. The desired result may comprise an objective or subjective improvement in the recipient of the dosage or amount, e.g., long-term survival, decrease in viremia, effective prevention of a disease state, and the like.
[0039] One or more HIV peptide vaults according to the present invention may be
administered, preferably in the form of pharmaceutical compositions, to a subject.
Preferably the subject is mammalian, more preferably, the subject is human. Preferred pharmaceutical compositions are those comprising at least one HIV peptide vault in an immunogenic amount or a therapeutically effective amount, and a pharmaceutically acceptable vehicle.
[0040] Vaccines according to the present invention provide a protective immune response when administered to a subject. As used herein, a "vaccine" according to the present invention is a pharmaceutical composition that comprises an immunogenic amount of at least one HIV peptide vault and provides a protective immune response when
administered to a subject. The protective immune response may be complete or partial, e.g., a reduction in symptoms as compared with an unvaccinated subject.
[0041] As used herein, an "immunogenic amount" is an amount that is sufficient to elicit an immune response in a subject and depends on a variety of factors such as the immunogenicity of the given HIV peptide vault, the manner of administration, the general state of health of the subject, and the like. The typical immunogenic amounts for initial and boosting immunizations for therapeutic or prophylactic administration may range from about 120 μg to 8 mg per kilogram of body weight of a subject. For example, the typical immunogenic amount for initial and boosting immunization for therapeutic or prophylactic administration for a human subject of 70 kg body weight ranges from about
8.4 mg to about 560 mg, preferably about 10-100 mg, more preferably about 10-20 mg, per about 65-70 kg body weight of a subject. Examples of suitable immunization protocols include an initial immunization injection (time 0), followed by booster injections at 4, and/or 8 weeks, which these initial immunization injections may be followed by further booster injections at 1 or 2 years if needed.
[0042] As used herein, a "therapeutically effective amount" refers to an amount that may be used to treat, prevent, or inhibit a given condition, such as an HIV infection, in a subject as compared to a control. Again, the skilled artisan will appreciate that certain factors may influence the dosage required to effectively treat a subject, including the degree of exposure to HIV, previous treatments, the general health and age of the subject, and the like. A therapeutically effective amount may be readily determined by
conventional methods known in the art. It should be noted that treatment of a subject with a therapeutically effective amount or an immunogenic amount, may be administered as a single dose or as a series of several doses.
[0043] The compositions of the present invention may include an adjuvant. As used
herein, an "adjuvant" refers to any substance which, when administered with or before a pharmaceutically active agent, such as a HIV peptide vault according to the present invention, aids the pharmaceutically active agent in its mechanism of action. Thus, an adjuvant in a vaccine according to the present invention is a substance that aids the at least one HIV peptide vault in eliciting an immune response. Suitable adjuvants include incomplete Freund's adjuvant, alum, aluminum phosphate, aluminum hydroxide, N- acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor-muramyl-L-alanyl- D-isoglutamine (CGP 11637, nor-MDP), N-acetylmuramyl-Lalanyl-D-isoglutaminyl-L- alanine-2-( -2'-dipa-lmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine (CGP 19835 A, MTP-PE), and RIBI, which comprise three components extracted from bacteria, monophosphoryl lipid A, trehalose dimycolate and cell wall skeleton ( PL+TDM+CWS) in a 2% squalene/Tween 80 emulsion. The effectiveness of an adjuvant may be determined by methods in the art.
[0044] Pharmaceutical compositions of the present invention may be formulated for the intended route of delivery, including intravenous, intramuscular, intra peritoneal, subcutaneous, intraocular, intrathecal, intraarticular, intrasynovial, cisternal, intrahepatic, intralesional injection, intracranial injection, infusion, and/or inhaled routes of
administration using methods known in the art. Pharmaceutical compositions according to the present invention may include one or more of the following: pH buffered solutions,
adjuvants (e.g., preservatives, wetting agents, emulsifying agents, and dispersing agents), liposomal formulations, nanoparticles, dispersions, suspensions or emulsions as well as sterile powders for reconstitution into sterile injectable solutions or dispersions. The compositions and formulations of the present invention may be optimized for increased stability and efficacy using methods in the art. See, e.g., Carra et al. (2007) Vaccine 25:4149-4158, which is herein incorporated by reference.
[0045] The compositions of the present invention may be administered to a subject by any suitable route including oral, transdermal, subcutaneous, intranasal, inhalation, intramuscular, and intravascular administration. It will be appreciated that the preferred route of administration and pharmaceutical formulation will vary with the condition and age of the subject, the nature of the condition to be treated, the therapeutic effect desired, and the particular polypeptide, polynucleotide, or antibody used.
[0046] As used herein, a "pharmaceutically acceptable vehicle" or "pharmaceutically acceptable carrier" are used interchangeably and refer to and include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration and comply with the applicable standards and regulations, e.g., the pharmacopeial standards set forth in the United States Pharmacopeia and the National Formulary (USP-NF) book, for pharmaceutical administration. Thus, for example, unsterile water is excluded as a pharmaceutically acceptable carrier for, at least, intravenous administration.
Pharmaceutically acceptable vehicles include those known in the art. See, e.g.,
REMINGTON: THE SCIENCE AND PRACTICE OF PHARMACY. 20th ed. (2000) Lippincott Williams & Wilkins. Baltimore, MD, which is herein incorporated by reference.
[0047] The pharmaceutical compositions of the present invention may be provided in dosage unit forms. "Dosage unit form" as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a
predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutically acceptable carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
[0048] Toxicity and therapeutic efficacy of the HIV peptide vaults according to the instant invention and compositions thereof can be determined by standard pharmaceutical
procedures in cell cultures or experimental animals. For example, one may determine the lethal dose, LC50 (the dose expressed as concentration x exposure time that is lethal to 50% of the population) or the LD50 (the dose lethal to 50% of the population), and the ED50 (the dose therapeutically effective in 50% of the population) by conventional methods in the art. The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50. HIV peptide vaults which exhibit large therapeutic indices are preferred. While HIV peptide vaults that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
[0049] The data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. For any compound used in the method of the invention, a therapeutically effective amount and/or dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography. Additionally, a suitable dosage for a given subject can be determined by an attending physician or other qualified medical personnel, based on various clinical factors.
[0050] In some embodiments, the present invention is directed to kits which comprise one or more HIV peptide vaults, optionally in a composition or in combination with one or more additional therapeutic agents such as an antiretroviral therapeutic, packaged together with one or more reagents or drug delivery devices for preventing, inhibiting, reducing, or treating an HIV infection in a subject. Such kits include a carrier, package, or container that may be compartmentalized to receive one or more containers, such as vials, tubes, and the like. In some embodiments, the kits optionally include an identifying description or label or instructions relating to its use. In some embodiments, the kits comprise the one or more HIV peptide vaults, optionally in one or more unit dosage forms, packaged together as a pack and/or in drug delivery device, e.g., a pre-filled syringe. In some embodiments,
the kits include information prescribed by a governmental agency that regulates the manufacture, use, or sale of compounds and compositions according to the present invention.
[0051] The following examples are intended to illustrate but not to limit the invention.
[0052] EXAMPLES
[0053] Although SEQ ID NO:2 was used as the exemplary HIV peptide for the
immunogenic data provided herein, any peptide that results in an antibody response against HIV by itself or with a vault particle as an HIV peptide vault may be used in accordance with the invention.
[0054] Selection of Peptides of the HIV-1 Proteome
[0055] Four candidate proteome regions of HIV-1 were obtained by scanning for amino acid variability (Shannon Entropy) across all available M-group HIV-1 sequences in the Los Alamos National Laboratory HIV Sequence Database. See Yang (2009) PLoS ONE 4(l):e7338, which is herein incorporated by reference. These regions included Gag 148- 214 (cGag-1), Gag 250-335 (cGag-2), Env 521-606 (cEnv), and Nef 106-148 (cNef). Because these candidate peptides were not perfectly conserved across all HIV isolates, a computing tool from the Los Alamos National Laboratory (Thurmond et al, 2008, Bioinformatics 24 (14): 1639-1640) was used to create sets of three HIV mosaic sequences for each of the above regions to maximize representation of all 9-mer sequences within a broad set of HIV-1 sequences spanning virus variability across the world. These sets of three mosaics per region {e.g., for cGag-1 : versions cGag-ΙΜΙ, cGag-lM2, cGag-lM3 are shown in Figure 3. These computed sets of mosaic sequences provide coverage of over 90% of all possible stretches of 9-mer sequences within the HIV-1 sequences representing virus variability across the world. Subsequently, these HIV peptide sequences were shown to be highly immunogenic in rhesus macaques in a vaccination study using DNA and viral vectors. See Yang, et al. (2015) J Virol 89(2): 1195-1204, which is herein incorporated by reference in its entirety.
[0056] Generation of Human Vaults That Deliver Conserved Regions of the HIV-1 Proteome [0057] HIV peptide vaults consisting of human MVP proteins having the HIV peptides
Figure 3 recombinantly linked to the N-terminus via a flexible linker
(GGGGS GGGGS GGGGS , SEQ ID NO: 17) of the MVP proteins were engineered using methods in the art. The linker sequence enhanced the yield of the HIV peptide vaults, presumably by reducing steric hindrance from the added sequences. Genetic constructs
encoding the HIV-MVP fusion proteins were delivered to insect Sf9 cells using a standard baculovirus vector and methods in the art for cell-based vault expression and purification were used. Figure 4 shows electron micrographs of the HIV peptide vaults.
[0058] Uptake by Human Antigen Presenting Cells (APCs) Demonstrates Remarkably Efficient Uptake
[0059] Uptake and processing of proteins by antigen presenting cells (APCs) is crucial for generating new immune responses, particularly T cell responses. Using methods in the art, the HIV peptide vaults were taken up by human peripheral blood mononuclear cells. The uptake of the HIV peptide vaults was assessed using fluorescent labels and flow cytometry. As shown in Figure 5, the uptake was remarkably efficient in activated CD4+ T cells and myeloid dendritic cells, approaching 100% in a 2 hour incubation.
[0060] Vaccination Studies
[0061] Systemic and mucosal immune responses in mice vaccinated with HIV peptide vaults (with HIV peptides having SEQ ID NO: 2 genetically linked to the MVP proteins of vault particles) were compared to that of mice vaccinated with control vaults (vault particle without any HIV peptide linked thereto). Three vaccinations separated by 2 weeks were given via subcutaneous injection or intranasal inoculation, and cellular immune responses were assessed by intracellular cytokine staining and flow cytometry for responses against the cGag-1 sequence delivered by the HIV peptide vault. The results of Figure 6, Figure 7, and Figure 8 show remarkably high frequency of responding T cells in both systemic (spleen) and mucosal (mesenteric) compartments from both inoculation routes. Note that when measuring cellular immune responses in persons with HIV-1 infection, the magnitudes of responses against HIV-1 peptides are typically <1% and measured as low as 0.005% of all T cells, while the observed frequencies of cells against the peptides are 10-70% of all T cells.
[0062] The data summarized in Figure 9 suggest that (1) overall, the responses in the mesenteric compartment are higher frequency than the splenic compartment for both vaccination routes (compare numbers of dots below versus above the dotted lines); and (2) intranasal vaccination may be more immunogenic for the mesenteric compartment than subcutaneous vaccination for CD4+ T cell responses (compare left panels to right panels). The data in Figure 10 indicate the percentage of cells responding to Gag-1 measured by interferon gamma production and that the maximal effect is probably achieved between 3 and 10 μg dose per mouse. The data in Figure 11 indicate that the maximal effect is not attained until at least three doses, although there are definite responses after the second
dose that have magnitudes similar to the recombinant Adenovirus serotype 5 vaccine in mice, which the Adenovirus serotype 5 vaccine was advanced to testing in macaques and then humans.
[0063] All scientific and technical terms used in this application have meanings
commonly used in the art unless otherwise specified.
[0064] As used herein, the term "subject" includes humans and non-human animals. The term "non-human animal" includes all vertebrates, e.g., mammals and non-mammals, such as non-human primates, horses, sheep, dogs, cows, pigs, chickens, and other veterinary subjects and test animals.
[0065] The use of the singular can include the plural unless specifically stated otherwise.
As used in the specification and the appended claims, the singular forms "a", "an", and "the" can include plural referents unless the context clearly dictates otherwise. As used herein, "and/or" means "and" or "or". For example, "A and/or B" means "A, B, or both A and B" and "A, B, C, and/or D" means "A, B, C, D, or a combination thereof and said "combination thereof means any subset of A, B, C, and D, for example, a single member subset (e.g., A or B or C or D), a two-member subset (e.g., A and B; A and C; etc.), or a three-member subset (e.g., A, B, and C; or A, B, and D; etc.), or all four members (e.g., A, B, C, and D).
[0066] The phrase "comprises or consists of is used as a tool to avoid excess page and translation fees and means that in some embodiments the given thing at issue comprises something, and in some embodiments the given thing at issue consists of something. For example, the sentence "In some embodiments, the composition comprises or consists of a A" is to be interpreted as if written as the following two separate sentences: "In some embodiments, the composition comprises A. In some embodiments, the composition consists of A." Similarly, sentence reciting a string of alternates is to be interpreted as if a string of sentences were provided such that each given alternate was provided in a sentence by itself. For example, the sentence "In some embodiments, the composition comprises A, B, or C" is to be interpreted as if written as the following three separate sentences: ""In some embodiments, the composition comprises A. In some embodiments, the composition comprises B. In some embodiments, the composition comprises C."
[0067] To the extent necessary to understand or complete the disclosure of the present invention, all publications, patents, and patent applications mentioned herein are expressly
incorporated by reference therein to the same extent as though each were individually so incorporated.
Having thus described exemplary embodiments of the present invention, it should be noted by those skilled in the art that the within disclosures are exemplary only and that various other alternatives, adaptations, and modifications may be made within the scope of the present invention. Accordingly, the present invention is not limited to the specific embodiments as illustrated herein, but is only limited by the following claims.
Claims
1. An HIV peptide vault which comprises a vault particle comprising a complex of MVP proteins and at least one HIV peptide bound or genetically linked to at least one MVP protein or packaged within an internal cavity of the vault particle.
2. The HIV peptide vault according to claim 1, wherein the at least one HIV peptide is an HIV epitope and/or has a sequence that is a consensus sequence, an ancestral sequence, or a mosaic sequence.
3. The HIV peptide vault according to claim 2, wherein the HIV peptide comprises a sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16.
4. The HIV peptide vault according to claim 2, wherein the HIV peptide consists of a sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16.
5. The HIV peptide vault according to claim 2, wherein the HIV peptide consists of a sequence having SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, or SEQ ID NO: 16.
6. The HIV peptide vault according to any one of claims 1 to 5, wherein the HIV peptide is bound to the N-terminus of the at least one MVP protein.
7. The HIV peptide vault according to any one of claims 1 to 5, wherein the HIV peptide is genetically linked to the at least one MVP protein or to a mINT domain.
8. The HIV peptide vault according to any one of claims 1 to 5, wherein the HIV peptide is genetically linked to the N-terminus of the at least one MVP protein.
9. The HIV peptide vault according to claim 7 or 8, wherein the HIV peptide is genetically linked to the at least one MVP protein via a flexible linker.
10. A composition comprising at least one HIV peptide vault according to any one of claims 1 to 9.
11. The composition according to claim 10, wherein the at least one HIV peptide vault is present in an immunogenic amount.
12. The composition according to claim 10 or claim 11, and further comprising a
pharmaceutically acceptable carrier.
13. A vaccine comprising at least one HIV peptide vault according to any one of claims 1 to 9.
14. The vaccine according to claim 13, and further comprising an adjuvant.
15. A method of inducing an immune response in a subject, which comprises administering an immunogenic amount of the HIV peptide vault according to any one of claims 1 to 9, the composition according to any one of claims 10 to 12, or the vaccine according to claim 13 or 14.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/097,248 US10821190B2 (en) | 2016-05-02 | 2017-05-01 | HIV peptide vaults and methods of making and using thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662330609P | 2016-05-02 | 2016-05-02 | |
| US62/330,609 | 2016-05-02 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017192459A1 true WO2017192459A1 (en) | 2017-11-09 |
Family
ID=60203271
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/030442 Ceased WO2017192459A1 (en) | 2016-05-02 | 2017-05-01 | Hiv peptide vaults and methods of making and using thereof |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US10821190B2 (en) |
| WO (1) | WO2017192459A1 (en) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050175627A1 (en) * | 2003-09-24 | 2005-08-11 | Oxxon Therapeutics Ltd. | HIV pharmaccines |
| US20160008452A1 (en) * | 2008-05-15 | 2016-01-14 | The Regents Of The University Of California | Vault Compositions for Immunization |
-
2017
- 2017-05-01 WO PCT/US2017/030442 patent/WO2017192459A1/en not_active Ceased
- 2017-05-01 US US16/097,248 patent/US10821190B2/en active Active
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050175627A1 (en) * | 2003-09-24 | 2005-08-11 | Oxxon Therapeutics Ltd. | HIV pharmaccines |
| US20160008452A1 (en) * | 2008-05-15 | 2016-01-14 | The Regents Of The University Of California | Vault Compositions for Immunization |
Non-Patent Citations (1)
| Title |
|---|
| PUTORTI ET AL.: "A Vaulted Mystery", THE SCIENTIST, 1 August 2014 (2014-08-01), Retrieved from the Internet <URL:http://mobile.the-scientist.com/article/40599/a-vaulted-mystery> [retrieved on 20170721] * |
Also Published As
| Publication number | Publication date |
|---|---|
| US20190111146A1 (en) | 2019-04-18 |
| US10821190B2 (en) | 2020-11-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Sardesai et al. | Electroporation delivery of DNA vaccines: prospects for success | |
| JP4772045B2 (en) | Vaccine against AIDS containing CMV / R nucleic acid construct | |
| KR20160079920A (en) | A novel sars immunogenic composition | |
| RO120065B1 (en) | COMPOSITION WITH PAPILLOMA ANTIGEN AND USE THEREOF | |
| US10159729B2 (en) | Antigen and method for production thereof | |
| US8338582B2 (en) | Anti-HIV immunogens and methods for inducing an immune response | |
| US6197311B1 (en) | Induction of cytotoxic T-lymphocyte responses | |
| Nardelli et al. | Cellular immune responses induced by in vivo priming with a lipid-conjugated multimeric antigen peptide | |
| US11235055B2 (en) | Nucleic acids encoding mosaic conserved region HIV immunogenic polypeptides | |
| US9060984B2 (en) | Recombinant HIV-1 envelope proteins comprising stabilizing two-cysteine mini-domains in gp41 | |
| US10821190B2 (en) | HIV peptide vaults and methods of making and using thereof | |
| CN114560917A (en) | T cell epitope polypeptide TFKVSIWNL derived from SARS-CoV-2 encoding protein and application thereof | |
| US20130337009A1 (en) | Chimeric dna vaccine compositions and methods of use | |
| CA2548483A1 (en) | Induction of antiviral neutralizing antibodies in humans and animals | |
| Sahloff | Current Issues in the Development of a Vaccine to Prevent Human Immunodeficiency Virus Insights from the Society of Infectious Diseases Pharmacists | |
| JPH07505613A (en) | Major histocompatibility complex class 2 antigen as a vaccine against immunodeficiency virus | |
| Kisakov et al. | Immunization of Mice with the pVAXrbd DNA Vaccine by Jet Injection Induces a Stronger Immune Response and Protection against SARS-CoV-2 Compared to Intramuscular Injection by Syringe | |
| EP4514386A1 (en) | A bacteriophage-based, needle and adjuvant-free, mucosal covid-19 vaccine | |
| HK40042641A (en) | Mers-cov vaccine | |
| Dueñas-Carrera et al. | Biotecnología Habana 2012 congress: Infectious Diseases symposium and satellite symposia on HIV and Dengue | |
| Cavicchi et al. | Franklin Pierce Law Center Educational Report: Patent Landscape of DNA Vaccines for HIV | |
| WO1994012212A1 (en) | Human aids vaccine from revertant cattle virus |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17793079 Country of ref document: EP Kind code of ref document: A1 |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 17793079 Country of ref document: EP Kind code of ref document: A1 |