WO2017187183A1 - Methods for the identification of bifunctional compounds - Google Patents
Methods for the identification of bifunctional compounds Download PDFInfo
- Publication number
- WO2017187183A1 WO2017187183A1 PCT/GB2017/051188 GB2017051188W WO2017187183A1 WO 2017187183 A1 WO2017187183 A1 WO 2017187183A1 GB 2017051188 W GB2017051188 W GB 2017051188W WO 2017187183 A1 WO2017187183 A1 WO 2017187183A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- optionally substituted
- target protein
- moiety
- compound
- synthetic
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C*NCCCC[C@](C(O)=O)NC(N[C@@](CCC(O)=O)C(O)=O)=O Chemical compound C*NCCCC[C@](C(O)=O)NC(N[C@@](CCC(O)=O)C(O)=O)=O 0.000 description 3
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/50—Cyclic peptides containing at least one abnormal peptide link
- C07K7/54—Cyclic peptides containing at least one abnormal peptide link with at least one abnormal peptide link in the ring
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/25—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving enzymes not classifiable in groups C12Q1/26 - C12Q1/66
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/34—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/74—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2318/00—Antibody mimetics or scaffolds
- C07K2318/20—Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y402/00—Carbon-oxygen lyases (4.2)
- C12Y402/01—Hydro-lyases (4.2.1)
- C12Y402/01001—Carbonate dehydratase (4.2.1.1), i.e. carbonic anhydrase
Definitions
- Small molecules can provide unique activity beyond natural amino acids and proteins, for example by binding to active sites (e.g., bioactive pockets) in ion channels, GPCRs, and enzymes. Yet small molecules alone often suffer from a lack of potency, specificity, sub-optimal pharmacokinetic profiles, or other properties. Proteins have been engineered to excel at these challenges yet often lack the ability to potently impact select epitopes.
- the present disclosure provides compounds and methods which merge the beneficial aspects of small molecules and proteins to develop bifunctional compounds including protein and small molecule binding interfaces as potent, specific agents of extracellular targets.
- the present disclosure provides bifunctional compounds including a polypeptide targeting moiety conjugated to a small molecule in a site-specific manner, both of which bind to the same target protein resulting in potent and specific binding characteristics, along with methods of identifying such compounds.
- the present disclosure provides a synthetic bifunctional compound, or a pharmaceutically acceptable salt thereof, that modulates the activity of an extracellular target protein (e.g., a soluble protein, a membrane-bound protein, or a transmembrane protein).
- an extracellular target protein e.g., a soluble protein, a membrane-bound protein, or a transmembrane protein.
- the bifunctional compound includes a polypeptide targeting moiety (e.g., an antibody or an antigen binding fragment thereof) that binds to the extracellular target protein covalently conjugated to a small molecule moiety (e.g., a sulfonamide-containing moiety, a hydroxamic acid-containing moiety, a thiadiazole sulfonamide- containing moiety, a glutamate-urea-lysine-containing moiety, or a cyclic peptide-containing moiety) that binds to the extracellular target protein, wherein the bifunctional compound binds to the target protein with at least 5-fold greater affinity and/or 5-fold greater selectivity than the affinity of each of the polypeptide targeting moiety and the small molecule moiety alone.
- a polypeptide targeting moiety e.g., an antibody or an antigen binding fragment thereof
- a small molecule moiety e.g., a sulfonamide-containing moiety, a hydroxamic acid
- the polypeptide targeting moiety is an antibody or an antigen binding fragment thereof. In some embodiments, the polypeptide targeting moiety is an antibody. For example, an antibody that binds to a soluble protein, a membrane-bound protein, or a transmembrane protein. In some embodiments, the extracellular target protein is a carbonic anhydrase (e.g., carbonic anhydrase 9 or carbonic anhydrase 2), CXCR4, PSMA, or a metalloprotease. In some embodiments, the antibody is a mAB 38C2 antibody.
- the polypeptide targeting moiety is a fibronectin type III domain, a variable heavy chain (VH) Ab fragment, a single-chain variable fragment, a centyrin, or a DARPin.
- the polypeptide targeting moiety is an antigen binding fragment of an antibody conjugated to a second polypeptide (e.g., human aminoguanyltransferase or a distinct variable heavy chain Ab fragment or fibronectin type III domain).
- the polypeptide targeting moiety does not bind at a small molecule binding site (e.g., the active site) of the extracellular target protein.
- the polypeptide targeting moiety binds at a small molecule binding site (e.g., the active site) of the extracellular target protein. In some embodiments, the small molecule moiety binds at the active site of the extracellular target protein. In some embodiments, the small molecule moiety does not bind at the active site of the extracellular target protein. In some embodiments, the small molecule moiety and the polypeptide targeting moiety bind to different sites on the extracellular target protein (e.g., the polypeptide targeting moiety does not bind at the active site of the extracellular target protein and the small molecule does bind at the active site of the extracellular target protein).
- the small molecule moiety binds the extracellular target protein with low affinity (e.g., the small molecule binds with a KD greater than 200 nM) when not covalently conjugated to the polypeptide targeting moiety.
- the extracellular target protein belongs to a family of extracellular proteins (e.g., a family of soluble, membrane-bound proteins, or transmembrane protein) and the small molecule moiety binds to at least two members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to all members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to at least two members of the family of extracellular proteins with similar affinity (e.g., with less than 5-fold difference in affinity between the at least two members).
- a family of extracellular proteins e.g., a family of soluble, membrane-bound proteins, or transmembrane protein
- the small molecule moiety binds to at least two members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to all members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to at least two members of the family of extracellular proteins with similar affinity (e.g
- the small molecule moiety is covalently conjugated to the polypeptide targeting moiety via a linker (e.g., via a cysteine, a lysine, or a non-natural amino acid in the polypeptide targeting moiety such as a cysteine, lysine, or non-natural amino acid in CDR1 , CDR2, or CDR3 of a variable heavy chain, a framework residue within the binding interface, or a framework residue not with in the binding interface).
- a linker e.g., via a cysteine, a lysine, or a non-natural amino acid in the polypeptide targeting moiety such as a cysteine, lysine, or non-natural amino acid in CDR1 , CDR2, or CDR3 of a variable heavy chain, a framework residue within the binding interface, or a framework residue not with in the binding interface.
- the small molecule moiety is covalently conjugated to the polypeptide targeting moiety via a free cysteine in the polypeptide targeting moiety (e.g., CDR1 , CDR2, or CDR3 of a variable heavy chain) which is formed by reduction of a disulfide bond.
- the polypeptide targeting moiety is modified to include a cysteine, lysine, or non-natural amino acid for conjugation to the small molecule moiety.
- the small molecule moiety is covalently conjugated to the polypeptide targeting moiety in a site-specific manner.
- the site of conjugation is a solvent exposed amino acid of the polypeptide targeting moiety.
- the linker includes a protein that does not bind to the extracellular target protein (e.g., human aminoguanyltransferase).
- the linker has the structure of Formula I:
- a 1 is a bond between the linker and polypeptide targeting moiety;
- a 2 is a bond between the small molecule moiety and the linker;
- B 1 , B 2 , B 3 , and B 4 each, independently, is selected from optionally substituted C1-C2 alkyl, optionally substituted C1-C3 heteroalkyl, O, S, and NR N ;
- R N is hydrogen, optionally substituted C1-4 alkyl, optionally substituted C2-4 alkenyl, optionally substituted C2-4 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted Ce-12 aryl, or optionally substituted C1-7 heteroalkyi;
- C 1 and C 2 are each, independently, selected from carbonyl, thiocarbonyl, sulphonyl, or phosphoryl;
- f, g, h, I, j, and k are each, independently, 0 or 1 ;
- D is optionally substituted C1-10 alky
- the bifunctional compound binds to the extracellular target protein pseudo-irreversibly (e.g., the off-rate of the binding of the synthetic bifunctional compound to the extracellular protein is slower than the turnover of the extracellular target protein).
- the synthetic bifunctional compound inhibits the activity of the extracellular target protein (e.g., the compound is an antagonist). In some embodiments, the synthetic bifunctional compound activates the activity of the extracellular target protein (e.g., the compound is an agonist or a partial agonist).
- the extracellular target protein is a druggable target protein. In some embodiments, the extracellular target protein has a small molecule binding site. In some embodiments, the extracellular target protein is a soluble protein. In some embodiments, the extracellular target protein is a membrane bound protein. In some embodiments, the extracellular target protein is a transmembrane protein (e.g., the extracellular domain of a transmembrane protein). In some embodiments, the extracellular target protein is a carbonic anhydrase (e.g., carbonic anhydrase 9 or carbonic anhydrase 2). In some embodiments, the small molecule moiety is a sulfonamide. For example, the small molecule moiety includes the structure of Formula II:
- R 1 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl.
- the extracellular target protein is a metalloprotease.
- the small molecule moiety is a hydroxamic acid.
- the small molecule moiety includes the structure of Formula III:
- R 2 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl.
- the extracellular target protein is PSMA.
- the smal molecule moiety is a thiadiazole sulfonamide or includes a glutamate-urea-lysine moiety.
- the small molecule moiety includes the structur V:
- R 3 is optionally substituted C1-C6 alkyl or optionally substituted C1-C6 heteroalkyi (e.g., -NHC(O)-);
- R 4 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl Ct alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
- the small molecule moiety includes the structure:
- the extracellular target protein is CXCR4.
- the small molecule moiety is a cyclic peptide.
- the small molecule moiety includes the structure of Formula VI:
- R 5 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl C1-C6 alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
- the small molecule moiety includes the structure:
- the disclosure provides a method of identifying a compound that modulates the activity of a target protein (e.g., an extracellular protein such as a soluble protein, a membrane-bound protein, or a transmembrane protein).
- a target protein e.g., an extracellular protein such as a soluble protein, a membrane-bound protein, or a transmembrane protein.
- This method includes: (a) providing two or more synthetic bifunctional compounds including a polypeptide targeting moiety (e.g., an antibody or antigen binding fragment thereof) covalently conjugated to a small molecule moiety (e.g., a sulfonamide-containing moiety or a hydroxamic acid-containing moiety); (b) contacting a target protein with the two or more synthetic bifunctional compounds; and (c) determining the binding of the two or more synthetic bifunctional compounds to the target protein, wherein a compound is identified as modulating the activity of the target protein if the synthetic bifunctional compound binds to the target protein
- the small molecule moiety of each of the two or more synthetic bifunctional compounds is the same. In some embodiments, the polypeptide targeting moiety of each of the two or more synthetic bifunctional compounds is the same.
- the polypeptide targeting moiety is a fibronectin type III domain, a variable heavy chain (VH) Ab fragment, a single-chain variable fragment, a centyrin, or a DARPin.
- the polypeptide targeting moiety is an antigen binding fragment of an antibody conjugated to a second polypeptide (e.g., human aminoguanyltransferase or a distinct variable heavy chain Ab fragment or fibronectin type III domain).
- the polypeptide targeting moiety does not bind at a small molecule binding site (e.g., the active site) of the extracellular target protein. In some embodiments, the polypeptide targeting moiety binds at a small molecule binding site (e.g., the active site) of the extracellular target protein. In some embodiments, the small molecule moiety binds at the active site of the extracellular target protein. In some embodiments, the small molecule moiety does not bind at the active site of the extracellular target protein.
- the small molecule moiety and the polypeptide targeting moiety bind to different sites on the extracellular target protein (e.g., the polypeptide targeting moiety does not bind at the active site of the extracellular target protein and the small molecule does bind at the active site of the extracellular target protein).
- the small molecule moiety binds the target protein with low affinity (e.g., the small molecule moiety binds with a KD greater than 200 nM) when not covalently conjugated to the polypeptide targeting moiety.
- the extracellular target protein belongs to a family of extracellular proteins (e.g., a family of soluble, membrane-bound proteins, or transmembrane proteins) and the small molecule moiety binds to at least two members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to all members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to at least two members of the family of extracellular proteins with similar affinity (e.g., with less than 5-fold difference in affinity between the at least two members).
- a family of extracellular proteins e.g., a family of soluble, membrane-bound proteins, or transmembrane proteins
- the small molecule moiety binds to at least two members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to all members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to at least two members of the family of extracellular proteins with similar affinity (e.g
- the small molecule moiety is covalently conjugated to the polypeptide targeting moiety via a linker (e.g., via a cysteine, a lysine, or a non-natural amino acid in the polypeptide targeting moiety such as a cysteine, lysine, or non-natural amino acid in CDR1 , CDR2, or CDR3 of a variable heavy chain, a framework residue within the binding interface, or a framework residue not within the binding interface).
- the polypeptide targeting moiety is modified to include a cysteine, lysine, or non-natural amino acid for conjugation to the small molecule moiety.
- the small molecule moiety is covalently conjugated to the polypeptide targeting moiety in a site-specific manner.
- the linker includes a protein that does not bind to the extracellular target protein (e.g., human aminoguanyltransferase).
- the linker has the structure of Formula I:
- a 1 is a bond between the linker and polypeptide targeting moiety;
- a 2 is a bond between the small molecule moiety and the linker;
- B 1 , B 2 , B 3 , and B 4 each, independently, is selected from optionally substituted C 1-C2 alkyl, optionally substituted C1-C3 heteroalkyl, O, S, and NR N ;
- R N is hydrogen, optionally substituted C 1-4 alkyl, optionally substituted C2-4 alkenyl, optionally substituted C2-4 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted Ce-12 aryl, or optionally substituted C1-7 heteroalkyl;
- C 1 and C 2 are each, independently, selected from carbonyl, thiocarbonyl, sulphonyl, or phosphoryl;
- f, g, h, I, j, and k are each, independently, 0 or 1 ;
- D is optionally substituted C1-10 alky
- the bifunctional compound binds to the extracellular target protein pseudo-irreversibly (e.g., the off-rate of the binding of the synthetic bifunctional compound to the extracellular protein is slower than the turnover of the extracellular target protein).
- the synthetic bifunctional compound inhibits the activity of the extracellular target protein (e.g., the compound is an antagonist).
- the synthetic bifunctional compound activates the activity of the extracellular target protein (e.g., the compound is an agonist or a partial agonist).
- the extracellular target protein is a druggable target protein. In some embodiments, the extracellular target protein has a small molecule binding site. In some embodiments, the extracellular target protein is a soluble protein. In some embodiments, the extracellular target protein is a membrane bound protein. In some embodiments, the extracellular target protein is a transmembrane protein (e.g., the extracellular domain of a transmembrane protein). In some embodiments, the extracellular target protein is a carbonic anhydrase (e.g., carbonic anhydrase 9 or carbonic anhydrase 2). In some embodiments, the small molecule moiety is a sulfonamide. For example, the small molecule moiety includes the structure of Formula II:
- R 1 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl.
- the extracellular target protein is a metalloprotease.
- the small molecule moiety is a hydroxamic acid.
- the small molecule moiety is a hydroxamic acid.
- the small molecule moiety includes the structure of Formula III:
- R 2 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl.
- the extracellular target protein is PSMA.
- the small molecule moiety is a thiadiazole sulfonamide or includes a glutamate-urea-lysine moiety.
- the small molecule moiety includes the structure of Formula IV or Formula V:
- R 3 is optionally substituted C1-C6 alkyl or optionally substituted C1-C6 heteroalkyi -NHC(O)-); and R 4 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl Ct alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
- the small molecule moiety includes the structure:
- the extracellular target protein is CXCR4.
- the small molecule moiety is a cyclic peptide.
- the small molecule moiety includes the structure of Formula VI:
- R 5 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optiona substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl C1-C alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
- the small molecule moiety includes the structure:
- the polypeptide targeting moiety is a member of a library (e.g., a DNA display library, an RNA display library, a yeast display library, or a phage display library) of polypeptide targeting moieties (e.g., a library including at least 10 5 polypeptide targeting moieties).
- a library e.g., a DNA display library, an RNA display library, a yeast display library, or a phage display library
- polypeptide targeting moieties e.g., a library including at least 10 5 polypeptide targeting moieties.
- the binding of the two or more synthetic bifunctional compounds to the target protein is determined using a cell-based assay.
- the invention features a method of producing a synthetic bifunctional compound, or a pharmaceutically acceptable salt thereof, that modulates the activity of an extracellular target protein (e.g., a soluble protein, a membrane-bound protein, or a transmembrane protein), wherein the bifunctional compound includes a polypeptide targeting moiety (e.g., an antibody or an antigen binding fragment thereof) that binds to the extracellular target protein covalently conjugated to a small molecule moiety (e.g., a sulfonamide-containing moiety or a hydroxamic acid-containing moiety) that binds to the extracellular target protein, wherein the bifunctional compound binds to the target protein with at least 5-fold greater affinity and/or 5-fold greater selectivity than the affinity of each of the polypeptide targeting moiety and the small molecule moiety alone.
- a polypeptide targeting moiety e.g., an antibody or an antigen binding fragment thereof
- a small molecule moiety e.g., a s
- the method includes (a) providing (i) a polypeptide targeting moiety; and (ii) a small molecule moiety, wherein at least one of the polypeptide targeting moiety or the small molecule moiety is covalently conjugated to a linker which includes a cross- linking moiety; and (b) reacting the polypeptide targeting moiety and small molecule moiety under conditions sufficient to produce the synthetic bifunctional compound, or a pharmaceutically acceptable salt thereof.
- the method includes reacting (a) a compound having the structure of Formula VII:
- A includes a small molecule moiety
- L is a linker
- B is a cross-linking moiety
- the cross-linking moiety is a thiol-reactive cross-linking moiety (e.g., a maleimide-containing cross-linking moiety). In some embodiments, the cross-linking moiety is an amine- reactive cross-linking moiety (e.g., a succinimide-containing cross-linking moiety).
- the cross-linking group includes a maleimide, e.g., the cross-linking group includes the structure:
- the cross-linking group includes a succinimide, e.g., the cross-linking group includes the structure:
- the small molecule moiety is covalently conjugated to the polypeptide targeting moiety via a linker (e.g., via a cysteine, a lysine, or a non-natural amino acid in the polypeptide targeting moiety such as a cysteine, lysine, or non-natural amino acid in CDR1 , CDR2, or CDR3 of a variable heavy chain, a framework residue within the binding interface, or a framework residue not with in the binding interface).
- the polypeptide targeting moiety is modified to include a cysteine, lysine, or non-natural amino acid for conjugation to the small molecule moiety.
- the small molecule moiety is covalently conjugated to the polypeptide targeting moiety in a site-specific manner.
- the linker includes a protein that does not bind to the extracellular target protein (e.g., human aminoguanyltransferase).
- the method further includes reducing the polypeptide targeting moiety under conditions sufficient to reduce at least one disulfide bond prior to reacting the polypeptide targeting moiety with the compound of Formula VII.
- the linker has the structure of Formula I:
- a 1 is a bond between the linker and polypeptide targeting moiety;
- a 2 is a bond between the small molecule moiety and the linker;
- B 1 , B 2 , B 3 , and B 4 each, independently, is selected from optionally substituted C1-C2 alkyl, optionally substituted C1-C3 heteroalkyl, O, S, and NR N ;
- R N is hydrogen, optionally substituted C1-4 alkyl, optionally substituted C2-4 alkenyl, optionally substituted C2-4 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted C6-12 aryl, or optionally substituted C1-7 heteroalkyl;
- C 1 and C 2 are each, independently, selected from carbonyl, thiocarbonyl, sulphonyl, or phosphoryl;
- f, g, h, I, j, and k are each, independently, 0 or 1 ;
- D is optionally substituted C1-10 al
- the disclosure provides a method of producing a synthetic bifunctional compound, or a pharmaceutically acceptable salt thereof, that modulates the activity of an extracellular target protein (e.g., a soluble protein, a membrane-bound protein, or a transmembrane protein).
- an extracellular target protein e.g., a soluble protein, a membrane-bound protein, or a transmembrane protein.
- the bifunctional compound includes a polypeptide targeting moiety (e.g., an antibody or an antigen binding fragment thereof) that binds to the extracellular target protein covalently conjugated to a small molecule moiety (e.g., a sulfonamide-containing moiety, a hydroxamic acid-containing moiety, a thiadiazole sulfonamide-containing moiety, a glutamate-urea-lysine-containing moiety, or a cyclic peptide-containing moiety) that binds to the extracellular target protein, wherein the bifunctional compound binds to the target protein with at least 5-fold greater affinity and/or 5-fold greater selectivity than the affinity of each of the polypeptide targeting moiety and the small molecule moiety alone.
- a polypeptide targeting moiety e.g., an antibody or an antigen binding fragment thereof
- a small molecule moiety e.g., a sulfonamide-containing moiety, a hydroxamic acid-
- the method includes generating a library of synthetic bifunctional compounds (e.g., by the methods described herein).
- the library of synthetic bifunctional compounds may be produced, for example, by sitewise diversification (e.g., mutagenesis) of a polypeptide targeting moiety (e.g. a fibronectin type III domain) to produce a diversified library of the polypeptide targeting moiety.
- the resulting library of the polypeptide targeting moiety may be displayed, for example, on the surface of yeast by yeast display, e.g., as described herein.
- the library of the polypeptide targeting moiety may be conjugated to the small molecule (e.g., via a linker) by chemical ligation or enzymatic ligation.
- the small molecule is conjugated to the polypeptide targeting moiety via a polypeptide linker, and the conjugation of the polypeptide linker to the polypeptide targeting moiety is done by enzymatic ligation.
- the method includes screening a library of synthetic bifunctional compounds for their ability to bind to a target protein (e.g., by the methods described herein).
- tautomeric forms result from the swapping of a single bond with an adjacent double bond and the concomitant migration of a proton.
- a tautomeric form may be a prototropic tautomer, which is an isomeric protonation states having the same empirical formula and total charge as a reference form.
- moieties with prototropic tautomeric forms are ketone - enol pairs, amide - imidic acid pairs, lactam - lactim pairs, amide - imidic acid pairs, enamine - imine pairs, and annular forms where a proton can occupy two or more positions of a heterocyclic system, such as, 1 H- and 3H-imidazole, 1 H-, 2H- and 4H- 1 ,2,4-triazole, 1 H- and 2H- isoindole, and 1 H- and 2H-pyrazole.
- tautomeric forms can be in equilibrium or sterically locked into one form by appropriate substitution.
- tautomeric forms result from acetal interconversion, e.g., the interconversion illustrated in the scheme below:
- isotopes of compounds described herein may be prepared and/or utilized in accordance with the present invention.
- isotopes refers to atoms having the same atomic number but different mass numbers resulting from a different number of neutrons in the nuclei.
- isotopes of hydrogen include tritium and deuterium.
- an isotopic substitution e.g., substitution of hydrogen with deuterium
- compounds described and/or depicted herein may be provided and/or utilized in salt form.
- compounds described and/or depicted herein may be provided and/or utilized in hydrate or solvate form.
- substituents of compounds of the present disclosure are disclosed in groups or in ranges. It is specifically intended that the present disclosure include each and every individual subcombination of the members of such groups and ranges.
- C 1-6 alkyl is specifically intended to individually disclose methyl, ethyl, C3 alkyl, C4 alkyl, C5 alkyl, and C6 alkyl.
- the present disclosure is intended to cover individual compounds and groups of compounds (e.g., genera and subgenera) containing each and every individual subcombination of members at each position.
- optionally substituted X e.g., optionally substituted alkyl
- X optionally substituted
- alkyl wherein said alkyl is optionally substituted
- alkyl refers to saturated hydrocarbon groups containing from 1 to 20 (e.g., from 1 to 10 or from 1 to 6) carbons.
- an alkyl group is unbranched (i.e., is linear); in some embodiments, an alkyl group is branched.
- Alkyl groups are exemplified by methyl, ethyl, n- and iso-propyl, n-, sec-, iso- and tert-butyl, neopentyl, and the like, and may be optionally substituted with one, two, three, or, in the case of alkyl groups of two carbons or more, four substituents
- C 1-6 alkoxy independently selected from the group consisting of: (1) C 1-6 alkoxy; (2) C1-6 alkylsulfinyl; (3) amino, as defined herein (e.g., unsubstituted amino (i.e., -N H2) or a substituted amino (i.e., -N(R N 1 )2, where R N1 is as defined for amino); (4) C6-10 aryl-Ci-6 alkoxy; (5) azido; (6) halo; (7) (C2-9 heterocyclyl)oxy; (8) hydroxyl, optionally substituted with an O-protecting group; (9) nitro; (10) oxo (e.g., carboxyaldehyde or acyl); (1 1) C1-7 spirocyclyl; (12) thioalkoxy; (13) thiol; (14) -C02R A , optionally substituted with an O-protecting group and where R A is selected from the group consisting of (a) C1
- s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4)
- each of s2 and s3, independently is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10)
- each R N1 is, independently, hydrogen or optionally substituted C1-6 alkyl; (21) amidine; and (22) silyl groups such as trimethylsilyl, t-butyldimethylsilyl, and tri-isopropylsilyl.
- each of these groups can be further substituted as described herein.
- the alkylene group of a Ci-alkaryl can be further substituted with an oxo group to afford the respective aryloyl substituent.
- alkylene and the prefix "alk-,” as used herein, represent a saturated divalent hydrocarbon group derived from a straight or branched chain saturated hydrocarbon by the removal of two hydrogen atoms, and is exemplified by methylene, ethylene, isopropylene, and the like.
- C* y alkylene and the prefix "C x - y alk-” represent alkylene groups having between x and y carbons.
- Exemplary values for x are 1 , 2, 3, 4, 5, and 6, and exemplary values for y are 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, or 20 (e.g., C1-6, C 1-10, C2-20, C2-6, C2-10, or C2-20 alkylene).
- the alkylene can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for an alkyl group.
- alkenyl represents monovalent straight or branched chain groups of, unless otherwise specified, from 2 to 20 carbons (e.g., from 2 to 6 or from 2 to 10 carbons) containing one or more carbon-carbon double bonds and is exemplified by ethenyl, 1 -propenyl, 2-propenyl, 2-methyl-1 - propenyl, 1 -butenyl, 2-butenyl, and the like. Alkenyls include both cis and trans isomers.
- Alkenyl groups may be optionally substituted with 1 , 2, 3, or 4 substituent groups that are selected, independently, from amino, aryl, cycloalkyl, or heterocyclyl (e.g., heteroaryl), as defined herein, or any of the exemplary alkyl substituent groups described herein.
- alkynyl represents monovalent straight or branched chain groups from 2 to 20 carbon atoms (e.g., from 2 to 4, from 2 to 6, or from 2 to 10 carbons) containing a carbon- carbon triple bond and is exemplified by ethynyl, 1 -propynyl, and the like.
- Alkynyl groups may be optionally substituted with 1 , 2, 3, or 4 substituent groups that are selected, independently, from aryl, cycloalkyl, or heterocyclyl (e.g., heteroaryl), as defined herein, or any of the exemplary alkyl substituent groups described herein.
- amino represents -N(R N1 )2, wherein each R N1 is, independently, H, OH, N0 2 , N(R N2 )2, S0 2 OR N2 , S0 2 R N2 , SOR N2 , an /V-protecting group, alkyl, alkenyl, alkynyl, alkoxy, aryl, alkaryl, cycloalkyl, alkcycloalkyl, carboxyalkyl (e.g., optionally substituted with an O-protecting group, such as optionally substituted arylalkoxycarbonyl groups or any described herein), sulfoalkyl, acyl (e.g., acetyl, trifluoroacetyl, or others described herein), alkoxycarbonylalkyl (e.g., optionally substituted with an O- protecting group, such as optionally substituted arylalkoxycarbonyl groups or any described herein
- amino groups of the invention can be an unsubstituted amino (i.e., -NH2) or a substituted amino (i.e., - N(R N1 )2).
- amino is -NH2 or -NHR N1 , wherein R N1 is, independently, OH, NO2, NH2, NR N2 2, S0 2 OR N2 , S0 2 R N2 , SOR N2 , alkyl, carboxyalkyl, sulfoalkyl, acyl (e.g., acetyl, trifluoroacetyl, or others described herein), alkoxycarbonylalkyl (e.g., t-butoxycarbonylalkyl) or aryl, and each R N2 can be H, C1-20 alkyl (e.g., C1-6 alkyl), or Ce-10 aryl.
- amino acid refers to a molecule having a side chain, an amino group, and an acid group (e.g., a carboxy group 0f -CO2H or a sulfo group 0f -SO3H), wherein the amino acid is attached to the parent molecular group by the side chain, amino group, or acid group (e.g., the side chain).
- amino acid in its broadest sense, refers to any compound and/or substance that can be incorporated into a polypeptide chain, e.g., through formation of one or more peptide bonds.
- an amino acid has the general structure H2N-C(H)(R)-COOH.
- an amino acid is a naturally-occurring amino acid.
- an amino acid is a synthetic amino acid; in some embodiments, an amino acid is a D-amino acid; in some embodiments, an amino acid is an L-amino acid.
- Standard amino acid refers to any of the twenty standard L-amino acids commonly found in naturally occurring peptides.
- Nonstandard amino acid refers to any amino acid, other than the standard amino acids, regardless of whether it is prepared synthetically or obtained from a natural source.
- an amino acid, including a carboxy- and/or amino-terminal amino acid in a polypeptide can contain a structural modification as compared with the general structure above.
- an amino acid may be modified by methylation, amidation, acetylation, and/or substitution as compared with the general structure.
- such modification may, for example, alter the circulating half life of a polypeptide containing the modified amino acid as compared with one containing an otherwise identical unmodified amino acid.
- such modification does not significantly alter a relevant activity of a polypeptide containing the modified amino acid, as compared with one containing an otherwise identical unmodified amino acid.
- the term "amino acid" is used to refer to a free amino acid; in some embodiments it is used to refer to an amino acid residue of a polypeptide.
- the amino acid is attached to the parent molecular group by a carbonyl group, where the side chain or amino group is attached to the carbonyl group.
- the amino acid is an a-amino acid.
- the amino acid is a ⁇ -amino acid.
- the amino acid is a ⁇ -amino acid.
- Exemplary side chains include an optionally substituted alkyl, aryl, heterocyclyl, alkaryl, alkheterocyclyl, aminoalkyl, carbamoylalkyl, and carboxyalkyl.
- Exemplary amino acids include alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, hydroxynorvaline, isoleucine, leucine, lysine, methionine, norvaline, ornithine, phenylalanine, proline, pyrrolysine, selenocysteine, serine, taurine, threonine, tryptophan, tyrosine, and valine.
- Amino acid groups may be optionally substituted with one, two, three, or, in the case of amino acid groups of two carbons or more, four substituents independently selected from the group consisting of: (1) C1-6 alkoxy; (2) C 1-6 alkylsulfinyl; (3) amino, as defined herein (e.g., unsubstituted amino (i.e., -N H2) or a substituted amino (i.e., -N(R N 1 )2, where R N1 is as defined for amino); (4) Ce-10 aryl-Ci-6 alkoxy; (5) azido; (6) halo; (7) (C2-9 heterocyclyl)oxy; (8) hydroxyl; (9) nitro; (10) oxo (e.g., carboxyaldehyde or acyl); (1 1) C1-7 spirocyclyl; (12) thioalkoxy; (13) thiol; (14) -C02R A , where R A is selected from the group consist
- (CH2)s2(OCH2CH2)si(CH2)s30R' wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and R' is H or C1-20 alkyl, and (h) amino-polyethylene glycol of - NR N 1 (CH2)s2(CH2CH 2 0)si(CH2)s3NR N1 , wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each R N1 is, independently, hydrogen or optionally substituted C1-6 alkyl; (15)
- R H is selected from the group consisting of (a1) hydrogen and (b1) C1-6 alkyl
- R' is selected from the group consisting of (a2) C1-20 alkyl (e.g., C1-6 alkyl), (b2) C2-20 alkenyl (e.g., C2- 6 alkenyl), (c2) Ce-10 aryl, (d2) hydrogen, (e2) C1-3 alk-C6-io aryl, (f2) amino-Ci-20 alkyl, (g2) polyethylene glycol of -(CH2)s2(OCH2CH2)si(CH2)s30R', wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and R' is H or C1-20 alkyl
- R J is selected from the group consisting of (a1) hydrogen and (b1) C1-3 alkyl
- R K is selected from the group consisting of (a2) C1-20 alkyl (e.g., C 1-6 alkyl), (b2) C2-20 alkenyl (e.g., C2- 6 alkenyl), (c2) Ce-10 aryl, (d2) hydrogen, (e2) C1-3 alk-C6-io aryl, (f2) amino-Ci-20 alkyl, (g2) polyethylene glycol of -(CH2)s2(OCH2CH2)si(CH2)s30R', wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and R' is H or C1-20
- N-alkylated amino acids refers to amino acids containing an optionally substituted Ci to C6 alkyl on the nitrogen of the amino acid that forms the peptidic bond.
- N-alkylated amino acids include, but are not limited to, N-methyl amino acids, such as N-methyl-alanine, N-methyl- threonine, N-methyl-phenylalanine, N-methyl-aspartic acid, N-methyl-valine, N-methyl-leucine, N-methyl- glycine, N-methyl-isoleucine, N(a)-methyl-lysine, N(a)-methyl-asparagine, and N(a)-methyl-glutamine.
- N-methyl amino acids such as N-methyl-alanine, N-methyl- threonine, N-methyl-phenylalanine, N-methyl-aspartic acid, N-methyl-valine, N-methyl-leucine, N-methyl- glycine, N-methyl-isoleucine
- aryl represents a mono-, bicyclic, or multicyclic carbocyclic ring system having one or two aromatic rings and is exemplified by phenyl, naphthyl, 1 ,2-dihydronaphthyl, 1 ,2,3,4-tetrahydronaphthyl, anthracenyl, phenanthrenyl, fluorenyl, indanyl, indenyl, and the like, and may be optionally substituted with 1 , 2, 3, 4, or 5 substituents independently selected from the group consisting of: (1) C1-7 acyl (e.g., carboxyaldehyde); (2) C1-20 alkyl (e.g., C1-6 alkyl, C1-6 alkoxy-Ci-6 alkyl, Ci- 6 a Ikylsulfinyl-C 1-6 alkyl, amino-Ci-6 alkyl, azido-Ci-6 alkyl, (carboxyaldeh
- each of these groups can be further substituted as described herein.
- the alkylene group of a C i-alkaryl or a Ci-alkheterocyclyl can be further substituted with an oxo group to afford the respective aryloyl and (heterocyclyl)oyl substituent group.
- arylalkyl group which as used herein, represents an aryl group, as defined herein, attached to the parent molecular group through an alkylene group, as defined herein.
- exemplary unsubstituted arylalkyl groups are from 7 to 30 carbons (e.g., from 7 to 16 or from 7 to 20 carbons, such as C1-6 alk-C6-io aryl, C1-10 alk-Ce- ⁇ aryl, or C1-20 alk-Ce- ⁇ ⁇ aryl).
- the alkylene and the aryl each can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for the respective groups.
- Other groups preceded by the prefix "alk-" are defined in the same manner, where “alk” refers to a C1-6 alkylene, unless otherwise noted, and the attached chemical structure is as defined herein.
- Carbocyclic and “carbocyclyl,” as used herein, refer to an optionally substituted C3-12 monocyclic, bicyclic, or tricyclic non-aromatic ring structure in which the rings are formed by carbon atoms.
- Carbocyclic structures include cycloalkyl, cycloalkenyl, and cycloalkynyl groups.
- carbocyclylalkyi which as used herein, represents a carbocyclic group, as defined herein, attached to the parent molecular group through an alkylene group, as defined herein.
- exemplary unsubstituted carbocyclylalkyi groups are from 7 to 30 carbons (e.g., from 7 to 16 or from 7 to 20 carbons, such as C1-6 alk-C6-io carbocyclyl, C1-10 alk-C6-i o carbocyclyl, or C1-20 alk-C6-i o carbocyclyl).
- alkylene and the carbocyclyl each can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for the respective groups.
- substituent groups as defined herein for the respective groups.
- alk- are defined in the same manner, where “alk” refers to a C1-6 alkylene, unless otherwise noted, and the attached chemical structure is as defined herein.
- cyano represents an -CN group.
- cycloalkyi represents a monovalent saturated or unsaturated non- aromatic cyclic hydrocarbon group from three to eight carbons, unless otherwise specified, and is exemplified by cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, bicycle heptyl, and the like.
- the cycloalkyi group includes one carbon-carbon double bond
- the cycloalkyi group can be referred to as a "cycloalkenyl” group.
- Exemplary cycloalkenyl groups include cyclopentenyl, cyclohexenyl, and the like.
- the cycloalkyi groups of this invention can be optionally substituted with: (1) C1-7 acyl (e.g., carboxyaldehyde); (2) C1-20 alkyl (e.g., C1-6 alkyl, C1-6 alkoxy-Ci-6 alkyl, C1-6 alkylsulfinyl-Ci e alkyl, amino- C1-6 alkyl, azido-Ci-6 alkyl, (carboxyaldehyde)-Ci-6 alkyl, halo-Ci-6 alkyl (e.g., perfluoroalkyl), hydroxy-Ci-6 alkyl, nitro-Ci-6 alkyl, or Ci-6 thioalkoxy-Ci-6 alkyl); (3) C1-20 alkoxy (e.g., C1-6 alkoxy, such as
- each of these groups can be further substituted as described herein.
- the alkylene group of a Ci-alkaryl or a Ci-alkheterocyclyl can be further substituted with an oxo group to afford the respective aryloyl and (heterocyclyl)oyl substituent group.
- cycloalkylalkyl which as used herein, represents a cycloalkyi group, as defined herein, attached to the parent molecular group through an alkylene group, as defined herein (e.g., an alkylene group of from 1 to 4, from 1 to 6, from 1 to 10, or form 1 to 20 carbons).
- alkylene group as defined herein (e.g., an alkylene group of from 1 to 4, from 1 to 6, from 1 to 10, or form 1 to 20 carbons).
- the alkylene and the cycloalkyi each can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for the respective group.
- diastereomer as used herein means stereoisomers that are not mirror images of one another and are non-superimposable on one another.
- enantiomer means each individual optically active form of a compound of the invention, having an optical purity or enantiomeric excess (as determined by methods standard in the art) of at least 80% (i.e., at least 90% of one enantiomer and at most 10% of the other enantiomer), preferably at least 90% and more preferably at least 98%.
- halo represents a halogen selected from bromine, chlorine, iodine, or fluorine.
- heteroalkyl refers to an alkyl group, as defined herein, in which one or two of the constituent carbon atoms have each been replaced by nitrogen, oxygen, or sulfur. In some embodiments, the heteroalkyl group can be further substituted with 1 , 2, 3, or 4 substituent groups as described herein for alkyl groups.
- heteroalkenyl and heteroalkynyl refer to alkenyl and alkynyl groups, as defined herein, respectively, in which one or two of the constituent carbon atoms have each been replaced by nitrogen, oxygen, or sulfur.
- the heteroalkenyl and heteroalkynyl groups can be further substituted with 1 , 2, 3, or 4 substituent groups as described herein for alkyl groups.
- heteroaryl represents that subset of heterocyclyls, as defined herein, which are aromatic: i.e., they contain 4n+2 pi electrons within the mono- or multicyclic ring system.
- Exemplary unsubstituted heteroaryl groups are of 1 to 12 (e.g., 1 to 1 1 , 1 to 10, 1 to 9, 2 to 12, 2 to 11 , 2 to 10, or 2 to 9) carbons.
- the heteroaryl is substituted with 1 , 2, 3, or 4 substituents groups as defined for a heterocyclyl group.
- heteroarylalkyl refers to a heteroaryl group, as defined herein, attached to the parent molecular group through an alkylene group, as defined herein.
- exemplary unsubstituted heteroarylalkyl groups are from 2 to 32 carbons (e.g., from 2 to 22, from 2 to 18, from 2 to 17, from 2 to 16, from 3 to 15, from 2 to 14, from 2 to 13, or from 2 to 12 carbons, such as C1-6 alk-Ci-12 heteroaryl, C1-10 alk-Ci-12 heteroaryl, or C1-20 alk-Ci-12 heteroaryl).
- the alkylene and the heteroaryl each can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for the respective group.
- Heteroarylalkyl groups are a subset of heterocyclylalkyl groups.
- heterocyclyl represents a 5-, 6- or 7-membered ring, unless otherwise specified, containing one, two, three, or four heteroatoms independently selected from the group consisting of nitrogen, oxygen, and sulfur.
- the 5-membered ring has zero to two double bonds, and the 6- and 7-membered rings have zero to three double bonds.
- Exemplary unsubstituted heterocyclyl groups are of 1 to 12 (e.g., 1 to 1 1 , 1 to 10, 1 to 9, 2 to 12, 2 to 1 1 , 2 to 10, or 2 to 9) carbons.
- heterocyclyl also represents a heterocyclic compound having a bridged
- heterocyclyl includes bicyclic, tricyclic, and tetracyclic groups in which any of the above heterocyclic rings is fused to one, two, or three carbocyclic rings, e.g., an aryl ring, a cyclohexane ring, a cyclohexene ring, a cyclopentane ring, a cyclopentene ring, or another monocyclic heterocyclic ring, such as indolyl, quinolyl, isoquinolyl, tetrahydroquinolyl, benzofuryl, benzothienyl and the like.
- fused heterocyclyls include tropanes and 1 ,2,3,5,8,8a-hexahydroindolizine.
- Heterocyclics include pyrrolyl, pyrrolinyl, pyrrolidinyl, pyrazolyl, pyrazolinyl, pyrazolidinyl, imidazolyl, imidazolinyl, imidazolidinyl, pyridyl, piperidinyl, homopiperidinyl, pyrazinyl, piperazinyl, pyrimidinyl, pyridazinyl, oxazolyl, oxazolidinyl, isoxazolyl, isoxazolidiniyl, morpholinyl, thiomorpholinyl, thiazolyl, thiazolidinyl, isothiazolyl, isothiazolidinyl, indolyl, indazolyl, quinolyl, isoquinoly
- heterocyclyls include: 2,3,4,5-tetrahydro-2-oxo-oxazolyl; 2,3- dihydro-2-oxo-1 H-imidazolyl; 2,3,4,5-tetrahydro-5-oxo-1 H-pyrazolyl (e.g., 2,3,4,5-tetrahydro-2-phenyl- 5-OXO-1 H-pyrazolyl); 2,3,4,5-tetrahydro-2,4-dioxo-1 H-imidazolyl (e.g., 2,3,4,5-tetrahydro-2,4-dioxo-5- methyl-5-phenyl-1 H-imidazolyl); 2,3-dihydro-2-thioxo-1 ,3,4-oxadiazolyl (e.g., 2,3-dihydro-2-thioxo-5- phenyl-1 ,3,4-oxadiazolyl); 4,5-dihydro-5-oxo-1 H-triazoly
- heterocyclics include 3,3a,4,5,6,6a-hexahydro-pyrrolo[3,4-b]pyrrol-(2H)-yl, and 2,5-diazabicyclo[2.2.1 ]heptan-2-yl, homopiperazinyl (or diazepanyl), tetrahydropyranyl, dithiazolyl, benzofuranyl, benzothienyl, oxepanyl, thiepanyl, azocanyl, oxecanyl, and thiocanyl.
- Heterocyclic groups also include groups of the formula re
- E' is selected from the group consisting of -N- and -CH-;
- G' is selected from the group consisting of -CH- and -N-.
- any of the heterocyclyl groups mentioned herein may be optionally substituted with one, two, three, four or five substituents independently selected from the group consisting of: (1) C1-7 acyl (e.g., carboxyaldehyde ); (2) C 1-20 alkyl (e.g., C 1-6 alkyl, C 1-6 alkoxy-Ci-6 alkyl, C1-3 alkylsulfinyl-Ci-6 alkyl, amino-Ci-6 alkyl, azido-Ci-6 alkyl, (carboxyaldehyde)-Ci-6 alkyl, halo-Ci-6 alkyl (e.g., perfluoroalkyl), hydroxy-Ci-6 alkyl, nitro-Ci-6 alkyl, or C1-6 thioalkoxy-Ci-6 alkyl); (3) C1-20 alkoxy (e.g., C 1-6 alkoxy, such as perfluoroalkoxy); (4) C1-6
- alkylsulfinyl (5) Ce-io aryl; (6) amino; (7) C1-6 alk-Ce-io aryl; (8) azido; (9) C3-8 cycloalkyl; (10) C1-3 alk-C3-s cycloalkyl; (1 1) halo; (12) C 1-12 heterocyclyl (e.g., C2-12 heteroaryl); (13) (C1-12 heterocyclyl)oxy; (14) hydroxyl; (15) nitro; (16) C1-20 thioalkoxy (e.g., C1-6 thioalkoxy); (17) -(CH2) q C02R A , where q is an integer from zero to four, and R A is selected from the group consisting of (a) C1-6 alkyl, (b) Ce-10 aryl, (c) hydrogen, and (d) C1-3 alk-C6-io aryl; (18) -(CH2) q CON R B R c , where q is an integer
- the alkylene group of a Ci-alkaryl or a C i-alkheterocyclyl can be further substituted with an oxo group to afford the respective aryloyl and (heterocyclyl)oyl substituent group.
- heterocyclylalkyi represents a heterocyclyl group, as defined herein, attached to the parent molecular group through an alkylene group, as defined herein.
- exemplary unsubstituted heterocyclylalkyi groups are from 2 to 32 carbons (e.g., from 2 to 22, from 2 to 18, from 2 to 17, from 2 to 16, from 3 to 15, from 2 to 14, from 2 to 13, or from 2 to 12 carbons, such as C1-6 alk-Ci-12 heterocyclyl, C1-10 alk-Ci-12 heterocyclyl, or C1-20 alk-Ci-12 heterocyclyl).
- the alkylene and the heterocyclyl each can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for the respective group.
- hydrocarbon represents a group consisting only of carbon and hydrogen atoms.
- hydroxyl represents an -OH group.
- the hydroxyl group can be substituted with 1 , 2, 3, or 4 substituent groups (e.g., O-protecting groups) as defined herein for an alkyl.
- isomer means any tautomer, stereoisomer, enantiomer, or diastereomer of any compound of the invention. It is recognized that the compounds of the invention can have one or more chiral centers and/or double bonds and, therefore, exist as stereoisomers, such as double-bond isomers (i.e., geometric E/Z isomers) or diastereomers (e.g., enantiomers (i.e., (+) or (-)) or cis/trans isomers).
- stereoisomers such as double-bond isomers (i.e., geometric E/Z isomers) or diastereomers (e.g., enantiomers (i.e., (+) or (-)) or cis/trans isomers).
- the chemical structures depicted herein, and therefore the compounds of the invention encompass all of the corresponding stereoisomers, that is, both the stereomerically pure form (e.g., geometrically pure, enantiomerically pure, or diastereomerically pure) and enantiomeric and stereoisomeric mixtures, e.g., racemates.
- Enantiomeric and stereoisomeric mixtures of compounds of the invention can typically be resolved into their component enantiomers or stereoisomers by well-known methods, such as chiral-phase gas chromatography, chiral-phase high performance liquid chromatography, crystallizing the compound as a chiral salt complex, or crystallizing the compound in a chiral solvent.
- Enantiomers and stereoisomers can also be obtained from stereomerically or
- V-protected amino refers to an amino group, as defined herein, to which is attached one or two /V-protecting groups, as defined herein.
- V-protecting group represents those groups intended to protect an amino group against undesirable reactions during synthetic procedures. Commonly used /V-protecting groups are disclosed in Greene, "Protective Groups in Organic Synthesis,” 3 rd Edition (John Wiley & Sons, New York, 1999), which is incorporated herein by reference.
- /V-protecting groups include acyl, aryloyl, or carbamyl groups such as formyl, acetyl, propionyl, pivaloyl, t-butylacetyl, 2-chloroacetyl, 2- bromoacetyl, trifluoroacetyl, trichloroacetyl, phthalyl, o-nitrophenoxyacetyl, a-chlorobutyryl, benzoyl, 4- chlorobenzoyl, 4-bromobenzoyl, 4-nitrobenzoyl, and chiral auxiliaries such as protected or unprotected D, L or D, L-amino acids such as alanine, leucine, phenylalanine, and the like; sulfonyl-containing groups such as benzenesulfonyl, p-toluenesulfonyl, and the like; carbamate forming groups such as
- benzyloxycarbonyl p-chlorobenzyloxycarbonyl, p-methoxybenzyloxycarbonyl, p-nitrobenzyloxycarbonyl, 2-nitrobenzyloxycarbonyl, p-bromobenzyloxycarbonyl, 3,4-dimethoxybenzyloxycarbonyl,
- phenylthiocarbonyl, and the like alkaryl groups such as benzyl, triphenylmethyl, benzyloxym ethyl, and the like and silyl groups, such as trimethylsilyl, and the like.
- Preferred /V-protecting groups are formyl, acetyl, benzoyl, pivaloyl, t-butylacetyl, alanyl, phenylsulfonyl, benzyl, t-butyloxycarbonyl (Boc), and benzyloxycarbonyl (Cbz).
- nitro represents an -NO2 group.
- O-protecting group represents those groups intended to protect an oxygen containing (e.g., phenol, hydroxyl, or carbonyl) group against undesirable reactions during synthetic procedures. Commonly used O-protecting groups are disclosed in Greene, "Protective Groups in Organic Synthesis,” 3 rd Edition (John Wiley & Sons, New York, 1999), which is incorporated herein by reference.
- alkoxyalkoxycarbonyl groups such as methoxymethoxycarbonyl, ethoxymethoxycarbonyl, 2-methoxyethoxycarbonyl, 2-ethoxyethoxycarbonyl, 2-butoxyethoxycarbonyl, 2-methoxyethoxymethoxycarbonyl, allyloxycarbonyl, propargyloxycarbonyl, 2- butenoxycarbonyl, 3-methyl-2-butenoxycarbonyl, and the like; haloalkoxycarbonyls, such as 2- chloroethoxycarbonyl, 2-chloroethoxycarbonyl, 2,2,2-trichloroethoxycarbonyl, and the like; optionally substituted arylalkoxycarbonyl groups, such as benzyloxycarbonyl, p-methylbenzyloxycarbonyl, p- methoxybenzyloxycarbonyl, p-nitrobenzyloxy
- aryloxycarbonyl groups such as phenoxycarbonyl, p-nitrophenoxycarbonyl, o-nitrophenoxycarbonyl, 2,4-dinitrophenoxycarbonyl, p-methyl- phenoxycarbonyl, m-methylphenoxycarbonyl, o-bromophenoxycarbonyl, 3,5-dimethylphenoxycarbonyl, p- chlorophenoxycarbonyl, 2-chloro-4-nitrophenoxy-carbonyl, and the like); substituted alkyl, aryl, and alkaryl ethers (e.g., trityl; methylthiomethyl; methoxymethyl; benzyloxymethyl; siloxymethyl; 2,2,2,- trichloroethoxymethyl; tetrahydropyranyl; tetrahydrofuranyl; ethoxyethyl; 1 -[2-(trimethylsilyl)ethoxy]
- aryloxycarbonyl groups such as phenoxycarbonyl,
- diphenymethylsilyl diphenymethylsilyl
- carbonates e.g., methyl, methoxymethyl, 9-fluorenylmethyl; ethyl; 2,2,2- trichloroethyl; 2-(trimethylsilyl)ethyl; vinyl, allyl, nitrophenyl; benzyl; methoxybenzyl; 3,4-dimethoxybenzyl; and nitrobenzyl
- carbonyl-protecting groups e.g., acetal and ketal groups, such as dimethyl acetal, 1 ,3- dioxolane, and the like; acylal groups; and dithiane groups, such as 1 ,3-dithianes, 1 ,3-dithiolane, and the like
- carboxylic acid-protecting groups e.g., ester groups, such as methyl ester, benzyl ester, t-butyl ester, orthoesters, and the like
- perfluoro represents anyl group, as defined herein, where each hydrogen radical bound to the alkyl group has been replaced by a fluoride radical.
- perfluoroalkyl groups are exemplified by trifluoromethyl, pentafluoroethyl, and the like.
- protected hydroxyl refers to an oxygen atom bound to an O-protecting group.
- spirocyclyl represents a C2-7 alkylene diradical, both ends of which are bonded to the same carbon atom of the parent group to form a spirocyclic group, and also a C1-6 heteroalkylene diradical, both ends of which are bonded to the same atom.
- the heteroalkylene radical forming the spirocyclyl group can containing one, two, three, or four heteroatoms independently selected from the group consisting of nitrogen, oxygen, and sulfur.
- the spirocyclyl group includes one to seven carbons, excluding the carbon atom to which the diradical is attached.
- the spirocyclyl groups of the invention may be optionally substituted with 1 , 2, 3, or 4 substituents provided herein as optional substituents for cycloalkyl and/or heterocyclyl groups.
- stereoisomer refers to all possible different isomeric as well as conformational forms which a compound may possess (e.g., a compound of any formula described herein), in particular all possible stereochemically and conformationally isomeric forms, all diastereomers, enantiomers and/or conformers of the basic molecular structure. Some compounds of the present invention may exist in different tautomeric forms, all of the latter being included within the scope of the present invention.
- sulfonyl represents an -S(0)2- group.
- thiol represents an -SH group.
- the term “a” may be understood to mean “at least one”;
- the term “or” may be understood to mean “and/or”;
- the terms “comprising” and “including” may be understood to encompass itemized components or steps whether presented by themselves or together with one or more additional components or steps; and
- the terms “about” and “approximately” may be understood to permit standard variation as would be understood by those of ordinary skill in the art; and (v) where ranges are provided, endpoints are included.
- active site refers to the location on a protein (e.g., an enzyme) where substrate molecules bind and undergo a chemical reaction.
- substrate molecules bind and undergo a chemical reaction.
- residues within the active site e.g., residues that participate in binding to a natural substrate molecule.
- affinity is a measure of the tightness with which a particular ligand binds to its partner. Affinities can be measured in different ways. In some embodiments, affinity is measured by a quantitative assay. In some such embodiments, binding partner concentration may be fixed to be in excess of ligand concentration so as to mimic physiological conditions. Alternatively or additionally, in some embodiments, binding partner concentration and/or ligand concentration may be varied. In some such embodiments, affinity may be compared to a reference under comparable conditions (e.g., concentrations).
- the term "antagonist” refers to a compound that i) partially of fully inhibits, decreases or reduces the effects of a target protein (e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein); and/or ii) partially or fully inhibits, decreases, reduces, or delays one or more biological events.
- a target protein e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein
- An antagonist may be direct (in which case it exerts its influence directly upon its target) or indirect (in which case it exerts its influence by other than binding to its target; e.g., by interacting with a regulator of the target protein (e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein), for example so that level or activity of the target protein is altered).
- a regulator of the target protein e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein
- an antagonist is an inverse agonists (e.g., a compound that prevents activation of a target protein by an agonist).
- the term "agonist” refers to a compound that i) activates or increases (e.g., increases the rate of onset or occurrence) the effects of a target protein (e.g., a eukaryotic target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein); and/or ii) activates or increases (e.g., increases the rate of onset or occurrence) one or more biological events.
- a target protein e.g., a eukaryotic target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein
- ii activates or increases (e.g., increases the rate of onset or occurrence) one or more biological events.
- the target protein is a protein that is displayed (e.g., transiently displayed) on the extracellular surface of a cell (e.g., in response to a cell stimulus, such as the activation of a cell signaling pathway).
- the target protein may be an intracellular protein that is secreted to the surface of a cell in response to a cell stimulus, e.g., an intracellular protein that is secreted to the surface of a tumor cell.
- an intracellular protein e.g., a soluble intracellular protein which is at any time displayed on the surface of a cell (e.g., as a membrane-bound protein), may also be considered to be an extracellular target protein.
- antibody refers to a polypeptide whose amino acid sequence including immunoglobulins and fragments thereof which specifically bind to a designated antigen, or fragments thereof.
- Antibodies in accordance with the present invention may be of any type (e.g., IgA, IgD, IgE, IgG, or IgM) or subtype (e.g., lgA1 , lgA2, lgG1 , lgG2, lgG3, or lgG4).
- a characteristic sequence or portion of an antibody may include amino acids found in one or more regions of an antibody (e.g., variable region, hypervariable region, constant region, heavy chain, light chain, and combinations thereof).
- a characteristic sequence or portion of an antibody may include one or more polypeptide chains, and may include sequence elements found in the same polypeptide chain or in different polypeptide chains.
- antigen-binding fragment refers to a portion of an antibody that retains the binding characteristics of the parent antibody.
- the terms “approximately” and “about” are each intended to encompass normal statistical variation as would be understood by those of ordinary skill in the art as appropriate to the relevant context.
- the terms “approximately” or “about” each refer to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11 %, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1 %, or less in either direction (greater than or less than) of a stated value, unless otherwise stated or otherwise evident from the context (e.g., where such number would exceed 100% of a possible value).
- binding typically refers to association (e.g., non-covalent or covalent) between or among two or more entities.
- Direct binding involves physical contact between entities or moieties; indirect binding involves physical interaction by way of physical contact with one or more intermediate entities. Binding between two or more entities can typically be assessed in any of a variety of contexts - including where interacting entities or moieties are studied in isolation or in the context of more complex systems (e.g., while covalently or otherwise associated with a carrier entity and/or in a biological system or cell).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD).
- KD dissociation constant
- Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described below.
- KD is intended to refer to the dissociation equilibrium constant of a particular compound-protein interaction.
- the compounds of the invention bind to target proteins (e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein) with a dissociation equilibrium constant (KD) of less than about 10 6 M, such as less than approximately 10 7 M, 10 8 M, 10 9 M, or 10 10 M or even lower or between 10 7 M and 10 8 M, between 10 8 M and 10 9 M, or between 10 9 M and 10 10 M, e.g., when determined by surface plasmon resonance (SPR) technology using the target protein as the analyte and the compound as the ligand.
- KD dissociation equilibrium constant
- conjugate refers to a compound formed by the joining (e.g., via a covalent bond forming reaction) of two or more chemical compounds (e.g., a compound including a small molecule moiety and a polypeptide targeting moiety).
- cross-linking group refers to a group comprising a reactive functional group capable of chemically attaching to specific functional groups (e.g., primary amines, sulfhydryls) on proteins or other molecules.
- specific functional groups e.g., primary amines, sulfhydryls
- Many methodologies described herein include a step of "determining.” Those of ordinary skill in the art, reading the present specification, will appreciate that such "determining” can utilize or be accomplished through use of any of a variety of techniques available to those skilled in the art, including for example specific techniques explicitly referred to herein.
- determining involves manipulation of a physical sample.
- determining involves consideration and/or manipulation of data or information, for example utilizing a computer or other processing unit adapted to perform a relevant analysis.
- determining involves receiving relevant information and/or materials from a source.
- determining involves comparing one or more features of a sample or entity to a comparable reference.
- free cysteine refers to a cysteine residue present in a biologic, whether on-diagonal or off-diagonal, that is not involved in a disulfide bond.
- modulator is used to refer to an entity whose presence or level in a system in which an activity of interest is observed correlates with a change in level and/or nature of that activity as compared with that observed under otherwise comparable conditions when the modulator is absent.
- a modulator is an activator, in that activity is increased in its presence as compared with that observed under otherwise comparable conditions when the modulator is absent.
- a modulator is an antagonist or inhibitor, in that activity is reduced in its presence as compared with otherwise comparable conditions when the modulator is absent.
- a modulator interacts directly with a target entity whose activity is of interest.
- a modulator interacts indirectly (i.e., directly with an intermediate compound that interacts with the target entity) with a target entity whose activity is of interest.
- a modulator affects level of a target entity of interest; alternatively or additionally, in some embodiments, a modulator affects activity of a target entity of interest without affecting level of the target entity.
- a modulator affects both level and activity of a target entity of interest, so that an observed difference in activity is not entirely explained by or commensurate with an observed difference in level.
- a modulator is an allosteric modulator such as an allosteric agonist.
- composition represents a composition containing a compound described herein formulated with a pharmaceutically acceptable excipient.
- the pharmaceutical composition is manufactured or sold with the approval of a governmental regulatory agency as part of a therapeutic regimen for the treatment of disease in a mammal.
- Pharmaceutical compositions can be formulated, for example, for oral administration in unit dosage form (e.g., a tablet, capsule, caplet, gelcap, or syrup); for topical administration (e.g., as a cream, gel, lotion, or ointment); for intravenous administration (e.g., as a sterile solution free of particulate emboli and in a solvent system suitable for intravenous use); or in any other formulation described herein.
- a "pharmaceutically acceptable excipient,” as used herein, refers any ingredient other than the compounds described herein (for example, a vehicle capable of suspending or dissolving the active compound) and having the properties of being nontoxic and non-inflammatory in a patient.
- Excipients may include, for example: antiadherents, antioxidants, binders, coatings, compression aids, disintegrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspensing or dispersing agents, sweeteners, or waters of hydration.
- excipients include, but are not limited to: ascorbic acid, histidine, phosphate buffer, butylated hydro xytoluene (BHT), calcium carbonate, calcium phosphate (dibasic), calcium stearate, croscarmellose, crosslinked polyvinyl pyrrolidone, citric acid, crospovidone, cysteine, ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl
- pharmaceutically acceptable salt refers to those salts of the compounds described here that are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and animals without undue toxicity, irritation, allergic response and the like and are commensurate with a reasonable benefit/risk ratio.
- Pharmaceutically acceptable salts are well known in the art. For example, pharmaceutically acceptable salts are described in: Berge et al., J. Pharmaceutical Sciences 66:1 -19, 1977 and in Pharmaceutical Salts: Properties, Selection, and Use, (Eds. P.H. Stahl and C.G. Wermuth), Wiley-VCH, 2008.
- the salts can be prepared in situ during the final isolation and purification of the compounds described herein or separately by reacting the free base group with a suitable organic acid.
- the compounds of the invention may have ionizable groups so as to be capable of preparation as pharmaceutically acceptable salts.
- These salts may be acid addition salts involving inorganic or organic acids or the salts may, in the case of acidic forms of the compounds of the invention be prepared from inorganic or organic bases.
- the compounds are prepared or used as pharmaceutically acceptable salts prepared as addition products of pharmaceutically acceptable acids or bases.
- Suitable pharmaceutically acceptable acids and bases are well-known in the art, such as hydrochloric, sulphuric, hydrobromic, acetic, lactic, citric, or tartaric acids for forming acid addition salts, and potassium hydroxide, sodium hydroxide, ammonium hydroxide, caffeine, various amines, and the like for forming basic salts. Methods for preparation of the appropriate salts are well-established in the art.
- Representative acid addition salts include acetate, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, fumarate, glucoheptonate, glycerophosphate, hemisulfate, heptonate, hexanoate, hydrobromide, hydrochloride, hydroiodide, 2- hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate,
- alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium and the like, as well as nontoxic ammonium, quaternary ammonium, and amine cations, including, but not limited to ammonium, tetramethylammonium, tetraethylammonium, methylamine, dimethylamine, trimethylamine, triethylamine, ethylamine and the like.
- polypeptide refers to a string of at least two amino acids attached to one another by a peptide bond.
- a polypeptide may include at least 3-5 amino acids, each of which is attached to others by way of at least one peptide bond.
- polypeptides can include one or more "non-natural" amino acids or other entities that nonetheless are capable of integrating into a polypeptide chain.
- a polypeptide may be glycosylated, e.g., a polypeptide may contain one or more covalently linked sugar moieties.
- a single "polypeptide" e.g., an antibody polypeptide
- reactive amino acid residue refers to a natural or non-natural amino acid comprising a functional group (e.g., a nucleophilic functional group) capable of chemically attaching to specific functional groups (e.g., a cross-linking group).
- a functional group e.g., a nucleophilic functional group
- reactive amino acids include cysteine, lysine, serine, and amino acids having azides on the side chain.
- Non-reactive amino acids refers to natural or non-natural amino acids that do not contain a functional group capable of chemically attaching to specific functional groups. Examples of non-reactive amino acids include valine, alanine, isoleucine, theronine, and leucine.
- a reference compound, individual, population, sample, sequence or value is tested and/or determined substantially simultaneously with the testing or determination of the compound, individual, population, sample, sequence or value of interest.
- a reference compound, individual, population, sample, sequence or value is a historical reference, optionally embodied in a tangible medium.
- a reference compound, individual, population, sample, sequence or value is determined or characterized under conditions comparable to those utilized to determine or characterize the compound, individual, population, sample, sequence or value of interest.
- small molecule means a low molecular weight organic and/or inorganic compound.
- a "small molecule” is a molecule that is less than about 5 kilodaltons (kD) in size.
- a small molecule is less than about 4 kD, 3 kD, about 2 kD, or about 1 kD.
- the small molecule is less than about 800 daltons (D), about 600 D, about 500 D, about 400 D, about 300 D, about 200 D, or about 100 D.
- a small molecule is less than about 2000 g/mol, less than about 1500 g/mol, less than about 1000 g/mol, less than about 800 g/mol, or less than about 500 g/mol. In some embodiments, a small molecule is not a polymer. In some embodiments, a small molecule does not include a polymeric moiety. In some embodiments, a small molecule is not a protein or polypeptide (e.g., is not an oligopeptide or peptide). In some embodiments, a small molecule is not a polynucleotide (e.g., is not an oligonucleotide). In some embodiments, a small molecule is not a polysaccharide.
- a small molecule does not comprise a polysaccharide (e.g., is not a glycoprotein, proteoglycan, glycolipid, etc.). In some embodiments, a small molecule is not a lipid. In some embodiments, a small molecule is a modulating compound. In some embodiments, a small molecule is biologically active. In some embodiments, a small molecule is detectable (e.g., comprises at least one detectable moiety). In some embodiments, a small molecule is a therapeutic.
- reference to a particular compound may relate to a specific form of that compound. In some embodiments, reference to a particular compound may relate to that compound in any form. In some embodiments, where a compound is one that exists or is found in nature, that compound may be provided and/or utilized in accordance in the present invention in a form different from that in which it exists or is found in nature.
- a compound preparation including a different level, amount, or ratio of one or more individual forms than a reference preparation or source (e.g., a natural source) of the compound may be considered to be a different form of the compound as described herein.
- a preparation of a single stereoisomer of a compound may be considered to be a different form of the compound than a racemic mixture of the compound; a particular salt of a compound may be considered to be a different form from another salt form of the compound; a preparation containing one conformational isomer ((Z) or (E)) of a double bond may be considered to be a different form from one containing the other conformational isomer ((E) or (Z)) of the double bond; a preparation in which one or more atoms is a different isotope than is present in a reference preparation may be considered to be a different form; etc.
- small molecule binding site refers to a location on a protein (e.g., a GPCR, an ion channel, or an enzyme) where a small molecule is capable of binding.
- small molecule binding sites include, but are not limited to, active sites of proteins which bind natural substrates and allosteric sites on proteins which may or may not bind a natural substrate, and are distinct from the active site.
- the terms "specific binding” or “specific for” or “specific to” refer to an interaction between a binding agent and a target entity. As will be understood by those of ordinary skill, an interaction is considered to be “specific” if it is favored in the presence of alternative interactions, for example, binding with a KD of less than 1 0 ⁇ (e.g., less than 5 ⁇ , less than 1 ⁇ , less than 500 nM, less than 200 nM, less than 100 nM, less than 75 nM, less than 50 nM, less than 25 nM, less than 10 nM, between 5 ⁇ and 1 ⁇ , between 1 ⁇ and 500 nM, between 500 nM and 200 nM, between 200 nM and 100 nM, between 100 nM and 75 nM, between 75 nM and 50 nM, between 50 nM and 25 nM, between 25 nM and 10 nM).
- a KD of less than 1 0 ⁇ (e.g., less than
- specific interaction is dependent upon the presence of a particular structural feature of the target entity (e.g., an epitope, a cleft, a binding site). It is to be understood that specificity need not be absolute. In some embodiments, specificity may be evaluated relative to that of the binding agent for one or more other potential target entities (e.g., competitors). In some embodiments, specificity is evaluated relative to that of a reference specific binding agent. In some embodiments specificity is evaluated relative to that of a reference non-specific binding agent.
- a compound when used with reference to a compound having an activity, is understood by those skilled in the art to mean that the compound discriminates between potential target entities or states.
- a compound is said to bind "specifically" to its target if it binds preferentially with that target in the presence of one or more competing alternative targets.
- specificity is evaluated relative to that of a reference specific binding agent.
- specificity is evaluated relative to that of a reference non-specific binding agent.
- the agent or entity does not detectably bind to the competing alternative target under conditions of binding to its target entity.
- binding agent binds with higher on-rate, lower off-rate, increased affinity, decreased dissociation, and/or increased stability to its target entity as compared with the competing alternative target(s).
- substantially refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
- One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result.
- the term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
- target protein refers to any protein that participates in a biological pathway associated with a disease, disorder or condition.
- a target protein is a naturally-occurring protein; in some such embodiments, a target protein is naturally found in certain mammalian cells (e.g., a mammalian target protein), fungal cells (e.g., a fungal target protein), bacterial cells (e.g., a bacterial target protein) or plant cells (e.g., a plant target protein).
- Target proteins can be naturally occurring, e.g., wild type. Alternatively, the target protein can vary from the wild type protein but still retain biological function, e.g., as an allelic variant, a splice mutant or a biologically active fragment.
- a target protein is a naturally-occurring protein; in some such embodiments, a target protein is naturally found in certain mammalian cells (e.g., a mammalian target protein), fungal cells (e.g., a fungal target protein),
- the target protein is an extracellular target protein.
- Extracellular target proteins of the invention are considered to include soluble proteins, membrane-bound proteins, and/or transmembrane proteins.
- a soluble protein may be considered to include any polypeptide (e.g., a globular protein or globular protein domain) that is soluble in an aqueous medium (e.g., the cytoplasm, the extracellular fluid, lymph, or blood).
- a membrane-bound protein is considered to include any protein that is associated (e.g., by non-covalent interaction or by covalent linkage) with a cellular membrane.
- Membrane-bound proteins may also be soluble proteins that interact transiently with a membrane.
- Transmembrane proteins are considered to include any polypeptide that spans (e.g., partially spans or fully spans) a cellular membrane. Transmembrane proteins may include an extracellular domain, transmembrane domain, and/or an intracellular domain. In some embodiments, the target protein is the extracellular domain of a transmembrane protein.
- beneficial or desired results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions; diminishment of extent of disease, disorder, or condition; stabilized (i.e., not worsening) state of disease, disorder, or condition; preventing spread of disease, disorder, or condition; delay or slowing the progress of the disease, disorder, or condition; amelioration or palliation of the disease, disorder, or condition; and remission (whether partial or total), whether detectable or undetectable.
- “Palliating" a disease, disorder, or condition means that the extent and/or undesirable clinical manifestations of the disease, disorder, or condition are lessened and/or time course of the progression is slowed or lengthened, as compared to the extent or time course in the absence of treatment.
- wild-type refers to an entity having a structure and/or activity as found in nature in a "normal” (as contrasted with mutant, diseased, altered, etc) state or context. Those of ordinary skill in the art will appreciate that wild-type genes and polypeptides often exist in multiple different forms (e.g., alleles).
- solvent exposed amino acid refers to an amino acid that is accessible to the solvent surrounding the protein.
- a solvent exposed amino acid is an amino acid that when substituted does not substantially change the three-dimensional structure of the protein.
- Fig. 1A-B is diagram depicting bifunctional compounds of the invention bound to a polypeptide.
- Fig. 1 A shows a bifunctional compound bound to a polypeptide in which the polypeptide targeting moiety and the small molecule bind to the polypeptide, at least in part, at the same site.
- Fig. 1 B shows a bifunctional compound bound to a polypeptide in which the polypeptide targeting moiety and the small molecule bind to the polypeptide at distinct sites on the polypeptide.
- Fig. 2A-B is a diagram and corresponding table showing the structure and solvent exposed amino acid sites of a wild-type tenth fibronectin type III domain (Fn).
- Fig. 2A is diagram showing the NMR structure of a wild-type tenth fibronectin type III domain, solved via NMR. Frequently mutated sites (e.g., the BC, DE, and FG loops) are located on three loops (denoted by boxes). Residue T28
- Fig. 3A-C is a series of graphs showing that maleimide-fluorescein is effectively conjugated to yeast-displayed Fn with a single cysteine.
- Fig. 3A is a trace generated by fluorescence-activated cell sorting (FACS) analysis of yeast displaying either the unlabeled yeast, the cysteine-free parental Fn domain (T28), or the cysteine mutant Fn domain (T28C).
- FACS fluorescence-activated cell sorting
- FIG. 3B is a graph showing the concentration-dependent conjugation of maleimide-fluorescein to Fn-T28C.
- Fig. 3C is a graph showing the time-dependent conjugation of maleiminde-fluorescein to Fn-T28C.
- Fig. 4 is a FACS trace showing that maleimide-acetazolamide (AAZ) is effectively conjugated to yeast-displayed Fn. Conjugation with maleimide-AAZ reduced fluorescein conjugation by 70%, which is consistent with effective AAZ conjugation.
- AAZ maleimide-acetazolamide
- Fig. 5 is FACS trace showing that yeast-displayed Fn-AAZ binds carbonic anhydrase 9.
- Fig. 6A-B is graph and corresponding set of images showing that yeast-displayed Fn-AAZ is functional at multiple Fn conjugation sites.
- Fig. 6A is a graph showing the relative binding of Fn-AAZ to carbonic anhydrase 9, wherein in the AAZ is conjugated to Fn through various solvent exposed amino acids (D80, R78, R30, or T28) and using various PEG linkers of different lengths (PEG2, PEG3, PEG5, or PEG7).
- Fig. 6B is two images depicting the location of the solvent exposed amino acids used for conjugation to Fn mapped onto the structure of Fn (side-view and top view).
- Fig. 7 is a diagram showing the design for the construction of combinatorial libraries of yeast- displayed Fn.
- Fig. 8 is series of FACS traces showing that Fn and AAZ provide a mutual benefit in binding to carbonic anhydrase 9. Binding is enabled by the combination of select Fn clones and the AAZ conjugation, with longer PEG lengths enabling greater binding.
- Fig. 9 is a series of FACS traces showing that sub-libraries of yeast-displayed Fn-AAZ conjugates can be identified (boxes in upper right quandrant) which bind with high affinity to carbonic anhydrase 9.
- Fig. 10A-B is a series of FACS traces showing that yeast-displayed Fn-AAZ clones bind selectively to carbonic anhydrase 9 over carbonic anhydrase 2.
- Fig. 10A shows that Fn-AAZ clones conjugated via Cys28 are selective for carbonic anhydrase 9 over carbonic anhydrase 2.
- Fig. 10B shows that Fn-AAZ clones conjugated via Cys80 are selective for carbonic anhydrase 9 over carbonic anhydrase 2.
- Fig. 13A-C is a series of images that shows the expression and purification of an individual Fn- AAZ clone.
- Fig. 13A is a polyacrylamide gel showing the expression of an Fn-AAZ clone.
- Fig. 14A-B is a series of graphs showing the binding characteristics of each of two exemplary purified clones of Fn-AAZ to carbonic anhydrase 9.
- Fig. 14A-B is a series of graphs showing the binding characteristics of each of two exemplary purified clones of Fn-AAZ to carbonic anhydrase 9.
- Fig. 14A-B is a series of graphs showing the binding characteristics
- FIG. 14A shows that a purified Fn-AAZ clone having the amino acid sequence of SEQ ID NO. 3 (Clone 0.3.10) binds with 10-fold higher affinity to carbonic anhydrase 9 when compared to Fn that has not been conjugated to AAZ.
- Fig. 14B shows that a purified Fn-AAZ clone having the amino acid sequence of SEQ ID NO. 4 (Clone 0.3.9) binds with approximately 6-fold higher affinity to carbonic anhydrase 9 when compared to Fn that has not been conjugated to AAZ.
- Fig. 14A shows that a purified Fn-AAZ clone having the amino acid sequence of SEQ ID NO. 3 (Clone 0.3.10) binds with 10-fold higher affinity to carbonic anhydrase 9 when compared to Fn that has not been conjugated to AAZ.
- Fig. 14B shows that a purified Fn-AAZ clone having the amino acid sequence of SEQ ID
- FIG. 15 is a graph showing the % yield of yeast recovered following two rounds of FACS sorting of a yeast-displayed library of Fn domains conjugated to a cyclic peptide (CP). FACS sorting was performed to identify Fn-CP clones that bind to the polypeptide target, CXCR4.
- the small molecule moieties of the invention include low molecular weight organic and/or inorganic compounds which have affinity (e.g., low affinity) for the target protein when not covalently conjugated to the polypeptide targeting moiety.
- the small molecule moiety binds at the active site of the target protein.
- the small molecule moiety does not specifically bind to the target protein (e.g., the small molecule binds to more than one member of the family of proteins to which the target protein belongs.)
- a small molecule is an antagonist (e.g., a direct inhibitor) of the target protein.
- the small molecule is an agonist or a partial agonist (e.g., a direct agonist of partial agonist) of the target protein.
- a small molecule is not a polymer. In some embodiments, a small molecule does not include a polymeric moiety. In some embodiments, a small molecule is not a protein or polypeptide (e.g., is not an oligopeptide or peptide). In some embodiments, a small molecule is not a polynucleotide (e.g., is not an oligonucleotide). In some embodiments, a small molecule is not a polysaccharide. In some embodiments, a small molecule does not comprise a polysaccharide (e.g., is not a glycoprotein, proteoglycan, glycolipid, etc.).
- a small molecule is not a lipid. In some embodiments, a small molecule is a modulating compound. In some embodiments, a small molecule is biologically active. In some embodiments, a small molecule is detectable (e.g., comprises at least one detectable moiety). In some embodiments, a small molecule is a therapeutic.
- the small molecule moiety is a sulfonamide.
- the small molecule moiety includes the structure of Formula II:
- the small molecule moiety is a hydroxamic acid.
- the small molecule moiety includes the structure of Formula II I:
- R 2 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl.
- the small molecule moiety is a thiadiazole sulfonamide or includes a glutamate-urea-lysine moiety.
- the small molecule moiety includes the structure of Formula IV or Formula V:
- R 3 is optionally substituted C1-C6 alkyl or optionally substituted C1-C6 heteroalkyi (e.g., -NHC(O)-);
- R 4 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl Ct alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
- the small molecule moiety includes the structure:
- the small molecule moiety is a cyclic peptide.
- the small molecule moiety includes the structure of Formula VI:
- R 5 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl C1-C6 alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
- the small molecule moiety includes the structure:
- the compounds of the invention include a linker (e.g., moiety linker joining a small molecule moiety to a polypeptide targeting moiety).
- the linker component of the invention is, at its simplest, a bond, but may also provide a linear, cyclic, or branched molecular skeleton having pendant groups covalently linking two moieties.
- a linker when included in a compound and/or conjugate as described herein, achieves linking of two (or more) moieties by covalent means, involving bond formation with one or more functional groups located on either moiety.
- functional groups which may be employed for this purpose include, without limitation, amino, hydroxyl, sulfhydryl, carboxyl, carbonyl, carbohydrate groups, vicinal diols, thioethers, 2-aminoalcohols, 2-aminothiols, guanidinyl, imidazolyl, and phenolic groups.
- such covalent linking of two (or more) moieties may be effected using a linker that contains reactive moieties capable of reaction with such functional groups present in either moiety.
- a linker that contains reactive moieties capable of reaction with such functional groups present in either moiety.
- an amine group of a moiety may react with a carboxyl group of the linker, or an activated derivative thereof, resulting in the formation of an amide linking the two.
- N-Maleimide derivatives are also considered selective towards sulfhydryl groups, but may additionally be useful in coupling to amino groups under certain conditions.
- Reagents such as 2-iminothiolane (Traut et al., Biochemistry 12:3266 (1973)), which introduce a thiol group through conversion of an amino group, may be considered as sulfhydryl reagents if linking occurs through the formation of disulfide bridges.
- reactive moieties capable of reaction with amino groups include, for example, alkylating and acylating agents.
- Representative alkylating agents include:
- N-maleimide derivatives which may react with amino groups either through a Michael type reaction or through acylation by addition to the ring carbonyl group, for example, as described by Smyth et al., J. Am. Chem. Soc. 82:4600 (1960) and Biochem. J. 91 :589 (1964);
- epoxide derivatives such as epichlorohydrin and bisoxiranes, which may react with amino, sulfhydryl, or phenolic hydroxyl groups;
- Representative amino-reactive acylating agents include:
- active esters such as nitrophenylesters or N-hydroxysuccinimidyl esters
- acylazides e.g., wherein the azide group is generated from a preformed hydrazide derivative using sodium nitrite, as described by Wetz et al., Anal. Biochem. 58:347 (1974);
- haloheteroaryl groups such as halopyridine or halopyrimidine.
- Aldehydes and ketones may be reacted with amines to form Schiff's bases, which may advantageously be stabilized through reductive amination.
- Alkoxylamino moieties readily react with ketones and aldehydes to produce stable alkoxamines, for example, as described by Webb et al., in Bioconjugate Chem. 1 :96 (1990).
- reactive moieties capable of reaction with carboxyl groups include diazo compounds such as diazoacetate esters and diazoacetamides, which react with high specificity to generate ester groups, for example, as described by Herriot, Adv. Protein Chem. 3:169 (1947).
- Carboxyl modifying reagents such as carbodiimides, which react through O-acylurea formation followed by amide bond formation, may also be employed.
- So-called zero-length linkers involving direct covalent joining of a reactive chemical group of one moiety with a reactive chemical group of the other without introducing additional linking material may, if desired, be used in accordance with the invention.
- the linker will include two or more reactive moieties, as described above, connected by a spacer element.
- the presence of such a spacer permits bifunctional linkers to react with specific functional groups within either moiety, resulting in a covalent linkage between the two.
- the reactive moieties in a linker may be the same (homobifunctional linker) or different (heterobifunctional linker, or, where several dissimilar reactive moieties are present, heteromultifunctional linker), providing a diversity of potential reagents that may bring about covalent attachment between the two moieties.
- Spacer elements in the linker typically consist of linear or branched chains and may include a Ci- 10 alkyl, C2-10 alkenyl, C2-10 alkynyl, C2-6 heterocyclyl, C6-12 aryl, C7-14 alkaryl, C3-10 alkheterocyclyl, C2- C100 polyethylene glycol, or C 1-10 heteroalkyl.
- the spacer element of a linker consists of a polyethylene glycol.
- Polyethylene glycols of the invention are considered to include an alkoxy chain comprised of one or more momomer units, each monomer unit consisting of -OCH2CH2-.
- Polyethyelene glycol (PEG) is also sometimes referred to as polyethylene oxide (PEO) or polyoxyethylene (POE), and these terms may be considered interchangeable for the purpose of this invention.
- a polyethylene glycol may have the structure, -(CH2)s2(OCH2CH2)s1 (CH2)s30-, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), and each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10).
- the PEG is PEG2, PEG3, PEG5, or PEG7, wherein the subscript refers to the number of -OCH2CH2- monomer units of the PEG.
- Polyethylene glycol may also be considered to include an amino-polyethylene glycol of -
- NRN1 (CH2)s2(CH2CH20)s1 (CH2)s3NRN1 -, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each RN1 is, independently, hydrogen or optionally substituted C1 -6 alkyl.
- the linker includes a polypeptide having two or more amino acid residues.
- the linker is a polypeptide having the formula (G4S) n , where n is 1 or greater (e.g., n is 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20). In some embodiments, the linker is a polypeptide having the formula (G4S)s. In some embodiments, the linker is a polypeptide having the formula (G4S)io. In some embodiments, the linker is a polypeptide having the formula (G4S)is.
- the linker is a polypeptide having the formula (G4S) n (EAK) m , where n and m each independently have a value or 1 or greater (e.g., n is 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20).
- the linker is a polypeptide having the formula (G4S)s(EAK)s.
- the linker is a polypeptide having the formula (G4S)io(EAK)s.
- the linker is a polypeptide having the formula (G4S) n (EAK) m (G4S)k, where n, m, and k each independently have a value or 1 or greater (e.g., n is 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20). In some embodiments, the linker is a polypeptide having the formula (G4S)s(EAK)io(G4S)5.
- the linker is described by Formula V.
- homobifunctional linkers useful in the preparation of conjugates of the invention include, without limitation, diamines and diols selected from ethylenediamine, propylenediamine and hexamethylenediamine, ethylene glycol, diethylene glycol, propylene glycol, 1 ,4-butanediol, 1 ,6- hexanediol, cyclohexanediol, and polycaprolactone diol.
- the linker is a bond or a linear chain of up to 10 atoms, independently selected from carbon, nitrogen, oxygen, sulfur or phosphorous atoms, wherein each atom in the chain is optionally substituted with one or more substituents independently selected from alkyl, alkenyl, alkynyl, aryl, heteroaryl, chloro, iodo, bromo, fluoro, hydroxyl, alkoxy, aryloxy, carboxy, amino, alkylamino, dialkylamino, acylamino, carboxamido, cyano, oxo, thio, alkylthio, arylthio, acylthio, alkylsulfonate, arylsulfonate, phosphoryl, and sulfonyl, and wherein any two atoms in the chain may be taken together with the substituents bound thereto to form a ring, wherein the ring may be further substituted and/or fused
- a 1 is a bond between the linker and polypeptide targeting moiety;
- a 2 is a bond between the small molecule moiety and the linker;
- B 1 , B 2 , B 3 , and B 4 each, independently, is selected from optionally substituted C1-C2 alkyl, optionally substituted C1-C3 heteroalkyl, O, S, and NR N ;
- R N is hydrogen, optionally substituted C1-4 alkyl, optionally substituted C2-4 alkenyl, optionally substituted C2-4 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted C6-12 aryl, or optionally substituted C1-7 heteroalkyl;
- C 1 and C 2 are each, independently, selected from carbonyl, thiocarbonyl, sulphonyl, or phosphoryl;
- a, b, c, d, e, and f are each, independently, 0 or 1 ;
- D is optionally substituted C1-10
- Polypeptides include, for example, any of a variety of hematologic agents (including, for instance, erythropoietin, blood-clotting factors, etc.), interferons, colony stimulating factors, antibodies, enzymes, and hormones.
- hematologic agents including, for instance, erythropoietin, blood-clotting factors, etc.
- interferons including, for instance, erythropoietin, blood-clotting factors, etc.
- colony stimulating factors antibodies, enzymes, and hormones.
- any polypeptide of interest can be a polypeptide in the present methods.
- the polypeptide is an ion channel, such as a leukocyte ion channel (e.g., CRAC or Kv1.3), a TRP channel (e.g., TRPV1), a purinergic receptor (e.g., a P2X or P2Y receptor), or an epithelial sodium channel (ENaC).
- a leukocyte ion channel e.g., CRAC or Kv1.3
- TRP channel e.g., TRPV1
- purinergic receptor e.g., a P2X or P2Y receptor
- ENaC epithelial sodium channel
- the polypeptide is a GPCR, such as an adenosine receptor (AR), an endothelin receptor (ETR), a bradykinin receptor (BKR), an angiotensin receptor (AIR or AMR), a cannabinoid receptor (CNR), a muscarinic receptor, a neurotensin receptor (NTR), a C5a receptor (C5aR), a purinergic receptor (e.g., a P2X or P2Y receptor), calcitonin gene-related peptide receptor (CGRP-R), or glucagon-like peptide 1 receptor (GLP1 R).
- GPCR such as an adenosine receptor (AR), an endothelin receptor (ETR), a bradykinin receptor (BKR), an angiotensin receptor (AIR or AMR), a cannabinoid receptor (CNR), a muscarinic receptor, a neurotensin receptor (NTR), a C5a
- the polypeptide is an enzyme, such an enzyme of the PCSK family (e.g., furin), matriptase, prostasin, MT1 -MMP (also called MMP14), a disintegrin and metalloproteinase (ADAMS), Factor Xia, Factor D, transglutaminases 2, cathepsin S, CD73, CD39, or membrane guanylyl cyclase C.
- PCSK family e.g., furin
- matriptase e.g., prostasin
- MT1 -MMP also called MMP14
- ADAMS disintegrin and metalloproteinase
- a reference polypeptide described herein can include a target-binding domain that binds to a target of interest (e.g., binds to an antigen).
- a polypeptide such as an antibody
- the extracellular target proteins of the present invention include proteins which have a small molecule binding site (e.g., an active site).
- Exemplary molecular targets (e.g., antigens) for polypeptides described herein (e.g., antibodies) include GPCRs (e.g., Class A GPCRs such as CXCR4, Class B GPCRs, Class C
- GPCRs Class D GPCRs, Class E GPCRs and Class F GPCRs
- ion channels e.g., Trp channels, Nav 1 .7 channels, and CRAC channels
- enzymes e.g., carbonic anhydrases and metalloproteases
- An IgG antibody consists of two identical light polypeptide chains and two identical heavy polypeptide chains linked together by disulfide bonds.
- the first domain located at the amino terminus of each chain is variable in amino acid sequence, providing the antibody binding specificities found in each individual antibody. These are known as variable heavy (VH) and variable light (VL) regions.
- the other domains of each chain are relatively invariant in amino acid sequence and are known as constant heavy (CH) and constant light (CL) regions.
- the light chain includes one variable region (VL) and one constant region (CL).
- An IgG heavy chain includes a variable region (VH), a first constant region (CH1), a hinge region, a second constant region (CH2), and a third constant region (CH3).
- the heavy chain includes an additional constant region (CH4).
- Antibodies described herein can include, for example, monoclonal antibodies, polyclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, camelized antibodies, chimeric antibodies, single-chain Fvs (scFv), disulfide-linked Fvs (sdFv), and anti-idiotypic (anti-Id) antibodies, and antigen-binding fragments of any of the above.
- Antibodies can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2) or subclass.
- antigen binding fragment of an antibody refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen.
- binding fragments encompassed within the term "antigen binding fragment” of an antibody include a Fab fragment, a F(ab')2 fragment, a Fd fragment, a Fv fragment, a scFv fragment, a dAb fragment (Ward et al., (1989) Nature 341 :544-546), and an isolated complementarity determining region (CDR).
- CDR complementarity determining region
- Antibodies or fragments described herein can be produced by any method known in the art for the synthesis of antibodies (see, e.g., Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Brinkman et al., 1995, J. Immunol. Methods 182:41 -50; WO 92/22324; WO 98/46645).
- Chimeric antibodies can be produced using the methods described in, e.g., Morrison, 1985, Science 229:1202, and humanized antibodies by methods described in, e.g., U.S. Pat. No. 6,180,370.
- Additional antibodies described herein are bispecific antibodies and multivalent antibodies, as described in, e.g., Segal et al., J. Immunol. Methods 248:1 -6 (2001); and Tutt et al., J. Immunol. 147: 60 (1991).
- targeting moieties e.g., antibody-like scaffold proteins or antibody mimetics such as fibronectin type III domains, DARPins, or centyrins.
- the targeting moiety is a non-antibody protein scaffold, such as a knottin, an affibody, a green fluorescent protein, an ankryn repreat protein, an SH2 domain, or a PDZ domain.
- Exemplary protein scaffolds of the invention are described in Stern, L.A., et al., Curr. Opion. in Chem. Engineering, 2013, 2:425-432; Banta, S. et al., Annu. Rev. Biomed.
- polypeptide targeting moieties may include monobodies constructed using a fibronectin type III domain (e.g., tenth type III domain of human fibronectin).
- the polypeptide targeting moiety is a tenth type III domain of human fibronectin, or a polypeptide variant thereof, having at least 80% sequence identity with SEQ ID NO: 1 .
- the polypeptide targeting moiety is an engineered or diversified polypeptide variant of SEQ ID NO: 1 .
- the polypeptide targeting moiety may be an engineered or diversified variant of the fibronectin type III domain of SEQ ID NO: 1 , wherein the polypeptide variant includes mutations to one or more amino acids of the peptide (e.g., one or more solvent exposed amino acids of the polypeptide).
- loops BC, DE, and FG of the tenth type III domain of human fibronectin bold in SEQ ID NO.
- the polypeptide targeting moiety in an engineered or diversified variant of the tenth type III domain of human fibronectin, where the BC, DE, or FG loop regions may include one or more mutations relative to SEQ ID NO: 1 .
- the polypeptide targeting moiety is an engineered or diversified variant of the tenth type III domain of human fibronectin, having at least 80% sequence identity SEQ ID NO: 2, where "X” is any amino acid, and "m,” “n,” and “k” each, independently, have a value of 2 or greater (e.g., 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20).
- Libraries of antibody-like scaffold proteins may be generated using molecular display and directed evolution techniques known in the art such as phage display, DNA or RNA display, or yeast surface display.
- a protein or polypeptide variant, as described herein, generally has an amino acid sequence that shows significant (e.g., 80% or more, i.e., 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) identity with that of a reference polypeptide but includes a limited number of particular amino acid changes (e.g., insertions, deletions, or substitutions, either conservative or non-conservative and/or including one or more amino acid variants or analogs [e.g., D-amino acids, desamino acids]) relative to the reference polypeptide.
- significant e.g., 80% or more, i.e., 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%
- a variant shares a relevant biological activity (e.g., binding to a particular compound or moiety thereof) with the reference polypeptide; in some such embodiments, the variant displays such activity at a level that is not less than about 50% of that of the reference polypeptide and/or is not less than about 0.5 fold below that of the reference polypeptide.
- a variant polypeptide has an amino acid sequence that differs from that of a reference polypeptide at least (or only) in that the variant has a larger number of cysteine residues and/or has one or more cysteine residues at a position corresponding to a non-cysteine residue in the reference polypeptide.
- addition of one or more cysteine residues to the amino or carboxy terminus of any of a polypeptide as described herein can facilitate conjugation of such polypeptide by, e.g., disulfide bonding.
- amino acid substitutions can be conservative (i.e., wherein a residue is replaced by another of the same general type or group) or non-conservative (i.e., wherein a residue is replaced by an amino acid of another type).
- a naturally occurring amino acid can be substituted for a non-naturally occurring amino acid (i.e., non-naturally occurring conservative amino acid substitution or a non-naturally occurring non-conservative amino acid substitution), or vice versa.
- Polypeptides made synthetically can include substitutions of amino acids not naturally encoded by DNA (e.g., non-naturally occurring or unnatural amino acid).
- non-naturally occurring amino acids include D-amino acids, an amino acid having an azide-containing side chain, an amino acid having an acetylaminomethyl group attached to a sulfur atom of a cysteine, a pegylated amino acid, the omega amino acids of the formula NH2(CH2)nCOOH wherein n is 2-6, neutral nonpolar amino acids, such as sarcosine, t-butyl alanine, t-butyl glycine, N-methyl isoleucine, and norleucine.
- Phenylglycine may substitute for Trp, Tyr, or Phe; citrulline and methionine sulfoxide are neutral nonpolar, cysteic acid is acidic, and ornithine is basic. Proline may be substituted with hydro xyproline and retain the conformation conferring properties.
- Analogs may be generated by substitutional mutagenesis and retain the structure (e.g., a local structure or global structure) of the original protein. Examples of substitutions identified as “conservative substitutions” are shown in Table 1 . If such substitutions result in a change not desired, then other type of substitutions, denominated “exemplary substitutions” in Table 1 , or as further described herein in reference to amino acid classes, are introduced and the products screened.
- Substantial modifications in function or immunological identity are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the protein backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- Naturally occurring residues are divided into groups based on common side chain properties:
- Trp Tryptophan
- Tyrosine Tyrosine
- Phe Phenylalanine
- Histidine His
- Val (V) lie, Leu, Met, Phe, Ala, norleucine Leu
- a protein or polypeptide variant may include the addition of one or more reactive amino acid residues (e.g., cysteines) to a protein (e.g., at the amino or carboxy terminus of any of the proteins described herein) can facilitate conjugation of these proteins by, e.g., disulfide bonding.
- one or more reactive amino acids e.g., cysteines
- one or more reactive amino acids may be removed to decrease the number of possible conjugation sites on a protein.
- Amino acid substitutions can be conservative (i.e., wherein a residue is replaced by another of the same general type or group) or non-conservative (i.e., wherein a residue is replaced by an amino acid of another type).
- a naturally occurring amino acid can be substituted for a non-naturally occurring amino acid (i.e., non-naturally occurring conservative amino acid substitution or a non-naturally occurring non-conservative amino acid substitution).
- the compounds, small molecule moieties, and/or polypeptide targeting moieties of the invention are members of libraries.
- Libraries including the compounds, small molecule moieties, and/or polypeptide targeting moieties of the invention may be tagged to assist in identification of library members.
- the libraries may be tagged using any method known in the art such as DNA display libraries (also known as DNA-encoded libraries), RNA display libraries, yeast display libraries, or phage display libraries. Tagged libraries offer advantages such as allowing the screening of large libraries in one pot.
- the compounds, small molecule moieties, and/or polypeptide targeting moieties of the invention are members of large libraries (e.g., libraries including at least 10 5 members).
- a library of the invention includes between about 10 2 to 10 20 complexes (e.g., about 10 2 to 10 3 , 10 2 to 10 4 , 10 2 to 10 5 , 10 2 to 10 6 , 10 2 to 10 7 , 10 2 to 10 8 , 10 2 to 10 9 , 10 2 to 10 10 , 10 2 to 10 11 , 10 2 to 10 12 , 10 2 to 10 13 , 10 2 to 10 14 , 10 2 to 10 15 , 10 2 to 10 16 , 10 2 to 10 17 , 10 2 to 10 18 , 10 2 to 10 19 , 10 4 to 10 5 , 10 4 to 10 6 , 10 4 to 10 7 , 10 4 to 10 8 , 10 4 to 10 9 , 10 4 to 10 10 , 10 4 to 10 11 , 10 4 to 10 12 , 10 4 to 10 13 , 10 4 to 10 14 , 10 4 to 10 15 , 10 4 to 10 16 , 10 4 to 10 17 , 10 4 to 10 18 , 10 4 to 10 19 , 10 4 to 10 5
- libraries useful in the methods of the invention may be prepared using any method known in the art.
- libraries of polypeptide targeting moieties e.g., fibronectin type III domains
- the members of the library may be prepared with only one reactive amino acid residue or with one optimal reactive amino acid residue.
- libraries of polypeptide targeting moieties may be prepared using methods similar to those described in Woldring et al. PLoS One 10:e0138956 (2015), the methods of which are herein incorporated by reference.
- the library of polypeptide targeting moieties is a synthetic antibody library. Synthetic antibody libraries may be prepared using any method known in the art.
- a synthetic antibody library may be prepared by utilizing a CDR randomization method such as those described in Chen et al. Methods in
- the libraries of polypeptide targeting moieties may be DNA or RNA display libraries, yeast display libraries, or phage display libraries.
- Libraries of polypeptide targeting moieties may be conjugated to one or more small molecule moieties to prepare a library of bifunctional compounds for use in the methods of the invention.
- the polypeptide targeting moieties may be conjugated to the one or more small molecule moieties via a linker (e.g., a polyethylene-containing linker).
- a linker e.g., a polyethylene-containing linker.
- all of the polypeptide targeting moieties in the library are conjugated to the same small molecule moiety.
- all of the polypeptide targeting moieties in the library are conjugated to the small molecule moiety with the same linker.
- the polypeptide targeting moieties in the library are conjugated to a small molecule moiety with different linkers.
- libraries of bifunctional compounds of the invention may be screened for the ability to modulate the activity of a target protein using any method known in the art.
- libraries of bifunctional compound may be screened for activity using flow cytometry methods, magnetic selection methods, or pull down methods.
- the libraries of bifunctional compounds may be screened for activity using fluorescence based competition assays.
- libraries of bifunctional compounds may be screened using methods described in Cho et al. Protein Eng. Des. Sel. 23:567-577 (2010); Tillotson, et al. Methods 60:27-37 (2013); Wang et al. J. Immunol. Methods 304:30-42 (2005); Wang et al. Nat.
- the identity of the bifunctional compounds in the library with optimal activity may be determined utilizing any method known in the art. For example, if the bifunctional compound library is a DNA or RNA display library, the identity of the bifunctional compounds may be determined by sequencing the DNA or RNA tag on each compound. If the bifunctional compound library is a yeast display library, the identity of the bifunctional compound may be determined by sequencing the enriched yeast plasmid.
- a target protein e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein
- a target protein mediates a disease condition or a symptom of a disease condition.
- a desirable therapeutic effect can be achieved by modulating (inhibiting or increasing) its activity.
- Target proteins can be naturally occurring, e.g., wild type.
- a target protein can vary from the wild type protein but still retain biological function, e.g., as an allelic variant, a splice mutant or a biologically active fragment.
- a target protein is a transmembrane protein.
- the target protein is a GPCR.
- the target protein is a Rhodopsin-like receptor such as a protein encoded by the gene CCR1 ; CCR2; CCR3; CCR4; CCR5;
- EDNRA EDNRB
- GPR37 NMUR1 ; NMUR2; NTSR1 ; NTSR2; TRHR; GHSR; GPR39; MLNR; C3AR1 ; C5AR1 ; CMKLR1 ; FPR1 ; FPRL1 ; FPRL2; MAS1 ; MAS1 L; GPR1 ; GPR32; GPR44; GPR77; MTNR1 A;
- MTNR1 B TACR1 ; TACR2; TACR3; NPYR; NPY2R; PPYR1 ; NPY5R; PRLHR; PROKR1 ; PROKR2;
- OXFR1 SUCNR1 ; P2RY12; P2RY13; P2RY14; GPR34; GPR87; GPR171 ; PTAFR; CNR1 ; CNR2;
- LPAR1 LPAR2; LPAR3; S1 PR1 ; S1 PR2; S1 PR3; S1 PR4; S1 PR5; MC1 R; MC3R; MC4R; MC5R; MC2R;
- RGR RGR; RRH ; 5-HT; HT2RA; HT2RB; HT2RC; HTR6; ADRA1 A; ADRA1 B; ADRA1 D; ADRA2A; DARA2B;
- ADRA2C ADRB1 ; ADRB2; ADRB3; DRD1 ; DRD2; DRD3; DRD4; DRD5; TAAR1 ; TAAR2; TAAR3;
- the target protein is a Secretin receptor such as a protein encoded by the gene
- the target protein is a metabotropic glutamate receptor such as a protein encoded by the gene GRM1 ; GRM5; GRM2; GRM3; GRM4; GRM6; GRM7; or GRM8.
- the target protein is a cyclic AMP receptor.
- the target protein is a Frizzled receptor family such as a protein encoded by the gene
- the target protein is smoothened.
- the target protein is an ion channel.
- the target protein is a calcium activated potassium channel such as a protein encoded by the gene KCNMA1 ;
- the target protein is a CatSper and Two-pore channel such as a protein encoded by the gene CATPSER1 ; CATSPER2;
- the target protein is a cyclic nucleotide-regulated channels such as a protein encoded by the gene CNGA1 ; CNGA2; CNGA3;
- the target protein is an inwardly rectifying potassium channel such as a protein encoded by the gene KCNJ1 ; KCNJ2;
- the target protein is a ryanodine receptor such as a protein encoded by the gene RYR1 ; RYR2; or RYR3.
- the target protein is a transient receptor potential channel such as a protein encoded by the gene TRPAA1 ; TRPC1 ; TRPC2; TRPC3;
- TRPC4 TRPC5; TRPC6; TRPC7; TRPM1 ; TRPM2; TRPM3; TRPM4; TRPM5; TRPM6; TRPM7; TRPM8;
- the target protein is a two-P potassium channel such as a protein encoded by the gene KCNK1 ; KCNK2; KCNK3; KCNK4; KCNK5; KCNK6; KCNK7; KCNK9; KCNK10; KCNK12; KCNK13; KCNK15; KCNK16; KCNK17; or KCNK18.
- the target protein is a voltage-gated calcium channel such as a protein encoded by the gene CACNA1 S; CACNA1 C;
- the target protein is a voltage-gated potassium channel such as a protein encoded by the gene KCNA1 ; KCNA2; KCNA3; KCNA4; KCNA5; KCNA6; KCNA7; KCNA10; KCNB1 ; KCNB2; KCNC1 ; KCNC2; KCNC3; KCNC4; KCND1 ; KCND2; KCND3; KCNF1 ; KCNG1 ; KCNG1 ; KCNG2;
- KCNS3 KCNH1 ; KCNH5; KCNH2; KCNH6; KCNH7; KCNH8; KCNH3; or KCNH4.
- the target protein is a voltage-gated proton channel such as a protein encoded by the gene HVCN1.
- the target protein is a voltage-gated sodium channel such as a protein encoded by the gene SCN1A; SCN2A; SCN3A; SCN4A; SCN5A; SCN8A; SCN9A; SCN10A; or SCN11A.
- the target protein is an enzyme.
- the target protein is a oxidoreductase, dehydrogenase, luciferase, DMSO reductase, alcohol dehydrogenase (NAD), alcohol dehydrogenase (NADP), homoserine dehydrogenase, aminopropanol oxidoreductase, diacetyl reductase, glycerol dehydrogenase, propanediol-phosphate dehydrogenase, glycerol-3-phosphate dehydrogenase (NAD+), D-xylulose reductase, L-xylulose reductase, lactate dehydrogenase, malate dehydrogenase, isocitrate dehydrogenase, HMG-CoA reductase, glucose oxidase, L-gulonolactone oxidase, thiamine oxidase
- the compounds of the invention may be prepared using methods known in the art.
- a small molecule moiety may be conjugated to a linker which includes a cross-linking group (e.g., a maleimide) to produce a compound of Formula VII:
- A includes a small molecule moiety
- L is a linker; and B is a cross-linking moiety.
- the compound of Formula VII may then be reacted with a polypeptide targeting moiety including one or more reactive amino acid residues (e.g., a free cysteine, a lysine, or a non-natural amino acid).
- a polypeptide targeting moiety including one or more reactive amino acid residues (e.g., a free cysteine, a lysine, or a non-natural amino acid).
- the small molecule moiety is conjugated to the polypeptide targeting moiety in a site-specific manner.
- the site of conjugation is a solvent exposed amino acid of the polypeptide targeting moiety.
- the site of conjugation is a solvent exposed amino acid located within the polypeptide chain (e.g., a solvent exposed amino acid residue located in a solvent exposed loop).
- the site of conjugation is located at or near the terminus (e.g., within 10 amino acid residues of the C-terminus or within 10 amino acid residues of the N-terminus) of the polypeptide.
- the polypeptide targeting moiety has been modified to include a reactive amino acid residue at a specific site.
- the polypeptide targeting moiety has been modified to include no more than one reactive amino acid residue or no more than one reactive residue of a particular type (e.g., no more than one cysteine, no more than one lysine).
- the small molecule moiety when the polypeptide targeting moiety is an antibody, the small molecule moiety is conjugated via a reactive amino acid residue in a CDR (e.g., CDR1) of the antibody. In some embodiments, the small molecule moiety is conjugated to the polypeptide targeting moiety via a glycosylation site. In some embodiments, the small molecule moiety is conjugated to the polypeptide targeting moiety via a framework residue distinct from the antigen binding site.
- a free cysteine utilized to conjugate a small molecule moiety to a polypeptide targeting moiety is produced by reducing the polypeptide targeting moiety under conditions sufficient to reduce at least one disulfide bond (e.g., a disulfide bond in the CDR or a loop region of the polypeptide targeting moiety).
- the small molecule moiety may be conjugated to the polypeptide targeting moiety using methods similar to those described in Badescu, et al. Bioconjug. Chem. 25(3) :460-469 (2014); Badescu et al. Bioconjug. Chem. 25(6):1 124-1 136 (2014); Bryant et al. Mol. Pharm.
- a small molecule is conjugated to a polypeptide (e.g., via a linker) by enzymatic ligation.
- Enzymatic ligation may be performed by various techniques known to one in the art. For example, enzymatic ligation may be performed by (a) prenylation of CaaX motifs with protein farnesyltransferase (e.g., a described in Rose, M.W., et al., Biopolymers, 2005, 80, 164-171 ; and Hurwitz, H. I.; Casey, P. J. Curr. Topics Membr.
- Target proteins described herein may be useful in the methods of treating diseases or disorders related to the target proteins described herein, and, while not bound by theory, are believed to exert their desirable effects through their ability to modulate (e.g., positively or negatively modulate) the activity of a target protein (e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein).
- a target protein e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein.
- the compounds of the invention can be formulated as pharmaceutical or veterinary compositions.
- a summary of such techniques is found in Remington: The Science and Practice of Pharmacy, 21 st Edition, Lippincott Williams & Wilkins, (2005); and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York, each of which is incorporated herein by reference.
- compositions described herein may be present in amounts totaling 1 -95% by weight of the total weight of the composition.
- the composition may be provided in a dosage form that is suitable for intraarticular, oral, parenteral (e.g., intravenous, intramuscular), rectal, cutaneous, subcutaneous, topical, transdermal, sublingual, nasal, vaginal, intravesicular, intraurethral, intrathecal, epidural, aural, or ocular administration, or by injection, inhalation, or direct contact with the nasal, genitourinary, reproductive or oral mucosa.
- parenteral e.g., intravenous, intramuscular
- rectal cutaneous, subcutaneous, topical, transdermal, sublingual, nasal, vaginal, intravesicular, intraurethral, intrathecal, epidural, aural, or ocular administration, or by injection, inhalation, or direct contact with the nasal, genitourinary, reproductive or oral mucosa.
- the pharmaceutical composition may be in the form of, e.g., tablets, capsules, pills, powders, granulates, suspensions, emulsions, solutions, gels including hydrogels, pastes, ointments, creams, plasters, drenches, osmotic delivery devices, suppositories, enemas, injectables, implants, sprays, preparations suitable for iontophoretic delivery, or aerosols.
- the compositions may be formulated according to conventional pharmaceutical practice.
- compounds described herein may be used alone, or in combination with one or more other active agents.
- An example of other pharmaceuticals to combine with the compounds described herein would include pharmaceuticals for the treatment of the same indication.
- Another example of a potential pharmaceutical to combine with compounds described herein would include pharmaceuticals for the treatment of different yet associated or related symptoms or indications.
- compounds will be formulated into suitable compositions to permit facile delivery.
- Each compound of a combination therapy may be formulated in a variety of ways that are known in the art.
- the first and second agents of the combination therapy may be formulated together or separately. Desirably, the first and second agents are formulated together for the simultaneous or near simultaneous administration of the agents.
- compositions comprising an effective amount of a compound described herein and a pharmaceutically acceptable carrier or excipient, as is well known in the art.
- a composition includes at least two different pharmaceutically acceptable excipients or carriers.
- Formulations may be prepared in a manner suitable for systemic administration or topical or local administration.
- Systemic formulations include those designed for injection (e.g., intramuscular, intravenous or subcutaneous injection) or may be prepared for transdermal, transmucosal, or oral administration.
- a formulation will generally include a diluents as well as, in some cases, adjuvants, buffers, preservatives and the like.
- Compounds can be administered also in liposomal compositions or as microemulsions.
- formulations can be prepared in conventional forms as liquid solutions or suspensions or as solid forms suitable for solution or suspension in liquid prior to injection or as emulsions.
- Suitable excipients include, for example, water, saline, dextrose, glycerol and the like.
- Such compositions may also contain amounts of nontoxic auxiliary substances such as wetting or emulsifying agents, pH buffering agents and the like, such as, for example, sodium acetate, sorbitan monolaurate, and so forth.
- Systemic administration may also include relatively noninvasive methods such as the use of suppositories, transdermal patches, transmucosal delivery and intranasal administration.
- Oral administration is also suitable for compounds of the invention. Suitable forms include syrups, capsules, and tablets, as is understood in the art.
- Each compound of a combination therapy may be formulated in a variety of ways that are known in the art.
- the first and second agents of the combination therapy may be formulated together or separately.
- kits that contain, e.g., two pills, a pill and a powder, a suppository and a liquid in a vial, two topical creams, etc.
- the kit can include optional components that aid in the administration of the unit dose to subjects, such as vials for reconstituting powder forms, syringes for injection, customized IV delivery systems, inhalers, etc.
- the unit dose kit can contain instructions for preparation and administration of the compositions.
- the kit may be manufactured as a single use unit dose for one subject, multiple uses for a particular subject (at a constant dose or in which the individual compounds may vary in potency as therapy progresses); or the kit may contain multiple doses suitable for administration to multiple subjects ("bulk packaging").
- the kit components may be assembled in cartons, blister packs, bottles, tubes, and the like.
- Formulations for oral use include tablets containing the active ingredient(s) in a mixture with nontoxic pharmaceutically acceptable excipients.
- excipients may be, for example, inert diluents or fillers (e.g., sucrose, sorbitol, sugar, mannitol, microcrystalline cellulose, starches including potato starch, calcium carbonate, sodium chloride, lactose, calcium phosphate, calcium sulfate, or sodium phosphate); granulating and disintegrating agents (e.g., cellulose derivatives including microcrystalline cellulose, starches including potato starch, croscarmellose sodium, alginates, or alginic acid); binding agents (e.g., sucrose, glucose, sorbitol, acacia, alginic acid, sodium alginate, gelatin, starch, pregelatinized starch, microcrystalline cellulose, magnesium aluminum silicate, carboxymethylcellulose sodium, methylcellulose, hydroxypropyl methylcellulose, ethylcellulose,
- Two or more compounds may be mixed together in a tablet, capsule, or other vehicle, or may be partitioned.
- the first compound is contained on the inside of the tablet, and the second compound is on the outside, such that a substantial portion of the second compound is released prior to the release of the first compound.
- Formulations for oral use may also be provided as chewable tablets, or as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluents (e.g., potato starch, lactose, microcrystalline cellulose, calcium carbonate, calcium phosphate or kaolin), or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example, peanut oil, liquid paraffin, or olive oil.
- an inert solid diluents e.g., potato starch, lactose, microcrystalline cellulose, calcium carbonate, calcium phosphate or kaolin
- water or an oil medium for example, peanut oil, liquid paraffin, or olive oil.
- Powders, granulates, and pellets may be prepared using the ingredients mentioned above under tablets and capsules in a conventional manner using, e.g., a mixer, a fluid bed apparatus or a spray drying equipment.
- Dissolution or diffusion controlled release can be achieved by appropriate coating of a tablet, capsule, pellet, or granulate formulation of compounds, or by incorporating the compound into an appropriate matrix.
- a controlled release coating may include one or more of the coating substances mentioned above and/or, e.g., shellac, beeswax, glycowax, castor wax, carnauba wax, stearyl alcohol, glyceryl monostearate, glyceryl distearate, glycerol palmitostearate, ethylcellulose, acrylic resins, dl- polylactic acid, cellulose acetate butyrate, polyvinyl chloride, polyvinyl acetate, vinyl pyrrolidone, polyethylene, polymethacrylate, methylmethacrylate, 2-hydroxymethacrylate, methacrylate hydrogels, 1 ,3 butylene glycol, ethylene glycol methacrylate, and/or polyethylene glycols.
- the matrix material may also include, e.g., hydrated methylcellulose, carnauba wax and stearyl alcohol, carbopol 934, silicone, glyceryl tristearate, methyl acrylate-methyl methacrylate, polyvinyl chloride, polyethylene, and/or halogenated fluorocarbon.
- the liquid forms in which the compounds and compositions of the present invention can be incorporated for administration orally include aqueous solutions, suitably flavored syrups, aqueous or oil suspensions, and flavored emulsions with edible oils such as cottonseed oil, sesame oil, coconut oil, or peanut oil, as well as elixirs and similar pharmaceutical vehicles.
- aqueous solutions suitably flavored syrups, aqueous or oil suspensions, and flavored emulsions with edible oils such as cottonseed oil, sesame oil, coconut oil, or peanut oil, as well as elixirs and similar pharmaceutical vehicles.
- the oral dosage of any of the compounds of the combination of the invention will depend on the nature of the compound, and can readily be determined by one skilled in the art. Typically, such dosage is normally about 0.001 mg to 2000 mg per day, desirably about 1 mg to 1000 mg per day, and more desirably about 5 mg to 500 mg per day. Dosages up to 200 mg per day may be necessary.
- each drug in a combination therapy can, independently, be one to four times daily for one day to one year, and may even be for the life of the subject. Chronic, long-term administration may be indicated.
- a non-binding fibronectin type III domain is mutated to contain a single cysteine at specific positions (e.g., G79, T28, R30, R78, D80, S53, T71 , K63, or L19).
- the fibronectin type III domains are displayed on the surface of a yeast cell. For example, using the methods described in Chen et al.
- Small molecule moieties e.g., sulfonamide-containing small molecule moieties
- a cross-linking group e.g., a maleimide
- the bifunctional compounds with different small molecule moieties or different linkers may be separated.
- the bifunctional compounds are combined with a target protein (e.g., a carbonic anhydrase such as carbonic anhydrase 9 or carbonic anhydrase 2) and the binding of the bifunctional compound to the target is determined, e.g., using a fluorescence based competition assay.
- a target protein e.g., a carbonic anhydrase such as carbonic anhydrase 9 or carbonic anhydrase 2
- Bifunctional compounds identified in Example 1 which are determined to bind to the target protein are utilized as starting points for libraries.
- a library of fibronectin type III domains identified in Example 1 as resulting in bifunctional compounds capable of binding the target protein is prepared by a designed sitewise diversification strategy of the remainder of the paratope (e.g., diversification of any amino acid except the added cysteine) developed through high throughput evolution and bioinformatics. For example, diversification is conducted using methods described in Woldring et al. PLoS One 10:e0138956 (2015).
- the library of fibronectin type III domains is introduced into the yeast display system by homologous recombination.
- the displayed fibronectin type III domains are conjugated to the small molecule moieties (e.g., via a cross-linking moiety such as a maleimide-containing cross-linking moiety).
- a cross-linking moiety such as a maleimide-containing cross-linking moiety.
- Bifunctional compounds are screened for activity against target proteins, e.g., using flow cytometry, magnetic selection, or yeast pull down assays.
- bifunctional compounds are screened with flow cytometry with fluorescently labeled human lysate or yeast pull-down on adherent human cell monolayers as described in Cho et al. Protein Eng. Des. Sel. 23:567-577 (2010); Tillotson, et al. Methods 60:27-37 (2013); Wang et al. J. Immunol. Methods 304:30-42 (2005); or Wang et al. Nat. Methods 4:143-145 (2007).
- the identity of bifunctional compounds which bind to the target protein are determined by sequencing enriched yeast plasmid.
- Bifunctional compounds comprising a fibronectin type III domain (Fn) conjugated via a linker to acetazolamide (AAZ) were identified by screening yeast-displayed Fn-AAZ libraries for their ability to bind either carbonic anhydrase 9 (CA9) or carbonic anhydrase 2 (CA2). Selection of an Fn-AAZ library against CA9 produced Fn-AAZ clones that bind with high affinity to CA9, including Fn-AAZ clones that bind to CA9 with higher affinity than either Fn or AAZ, alone. Selected Fn-AAZ clones also showed increased specificity for CA9 over related carbonic anhydrase 2 (CA2). Selection of an Fn-AAZ library against CA2 produced Fn-AAZ clones that bind with high affinity to CA2. Target biotinylation
- Plasmids encoding single clones pCT-FnR (a hydrophilic fibronectin domain binder to rabbit IgG) and pCT-FnR-T28C were transformed into EBY100 yeast following the EZ yeast method (Zymo
- Plasmids were generated using standard cloning techniques.
- Transformed yeast were grown by shaking at 30°C in SD-CAA (16.8 g/L sodium citrate dihydrate, 3.9 g/L citric acid, 20.0 g/L dextrose, 6.7 g/L yeast nitrogen base, 5.0 g/L casamino acids) media and induced by transferring to SG-CAA (10.2 g/L sodium phosphate dibasic heptahydrate, 8.6 g/L sodium phosphate monobasic monohydrate, 19.0 g/L galactose, 1 .0 g/L dextrose, 6.7 g/L yeast nitrogen base, 5.0 g/L casamino acids) media and shaking for at least 4 hours at 30°C. Selection of sites for conjugation to small molecules
- Fn The structure of Fn was evaluated to select amino acids (e.g., solvent exposed amino acids) for conjugation to a small molecule (AAZ) ( Figures 2A-B).
- amino acids e.g., solvent exposed amino acids
- Maleimide-fluorescein is effectively conjugated to yeast-displayed Fn with a single cysteine.
- EBY100 yeast transformed with pCT-FnR or pCT-FnR-T28C vector, were induced to display the indicated Fn clone.
- Two million induced yeast were washed in PBS, pH 7.4 and incubated with maleimide-fluorescein in 50 ⁇ _ PBS, pH 7.4 at room temperature.
- Yeast were washed with PBS +1 g/L BSA (PBSA) and analyzed via flow cytometry.
- PBSA PBS +1 g/L BSA
- Maleimide-AAZ is effectively conjugated to yeast-displayed Fn.
- Two million induced yeast were washed in PBS, pH 7.4 and incubated with 0 or 2 ⁇ maleimide-PEG3-AAZ in PBS, pH 7.4 for 2 hours.
- Yeast were then incubated with 2 ⁇ maleimide-fluorescein in PBS, pH 7.4 for 2 hours.
- Two million induced yeast expressing selected fibronectin clones were washed in PBS, pH 6.5, then incubated in 50 ⁇ _ PBS, pH 6.5 with 0.02, 0.2, or 2 ⁇ fluorescein-5-maleimide (Pierce) or maleimide-XPEG-Acetazolamide (AAZ) for 10 minutes, 30 minutes, 1 , or 2 hours at room temperature while rocking.
- Yeast were washed 2x in 1 mL PBS, pH 7.4 +1 g/L BSA (PBSA) to remove unconjugated small molecule.
- PBSA +1 g/L BSA
- Oligonucleotides encoding the Fn-Cys yeast-displayed designed libraries were synthesized by IDT DNA Technologies, amplified by overlap extension PCR, and transformed into EBY100 by homologous recombination with the pCT vector following the protocol by Woldring, D.R., et al. PLoS One. 10:e0138956 (2015). As shown in Figure 7, the indicated sites were diversified using degenerate codons to allow the indicated amino acids. 20 * refers to a biased composition that balances amino acid frequencies observed in human antibody complementarity-determining regions as well as evolved fibronectin domains (Woldring, et al. PLOS One 2015).
- Loop lengths are varied by including or excluding codons at sites 27, 28, 55, 81 , and 82.
- site 28 was conserved as cysteine.
- site 80 was conserved as cysteine. Both libraries had 200 million transformants in yeast.
- Beads were washed 2x in PBSA, resuspended in SD-CAA media and incubated overnight while shaking at 30°C. Beads were then removed and the yeast were induced in SG-CAA for subsequent magnetic bead sorting, sorting by flow cytometry, or analysis.
- yeast-displaying Fn were conjugated with maleimide-XPEG-AAZ as described above.
- Yeast were incubated to equilibrium with indicated concentrations of biotinylated target at room temperature in sufficient volume of PBSA to ensure at least 10-fold molar excess of target to Fn.
- Primary antibody against c-MYC (9E10) was also included in the target incubation.
- Yeast were then washed in cold PBSA and incubated with streptavidin-AF647 (Thermo) and goat anti-mouse-FITC (Thermo) for 15 minutes at 4°C.
- Yeast were again washed in cold PBSA and analyzed using a BD Accuri C6 flow cytometer equipped with the standard 488 nm laser and 533/30 nm emission filter for FITC detection and the 640 nm laser and 675/25 nm emission filter for AF647 detection.
- Yeast-displayed Fn-AAZ is functional at multiple conjugation sites
- yeast-displayed Fn-AAZ is functional at multiple conjugation sites.
- Yeast displaying FnR or a single mutant (D80, R78, R30, or T28) were conjugated with maleimide- fluorescein or
- Fn-AAZ conjugates can be selected for binding to carbonic anhydrase 9
- yeast-displayed Fn-AAZ libraries were determined to bind carbonic anhydrase.
- Yeast displayed FnR or FnRT28C were conjugated with maleimide-fluorescein or maleimide- PEG3-AAZ.
- Yeast were washed and analyzed by flow cytometry. Bare yeast were also included for comparison. Dramatically increased carbonic anhydrase binding was observed for FnR-T28C + maleimide-PEG3-AAZ relative to both the non-cysteine control and the maleimide-fluorescein controlA
- Fn and AAZ provide mutual benefit in target binding.
- Yeast-displayed Fn libraries were sorted for binding to carbonic anhydrase using one magnetic bead selection (Ackerman, et al. Biotech. Prog. 2009).
- the resulting populations (Lib 0.1), as well as the FnR control, were conjugated with maleimide-PEG-AAZ (or not conjugated as a control).
- Yeast were labeled with 35.5 nM biotinylated carbonic anhydrase 9, washed, and labeled with AlexaFluor647-conjugated streptavidin.
- Yeast were also labeled with mouse anti-c-MYC antibody and AlexaFluor488-conjugated anti-mouse antibody to identify full-length Fn in the library populations (FnR lacks the c-MYC epitope). Binding is enabled by the combination of select Fn clones and the AAZ conjugation. AAZ conjugation by itself is insufficient to provide binding at this concentration in the context of FnR and many library variants. Fn variants by themselves (no AAZ) are unable to provide binding at this concentration.
- Fn-AAZ conjugates bind strongly to carbonic anhydrase 9.
- Yeast- displayed Fn libraries were sorted twice for binding to carbonic anhydrase (two bead sorts for PEG2 and PEG3 populations; one bead sort and one flow cytometric sort for PEG5 and PEG7 populations). The resulting populations were conjugated with maleimide-PEG-AAZ.
- Yeast were labeled with 0.1 or 1 nM biotinylated carbonic anhydrase 9 (0.1 nM for PEG5 and PEG7; 1 nM for PEG2 and PEG3), washed, and labeled with AlexaFluor647-conjugated streptavidin.
- Yeast were also labeled with mouse anti-c-MYC antibody and AlexaFluor488-conjugated anti-mouse antibody to identify full-length Fn in the library populations.
- Fn-AAZ clones selected for binding to carbonic anhydrase 9 were found to bind selectively to carbonic anhydrase 9 (CA9) over carbonic anhydrase 2 (CA2).
- Yeast-Fn-AAZ populations enriched for CA9 binding were induced to display Fn and conjugated with maleimide- PEG-AAZ and washed.
- Conjugated yeast were labeled with 0.1 nM biotinylated CA9 or 10 nM biotinylated CA2, washed, and labeled with AlexaFluor647-conjugated streptavidin.
- Yeast were also labeled with mouse anti-c-MYC antibody and AlexaFluor488-conjugated anti-mouse antibody to identify full-length Fn in the library populations. CA9 specific binding is observed in both the T28C libraries and the D80C libraries.
- libraries of yeast-displayed Fn-AAZ conjugates can be enriched to identify clones that bind with high affinity to carbonic anhydrase 2.
- Yeast-displayed Fn libraries were sorted twice for binding to carbonic anhydrase 2 (two bead sorts for PEG3 population; one bead sort and one flow cytometric sort for PEG5 and PEG7 populations). The resulting populations were conjugated with maleimide-PEG-AAZ.
- Yeast were labeled with 2.5 nM biotinylated carbonic anhydrase 2, washed, and labeled with AlexaFluor647-conjugated streptavidin.
- Yeast were also labeled with mouse anti-c-MYC antibody and AlexaFluor488-conjugated anti-mouse antibody to identify full-length Fn in the library populations.
- Fn-AAZ clones selected for binding to carbonic anhydrase 9 were expressed, purified, and sequenced according to methods well-known to one of skill in the art.
- Figures 13A-C show the results of an exemplary expression and purification of an Fn-AAZ clone.
- two Fn-AAZ conjugates were further characterized following expression and purification.
- a first Fn-AAZ clone (Clone 0.3.10) was identified that has 10-fold higher affinity to carbonic anhydrase 9 when compared to Fn that has not been conjugated to AAZ ( Figure 14A).
- the sequence of the selected fibronectin type III domain of the first Fn-AAZ conjugate corresponds to SEQ ID NO:3.
- a second Fn-AAZ clone (Clone 0.3.9) was identified that has approximately 6-fold higher affinity to carbonic anhydrase 9 when compared to Fn that has not been conjugated to AAZ ( Figure 14B).
- the sequence of the selected fibronectin type III domain of the second Fn-AAZ conjugate corresponds to SEQ ID NO:4.
- the sequences of the selected fibronectin type III domains of several other Fn-AAZ conjugates having high affinity and selectivity for carbonic anhydrase 9 are provided in SEQ ID NOs: 5-8.
- SEQ ID NO: 6 MASSSDSPRNLEVTNATPNSLTISWDYSYCVLYYRITYGETGGNSPSQEFTVPGYYYSATISGLKPGQDY TITVYAVTDTGDESNPISINYRTEIDKPSQGS
- Fn fibronectin type III domain
- CP cyclic peptide CXCR4 antagonist
- Figure 15 shows the % yield of yeast recovered following two rounds of FACS sorting of the yeast- displayed libraries of Fn-CPs.
- the resulting Fn-CPs are further enriched by additional rounds of sorting, and the resulting enriched populations are characterized for their ability to bind CXCR4, as previously described and by other methods known to one or skill in art.
- Individual Fn-CP clones are selected from the enriched population, and are further expressed, purified, and characterized for their ability to bind CXCR4 and related target.
- articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context.
- the invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process.
- the invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
- any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Since such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the compositions of the invention (e.g., any polynucleotide or protein encoded thereby; any method of production; any method of use) can be excluded from any one or more claims, for any reason, whether or not related to the existence of prior art.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Zoology (AREA)
- Hematology (AREA)
- Biotechnology (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Wood Science & Technology (AREA)
- Cell Biology (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Endocrinology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present disclosure provides bifunctional compounds including a polypeptide targeting moiety conjugated to a small molecule in a site-specific manner both of which bind to the same target protein resulting in potent and specific binding characteristics and methods of identifying such compounds.
Description
METHODS FOR THE IDENTIFICATION OF BIFUNCTIONAL COMPOUNDS
Background
Small molecules can provide unique activity beyond natural amino acids and proteins, for example by binding to active sites (e.g., bioactive pockets) in ion channels, GPCRs, and enzymes. Yet small molecules alone often suffer from a lack of potency, specificity, sub-optimal pharmacokinetic profiles, or other properties. Proteins have been engineered to excel at these challenges yet often lack the ability to potently impact select epitopes. The present disclosure provides compounds and methods which merge the beneficial aspects of small molecules and proteins to develop bifunctional compounds including protein and small molecule binding interfaces as potent, specific agents of extracellular targets.
Summary
The present disclosure provides bifunctional compounds including a polypeptide targeting moiety conjugated to a small molecule in a site-specific manner, both of which bind to the same target protein resulting in potent and specific binding characteristics, along with methods of identifying such compounds.
Accordingly, in a first aspect, the present disclosure provides a synthetic bifunctional compound, or a pharmaceutically acceptable salt thereof, that modulates the activity of an extracellular target protein (e.g., a soluble protein, a membrane-bound protein, or a transmembrane protein). The bifunctional compound includes a polypeptide targeting moiety (e.g., an antibody or an antigen binding fragment thereof) that binds to the extracellular target protein covalently conjugated to a small molecule moiety (e.g., a sulfonamide-containing moiety, a hydroxamic acid-containing moiety, a thiadiazole sulfonamide- containing moiety, a glutamate-urea-lysine-containing moiety, or a cyclic peptide-containing moiety) that binds to the extracellular target protein, wherein the bifunctional compound binds to the target protein with at least 5-fold greater affinity and/or 5-fold greater selectivity than the affinity of each of the polypeptide targeting moiety and the small molecule moiety alone.
In some embodiments, the polypeptide targeting moiety is an antibody or an antigen binding fragment thereof. In some embodiments, the polypeptide targeting moiety is an antibody. For example, an antibody that binds to a soluble protein, a membrane-bound protein, or a transmembrane protein. In some embodiments, the extracellular target protein is a carbonic anhydrase (e.g., carbonic anhydrase 9 or carbonic anhydrase 2), CXCR4, PSMA, or a metalloprotease. In some embodiments, the antibody is a mAB 38C2 antibody.
In some embodiments, the polypeptide targeting moiety is a fibronectin type III domain, a variable heavy chain (VH) Ab fragment, a single-chain variable fragment, a centyrin, or a DARPin. In some embodiments, the polypeptide targeting moiety is an antigen binding fragment of an antibody conjugated to a second polypeptide (e.g., human aminoguanyltransferase or a distinct variable heavy chain Ab fragment or fibronectin type III domain).
In some embodiments, the polypeptide targeting moiety does not bind at a small molecule binding site (e.g., the active site) of the extracellular target protein. In some embodiments, the polypeptide targeting moiety binds at a small molecule binding site (e.g., the active site) of the extracellular target protein. In some embodiments, the small molecule moiety binds at the active site of the extracellular target protein. In some embodiments, the small molecule moiety does not bind at the active site of the extracellular target protein. In some embodiments, the small molecule moiety and the polypeptide targeting moiety bind to different sites on the extracellular target protein (e.g., the polypeptide targeting moiety does not bind at the active site of the extracellular target protein and the small molecule does bind at the active site of the extracellular target protein).
In some embodiments, the small molecule moiety binds the extracellular target protein with low affinity (e.g., the small molecule binds with a KD greater than 200 nM) when not covalently conjugated to the polypeptide targeting moiety.
In some embodiments, the extracellular target protein belongs to a family of extracellular proteins (e.g., a family of soluble, membrane-bound proteins, or transmembrane protein) and the small molecule moiety binds to at least two members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to all members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to at least two members of the family of extracellular proteins with similar affinity (e.g., with less than 5-fold difference in affinity between the at least two members).
In some embodiments, the small molecule moiety is covalently conjugated to the polypeptide targeting moiety via a linker (e.g., via a cysteine, a lysine, or a non-natural amino acid in the polypeptide targeting moiety such as a cysteine, lysine, or non-natural amino acid in CDR1 , CDR2, or CDR3 of a variable heavy chain, a framework residue within the binding interface, or a framework residue not with in the binding interface). In some embodiments, the small molecule moiety is covalently conjugated to the polypeptide targeting moiety via a free cysteine in the polypeptide targeting moiety (e.g., CDR1 , CDR2, or CDR3 of a variable heavy chain) which is formed by reduction of a disulfide bond. In some embodiments, the polypeptide targeting moiety is modified to include a cysteine, lysine, or non-natural amino acid for conjugation to the small molecule moiety. In some embodiments, the small molecule moiety is covalently conjugated to the polypeptide targeting moiety in a site-specific manner. In some embodiments, the site of conjugation is a solvent exposed amino acid of the polypeptide targeting moiety. In some
embodiments, the linker includes a protein that does not bind to the extracellular target protein (e.g., human aminoguanyltransferase).
In some embodiments, the linker has the structure of Formula I:
A1-(B1)^(C1)g-(B2)h-(D)-(B3)i-(C2)r(B4)k-A2
Formula I
wherein A1 is a bond between the linker and polypeptide targeting moiety; A2 is a bond between the small molecule moiety and the linker; B1 , B2, B3, and B4 each, independently, is selected from optionally substituted C1-C2 alkyl, optionally substituted C1-C3 heteroalkyl, O, S, and NRN; RN is hydrogen,
optionally substituted C1-4 alkyl, optionally substituted C2-4 alkenyl, optionally substituted C2-4 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted Ce-12 aryl, or optionally substituted C1-7 heteroalkyi; C1 and C2 are each, independently, selected from carbonyl, thiocarbonyl, sulphonyl, or phosphoryl; f, g, h, I, j, and k are each, independently, 0 or 1 ; and D is optionally substituted C1-10 alkyl, optionally substituted C2-10 alkenyl, optionally substituted C2-10 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted Ce-12 aryl, optionally substituted C2-C10 polyethylene glycol, or optionally substituted C1-10 heteroalkyi, or a chemical bond linking A1-(B1)i-(C1)g-(B2)h- to -(Β3)ί-(0¾-(Β4)κ- A2.
In some embodiments, the bifunctional compound binds to the extracellular target protein pseudo-irreversibly (e.g., the off-rate of the binding of the synthetic bifunctional compound to the extracellular protein is slower than the turnover of the extracellular target protein).
In some embodiments, the synthetic bifunctional compound inhibits the activity of the extracellular target protein (e.g., the compound is an antagonist). In some embodiments, the synthetic bifunctional compound activates the activity of the extracellular target protein (e.g., the compound is an agonist or a partial agonist).
In some embodiments, the extracellular target protein is a druggable target protein. In some embodiments, the extracellular target protein has a small molecule binding site. In some embodiments, the extracellular target protein is a soluble protein. In some embodiments, the extracellular target protein is a membrane bound protein. In some embodiments, the extracellular target protein is a transmembrane protein (e.g., the extracellular domain of a transmembrane protein). In some embodiments, the extracellular target protein is a carbonic anhydrase (e.g., carbonic anhydrase 9 or carbonic anhydrase 2). In some embodiments, the small molecule moiety is a sulfonamide. For example, the small molecule moiety includes the structure of Formula II:
0
-R1-S-NH2
0
Formula II
wherein R1 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl.
In some embodiments, the extracellular target protein is a metalloprotease. In some
embodiments, the small molecule moiety is a hydroxamic acid. For example, the small molecule moiety includes the structure of Formula III:
Formula III
wherein R2 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl.
In some embodiments, the extracellular target protein is PSMA. In some embodiments, the smal molecule moiety is a thiadiazole sulfonamide or includes a glutamate-urea-lysine moiety. For example, the small molecule moiety includes the structur V:
wherein R3 is optionally substituted C1-C6 alkyl or optionally substituted C1-C6 heteroalkyi (e.g., -NHC(O)-); and
R4 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl Ct alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
In some embodiments, the small molecule moiety includes the structure:
In some embodiments, the extracellular target protein is CXCR4. In some embodiments, the small molecule moiety is a cyclic peptide. For example, the small molecule moiety includes the structure of Formula VI:
Formula VI
wherein R5 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl C1-C6 alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
In some embodiments, the small molecule moiety includes the structure:
In another aspect, the disclosure provides a method of identifying a compound that modulates the activity of a target protein (e.g., an extracellular protein such as a soluble protein, a membrane-bound protein, or a transmembrane protein). This method includes: (a) providing two or more synthetic bifunctional compounds including a polypeptide targeting moiety (e.g., an antibody or antigen binding fragment thereof) covalently conjugated to a small molecule moiety (e.g., a sulfonamide-containing moiety or a hydroxamic acid-containing moiety); (b) contacting a target protein with the two or more synthetic bifunctional compounds; and (c) determining the binding of the two or more synthetic bifunctional compounds to the target protein, wherein a compound is identified as modulating the activity of the target protein if the synthetic bifunctional compound binds to the target protein with at least 5-fold greater affinity and/or 5-fold greater selectivity than the affinity of each of the polypeptide targeting moiety and the small molecule alone.
In some embodiments, the small molecule moiety of each of the two or more synthetic bifunctional compounds is the same. In some embodiments, the polypeptide targeting moiety of each of the two or more synthetic bifunctional compounds is the same.
In some embodiments, the polypeptide targeting moiety is a fibronectin type III domain, a variable heavy chain (VH) Ab fragment, a single-chain variable fragment, a centyrin, or a DARPin. In some embodiments, the polypeptide targeting moiety is an antigen binding fragment of an antibody conjugated to a second polypeptide (e.g., human aminoguanyltransferase or a distinct variable heavy chain Ab fragment or fibronectin type III domain).
In some embodiments, the polypeptide targeting moiety does not bind at a small molecule binding site (e.g., the active site) of the extracellular target protein. In some embodiments, the polypeptide targeting moiety binds at a small molecule binding site (e.g., the active site) of the extracellular target protein. In some embodiments, the small molecule moiety binds at the active site of the extracellular target protein. In some embodiments, the small molecule moiety does not bind at the active site of the extracellular target protein. In some embodiments, the small molecule moiety and the polypeptide targeting moiety bind to different sites on the extracellular target protein (e.g., the polypeptide targeting
moiety does not bind at the active site of the extracellular target protein and the small molecule does bind at the active site of the extracellular target protein).
In some embodiments, the small molecule moiety binds the target protein with low affinity (e.g., the small molecule moiety binds with a KD greater than 200 nM) when not covalently conjugated to the polypeptide targeting moiety.
In some embodiments, the extracellular target protein belongs to a family of extracellular proteins (e.g., a family of soluble, membrane-bound proteins, or transmembrane proteins) and the small molecule moiety binds to at least two members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to all members of the family of extracellular proteins. In some embodiments, the small molecule moiety binds to at least two members of the family of extracellular proteins with similar affinity (e.g., with less than 5-fold difference in affinity between the at least two members).
In some embodiments, the small molecule moiety is covalently conjugated to the polypeptide targeting moiety via a linker (e.g., via a cysteine, a lysine, or a non-natural amino acid in the polypeptide targeting moiety such as a cysteine, lysine, or non-natural amino acid in CDR1 , CDR2, or CDR3 of a variable heavy chain, a framework residue within the binding interface, or a framework residue not within the binding interface). In some embodiments, the polypeptide targeting moiety is modified to include a cysteine, lysine, or non-natural amino acid for conjugation to the small molecule moiety. In some embodiments, the small molecule moiety is covalently conjugated to the polypeptide targeting moiety in a site-specific manner. In some embodiments, the linker includes a protein that does not bind to the extracellular target protein (e.g., human aminoguanyltransferase).
In some embodiments, the linker has the structure of Formula I:
A1-(B1)^(C1)g-(B2)h-(D)-(B3)i-(C2)r(B4)k-A2
Formula I
wherein A1 is a bond between the linker and polypeptide targeting moiety; A2 is a bond between the small molecule moiety and the linker; B1 , B2, B3, and B4 each, independently, is selected from optionally substituted C 1-C2 alkyl, optionally substituted C1-C3 heteroalkyl, O, S, and NRN; RN is hydrogen, optionally substituted C 1-4 alkyl, optionally substituted C2-4 alkenyl, optionally substituted C2-4 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted Ce-12 aryl, or optionally substituted C1-7 heteroalkyl; C1 and C2 are each, independently, selected from carbonyl, thiocarbonyl, sulphonyl, or phosphoryl; f, g, h, I, j, and k are each, independently, 0 or 1 ; and D is optionally substituted C1-10 alkyl, optionally substituted C2-10 alkenyl, optionally substituted C2-10 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted Ce-12 aryl, optionally substituted C2-C 10 polyethylene glycol, or optionally substituted C 1-10 heteroalkyl, or a chemical bond linking A1-(BV(C1)g-(BV to -(B3)i-(C2)j-(B4)k- A2.
In some embodiments, the bifunctional compound binds to the extracellular target protein pseudo-irreversibly (e.g., the off-rate of the binding of the synthetic bifunctional compound to the extracellular protein is slower than the turnover of the extracellular target protein).
In some embodiments, the synthetic bifunctional compound inhibits the activity of the extracellular target protein (e.g., the compound is an antagonist). In some embodiments, the synthetic bifunctional compound activates the activity of the extracellular target protein (e.g., the compound is an agonist or a partial agonist).
In some embodiments, the extracellular target protein is a druggable target protein. In some embodiments, the extracellular target protein has a small molecule binding site. In some embodiments, the extracellular target protein is a soluble protein. In some embodiments, the extracellular target protein is a membrane bound protein. In some embodiments, the extracellular target protein is a transmembrane protein (e.g., the extracellular domain of a transmembrane protein). In some embodiments, the extracellular target protein is a carbonic anhydrase (e.g., carbonic anhydrase 9 or carbonic anhydrase 2). In some embodiments, the small molecule moiety is a sulfonamide. For example, the small molecule moiety includes the structure of Formula II:
0
-R1-S-NH2
? I I
0
Formula II
wherein R1 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl.
In some embodimetns, the extracellular target protein is a metalloprotease. In some
embodiments, the small molecule moiety is a hydroxamic acid. For example,
Formula III
wherein R2 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl.
In some embodiments, the extracellular target protein is PSMA. In some embodiments, the small molecule moiety is a thiadiazole sulfonamide or includes a glutamate-urea-lysine moiety. For example, the small molecule moiety includes the structure of Formula IV or Formula V:
wherein R3 is optionally substituted C1-C6 alkyl or optionally substituted C1-C6 heteroalkyi -NHC(O)-); and
R4 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl Ct alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
In some embodiments, the small molecule moiety includes the structure:
In some embodiments, the extracellular target protein is CXCR4. In some embodiments, the small molecule moiety is a cyclic peptide. For example, the small molecule moiety includes the structure of Formula VI:
wherein R5 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optiona substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl C1-C alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
In some embodiments, the small molecule moiety includes the structure:
In some embodiments, the polypeptide targeting moiety is a member of a library (e.g., a DNA display library, an RNA display library, a yeast display library, or a phage display library) of polypeptide targeting moieties (e.g., a library including at least 105 polypeptide targeting moieties).
In some embodiments, the binding of the two or more synthetic bifunctional compounds to the target protein is determined using a cell-based assay.
In another aspect, the invention features a method of producing a synthetic bifunctional compound, or a pharmaceutically acceptable salt thereof, that modulates the activity of an extracellular target protein (e.g., a soluble protein, a membrane-bound protein, or a transmembrane protein), wherein the bifunctional compound includes a polypeptide targeting moiety (e.g., an antibody or an antigen binding fragment thereof) that binds to the extracellular target protein covalently conjugated to a small molecule moiety (e.g., a sulfonamide-containing moiety or a hydroxamic acid-containing moiety) that binds to the extracellular target protein, wherein the bifunctional compound binds to the target protein with at least 5-fold greater affinity and/or 5-fold greater selectivity than the affinity of each of the polypeptide targeting moiety and the small molecule moiety alone. The method includes (a) providing (i) a polypeptide targeting moiety; and (ii) a small molecule moiety, wherein at least one of the polypeptide targeting moiety or the small molecule moiety is covalently conjugated to a linker which includes a cross- linking moiety; and (b) reacting the polypeptide targeting moiety and small molecule moiety under conditions sufficient to produce the synthetic bifunctional compound, or a pharmaceutically acceptable salt thereof.
In some embodiments, wherein the small molecule moiety is covalently conjugated to a linker which includes a cross-linking moiety. For example, the method includes reacting (a) a compound having the structure of Formula VII:
A-L-B
Formula VII
wherein A includes a small molecule moiety;
L is a linker; and
B is a cross-linking moiety;
with (b) a polypeptide targeting moiety;
under conditions sufficient to result in covalent conjugation between the compound of Formula VII and the polypeptide targeting moiety.
In some embodiments, the cross-linking moiety is a thiol-reactive cross-linking moiety (e.g., a maleimide-containing cross-linking moiety). In some embodiments, the cross-linking moiety is an amine- reactive cross-linking moiety (e.g., a succinimide-containing cross-linking moiety).
In some embodiments, the cross-linking group includes a maleimide, e.g., the cross-linking group includes the structure:
In some embodiments, the cross-linking group includes a succinimide, e.g., the cross-linking group includes the structure:
In some embodiments, the small molecule moiety is covalently conjugated to the polypeptide targeting moiety via a linker (e.g., via a cysteine, a lysine, or a non-natural amino acid in the polypeptide targeting moiety such as a cysteine, lysine, or non-natural amino acid in CDR1 , CDR2, or CDR3 of a variable heavy chain, a framework residue within the binding interface, or a framework residue not with in the binding interface). In some embodiments, the polypeptide targeting moiety is modified to include a cysteine, lysine, or non-natural amino acid for conjugation to the small molecule moiety. In some embodiments, the small molecule moiety is covalently conjugated to the polypeptide targeting moiety in a site-specific manner. In some embodiments, the linker includes a protein that does not bind to the extracellular target protein (e.g., human aminoguanyltransferase).
In some embodiments, the method further includes reducing the polypeptide targeting moiety under conditions sufficient to reduce at least one disulfide bond prior to reacting the polypeptide targeting moiety with the compound of Formula VII.
In some embodiments, the linker has the structure of Formula I:
A1-(B1)^(C1)g-(B2)h-(D)-(B3)i-(C2)r(B4)k-A2
Formula I
wherein A1 is a bond between the linker and polypeptide targeting moiety; A2 is a bond between the small molecule moiety and the linker; B1 , B2, B3, and B4 each, independently, is selected from optionally substituted C1-C2 alkyl, optionally substituted C1-C3 heteroalkyl, O, S, and NRN; RN is hydrogen, optionally substituted C1-4 alkyl, optionally substituted C2-4 alkenyl, optionally substituted C2-4 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted C6-12 aryl, or optionally substituted C1-7 heteroalkyl; C1 and C2 are each, independently, selected from carbonyl, thiocarbonyl, sulphonyl, or phosphoryl; f, g, h, I, j, and k are each, independently, 0 or 1 ; and D is optionally substituted C1-10 alkyl, optionally substituted C2-10 alkenyl, optionally substituted C2-10 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted Ce-12 aryl, optionally substituted C2-C10 polyethylene glycol, or optionally substituted C1-10 heteroalkyl, or a chemical bond linking A1-(BV(C1)g-(BV to -(B3)i-(C2)j-(B4)k- A2.
In another aspect, the disclosure provides a method of producing a synthetic bifunctional compound, or a pharmaceutically acceptable salt thereof, that modulates the activity of an extracellular
target protein (e.g., a soluble protein, a membrane-bound protein, or a transmembrane protein). The bifunctional compound includes a polypeptide targeting moiety (e.g., an antibody or an antigen binding fragment thereof) that binds to the extracellular target protein covalently conjugated to a small molecule moiety (e.g., a sulfonamide-containing moiety, a hydroxamic acid-containing moiety, a thiadiazole sulfonamide-containing moiety, a glutamate-urea-lysine-containing moiety, or a cyclic peptide-containing moiety) that binds to the extracellular target protein, wherein the bifunctional compound binds to the target protein with at least 5-fold greater affinity and/or 5-fold greater selectivity than the affinity of each of the polypeptide targeting moiety and the small molecule moiety alone.
In some embodiments, the method includes generating a library of synthetic bifunctional compounds (e.g., by the methods described herein). The library of synthetic bifunctional compounds may be produced, for example, by sitewise diversification (e.g., mutagenesis) of a polypeptide targeting moiety (e.g. a fibronectin type III domain) to produce a diversified library of the polypeptide targeting moiety. The resulting library of the polypeptide targeting moiety may be displayed, for example, on the surface of yeast by yeast display, e.g., as described herein. The library of the polypeptide targeting moiety may be conjugated to the small molecule (e.g., via a linker) by chemical ligation or enzymatic ligation. In some embodiments, the small molecule is conjugated to the polypeptide targeting moiety via a polypeptide linker, and the conjugation of the polypeptide linker to the polypeptide targeting moiety is done by enzymatic ligation.
In some embodiments, the method includes screening a library of synthetic bifunctional compounds for their ability to bind to a target protein (e.g., by the methods described herein).
Chemical Terms
Those skilled in the art will appreciate that certain compounds described herein can exist in one or more different isomeric (e.g., stereoisomers, geometric isomers, tautomers) and/or isotopic (e.g., in which one or more atoms has been substituted with a different isotope of the atom, such as hydrogen substituted for deuterium) forms. Unless otherwise indicated or clear from context, a depicted structure can be understood to represent any such isomeric or isotopic form, individually or in combination.
Compounds described herein can be asymmetric (e.g., having one or more stereocenters). All stereoisomers, such as enantiomers and diastereomers, are intended unless otherwise indicated.
Compounds of the present disclosure that contain asymmetrically substituted carbon atoms can be isolated in optically active or racemic forms. Methods on how to prepare optically active forms from optically active starting materials are known in the art, such as by resolution of racemic mixtures or by stereoselective synthesis. Many geometric isomers of olefins, C=N double bonds, and the like can also be present in the compounds described herein, and all such stable isomers are contemplated in the present disclosure. Cis and trans geometric isomers of the compounds of the present disclosure are described and may be isolated as a mixture of isomers or as separated isomeric forms.
In some embodiments, one or more compounds depicted herein may exist in different tautomeric forms. As will be clear from context, unless explicitly excluded, references to such compounds encompass all such tautomeric forms. In some embodiments, tautomeric forms result from the swapping of a single bond with an adjacent double bond and the concomitant migration of a proton. In certain embodiments, a tautomeric form may be a prototropic tautomer, which is an isomeric protonation states having the same empirical formula and total charge as a reference form. Examples of moieties with prototropic tautomeric forms are ketone - enol pairs, amide - imidic acid pairs, lactam - lactim pairs, amide - imidic acid pairs, enamine - imine pairs, and annular forms where a proton can occupy two or more positions of a heterocyclic system, such as, 1 H- and 3H-imidazole, 1 H-, 2H- and 4H- 1 ,2,4-triazole, 1 H- and 2H- isoindole, and 1 H- and 2H-pyrazole. In some embodiments, tautomeric forms can be in equilibrium or sterically locked into one form by appropriate substitution. In certain embodiments, tautomeric forms result from acetal interconversion, e.g., the interconversion illustrated in the scheme below:
Those skilled in the art will appreciate that, in some embodiments, isotopes of compounds described herein may be prepared and/or utilized in accordance with the present invention. "Isotopes" refers to atoms having the same atomic number but different mass numbers resulting from a different number of neutrons in the nuclei. For example, isotopes of hydrogen include tritium and deuterium. In some embodiments, an isotopic substitution (e.g., substitution of hydrogen with deuterium) may alter the physicochemical properties of the molecules, such as metabolism and/or the rate of racemization of a chiral center.
As is known in the art, many chemical entities (in particular many organic molecules and/or many small molecules) can adopt a variety of different solid forms such as, for example, amorphous forms and/or crystalline forms (e.g., polymorphs, hydrates, solvates, etc). In some embodiments, such entities may be utilized in any form, including in any solid form. In some embodiments, such entities are utilized in a particular form, for example in a particular solid form.
In some embodiments, compounds described and/or depicted herein may be provided and/or utilized in salt form.
In certain embodiments, compounds described and/or depicted herein may be provided and/or utilized in hydrate or solvate form.
At various places in the present specification, substituents of compounds of the present disclosure are disclosed in groups or in ranges. It is specifically intended that the present disclosure include each and every individual subcombination of the members of such groups and ranges. For example, the term "C 1-6 alkyl" is specifically intended to individually disclose methyl, ethyl, C3 alkyl, C4 alkyl, C5 alkyl, and C6 alkyl. Furthermore, where a compound includes a plurality of positions at which
substitutes are disclosed in groups or in ranges, unless otherwise indicated, the present disclosure is intended to cover individual compounds and groups of compounds (e.g., genera and subgenera) containing each and every individual subcombination of members at each position.
Herein a phrase of the form "optionally substituted X" (e.g., optionally substituted alkyl) is intended to be equivalent to "X, wherein X is optionally substituted" (e.g., "alkyl, wherein said alkyl is optionally substituted"). It is not intended to mean that the feature "X" (e.g. alkyl) per se is optional.
The term "alkyl," as used herein, refers to saturated hydrocarbon groups containing from 1 to 20 (e.g., from 1 to 10 or from 1 to 6) carbons. In some embodiments, an alkyl group is unbranched (i.e., is linear); in some embodiments, an alkyl group is branched. Alkyl groups are exemplified by methyl, ethyl, n- and iso-propyl, n-, sec-, iso- and tert-butyl, neopentyl, and the like, and may be optionally substituted with one, two, three, or, in the case of alkyl groups of two carbons or more, four substituents
independently selected from the group consisting of: (1) C 1-6 alkoxy; (2) C1-6 alkylsulfinyl; (3) amino, as defined herein (e.g., unsubstituted amino (i.e., -N H2) or a substituted amino (i.e., -N(RN 1)2, where RN1 is as defined for amino); (4) C6-10 aryl-Ci-6 alkoxy; (5) azido; (6) halo; (7) (C2-9 heterocyclyl)oxy; (8) hydroxyl, optionally substituted with an O-protecting group; (9) nitro; (10) oxo (e.g., carboxyaldehyde or acyl); (1 1) C1-7 spirocyclyl; (12) thioalkoxy; (13) thiol; (14) -C02RA , optionally substituted with an O-protecting group and where RA is selected from the group consisting of (a) C1-20 alkyl (e.g., C1-6 alkyl), (b) C2-20 alkenyl (e.g., C2-6 alkenyl), (c) C6-10 aryl, (d) hydrogen, (e) C 1-6 alk-Ce-10 aryl, (f) amino-Ci-20 alkyl, (g) polyethylene glycol of -(CH2)s2(OCH2CH2)si(CH2)s30R', wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and R' is H or C1-20 alkyl, and (h) amino-polyethylene glycol of - NRN 1 (CH2)s2(CH2CH20)si(CH2)s3NRN1 , wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each RN1 is, independently, hydrogen or optionally substituted C1-6 alkyl; (15) -C(0)NRB Rc , where each of RB and Rc is, independently, selected from the group consisting of (a) hydrogen, (b) C1-6 alkyl, (c) Ce-10 aryl, and (d) C1-3 alk-C6-io aryl; (16) -S02RD , where RD is selected from the group consisting of (a) C1-3 alkyl, (b) C6-10 aryl, (c) C1-6 alk-Ce-ιο aryl, and (d) hydroxyl; (17) - S02NRE RF , where each of RE and RF is, independently, selected from the group consisting of (a) hydrogen, (b) C1-6 alkyl, (c) Ce-10 aryl and (d) C1-6 alk-C6-io aryl; (18) -C(0)RG , where RG is selected from the group consisting of (a) C1-20 alkyl (e.g., C1-6 alkyl), (b) C2-20 alkenyl (e.g., C2-6 alkenyl), (c) Ce-10 aryl, (d) hydrogen, (e) C1-6 alk-C6-io aryl, (f) amino-Ci-20 alkyl, (g) polyethylene glycol of - (CH2)s2(OCH2CH2)si(CH2)s30R', wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and R' is H or C1-20 alkyl, and (h) amino-polyethylene glycol of - NRN 1 (CH2)s2(CH2CH20)si(CH2)s3N RN 1 , wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each RN1 is, independently, hydrogen or optionally substituted C1-6 alkyl;
(19) -NRH C(0)R' , wherein RH is selected from the group consisting of (a1) hydrogen and (b1) C1-6 alkyl, and R' is selected from the group consisting of (a2) C1-20 alkyl (e.g., C1-6 alkyl), (b2) C2-20 alkenyl (e.g., C2- 6 alkenyl), (c2) Ce-10 aryl, (d2) hydrogen, (e2) C1-3 alk-C6-io aryl, (f2) amino-Ci-20 alkyl, (g2) polyethylene glycol of -(CH2)s2(OCH2CH2)si(CH2)s30R', wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and R' is H or C1-20 alkyl, and (h2) amino-polyethylene glycol of - NRN 1 (CH2)s2(CH2CH20)si(CH2)s3NRN1 , wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each RN1 is, independently, hydrogen or optionally substituted C1-6 alkyl; (20) -NRJC(0)ORK , wherein RJ is selected from the group consisting of (a1) hydrogen and (b1) C1-3 alkyl, and RK is selected from the group consisting of (a2) C1-20 alkyl (e.g., C 1-6 alkyl), (b2) C2-20 alkenyl (e.g., C2- 6 alkenyl), (c2) Ce-10 aryl, (d2) hydrogen, (e2) C1-3 alk-C6-io aryl, (f2) amino-Ci-20 alkyl, (g2) polyethylene glycol of -(CH2)s2(OCH2CH2)si(CH2)s30R', wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and R' is H or C1-20 alkyl, and (h2) amino-polyethylene glycol of -
NRN 1 (CH2)s2(CH2CH20)si(CH2)s3N RN 1 , wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each RN1 is, independently, hydrogen or optionally substituted C1-6 alkyl; (21) amidine; and (22) silyl groups such as trimethylsilyl, t-butyldimethylsilyl, and tri-isopropylsilyl. In some embodiments, each of these groups can be further substituted as described herein. For example, the alkylene group of a Ci-alkaryl can be further substituted with an oxo group to afford the respective aryloyl substituent.
The term "alkylene" and the prefix "alk-," as used herein, represent a saturated divalent hydrocarbon group derived from a straight or branched chain saturated hydrocarbon by the removal of two hydrogen atoms, and is exemplified by methylene, ethylene, isopropylene, and the like. The term "C* y alkylene" and the prefix "Cx-y alk-" represent alkylene groups having between x and y carbons.
Exemplary values for x are 1 , 2, 3, 4, 5, and 6, and exemplary values for y are 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, or 20 (e.g., C1-6, C 1-10, C2-20, C2-6, C2-10, or C2-20 alkylene). In some embodiments, the alkylene can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for an alkyl group.
The term "alkenyl," as used herein, represents monovalent straight or branched chain groups of, unless otherwise specified, from 2 to 20 carbons (e.g., from 2 to 6 or from 2 to 10 carbons) containing one or more carbon-carbon double bonds and is exemplified by ethenyl, 1 -propenyl, 2-propenyl, 2-methyl-1 - propenyl, 1 -butenyl, 2-butenyl, and the like. Alkenyls include both cis and trans isomers. Alkenyl groups may be optionally substituted with 1 , 2, 3, or 4 substituent groups that are selected, independently, from amino, aryl, cycloalkyl, or heterocyclyl (e.g., heteroaryl), as defined herein, or any of the exemplary alkyl substituent groups described herein.
The term "alkynyl," as used herein, represents monovalent straight or branched chain groups from 2 to 20 carbon atoms (e.g., from 2 to 4, from 2 to 6, or from 2 to 10 carbons) containing a carbon- carbon triple bond and is exemplified by ethynyl, 1 -propynyl, and the like. Alkynyl groups may be optionally substituted with 1 , 2, 3, or 4 substituent groups that are selected, independently, from aryl, cycloalkyl, or heterocyclyl (e.g., heteroaryl), as defined herein, or any of the exemplary alkyl substituent groups described herein.
The term "amino," as used herein, represents -N(RN1)2, wherein each RN1 is, independently, H, OH, N02, N(RN2)2, S02ORN2, S02RN2, SORN2, an /V-protecting group, alkyl, alkenyl, alkynyl, alkoxy, aryl, alkaryl, cycloalkyl, alkcycloalkyl, carboxyalkyl (e.g., optionally substituted with an O-protecting group, such as optionally substituted arylalkoxycarbonyl groups or any described herein), sulfoalkyl, acyl (e.g., acetyl, trifluoroacetyl, or others described herein), alkoxycarbonylalkyl (e.g., optionally substituted with an O- protecting group, such as optionally substituted arylalkoxycarbonyl groups or any described herein), heterocyclyl (e.g., heteroaryl), or alkheterocyclyl (e.g., alkheteroaryl), wherein each of these recited RN1 groups can be optionally substituted, as defined herein for each group; or two RN1 combine to form a heterocyclyl or an /V-protecting group, and wherein each RN2 is, independently, H, alkyl, or aryl. The amino groups of the invention can be an unsubstituted amino (i.e., -NH2) or a substituted amino (i.e., - N(RN1)2). In a preferred embodiment, amino is -NH2 or -NHRN1 , wherein RN1 is, independently, OH, NO2, NH2, NRN22, S02ORN2, S02RN2, SORN2, alkyl, carboxyalkyl, sulfoalkyl, acyl (e.g., acetyl, trifluoroacetyl, or others described herein), alkoxycarbonylalkyl (e.g., t-butoxycarbonylalkyl) or aryl, and each RN2 can be H, C1-20 alkyl (e.g., C1-6 alkyl), or Ce-10 aryl.
The term "amino acid," as described herein, refers to a molecule having a side chain, an amino group, and an acid group (e.g., a carboxy group 0f -CO2H or a sulfo group 0f -SO3H), wherein the amino acid is attached to the parent molecular group by the side chain, amino group, or acid group (e.g., the side chain). As used herein, the term "amino acid" in its broadest sense, refers to any compound and/or substance that can be incorporated into a polypeptide chain, e.g., through formation of one or more peptide bonds. In some embodiments, an amino acid has the general structure H2N-C(H)(R)-COOH. In some embodiments, an amino acid is a naturally-occurring amino acid. In some embodiments, an amino acid is a synthetic amino acid; in some embodiments, an amino acid is a D-amino acid; in some embodiments, an amino acid is an L-amino acid. "Standard amino acid" refers to any of the twenty standard L-amino acids commonly found in naturally occurring peptides. "Nonstandard amino acid" refers to any amino acid, other than the standard amino acids, regardless of whether it is prepared synthetically or obtained from a natural source. In some embodiments, an amino acid, including a carboxy- and/or amino-terminal amino acid in a polypeptide, can contain a structural modification as compared with the general structure above. For example, in some embodiments, an amino acid may be modified by methylation, amidation, acetylation, and/or substitution as compared with the general structure. In some embodiments, such modification may, for example, alter the circulating half life of a polypeptide containing the modified amino acid as compared with one containing an otherwise identical unmodified
amino acid. In some embodiments, such modification does not significantly alter a relevant activity of a polypeptide containing the modified amino acid, as compared with one containing an otherwise identical unmodified amino acid. As will be clear from context, in some embodiments, the term "amino acid" is used to refer to a free amino acid; in some embodiments it is used to refer to an amino acid residue of a polypeptide. In some embodiments, the amino acid is attached to the parent molecular group by a carbonyl group, where the side chain or amino group is attached to the carbonyl group. In some embodiments, the amino acid is an a-amino acid. In certain embodiments, the amino acid is a β-amino acid. In some embodiments, the amino acid is a γ-amino acid. Exemplary side chains include an optionally substituted alkyl, aryl, heterocyclyl, alkaryl, alkheterocyclyl, aminoalkyl, carbamoylalkyl, and carboxyalkyl. Exemplary amino acids include alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, hydroxynorvaline, isoleucine, leucine, lysine, methionine, norvaline, ornithine, phenylalanine, proline, pyrrolysine, selenocysteine, serine, taurine, threonine, tryptophan, tyrosine, and valine. Amino acid groups may be optionally substituted with one, two, three, or, in the case of amino acid groups of two carbons or more, four substituents independently selected from the group consisting of: (1) C1-6 alkoxy; (2) C 1-6 alkylsulfinyl; (3) amino, as defined herein (e.g., unsubstituted amino (i.e., -N H2) or a substituted amino (i.e., -N(RN 1)2, where RN1 is as defined for amino); (4) Ce-10 aryl-Ci-6 alkoxy; (5) azido; (6) halo; (7) (C2-9 heterocyclyl)oxy; (8) hydroxyl; (9) nitro; (10) oxo (e.g., carboxyaldehyde or acyl); (1 1) C1-7 spirocyclyl; (12) thioalkoxy; (13) thiol; (14) -C02RA , where RA is selected from the group consisting of (a) C1-20 alkyl (e.g., C1-6 alkyl), (b) C2-20 alkenyl (e.g., C2-6 alkenyl), (c) Ce-10 aryl, (d) hydrogen, (e) C1-3 alk-Ce-ιο aryl, (f) amino-Ci-20 alkyl, (g) polyethylene glycol of -
(CH2)s2(OCH2CH2)si(CH2)s30R', wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and R' is H or C1-20 alkyl, and (h) amino-polyethylene glycol of - NRN 1 (CH2)s2(CH2CH20)si(CH2)s3NRN1 , wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each RN1 is, independently, hydrogen or optionally substituted C1-6 alkyl; (15) -C(0)NRB Rc , where each of RB and Rc is, independently, selected from the group consisting of (a) hydrogen, (b) C1-6 alkyl, (c) Ce-10 aryl, and (d) C1-3 alk-C6-io aryl; (16) -S02RD , where RD is selected from the group consisting of (a) C1-3 alkyl, (b) Ce-ιο aryl, (c) C1-6 alk-Ce-ιο aryl, and (d) hydroxyl; (17) - S02NRE RF , where each of RE and RF is, independently, selected from the group consisting of (a) hydrogen, (b) C1-6 alkyl, (c) Ce-ιο aryl and (d) C1-6 alk-Ce-ιο aryl; (18) -C(0)RG , where RG is selected from the group consisting of (a) C1-20 alkyl (e.g., C1-6 alkyl), (b) C2-20 alkenyl (e.g., C2-6 alkenyl), (c) Ce-ιο aryl, (d) hydrogen, (e) C1-6 alk-Ce-ιο aryl, (f) amino-Ci-20 alkyl, (g) polyethylene glycol of - (CH2)s2(OCH2CH2)si(CH2)s30R', wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and R' is H or C1-20 alkyl, and (h) amino-polyethylene glycol of - NRN 1 (CH2)s2(CH2CH20)si(CH2)s3N RN 1 , wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to
4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each RN1 is, independently, hydrogen or optionally substituted C1-6 alkyl;
(19) -NRH C(0)R' , wherein RH is selected from the group consisting of (a1) hydrogen and (b1) C1-6 alkyl, and R' is selected from the group consisting of (a2) C1-20 alkyl (e.g., C1-6 alkyl), (b2) C2-20 alkenyl (e.g., C2- 6 alkenyl), (c2) Ce-10 aryl, (d2) hydrogen, (e2) C1-3 alk-C6-io aryl, (f2) amino-Ci-20 alkyl, (g2) polyethylene glycol of -(CH2)s2(OCH2CH2)si(CH2)s30R', wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and R' is H or C1-20 alkyl, and (h2) amino-polyethylene glycol of - NRN 1 (CH2)s2(CH2CH20)si(CH2)s3NRN1 , wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each RN1 is, independently, hydrogen or optionally substituted C1-6 alkyl;
(20) -NRJC(0)ORK , wherein RJ is selected from the group consisting of (a1) hydrogen and (b1) C1-3 alkyl, and RK is selected from the group consisting of (a2) C1-20 alkyl (e.g., C 1-6 alkyl), (b2) C2-20 alkenyl (e.g., C2- 6 alkenyl), (c2) Ce-10 aryl, (d2) hydrogen, (e2) C1-3 alk-C6-io aryl, (f2) amino-Ci-20 alkyl, (g2) polyethylene glycol of -(CH2)s2(OCH2CH2)si(CH2)s30R', wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and R' is H or C1-20 alkyl, and (h2) amino-polyethylene glycol of - NRN 1 (CH2)s2(CH2CH20)si(CH2)s3N RN 1 , wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each RN1 is, independently, hydrogen or optionally substituted C1-6 alkyl; and (21) amidine. In some embodiments, each of these groups can be further substituted as described herein.
The term "N-alkylated amino acids" as used herein, refers to amino acids containing an optionally substituted Ci to C6 alkyl on the nitrogen of the amino acid that forms the peptidic bond. N-alkylated amino acids include, but are not limited to, N-methyl amino acids, such as N-methyl-alanine, N-methyl- threonine, N-methyl-phenylalanine, N-methyl-aspartic acid, N-methyl-valine, N-methyl-leucine, N-methyl- glycine, N-methyl-isoleucine, N(a)-methyl-lysine, N(a)-methyl-asparagine, and N(a)-methyl-glutamine.
The term "aryl," as used herein, represents a mono-, bicyclic, or multicyclic carbocyclic ring system having one or two aromatic rings and is exemplified by phenyl, naphthyl, 1 ,2-dihydronaphthyl, 1 ,2,3,4-tetrahydronaphthyl, anthracenyl, phenanthrenyl, fluorenyl, indanyl, indenyl, and the like, and may be optionally substituted with 1 , 2, 3, 4, or 5 substituents independently selected from the group consisting of: (1) C1-7 acyl (e.g., carboxyaldehyde); (2) C1-20 alkyl (e.g., C1-6 alkyl, C1-6 alkoxy-Ci-6 alkyl, Ci- 6 a Ikylsulfinyl-C 1-6 alkyl, amino-Ci-6 alkyl, azido-Ci-6 alkyl, (carboxyaldehyde)-Ci-6 alkyl, halo-Ci-6 alkyl (e.g., perfluoroalkyl), hydroxy-Ci-6 alkyl, nitro-Ci-6 alkyl, or C 1-6 thioalkoxy-Ci-6 alkyl); (3) C1-20 alkoxy (e.g., C1-6 alkoxy, such as perfluoroalkoxy); (4) C1-3 alkylsulfinyl; (5) C6-10 aryl; (6) amino; (7) C1-3 alk-C6-io aryl; (8) azido; (9) C3-8 cycloalkyl; (10) C1-6 alk-C3-8 cycloalkyl; (1 1) halo; (12) C1-12 heterocyclyl (e.g., C1-12 heteroaryl); (13) (C 1-12 heterocyclyl)oxy; (14) hydroxyl; (15) nitro; (16) C1-20 thioalkoxy (e.g., C1-6
thioalkoxy); (17) -(CH2)qC02RA , where q is an integer from zero to four, and RA is selected from the group consisting of (a) C1-3 alkyl, (b) C6-10 aryl, (c) hydrogen, and (d) C 1-6 alk-C6-i o aryl; (18) - (CH2)qCONRB Rc , where q is an integer from zero to four and where RB and Rc are independently selected from the group consisting of (a) hydrogen, (b) C1-6 alkyl, (c) Ce-10 aryl, and (d) C1-6 alk-Ce-10 aryl; (19) -(CH2)qS02RD , where q is an integer from zero to four and where RD is selected from the group consisting of (a) alkyl, (b) Ce-10 aryl, and (c) alk-Ce-ι ο aryl; (20) -(CH2)qS02N RE RF , where q is an integer from zero to four and where each of RE and RF is, independently, selected from the group consisting of (a) hydrogen, (b) C i-e alkyl, (c) Ce-i o aryl, and (d) Ci-e alk-Ce-io aryl; (21) thiol; (22) Ce-i o aryloxy; (23) C3-8 cycloalkoxy; (24) Ce-10 aryl-Ci-3 alkoxy; (25) C1-6 alk-Ci-12 heterocyclyl (e.g., C1-6 alk-Ci-12 heteroaryl); (26) C2-20 alkenyl; and (27) C2-20 alkynyl. In some embodiments, each of these groups can be further substituted as described herein. For example, the alkylene group of a C i-alkaryl or a Ci-alkheterocyclyl can be further substituted with an oxo group to afford the respective aryloyl and (heterocyclyl)oyl substituent group.
The "arylalkyl" group, which as used herein, represents an aryl group, as defined herein, attached to the parent molecular group through an alkylene group, as defined herein. Exemplary unsubstituted arylalkyl groups are from 7 to 30 carbons (e.g., from 7 to 16 or from 7 to 20 carbons, such as C1-6 alk-C6-io aryl, C1-10 alk-Ce-ιο aryl, or C1-20 alk-Ce-ι ο aryl). In some embodiments, the alkylene and the aryl each can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for the respective groups. Other groups preceded by the prefix "alk-" are defined in the same manner, where "alk" refers to a C1-6 alkylene, unless otherwise noted, and the attached chemical structure is as defined herein.
The term "azido" represents an -IM3 group, which can also be represented as -N=N=N .
The terms "carbocyclic" and "carbocyclyl," as used herein, refer to an optionally substituted C3-12 monocyclic, bicyclic, or tricyclic non-aromatic ring structure in which the rings are formed by carbon atoms. Carbocyclic structures include cycloalkyl, cycloalkenyl, and cycloalkynyl groups.
The "carbocyclylalkyi" group, which as used herein, represents a carbocyclic group, as defined herein, attached to the parent molecular group through an alkylene group, as defined herein. Exemplary unsubstituted carbocyclylalkyi groups are from 7 to 30 carbons (e.g., from 7 to 16 or from 7 to 20 carbons, such as C1-6 alk-C6-io carbocyclyl, C1-10 alk-C6-i o carbocyclyl, or C1-20 alk-C6-i o carbocyclyl). In some embodiments, the alkylene and the carbocyclyl each can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for the respective groups. Other groups preceded by the prefix "alk- " are defined in the same manner, where "alk" refers to a C1-6 alkylene, unless otherwise noted, and the attached chemical structure is as defined herein.
The term "carbonyl," as used herein, represents a C(O) group, which can also be represented as c=o.
The term "carboxy," as used herein, means -CO2H .
The term "cyano," as used herein, represents an -CN group.
The term "cycloalkyi," as used herein represents a monovalent saturated or unsaturated non- aromatic cyclic hydrocarbon group from three to eight carbons, unless otherwise specified, and is exemplified by cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, bicycle heptyl, and the like. When the cycloalkyi group includes one carbon-carbon double bond, the cycloalkyi group can be referred to as a "cycloalkenyl" group. Exemplary cycloalkenyl groups include cyclopentenyl, cyclohexenyl, and the like. The cycloalkyi groups of this invention can be optionally substituted with: (1) C1-7 acyl (e.g., carboxyaldehyde); (2) C1-20 alkyl (e.g., C1-6 alkyl, C1-6 alkoxy-Ci-6 alkyl, C1-6 alkylsulfinyl-Ci e alkyl, amino- C1-6 alkyl, azido-Ci-6 alkyl, (carboxyaldehyde)-Ci-6 alkyl, halo-Ci-6 alkyl (e.g., perfluoroalkyl), hydroxy-Ci-6 alkyl, nitro-Ci-6 alkyl, or Ci-6 thioalkoxy-Ci-6 alkyl); (3) C1-20 alkoxy (e.g., C1-6 alkoxy, such as
perfluoroalkoxy); (4) C1-3 alkylsulfinyl; (5) C6-10 aryl; (6) amino; (7) C1-3 alk-Ce-ιο aryl; (8) azido; (9) C3-8 cycloalkyi; (10) C1-6 alk-C3-s cycloalkyi; (1 1) halo; (12) C1-12 heterocyclyl (e.g., C1-12 heteroaryl); (13) (C1-12 heterocyclyl)oxy; (14) hydroxyl; (15) nitro; (16) C1-20 thioalkoxy (e.g., C1-6 thioalkoxy); (17) -(CH2)qC02RA , where q is an integer from zero to four, and RA is selected from the group consisting of (a) C1-6 alkyl, (b) C6-10 aryl, (c) hydrogen, and (d) C1-6 alk-Ce-10 aryl; (18) -(CH2)qCONRB Rc , where q is an integer from zero to four and where RB and Rc are independently selected from the group consisting of (a) hydrogen, (b) C6-10 alkyl, (c) C6-10 aryl, and (d) C1-6 alk-C6-io aryl; (19) -(CH2)qS02RD , where q is an integer from zero to four and where RD is selected from the group consisting of (a) C6-10 alkyl, (b) C6-10 aryl, and (c) C1-6 alk-C6- 10 aryl; (20) -(CH2)qS02NRE RF , where q is an integer from zero to four and where each of RE and RF is, independently, selected from the group consisting of (a) hydrogen, (b) Ce-10 alkyl, (c) Ce-10 aryl, and (d) Ci- 6 alk-Ce-10 aryl; (21) thiol; (22) Ce-10 aryloxy; (23) C3-8 cycloalkoxy; (24) Ce-10 aryl-Ci-e alkoxy; (25) Ci-e alk- C1-12 heterocyclyl (e.g., C1-6 alk-Ci-12 heteroaryl); (26) oxo; (27) C2-20 alkenyl; and (28) C2-20 alkynyl. In some embodiments, each of these groups can be further substituted as described herein. For example, the alkylene group of a Ci-alkaryl or a Ci-alkheterocyclyl can be further substituted with an oxo group to afford the respective aryloyl and (heterocyclyl)oyl substituent group.
The "cycloalkylalkyl" group, which as used herein, represents a cycloalkyi group, as defined herein, attached to the parent molecular group through an alkylene group, as defined herein (e.g., an alkylene group of from 1 to 4, from 1 to 6, from 1 to 10, or form 1 to 20 carbons). In some embodiments, the alkylene and the cycloalkyi each can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for the respective group.
The term "diastereomer," as used herein means stereoisomers that are not mirror images of one another and are non-superimposable on one another.
The term "enantiomer," as used herein, means each individual optically active form of a compound of the invention, having an optical purity or enantiomeric excess (as determined by methods standard in the art) of at least 80% (i.e., at least 90% of one enantiomer and at most 10% of the other enantiomer), preferably at least 90% and more preferably at least 98%.
The term "halo," as used herein, represents a halogen selected from bromine, chlorine, iodine, or fluorine.
The term "heteroalkyl," as used herein, refers to an alkyl group, as defined herein, in which one or two of the constituent carbon atoms have each been replaced by nitrogen, oxygen, or sulfur. In some embodiments, the heteroalkyl group can be further substituted with 1 , 2, 3, or 4 substituent groups as described herein for alkyl groups. The terms "heteroalkenyl" and heteroalkynyl," as used herein refer to alkenyl and alkynyl groups, as defined herein, respectively, in which one or two of the constituent carbon atoms have each been replaced by nitrogen, oxygen, or sulfur. In some embodiments, the heteroalkenyl and heteroalkynyl groups can be further substituted with 1 , 2, 3, or 4 substituent groups as described herein for alkyl groups.
The term "heteroaryl," as used herein, represents that subset of heterocyclyls, as defined herein, which are aromatic: i.e., they contain 4n+2 pi electrons within the mono- or multicyclic ring system.
Exemplary unsubstituted heteroaryl groups are of 1 to 12 (e.g., 1 to 1 1 , 1 to 10, 1 to 9, 2 to 12, 2 to 11 , 2 to 10, or 2 to 9) carbons. In some embodiment, the heteroaryl is substituted with 1 , 2, 3, or 4 substituents groups as defined for a heterocyclyl group.
The term "heteroarylalkyl" refers to a heteroaryl group, as defined herein, attached to the parent molecular group through an alkylene group, as defined herein. Exemplary unsubstituted heteroarylalkyl groups are from 2 to 32 carbons (e.g., from 2 to 22, from 2 to 18, from 2 to 17, from 2 to 16, from 3 to 15, from 2 to 14, from 2 to 13, or from 2 to 12 carbons, such as C1-6 alk-Ci-12 heteroaryl, C1-10 alk-Ci-12 heteroaryl, or C1-20 alk-Ci-12 heteroaryl). In some embodiments, the alkylene and the heteroaryl each can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for the respective group. Heteroarylalkyl groups are a subset of heterocyclylalkyl groups.
The term "heterocyclyl," as used herein represents a 5-, 6- or 7-membered ring, unless otherwise specified, containing one, two, three, or four heteroatoms independently selected from the group consisting of nitrogen, oxygen, and sulfur. The 5-membered ring has zero to two double bonds, and the 6- and 7-membered rings have zero to three double bonds. Exemplary unsubstituted heterocyclyl groups are of 1 to 12 (e.g., 1 to 1 1 , 1 to 10, 1 to 9, 2 to 12, 2 to 1 1 , 2 to 10, or 2 to 9) carbons. The term "heterocyclyl" also represents a heterocyclic compound having a bridged
multicyclic structure in which one or more carbons and/or heteroatoms bridges two non-adjacent members of a monocyclic ring, e.g., a quinuclidinyl group. The term "heterocyclyl" includes bicyclic, tricyclic, and tetracyclic groups in which any of the above heterocyclic rings is fused to one, two, or three carbocyclic rings, e.g., an aryl ring, a cyclohexane ring, a cyclohexene ring, a cyclopentane ring, a cyclopentene ring, or another monocyclic heterocyclic ring, such as indolyl, quinolyl, isoquinolyl, tetrahydroquinolyl, benzofuryl, benzothienyl and the like. Examples of fused heterocyclyls include tropanes and 1 ,2,3,5,8,8a-hexahydroindolizine. Heterocyclics include pyrrolyl, pyrrolinyl, pyrrolidinyl, pyrazolyl, pyrazolinyl, pyrazolidinyl, imidazolyl, imidazolinyl, imidazolidinyl, pyridyl, piperidinyl, homopiperidinyl, pyrazinyl, piperazinyl, pyrimidinyl, pyridazinyl, oxazolyl, oxazolidinyl, isoxazolyl, isoxazolidiniyl, morpholinyl, thiomorpholinyl, thiazolyl, thiazolidinyl, isothiazolyl, isothiazolidinyl, indolyl, indazolyl, quinolyl, isoquinolyl, quinoxalinyl, dihydroquinoxalinyl, quinazolinyl, cinnolinyl,
phthalazinyl, benzimidazolyl, benzothiazolyl, benzoxazolyl, benzothiadiazolyl, furyl, thienyl, thiazolidinyl, isothiazolyl, triazolyl, tetrazolyl, oxadiazolyl (e.g., 1 ,2,3-oxadiazolyl), purinyl, thiadiazolyl (e.g., 1 ,2,3-thiadiazolyl), tetrahydrofuranyl, dihydrofuranyl, tetrahydrothienyl, dihydrothienyl, dihydroindolyl, dihydroquinolyl, tetrahydroquinolyl, tetrahydroisoquinolyl, dihydroisoquinolyl, pyranyl, dihydropyranyl, dithiazolyl, benzofuranyl, isobenzofuranyl, benzothienyl, and the like, including dihydro and tetrahydro forms thereof, where one or more double bonds are reduced and replaced with hydrogens. Still other exemplary heterocyclyls include: 2,3,4,5-tetrahydro-2-oxo-oxazolyl; 2,3- dihydro-2-oxo-1 H-imidazolyl; 2,3,4,5-tetrahydro-5-oxo-1 H-pyrazolyl (e.g., 2,3,4,5-tetrahydro-2-phenyl- 5-OXO-1 H-pyrazolyl); 2,3,4,5-tetrahydro-2,4-dioxo-1 H-imidazolyl (e.g., 2,3,4,5-tetrahydro-2,4-dioxo-5- methyl-5-phenyl-1 H-imidazolyl); 2,3-dihydro-2-thioxo-1 ,3,4-oxadiazolyl (e.g., 2,3-dihydro-2-thioxo-5- phenyl-1 ,3,4-oxadiazolyl); 4,5-dihydro-5-oxo-1 H-triazolyl (e.g., 4,5-dihydro-3-methyl-4-amino 5-oxo- 1 H-triazolyl); 1 ,2,3,4-tetrahydro-2,4-dioxopyridinyl (e.g., 1 ,2,3,4-tetrahydro-2,4-dioxo-3,3- diethylpyridinyl); 2,6-dioxo-piperidinyl (e.g., 2,6-dioxo-3-ethyl-3-phenylpiperidinyl); 1 ,6-dihydro-6- oxopyridiminyl; 1 ,6-dihydro-4-oxopyrimidinyl (e.g., 2-(methylthio)-1 ,6-dihydro-4-oxo-5- methylpyrimidin-1 -yl); 1 ,2,3,4-tetrahydro-2,4-dioxopyrimidinyl (e.g., 1 ,2,3,4-tetrahydro-2,4-dioxo-3- ethylpyrimidinyl); 1 ,6-dihydro-6-oxo-pyridazinyl (e.g., 1 ,6-dihydro-6-oxo-3-ethylpyridazinyl); 1 ,6- dihydro-6-oxo-1 ,2,4-triazinyl (e.g., 1 ,6-dihydro-5-isopropyl-6-oxo-1 ,2,4-triazinyl); 2,3-dihydro-2-oxo- 1 H-indolyl (e.g., 3,3-dimethyl-2,3-dihydro-2-oxo-1 H-indolyl and 2,3-dihydro-2-oxo-3,3'-spiropropane- 1 H-indol-1 -yl); 1 ,3-dihydro-1 -oxo-2H-iso-indolyl; 1 ,3-dihydro-1 ,3-dioxo-2H-iso-indolyl; 1 H- benzopyrazolyl (e.g., l -(ethoxycarbonyl)- 1 H-benzopyrazolyl); 2,3-dihydro-2-oxo-1 H-benzimidazolyl (e.g., 3-ethyl-2,3-dihydro-2-oxo-1 H-benzimidazolyl); 2,3-dihydro-2-oxo-benzoxazolyl (e.g., 5-chloro- 2,3-dihydro-2-oxo-benzoxazolyl); 2,3-dihydro-2-oxo-benzoxazolyl; 2-oxo-2H-benzopyranyl; 1 ,4- benzodioxanyl; 1 ,3-benzodioxanyl; 2,3-dihydro-3-oxo,4H-1 ,3-benzothiazinyl; 3,4-dihydro-4-oxo-3H- quinazolinyl (e.g., 2-methyl-3,4-dihydro-4-oxo-3H-quinazolinyl); 1 ,2,3,4-tetrahydro-2,4-dioxo-3H- quinazolyl (e.g., 1 -ethyl-1 ,2,3,4-tetrahydro-2,4-dioxo-3H-quinazolyl); 1 ,2,3,6-tetrahydro-2,6-dioxo-7H- purinyl (e.g., 1 ,2,3,6-tetrahydro-1 ,3-dimethyl-2,6-dioxo-7 H -purinyl); 1 ,2,3,6-tetrahydro-2,6-dioxo-1 H -purinyl (e.g., 1 ,2,3,6-tetrahydro-3,7-dimethyl-2,6-dioxo-1 H -purinyl); 2-oxobenz[c,cf]indolyl; 1 ,1 - dioxo-2H-naphth[1 ,8-c,cf]isothiazolyl; and 1 ,8-naphthylenedicarboxamido. Additional heterocyclics include 3,3a,4,5,6,6a-hexahydro-pyrrolo[3,4-b]pyrrol-(2H)-yl, and 2,5-diazabicyclo[2.2.1 ]heptan-2-yl, homopiperazinyl (or diazepanyl), tetrahydropyranyl, dithiazolyl, benzofuranyl, benzothienyl, oxepanyl, thiepanyl, azocanyl, oxecanyl, and thiocanyl. Heterocyclic groups also include groups of the formula
re
E' is selected from the group consisting of -N- and -CH-; F' is selected from the group consisting of -N=CH-, -NH-CH2-, -NH-C(O)-, -NH-, -CH=N-, -CH2-IMH-, -C(0)-NH-, -CH=CH-, -CH2-, -CH2CH2-, - CH2O-, -OCH2-, -0-, and -S-; and G' is selected from the group consisting of -CH- and -N-. Any of the
heterocyclyl groups mentioned herein may be optionally substituted with one, two, three, four or five substituents independently selected from the group consisting of: (1) C1-7 acyl (e.g., carboxyaldehyde ); (2) C 1-20 alkyl (e.g., C 1-6 alkyl, C 1-6 alkoxy-Ci-6 alkyl, C1-3 alkylsulfinyl-Ci-6 alkyl, amino-Ci-6 alkyl, azido-Ci-6 alkyl, (carboxyaldehyde)-Ci-6 alkyl, halo-Ci-6 alkyl (e.g., perfluoroalkyl), hydroxy-Ci-6 alkyl, nitro-Ci-6 alkyl, or C1-6 thioalkoxy-Ci-6 alkyl); (3) C1-20 alkoxy (e.g., C 1-6 alkoxy, such as perfluoroalkoxy); (4) C1-6
alkylsulfinyl; (5) Ce-io aryl; (6) amino; (7) C1-6 alk-Ce-io aryl; (8) azido; (9) C3-8 cycloalkyl; (10) C1-3 alk-C3-s cycloalkyl; (1 1) halo; (12) C 1-12 heterocyclyl (e.g., C2-12 heteroaryl); (13) (C1-12 heterocyclyl)oxy; (14) hydroxyl; (15) nitro; (16) C1-20 thioalkoxy (e.g., C1-6 thioalkoxy); (17) -(CH2)qC02RA , where q is an integer from zero to four, and RA is selected from the group consisting of (a) C1-6 alkyl, (b) Ce-10 aryl, (c) hydrogen, and (d) C1-3 alk-C6-io aryl; (18) -(CH2)qCON RB Rc , where q is an integer from zero to four and where RB and Rc are independently selected from the group consisting of (a) hydrogen, (b) C1-3 alkyl, (c) C6-10 aryl, and (d) C1-6 alk-C6-io aryl; (19) -(CH2)qS02RD , where q is an integer from zero to four and where RD is selected from the group consisting of (a) C1-6 alkyl, (b) C6-10 aryl, and (c) C1-6 alk-Ce-10 aryl; (20) - (CH2)qS02NRE RF , where q is an integer from zero to four and where each of RE and RF is,
independently, selected from the group consisting of (a) hydrogen, (b) C 1-6 alkyl, (c) C6-10 aryl, and (d) C1-6 alk-Ce-io aryl; (21) thiol; (22) Ce-io aryloxy; (23) C3-8 cycloalkoxy; (24) arylalkoxy; (25) C1-6 alk-Ci-12 heterocyclyl (e.g., C1-6 alk-Ci-12 heteroaryl); (26) oxo; (27) (C1-12 heterocyclyl)imino; (28) C2-20 alkenyl; and (29) C2-20 alkynyl. In some embodiments, each of these groups can be further substituted as described herein. For example, the alkylene group of a Ci-alkaryl or a C i-alkheterocyclyl can be further substituted with an oxo group to afford the respective aryloyl and (heterocyclyl)oyl substituent group.
The "heterocyclylalkyi" group, which as used herein, represents a heterocyclyl group, as defined herein, attached to the parent molecular group through an alkylene group, as defined herein. Exemplary unsubstituted heterocyclylalkyi groups are from 2 to 32 carbons (e.g., from 2 to 22, from 2 to 18, from 2 to 17, from 2 to 16, from 3 to 15, from 2 to 14, from 2 to 13, or from 2 to 12 carbons, such as C1-6 alk-Ci-12 heterocyclyl, C1-10 alk-Ci-12 heterocyclyl, or C1-20 alk-Ci-12 heterocyclyl). In some embodiments, the alkylene and the heterocyclyl each can be further substituted with 1 , 2, 3, or 4 substituent groups as defined herein for the respective group.
The term "hydrocarbon," as used herein, represents a group consisting only of carbon and hydrogen atoms.
The term "hydroxyl," as used herein, represents an -OH group. In some embodiments, the hydroxyl group can be substituted with 1 , 2, 3, or 4 substituent groups (e.g., O-protecting groups) as defined herein for an alkyl.
The term "isomer," as used herein, means any tautomer, stereoisomer, enantiomer, or diastereomer of any compound of the invention. It is recognized that the compounds of the invention can have one or more chiral centers and/or double bonds and, therefore, exist as stereoisomers, such as double-bond isomers (i.e., geometric E/Z isomers) or diastereomers (e.g., enantiomers (i.e., (+) or (-)) or cis/trans isomers). According to the invention, the chemical structures depicted herein, and therefore the
compounds of the invention, encompass all of the corresponding stereoisomers, that is, both the stereomerically pure form (e.g., geometrically pure, enantiomerically pure, or diastereomerically pure) and enantiomeric and stereoisomeric mixtures, e.g., racemates. Enantiomeric and stereoisomeric mixtures of compounds of the invention can typically be resolved into their component enantiomers or stereoisomers by well-known methods, such as chiral-phase gas chromatography, chiral-phase high performance liquid chromatography, crystallizing the compound as a chiral salt complex, or crystallizing the compound in a chiral solvent. Enantiomers and stereoisomers can also be obtained from stereomerically or
enantiomerically pure intermediates, reagents, and catalysts by well-known asymmetric synthetic methods.
The term "/V-protected amino," as used herein, refers to an amino group, as defined herein, to which is attached one or two /V-protecting groups, as defined herein.
The term "/V-protecting group," as used herein, represents those groups intended to protect an amino group against undesirable reactions during synthetic procedures. Commonly used /V-protecting groups are disclosed in Greene, "Protective Groups in Organic Synthesis," 3rd Edition (John Wiley & Sons, New York, 1999), which is incorporated herein by reference. /V-protecting groups include acyl, aryloyl, or carbamyl groups such as formyl, acetyl, propionyl, pivaloyl, t-butylacetyl, 2-chloroacetyl, 2- bromoacetyl, trifluoroacetyl, trichloroacetyl, phthalyl, o-nitrophenoxyacetyl, a-chlorobutyryl, benzoyl, 4- chlorobenzoyl, 4-bromobenzoyl, 4-nitrobenzoyl, and chiral auxiliaries such as protected or unprotected D, L or D, L-amino acids such as alanine, leucine, phenylalanine, and the like; sulfonyl-containing groups such as benzenesulfonyl, p-toluenesulfonyl, and the like; carbamate forming groups such as
benzyloxycarbonyl, p-chlorobenzyloxycarbonyl, p-methoxybenzyloxycarbonyl, p-nitrobenzyloxycarbonyl, 2-nitrobenzyloxycarbonyl, p-bromobenzyloxycarbonyl, 3,4-dimethoxybenzyloxycarbonyl,
3,5-dimethoxybenzyloxycarbonyl, 2,4-dimethoxybenzyloxycarbonyl, 4-methoxybenzyloxycarbonyl, 2-nitro- 4,5-dimethoxybenzyloxycarbonyl, 3,4,5-trimethoxybenzyloxycarbonyl, 1 -(p-biphenylyl)-l - methylethoxycarbonyl, a,a-dimethyl-3,5-dimethoxybenzyloxycarbonyl, benzhydryloxy carbonyl, t- butyloxycarbonyl, diisopropylmethoxycarbonyl, isopropyloxycarbonyl, ethoxycarbonyl, methoxycarbonyl, allyloxycarbonyl, 2,2,2,-trichloroethoxycarbonyl, phenoxycarbonyl, 4-nitrophenoxy carbonyl, fluorenyl-9- methoxycarbonyl, cyclopentyloxycarbonyl, adamantyloxycarbonyl, cyclohexyloxycarbonyl,
phenylthiocarbonyl, and the like, alkaryl groups such as benzyl, triphenylmethyl, benzyloxym ethyl, and the like and silyl groups, such as trimethylsilyl, and the like. Preferred /V-protecting groups are formyl, acetyl, benzoyl, pivaloyl, t-butylacetyl, alanyl, phenylsulfonyl, benzyl, t-butyloxycarbonyl (Boc), and benzyloxycarbonyl (Cbz).
The term "nitro," as used herein, represents an -NO2 group.
The term "O-protecting group," as used herein, represents those groups intended to protect an oxygen containing (e.g., phenol, hydroxyl, or carbonyl) group against undesirable reactions during synthetic procedures. Commonly used O-protecting groups are disclosed in Greene, "Protective Groups in Organic Synthesis," 3rd Edition (John Wiley & Sons, New York, 1999), which is incorporated herein by
reference. Exemplary O-protecting groups include acyl, aryloyl, or carbamyl groups, such as formyl, acetyl, propionyl, pivaloyl, t-butylacetyl, 2-chloroacetyl, 2-bromoacetyl, trifluoroacetyl, trichloroacetyl, phthalyl, o-nitrophenoxyacetyl, a-chlorobutyryl, benzoyl, 4-chlorobenzoyl, 4-bromobenzoyl, t- butyldimethylsilyl, tri-/'so-propylsilyloxymethyl, 4,4'-dimethoxytrityl, isobutyryl, phenoxyacetyl, 4- isopropylpehenoxyacetyl, dimethylformamidino, and 4-nitrobenzoyl; alkylcarbonyl groups, such as acyl, acetyl, propionyl, pivaloyl, and the like; optionally substituted arylcarbonyl groups, such as benzoyl; silyl groups, such as trimethylsilyl (TMS), tert-butyldimethylsilyl (TBDMS), tri-iso-propylsilyloxymethyl (TOM), triisopropylsilyl (TIPS), and the like; ether-forming groups with the hydroxyl, such methyl, methoxym ethyl, tetrahydropyranyl, benzyl, p-methoxybenzyl, trityl, and the like; alkoxycarbonyls, such as
methoxycarbonyl, ethoxycarbonyl, isopropoxycarbonyl, n-isopropoxycarbonyl, n-butyloxycarbonyl, isobutyloxycarbonyl, sec-butyloxycarbonyl, t-butyloxycarbonyl, 2-ethylhexyloxycarbonyl,
cyclohexyloxycarbonyl, methyloxycarbonyl, and the like; alkoxyalkoxycarbonyl groups, such as methoxymethoxycarbonyl, ethoxymethoxycarbonyl, 2-methoxyethoxycarbonyl, 2-ethoxyethoxycarbonyl, 2-butoxyethoxycarbonyl, 2-methoxyethoxymethoxycarbonyl, allyloxycarbonyl, propargyloxycarbonyl, 2- butenoxycarbonyl, 3-methyl-2-butenoxycarbonyl, and the like; haloalkoxycarbonyls, such as 2- chloroethoxycarbonyl, 2-chloroethoxycarbonyl, 2,2,2-trichloroethoxycarbonyl, and the like; optionally substituted arylalkoxycarbonyl groups, such as benzyloxycarbonyl, p-methylbenzyloxycarbonyl, p- methoxybenzyloxycarbonyl, p-nitrobenzyloxycarbonyl, 2,4-dinitrobenzyloxycarbonyl, 3,5- dimethylbenzyloxycarbonyl, p-chlorobenzyloxycarbonyl, p-bromobenzyloxy-carbonyl,
fluorenylmethyloxycarbonyl, and the like; and optionally substituted aryloxycarbonyl groups, such as phenoxycarbonyl, p-nitrophenoxycarbonyl, o-nitrophenoxycarbonyl, 2,4-dinitrophenoxycarbonyl, p-methyl- phenoxycarbonyl, m-methylphenoxycarbonyl, o-bromophenoxycarbonyl, 3,5-dimethylphenoxycarbonyl, p- chlorophenoxycarbonyl, 2-chloro-4-nitrophenoxy-carbonyl, and the like); substituted alkyl, aryl, and alkaryl ethers (e.g., trityl; methylthiomethyl; methoxymethyl; benzyloxymethyl; siloxymethyl; 2,2,2,- trichloroethoxymethyl; tetrahydropyranyl; tetrahydrofuranyl; ethoxyethyl; 1 -[2-(trimethylsilyl)ethoxy]ethyl; 2-trimethylsilylethyl; t-butyl ether; p-chlorophenyl, p-methoxyphenyl, p-nitrophenyl, benzyl, p- methoxybenzyl, and nitrobenzyl); silyl ethers (e.g., trimethylsilyl; triethylsilyl; triisopropylsilyl;
dimethylisopropylsilyl; t-butyldimethylsilyl; t-butyldiphenylsilyl; tribenzylsilyl; triphenylsilyl; and
diphenymethylsilyl); carbonates (e.g., methyl, methoxymethyl, 9-fluorenylmethyl; ethyl; 2,2,2- trichloroethyl; 2-(trimethylsilyl)ethyl; vinyl, allyl, nitrophenyl; benzyl; methoxybenzyl; 3,4-dimethoxybenzyl; and nitrobenzyl); carbonyl-protecting groups (e.g., acetal and ketal groups, such as dimethyl acetal, 1 ,3- dioxolane, and the like; acylal groups; and dithiane groups, such as 1 ,3-dithianes, 1 ,3-dithiolane, and the like); carboxylic acid-protecting groups (e.g., ester groups, such as methyl ester, benzyl ester, t-butyl ester, orthoesters, and the like; and oxazoline groups.
The term "oxo" as used herein, represents =0.
The prefix "perfluoro," as used herein, represents anyl group, as defined herein, where each hydrogen radical bound to the alkyl group has been replaced by a fluoride radical. For example, perfluoroalkyl groups are exemplified by trifluoromethyl, pentafluoroethyl, and the like.
The term "protected hydroxyl," as used herein, refers to an oxygen atom bound to an O-protecting group.
The term "spirocyclyl," as used herein, represents a C2-7 alkylene diradical, both ends of which are bonded to the same carbon atom of the parent group to form a spirocyclic group, and also a C1-6 heteroalkylene diradical, both ends of which are bonded to the same atom. The heteroalkylene radical forming the spirocyclyl group can containing one, two, three, or four heteroatoms independently selected from the group consisting of nitrogen, oxygen, and sulfur. In some embodiments, the spirocyclyl group includes one to seven carbons, excluding the carbon atom to which the diradical is attached. The spirocyclyl groups of the invention may be optionally substituted with 1 , 2, 3, or 4 substituents provided herein as optional substituents for cycloalkyl and/or heterocyclyl groups.
The term "stereoisomer," as used herein, refers to all possible different isomeric as well as conformational forms which a compound may possess (e.g., a compound of any formula described herein), in particular all possible stereochemically and conformationally isomeric forms, all diastereomers, enantiomers and/or conformers of the basic molecular structure. Some compounds of the present invention may exist in different tautomeric forms, all of the latter being included within the scope of the present invention.
The term "sulfonyl," as used herein, represents an -S(0)2- group.
The term "thiol," as used herein, represents an -SH group.
Definitions
In this application, unless otherwise clear from context, (i) the term "a" may be understood to mean "at least one"; (ii) the term "or" may be understood to mean "and/or"; (iii) the terms "comprising" and "including" may be understood to encompass itemized components or steps whether presented by themselves or together with one or more additional components or steps; and (iv) the terms "about" and "approximately" may be understood to permit standard variation as would be understood by those of ordinary skill in the art; and (v) where ranges are provided, endpoints are included.
As used herein, the term "active site" refers to the location on a protein (e.g., an enzyme) where substrate molecules bind and undergo a chemical reaction. By "does not bind at the active site" is meant that no atoms of a moiety substantially participate in binding with residues within the active site (e.g., residues that participate in binding to a natural substrate molecule).
As is known in the art, "affinity" is a measure of the tightness with which a particular ligand binds to its partner. Affinities can be measured in different ways. In some embodiments, affinity is measured by a quantitative assay. In some such embodiments, binding partner concentration may be fixed to be in excess of ligand concentration so as to mimic physiological conditions. Alternatively or additionally, in
some embodiments, binding partner concentration and/or ligand concentration may be varied. In some such embodiments, affinity may be compared to a reference under comparable conditions (e.g., concentrations).
As used herein, the term "antagonist" refers to a compound that i) partially of fully inhibits, decreases or reduces the effects of a target protein (e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein); and/or ii) partially or fully inhibits, decreases, reduces, or delays one or more biological events. An antagonist may be direct (in which case it exerts its influence directly upon its target) or indirect (in which case it exerts its influence by other than binding to its target; e.g., by interacting with a regulator of the target protein (e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein), for example so that level or activity of the target protein is altered). In some embodiments, an antagonist is an inverse agonists (e.g., a compound that prevents activation of a target protein by an agonist).
As used herein, the term "agonist" refers to a compound that i) activates or increases (e.g., increases the rate of onset or occurrence) the effects of a target protein (e.g., a eukaryotic target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein); and/or ii) activates or increases (e.g., increases the rate of onset or occurrence) one or more biological events. An agonist may be direct (in which case it exerts its influence directly upon its target) or indirect (in which case it exerts its influence by other than binding to its target; e.g., by interacting with a regulator of the target protein (e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein), for example so that the level or activity of the target protein is altered). The term agonist is also considered to include a "partial agonist," which refers to a compound that activates or increases the effects of a target protein and/or activates or increases one or more biological events, but which only has partial efficacy relative to a full agonist. In some embodiments, the target protein is a protein that is displayed (e.g., transiently displayed) on the extracellular surface of a cell (e.g., in response to a cell stimulus, such as the activation of a cell signaling pathway). For example, the target protein may be an intracellular protein that is secreted to the surface of a cell in response to a cell stimulus, e.g., an intracellular protein that is secreted to the surface of a tumor cell. Accordingly, for the purposes of this invention, an intracellular protein (e.g., a soluble intracellular protein) which is at any time displayed on the surface of a cell (e.g., as a membrane-bound protein), may also be considered to be an extracellular target protein.
As used herein, "antibody" refers to a polypeptide whose amino acid sequence including immunoglobulins and fragments thereof which specifically bind to a designated antigen, or fragments thereof. Antibodies in accordance with the present invention may be of any type (e.g., IgA, IgD, IgE, IgG, or IgM) or subtype (e.g., lgA1 , lgA2, lgG1 , lgG2, lgG3, or lgG4). Those of ordinary skill in the art will appreciate that a characteristic sequence or portion of an antibody may include amino acids found in one or more regions of an antibody (e.g., variable region, hypervariable region, constant region, heavy chain,
light chain, and combinations thereof). Moreover, those of ordinary skill in the art will appreciate that a characteristic sequence or portion of an antibody may include one or more polypeptide chains, and may include sequence elements found in the same polypeptide chain or in different polypeptide chains.
As used herein, "antigen-binding fragment" refers to a portion of an antibody that retains the binding characteristics of the parent antibody.
As used herein, the terms "approximately" and "about" are each intended to encompass normal statistical variation as would be understood by those of ordinary skill in the art as appropriate to the relevant context. In certain embodiments, the terms "approximately" or "about" each refer to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11 %, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1 %, or less in either direction (greater than or less than) of a stated value, unless otherwise stated or otherwise evident from the context (e.g., where such number would exceed 100% of a possible value).
It will be understood that the term "binding" as used herein, typically refers to association (e.g., non-covalent or covalent) between or among two or more entities. "Direct" binding involves physical contact between entities or moieties; indirect binding involves physical interaction by way of physical contact with one or more intermediate entities. Binding between two or more entities can typically be assessed in any of a variety of contexts - including where interacting entities or moieties are studied in isolation or in the context of more complex systems (e.g., while covalently or otherwise associated with a carrier entity and/or in a biological system or cell).
The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described below. The term "KD," as used herein, is intended to refer to the dissociation equilibrium constant of a particular compound-protein interaction. Typically, the compounds of the invention bind to target proteins (e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein) with a dissociation equilibrium constant (KD) of less than about 10 6 M, such as less than approximately 10 7 M, 10 8 M, 10 9 M, or 10 10 M or even lower or between 10 7 M and 10 8 M, between 10 8 M and 10 9 M, or between 10 9 M and 10 10 M, e.g., when determined by surface plasmon resonance (SPR) technology using the target protein as the analyte and the compound as the ligand.
As used herein, the term "conjugate" refers to a compound formed by the joining (e.g., via a covalent bond forming reaction) of two or more chemical compounds (e.g., a compound including a small molecule moiety and a polypeptide targeting moiety).
As used herein, the term "cross-linking group" refers to a group comprising a reactive functional group capable of chemically attaching to specific functional groups (e.g., primary amines, sulfhydryls) on proteins or other molecules.
Many methodologies described herein include a step of "determining." Those of ordinary skill in the art, reading the present specification, will appreciate that such "determining" can utilize or be accomplished through use of any of a variety of techniques available to those skilled in the art, including for example specific techniques explicitly referred to herein. In some embodiments, determining involves manipulation of a physical sample. In some embodiments, determining involves consideration and/or manipulation of data or information, for example utilizing a computer or other processing unit adapted to perform a relevant analysis. In some embodiments, determining involves receiving relevant information and/or materials from a source. In some embodiments, determining involves comparing one or more features of a sample or entity to a comparable reference.
As used herein, the term "free cysteine" refers to a cysteine residue present in a biologic, whether on-diagonal or off-diagonal, that is not involved in a disulfide bond.
The term "modulator" is used to refer to an entity whose presence or level in a system in which an activity of interest is observed correlates with a change in level and/or nature of that activity as compared with that observed under otherwise comparable conditions when the modulator is absent. In some embodiments, a modulator is an activator, in that activity is increased in its presence as compared with that observed under otherwise comparable conditions when the modulator is absent. In some embodiments, a modulator is an antagonist or inhibitor, in that activity is reduced in its presence as compared with otherwise comparable conditions when the modulator is absent. In some embodiments, a modulator interacts directly with a target entity whose activity is of interest. In some embodiments, a modulator interacts indirectly (i.e., directly with an intermediate compound that interacts with the target entity) with a target entity whose activity is of interest. In some embodiments, a modulator affects level of a target entity of interest; alternatively or additionally, in some embodiments, a modulator affects activity of a target entity of interest without affecting level of the target entity. In some embodiments, a modulator affects both level and activity of a target entity of interest, so that an observed difference in activity is not entirely explained by or commensurate with an observed difference in level. In some embodiments, a modulator is an allosteric modulator such as an allosteric agonist.
The term "pharmaceutical composition," as used herein, represents a composition containing a compound described herein formulated with a pharmaceutically acceptable excipient. In some embodiments, the pharmaceutical composition is manufactured or sold with the approval of a governmental regulatory agency as part of a therapeutic regimen for the treatment of disease in a mammal. Pharmaceutical compositions can be formulated, for example, for oral administration in unit dosage form (e.g., a tablet, capsule, caplet, gelcap, or syrup); for topical administration (e.g., as a cream, gel, lotion, or ointment); for intravenous administration (e.g., as a sterile solution free of particulate emboli and in a solvent system suitable for intravenous use); or in any other formulation described herein.
A "pharmaceutically acceptable excipient," as used herein, refers any ingredient other than the compounds described herein (for example, a vehicle capable of suspending or dissolving the active compound) and having the properties of being nontoxic and non-inflammatory in a patient. Excipients
may include, for example: antiadherents, antioxidants, binders, coatings, compression aids, disintegrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspensing or dispersing agents, sweeteners, or waters of hydration. Exemplary excipients include, but are not limited to: ascorbic acid, histidine, phosphate buffer, butylated hydro xytoluene (BHT), calcium carbonate, calcium phosphate (dibasic), calcium stearate, croscarmellose, crosslinked polyvinyl pyrrolidone, citric acid, crospovidone, cysteine, ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl
methylcellulose, lactose, magnesium stearate, maltitol, mannitol, methionine, methylcellulose, methyl paraben, microcrystalline cellulose, polyethylene glycol, polyvinyl pyrrolidone, povidone, pregelatinized starch, propyl paraben, retinyl palmitate, shellac, silicon dioxide, sodium carboxymethyl cellulose, sodium citrate, sodium starch glycolate, sorbitol, starch (corn), stearic acid, stearic acid, sucrose, talc, titanium dioxide, vitamin A, vitamin E, vitamin C, and xylitol.
The term "pharmaceutically acceptable salt," as use herein, refers to those salts of the compounds described here that are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and animals without undue toxicity, irritation, allergic response and the like and are commensurate with a reasonable benefit/risk ratio. Pharmaceutically acceptable salts are well known in the art. For example, pharmaceutically acceptable salts are described in: Berge et al., J. Pharmaceutical Sciences 66:1 -19, 1977 and in Pharmaceutical Salts: Properties, Selection, and Use, (Eds. P.H. Stahl and C.G. Wermuth), Wiley-VCH, 2008. The salts can be prepared in situ during the final isolation and purification of the compounds described herein or separately by reacting the free base group with a suitable organic acid.
The compounds of the invention may have ionizable groups so as to be capable of preparation as pharmaceutically acceptable salts. These salts may be acid addition salts involving inorganic or organic acids or the salts may, in the case of acidic forms of the compounds of the invention be prepared from inorganic or organic bases. Frequently, the compounds are prepared or used as pharmaceutically acceptable salts prepared as addition products of pharmaceutically acceptable acids or bases. Suitable pharmaceutically acceptable acids and bases are well-known in the art, such as hydrochloric, sulphuric, hydrobromic, acetic, lactic, citric, or tartaric acids for forming acid addition salts, and potassium hydroxide, sodium hydroxide, ammonium hydroxide, caffeine, various amines, and the like for forming basic salts. Methods for preparation of the appropriate salts are well-established in the art.
Representative acid addition salts include acetate, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, fumarate, glucoheptonate, glycerophosphate, hemisulfate, heptonate, hexanoate, hydrobromide, hydrochloride, hydroiodide, 2- hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate,
sulfate, tartrate, thiocyanate, toluenesulfonate, undecanoate, valerate salts and the like. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium and the like, as well as nontoxic ammonium, quaternary ammonium, and amine cations, including, but not limited to ammonium, tetramethylammonium, tetraethylammonium, methylamine, dimethylamine, trimethylamine, triethylamine, ethylamine and the like.
The term "polypeptide" as used herein refers to a string of at least two amino acids attached to one another by a peptide bond. In some embodiments, a polypeptide may include at least 3-5 amino acids, each of which is attached to others by way of at least one peptide bond. Those of ordinary skill in the art will appreciate that polypeptides can include one or more "non-natural" amino acids or other entities that nonetheless are capable of integrating into a polypeptide chain. In some embodiments, a polypeptide may be glycosylated, e.g., a polypeptide may contain one or more covalently linked sugar moieties. In some embodiments, a single "polypeptide" (e.g., an antibody polypeptide) may comprise two or more individual polypeptide chains, which may in some cases be linked to one another, for example by one or more disulfide bonds or other means.
As used herein, the term "reactive amino acid residue" refers to a natural or non-natural amino acid comprising a functional group (e.g., a nucleophilic functional group) capable of chemically attaching to specific functional groups (e.g., a cross-linking group). Examples of reactive amino acids include cysteine, lysine, serine, and amino acids having azides on the side chain. "Non-reactive amino acids" refers to natural or non-natural amino acids that do not contain a functional group capable of chemically attaching to specific functional groups. Examples of non-reactive amino acids include valine, alanine, isoleucine, theronine, and leucine.
The term "reference" is often used herein to describe a standard or control compound, individual, population, sample, sequence or value against which a compound, individual, population, sample, sequence or value of interest is compared. In some embodiments, a reference compound, individual, population, sample, sequence or value is tested and/or determined substantially simultaneously with the testing or determination of the compound, individual, population, sample, sequence or value of interest. In some embodiments, a reference compound, individual, population, sample, sequence or value is a historical reference, optionally embodied in a tangible medium. Typically, as would be understood by those skilled in the art, a reference compound, individual, population, sample, sequence or value is determined or characterized under conditions comparable to those utilized to determine or characterize the compound, individual, population, sample, sequence or value of interest.
The term "small molecule" means a low molecular weight organic and/or inorganic compound. In general, a "small molecule" is a molecule that is less than about 5 kilodaltons (kD) in size. In some embodiments, a small molecule is less than about 4 kD, 3 kD, about 2 kD, or about 1 kD. In some embodiments, the small molecule is less than about 800 daltons (D), about 600 D, about 500 D, about 400 D, about 300 D, about 200 D, or about 100 D. In some embodiments, a small molecule is less than about 2000 g/mol, less than about 1500 g/mol, less than about 1000 g/mol, less than about 800 g/mol, or
less than about 500 g/mol. In some embodiments, a small molecule is not a polymer. In some embodiments, a small molecule does not include a polymeric moiety. In some embodiments, a small molecule is not a protein or polypeptide (e.g., is not an oligopeptide or peptide). In some embodiments, a small molecule is not a polynucleotide (e.g., is not an oligonucleotide). In some embodiments, a small molecule is not a polysaccharide. In some embodiments, a small molecule does not comprise a polysaccharide (e.g., is not a glycoprotein, proteoglycan, glycolipid, etc.). In some embodiments, a small molecule is not a lipid. In some embodiments, a small molecule is a modulating compound. In some embodiments, a small molecule is biologically active. In some embodiments, a small molecule is detectable (e.g., comprises at least one detectable moiety). In some embodiments, a small molecule is a therapeutic.
Those of ordinary skill in the art, reading the present disclosure, will appreciate that certain small molecule compounds described herein may be provided and/or utilized in any of a variety of forms such as, for example, salt forms, protected forms, pro-drug forms, ester forms, isomeric forms (e.g., optical and/or structural isomers), isotopic forms, etc. In some embodiments, reference to a particular compound may relate to a specific form of that compound. In some embodiments, reference to a particular compound may relate to that compound in any form. In some embodiments, where a compound is one that exists or is found in nature, that compound may be provided and/or utilized in accordance in the present invention in a form different from that in which it exists or is found in nature. Those of ordinary skill in the art will appreciate that a compound preparation including a different level, amount, or ratio of one or more individual forms than a reference preparation or source (e.g., a natural source) of the compound may be considered to be a different form of the compound as described herein. Thus, in some embodiments, for example, a preparation of a single stereoisomer of a compound may be considered to be a different form of the compound than a racemic mixture of the compound; a particular salt of a compound may be considered to be a different form from another salt form of the compound; a preparation containing one conformational isomer ((Z) or (E)) of a double bond may be considered to be a different form from one containing the other conformational isomer ((E) or (Z)) of the double bond; a preparation in which one or more atoms is a different isotope than is present in a reference preparation may be considered to be a different form; etc.
As used herein, the term "small molecule binding site" refers to a location on a protein (e.g., a GPCR, an ion channel, or an enzyme) where a small molecule is capable of binding. For example, small molecule binding sites include, but are not limited to, active sites of proteins which bind natural substrates and allosteric sites on proteins which may or may not bind a natural substrate, and are distinct from the active site.
As used herein, the terms "specific binding" or "specific for" or "specific to" refer to an interaction between a binding agent and a target entity. As will be understood by those of ordinary skill, an interaction is considered to be "specific" if it is favored in the presence of alternative interactions, for example, binding with a KD of less than 1 0 μΜ (e.g., less than 5 μΜ, less than 1 μΜ, less than 500 nM,
less than 200 nM, less than 100 nM, less than 75 nM, less than 50 nM, less than 25 nM, less than 10 nM, between 5 μΜ and 1 μΜ, between 1 μΜ and 500 nM, between 500 nM and 200 nM, between 200 nM and 100 nM, between 100 nM and 75 nM, between 75 nM and 50 nM, between 50 nM and 25 nM, between 25 nM and 10 nM). In many embodiments, specific interaction is dependent upon the presence of a particular structural feature of the target entity (e.g., an epitope, a cleft, a binding site). It is to be understood that specificity need not be absolute. In some embodiments, specificity may be evaluated relative to that of the binding agent for one or more other potential target entities (e.g., competitors). In some embodiments, specificity is evaluated relative to that of a reference specific binding agent. In some embodiments specificity is evaluated relative to that of a reference non-specific binding agent.
The term "specific" when used with reference to a compound having an activity, is understood by those skilled in the art to mean that the compound discriminates between potential target entities or states. For example, in some embodiments, a compound is said to bind "specifically" to its target if it binds preferentially with that target in the presence of one or more competing alternative targets. In some embodiments, specificity is evaluated relative to that of a reference specific binding agent. In some embodiments specificity is evaluated relative to that of a reference non-specific binding agent. In some embodiments, the agent or entity does not detectably bind to the competing alternative target under conditions of binding to its target entity. In some embodiments, binding agent binds with higher on-rate, lower off-rate, increased affinity, decreased dissociation, and/or increased stability to its target entity as compared with the competing alternative target(s).
The term "substantially" refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest. One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result. The term "substantially" is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
The term "target protein" refers to any protein that participates in a biological pathway associated with a disease, disorder or condition. In some embodiments, a target protein is a naturally-occurring protein; in some such embodiments, a target protein is naturally found in certain mammalian cells (e.g., a mammalian target protein), fungal cells (e.g., a fungal target protein), bacterial cells (e.g., a bacterial target protein) or plant cells (e.g., a plant target protein). Target proteins can be naturally occurring, e.g., wild type. Alternatively, the target protein can vary from the wild type protein but still retain biological function, e.g., as an allelic variant, a splice mutant or a biologically active fragment. In some
embodiments, the target protein is an extracellular target protein. Extracellular target proteins of the invention are considered to include soluble proteins, membrane-bound proteins, and/or transmembrane proteins. A soluble protein may be considered to include any polypeptide (e.g., a globular protein or globular protein domain) that is soluble in an aqueous medium (e.g., the cytoplasm, the extracellular fluid, lymph, or blood). A membrane-bound protein is considered to include any protein that is associated (e.g., by non-covalent interaction or by covalent linkage) with a cellular membrane. Membrane-bound proteins
may also be soluble proteins that interact transiently with a membrane. Transmembrane proteins are considered to include any polypeptide that spans (e.g., partially spans or fully spans) a cellular membrane. Transmembrane proteins may include an extracellular domain, transmembrane domain, and/or an intracellular domain. In some embodiments, the target protein is the extracellular domain of a transmembrane protein.
As used herein, and as well understood in the art, "to treat" a condition or "treatment" of the condition (e.g., the conditions described herein such as cancer) is an approach for obtaining beneficial or desired results, such as clinical results. Beneficial or desired results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions; diminishment of extent of disease, disorder, or condition; stabilized (i.e., not worsening) state of disease, disorder, or condition; preventing spread of disease, disorder, or condition; delay or slowing the progress of the disease, disorder, or condition; amelioration or palliation of the disease, disorder, or condition; and remission (whether partial or total), whether detectable or undetectable. "Palliating" a disease, disorder, or condition means that the extent and/or undesirable clinical manifestations of the disease, disorder, or condition are lessened and/or time course of the progression is slowed or lengthened, as compared to the extent or time course in the absence of treatment.
The term "wild-type" refers to an entity having a structure and/or activity as found in nature in a "normal" (as contrasted with mutant, diseased, altered, etc) state or context. Those of ordinary skill in the art will appreciate that wild-type genes and polypeptides often exist in multiple different forms (e.g., alleles).
As used herein, the term "solvent exposed amino acid" refers to an amino acid that is accessible to the solvent surrounding the protein. In some embodiments, a solvent exposed amino acid is an amino acid that when substituted does not substantially change the three-dimensional structure of the protein. Brief Description of the Drawings
Fig. 1A-B is diagram depicting bifunctional compounds of the invention bound to a polypeptide. Fig. 1 A shows a bifunctional compound bound to a polypeptide in which the polypeptide targeting moiety and the small molecule bind to the polypeptide, at least in part, at the same site. Fig. 1 B shows a bifunctional compound bound to a polypeptide in which the polypeptide targeting moiety and the small molecule bind to the polypeptide at distinct sites on the polypeptide.
Fig. 2A-B is a diagram and corresponding table showing the structure and solvent exposed amino acid sites of a wild-type tenth fibronectin type III domain (Fn). Fig. 2A is diagram showing the NMR structure of a wild-type tenth fibronectin type III domain, solved via NMR. Frequently mutated sites (e.g., the BC, DE, and FG loops) are located on three loops (denoted by boxes). Residue T28
(represented as a ball) is a solvent exposed amino acid located on one of the frequently diversified regions, and may be used as a site for conjugation of a linker. Fig. 2B is a table showing solvent- accessible surface area (SASA) for sites within the frequently diversified regions.
Fig. 3A-C is a series of graphs showing that maleimide-fluorescein is effectively conjugated to yeast-displayed Fn with a single cysteine. Fig. 3A is a trace generated by fluorescence-activated cell sorting (FACS) analysis of yeast displaying either the unlabeled yeast, the cysteine-free parental Fn domain (T28), or the cysteine mutant Fn domain (T28C). Fig. 3B is a graph showing the concentration- dependent conjugation of maleimide-fluorescein to Fn-T28C. Fig. 3C is a graph showing the time- dependent conjugation of maleiminde-fluorescein to Fn-T28C.
Fig. 4 is a FACS trace showing that maleimide-acetazolamide (AAZ) is effectively conjugated to yeast-displayed Fn. Conjugation with maleimide-AAZ reduced fluorescein conjugation by 70%, which is consistent with effective AAZ conjugation.
Fig. 5 is FACS trace showing that yeast-displayed Fn-AAZ binds carbonic anhydrase 9.
Fig. 6A-B is graph and corresponding set of images showing that yeast-displayed Fn-AAZ is functional at multiple Fn conjugation sites. Fig. 6A is a graph showing the relative binding of Fn-AAZ to carbonic anhydrase 9, wherein in the AAZ is conjugated to Fn through various solvent exposed amino acids (D80, R78, R30, or T28) and using various PEG linkers of different lengths (PEG2, PEG3, PEG5, or PEG7). Fig. 6B is two images depicting the location of the solvent exposed amino acids used for conjugation to Fn mapped onto the structure of Fn (side-view and top view).
Fig. 7 is a diagram showing the design for the construction of combinatorial libraries of yeast- displayed Fn.
Fig. 8 is series of FACS traces showing that Fn and AAZ provide a mutual benefit in binding to carbonic anhydrase 9. Binding is enabled by the combination of select Fn clones and the AAZ conjugation, with longer PEG lengths enabling greater binding.
Fig. 9 is a series of FACS traces showing that sub-libraries of yeast-displayed Fn-AAZ conjugates can be identified (boxes in upper right quandrant) which bind with high affinity to carbonic anhydrase 9.
Fig. 10A-B is a series of FACS traces showing that yeast-displayed Fn-AAZ clones bind selectively to carbonic anhydrase 9 over carbonic anhydrase 2. Fig. 10A shows that Fn-AAZ clones conjugated via Cys28 are selective for carbonic anhydrase 9 over carbonic anhydrase 2. Fig. 10B shows that Fn-AAZ clones conjugated via Cys80 are selective for carbonic anhydrase 9 over carbonic anhydrase 2.
Fig. 11 is a graph showing that, in the absence of an Fn domain, AAZ-Fluorescein is not highly selective for carbonic anhydrase 9 (Kd = 340nM) over and carbonic anhydrase 2 (Kd = 560nM).
Fig. 12 is a series of FACS traces showing that libraries of yeast-displayed Fn-AAZ conjugates can be enriched to identify clones that bind with high affinity to carbonic anhydrase 2.
Fig. 13A-C is a series of images that shows the expression and purification of an individual Fn- AAZ clone. Fig. 13A is a polyacrylamide gel showing the expression of an Fn-AAZ clone. Fig. 13B is a mass spectrometry trace showing the purified Fn clone (M = 11835 Da). Fig. 13C is a mass spectrometry trace of the purified Fn clone after maleimide conjugation to PEGsAAZ (M = 12374 Da).
Fig. 14A-B is a series of graphs showing the binding characteristics of each of two exemplary purified clones of Fn-AAZ to carbonic anhydrase 9. Fig. 14A shows that a purified Fn-AAZ clone having the amino acid sequence of SEQ ID NO. 3 (Clone 0.3.10) binds with 10-fold higher affinity to carbonic anhydrase 9 when compared to Fn that has not been conjugated to AAZ. Fig. 14B shows that a purified Fn-AAZ clone having the amino acid sequence of SEQ ID NO. 4 (Clone 0.3.9) binds with approximately 6-fold higher affinity to carbonic anhydrase 9 when compared to Fn that has not been conjugated to AAZ. Fig. 15 is a graph showing the % yield of yeast recovered following two rounds of FACS sorting of a yeast-displayed library of Fn domains conjugated to a cyclic peptide (CP). FACS sorting was performed to identify Fn-CP clones that bind to the polypeptide target, CXCR4.
Detailed Description
Small Molecule Moieties
The small molecule moieties of the invention include low molecular weight organic and/or inorganic compounds which have affinity (e.g., low affinity) for the target protein when not covalently conjugated to the polypeptide targeting moiety. In some embodiments, the small molecule moiety binds at the active site of the target protein. In some embodiments, the small molecule moiety does not specifically bind to the target protein (e.g., the small molecule binds to more than one member of the family of proteins to which the target protein belongs.)
In some embodiments, a small molecule is an antagonist (e.g., a direct inhibitor) of the target protein. In some embodiments, the small molecule is an agonist or a partial agonist (e.g., a direct agonist of partial agonist) of the target protein.
In some embodiments, a small molecule is not a polymer. In some embodiments, a small molecule does not include a polymeric moiety. In some embodiments, a small molecule is not a protein or polypeptide (e.g., is not an oligopeptide or peptide). In some embodiments, a small molecule is not a polynucleotide (e.g., is not an oligonucleotide). In some embodiments, a small molecule is not a polysaccharide. In some embodiments, a small molecule does not comprise a polysaccharide (e.g., is not a glycoprotein, proteoglycan, glycolipid, etc.). In some embodiments, a small molecule is not a lipid. In some embodiments, a small molecule is a modulating compound. In some embodiments, a small molecule is biologically active. In some embodiments, a small molecule is detectable (e.g., comprises at least one detectable moiety). In some embodiments, a small molecule is a therapeutic.
In some embodiments, the small molecule moiety is a sulfonamide. For example, the small molecule moiety includes the structure of Formula II:
O
£-R1-S-NH2
O
Formula II
wherein R1 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl.
In some embodiments, the small molecule moiety is a hydroxamic acid. For example, the small molecule moiety includes the structure of Formula II I:
Formula III
wherein R2 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, or optionally substituted C2-C9 heteroaryl.
In some embodiments, the small molecule moiety is a thiadiazole sulfonamide or includes a glutamate-urea-lysine moiety. For example, the small molecule moiety includes the structure of Formula IV or Formula V:
Formula IV Formula V
wherein R3 is optionally substituted C1-C6 alkyl or optionally substituted C1-C6 heteroalkyi (e.g., -NHC(O)-); and
R4 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyi, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl Ct alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
In some embodiments, the small molecule moiety includes the structure:
In some embodiments, the small molecule moiety is a cyclic peptide. For example, the small molecule moiety includes the structure of Formula VI:
Formula VI
wherein R5 is optionally substituted C1-C6 alkyl, optionally substituted C1-C6 heteroalkyl, optionally substituted C6-C10 aryl, optionally substituted C2-C9 heteroaryl, or optionally substituted C6-C10 aryl C1-C6 alkyl, or optionally substituted C2-C9 heteroaryl C1-C6 alkyl.
In some embodiments, the small molecule moiety includes the structure:
Linkers
The compounds of the invention include a linker (e.g., moiety linker joining a small molecule moiety to a polypeptide targeting moiety). The linker component of the invention is, at its simplest, a bond, but may also provide a linear, cyclic, or branched molecular skeleton having pendant groups covalently linking two moieties.
Thus, a linker, when included in a compound and/or conjugate as described herein, achieves linking of two (or more) moieties by covalent means, involving bond formation with one or more functional groups located on either moiety. Examples of chemically reactive functional groups which may be employed for this purpose include, without limitation, amino, hydroxyl, sulfhydryl, carboxyl, carbonyl, carbohydrate groups, vicinal diols, thioethers, 2-aminoalcohols, 2-aminothiols, guanidinyl, imidazolyl, and phenolic groups.
In some embodiments, such covalent linking of two (or more) moieties may be effected using a linker that contains reactive moieties capable of reaction with such functional groups present in either moiety. For example, an amine group of a moiety may react with a carboxyl group of the linker, or an activated derivative thereof, resulting in the formation of an amide linking the two.
Examples of moieties capable of reaction with sulfhydryl groups include a-haloacetyl compounds of the type XCH2CO- (where X=Br, CI, or I), which show particular reactivity for sulfhydryl groups, but which can also be used to modify imidazolyl, thioether, phenol, and amino groups as described by Gurd, Methods Enzymol. 1 1 :532 (1967). N-Maleimide derivatives are also considered selective towards sulfhydryl groups, but may additionally be useful in coupling to amino groups under certain conditions. Reagents such as 2-iminothiolane (Traut et al., Biochemistry 12:3266 (1973)), which introduce a thiol group through conversion of an amino group, may be considered as sulfhydryl reagents if linking occurs through the formation of disulfide bridges.
Examples of reactive moieties capable of reaction with amino groups include, for example, alkylating and acylating agents. Representative alkylating agents include:
(i) a-haloacetyl compounds, which show specificity towards amino groups in the absence of reactive thiol groups and are of the type XCH2CO- (where X=Br, CI, or I), for example, as described by Wong Biochemistry 24:5337 (1979);
(ii) N-maleimide derivatives, which may react with amino groups either through a Michael type reaction or through acylation by addition to the ring carbonyl group, for example, as described by Smyth et al., J. Am. Chem. Soc. 82:4600 (1960) and Biochem. J. 91 :589 (1964);
(iii) aryl halides such as reactive nitrohaloaromatic compounds;
(iv) alkyl halides, as described, for example, by McKenzie et al., J. Protein Chem. 7:581 (1988);
(v) aldehydes and ketones capable of Schiff's base formation with amino groups, the adducts formed usually being stabilized through reduction to give a stable amine;
(vi) epoxide derivatives such as epichlorohydrin and bisoxiranes, which may react with amino, sulfhydryl, or phenolic hydroxyl groups;
(vii) chlorine-containing derivatives of s-triazines, which are very reactive towards nucleophiles such as amino, sufhydryl, and hydroxyl groups;
(viii) aziridines based on s-triazine compounds detailed above, e.g., as described by Ross, J. Adv. Cancer Res. 2:1 (1954), which react with nucleophiles such as amino groups by ring opening;
(ix) squaric acid diethyl esters as described by Tietze, Chem. Ber. 124:1215 (1991); and
(x) a-haloalkyl ethers, which are more reactive alkylating agents than normal alkyl halides because of the activation caused by the ether oxygen atom, as described by Benneche et al., Eur. J. Med. Chem. 28:463 (1993).
Representative amino-reactive acylating agents include:
(i) isocyanates and isothiocyanates, particularly aromatic derivatives, which form stable urea and thiourea derivatives respectively;
(ii) sulfonyl chlorides, which have been described by Herzig et al., Biopolymers 2:349 (1964);
(iii) acid halides;
(iv) active esters such as nitrophenylesters or N-hydroxysuccinimidyl esters;
(v) acid anhydrides such as mixed, symmetrical, or N-carboxyanhydrides;
(vi) other useful reagents for amide bond formation, for example, as described by M. Bodansky,
Principles of Peptide Synthesis, Springer- Verlag, 1984;
(vii) acylazides, e.g., wherein the azide group is generated from a preformed hydrazide derivative using sodium nitrite, as described by Wetz et al., Anal. Biochem. 58:347 (1974);
(viii) imidoesters, which form stable amidines on reaction with amino groups, for example, as described by Hunter and Ludwig, J. Am. Chem. Soc. 84:3491 (1962); and
(ix) haloheteroaryl groups such as halopyridine or halopyrimidine.
Aldehydes and ketones may be reacted with amines to form Schiff's bases, which may advantageously be stabilized through reductive amination. Alkoxylamino moieties readily react with ketones and aldehydes to produce stable alkoxamines, for example, as described by Webb et al., in Bioconjugate Chem. 1 :96 (1990).
Examples of reactive moieties capable of reaction with carboxyl groups include diazo compounds such as diazoacetate esters and diazoacetamides, which react with high specificity to generate ester groups, for example, as described by Herriot, Adv. Protein Chem. 3:169 (1947). Carboxyl modifying reagents such as carbodiimides, which react through O-acylurea formation followed by amide bond formation, may also be employed.
It will be appreciated that functional groups in either moiety may, if desired, be converted to other functional groups prior to reaction, for example, to confer additional reactivity or selectivity. Examples of methods useful for this purpose include conversion of amines to carboxyls using reagents such as dicarboxylic anhydrides; conversion of amines to thiols using reagents such as N-acetylhomocysteine thiolactone, S-acetylmercaptosuccinic anhydride, 2-iminothiolane, or thiol-containing succinimidyl derivatives; conversion of thiols to carboxyls using reagents such as a -haloacetates; conversion of thiols to amines using reagents such as ethylenimine or 2-bromoethylamine; conversion of carboxyls to amines using reagents such as carbodiimides followed by diamines; and conversion of alcohols to thiols using reagents such as tosyl chloride followed by transesterification with thioacetate and hydrolysis to the thiol with sodium acetate.
So-called zero-length linkers, involving direct covalent joining of a reactive chemical group of one moiety with a reactive chemical group of the other without introducing additional linking material may, if desired, be used in accordance with the invention.
More commonly, however, the linker will include two or more reactive moieties, as described above, connected by a spacer element. The presence of such a spacer permits bifunctional linkers to react with specific functional groups within either moiety, resulting in a covalent linkage between the two. The reactive moieties in a linker may be the same (homobifunctional linker) or different (heterobifunctional
linker, or, where several dissimilar reactive moieties are present, heteromultifunctional linker), providing a diversity of potential reagents that may bring about covalent attachment between the two moieties.
Spacer elements in the linker typically consist of linear or branched chains and may include a Ci- 10 alkyl, C2-10 alkenyl, C2-10 alkynyl, C2-6 heterocyclyl, C6-12 aryl, C7-14 alkaryl, C3-10 alkheterocyclyl, C2- C100 polyethylene glycol, or C 1-10 heteroalkyl.
In some embodiments, the spacer element of a linker consists of a polyethylene glycol.
Polyethylene glycols of the invention are considered to include an alkoxy chain comprised of one or more momomer units, each monomer unit consisting of -OCH2CH2-. Polyethyelene glycol (PEG) is also sometimes referred to as polyethylene oxide (PEO) or polyoxyethylene (POE), and these terms may be considered interchangeable for the purpose of this invention. For example, a polyethylene glycol may have the structure, -(CH2)s2(OCH2CH2)s1 (CH2)s30-, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), and each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10). In some embodiments, the PEG is PEG2, PEG3, PEG5, or PEG7, wherein the subscript refers to the number of -OCH2CH2- monomer units of the PEG. Polyethylene glycol may also be considered to include an amino-polyethylene glycol of -
NRN1 (CH2)s2(CH2CH20)s1 (CH2)s3NRN1 -, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1 to 4), each of s2 and s3, independently, is an integer from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from 1 to 10), and each RN1 is, independently, hydrogen or optionally substituted C1 -6 alkyl.
In some embodiments, the linker includes a polypeptide having two or more amino acid residues.
In some embodiments, the linker is a polypeptide having the formula (G4S)n, where n is 1 or greater (e.g., n is 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20). In some embodiments, the linker is a polypeptide having the formula (G4S)s. In some embodiments, the linker is a polypeptide having the formula (G4S)io. In some embodiments, the linker is a polypeptide having the formula (G4S)is. In some embodiments, the linker is a polypeptide having the formula (G4S)n(EAK)m, where n and m each independently have a value or 1 or greater (e.g., n is 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20). In some embodiments, the linker is a polypeptide having the formula (G4S)s(EAK)s. In some embodiments, the linker is a polypeptide having the formula (G4S)io(EAK)s. In some embodiments, the linker is a polypeptide having the formula (G4S)n(EAK)m(G4S)k, where n, m, and k each independently have a value or 1 or greater (e.g., n is 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20). In some embodiments, the linker is a polypeptide having the formula (G4S)s(EAK)io(G4S)5.
In some instances, the linker is described by Formula V.
Examples of homobifunctional linkers useful in the preparation of conjugates of the invention include, without limitation, diamines and diols selected from ethylenediamine, propylenediamine and hexamethylenediamine, ethylene glycol, diethylene glycol, propylene glycol, 1 ,4-butanediol, 1 ,6- hexanediol, cyclohexanediol, and polycaprolactone diol.
In some embodiments, the linker is a bond or a linear chain of up to 10 atoms, independently selected from carbon, nitrogen, oxygen, sulfur or phosphorous atoms, wherein each atom in the chain is optionally substituted with one or more substituents independently selected from alkyl, alkenyl, alkynyl, aryl, heteroaryl, chloro, iodo, bromo, fluoro, hydroxyl, alkoxy, aryloxy, carboxy, amino, alkylamino, dialkylamino, acylamino, carboxamido, cyano, oxo, thio, alkylthio, arylthio, acylthio, alkylsulfonate, arylsulfonate, phosphoryl, and sulfonyl, and wherein any two atoms in the chain may be taken together with the substituents bound thereto to form a ring, wherein the ring may be further substituted and/or fused to one or more optionally substituted carbocyclic, heterocyclic, aryl, or heteroaryl rings. In some embodiments, a linker has the structure of Formula I:
A1-(B1)a-(C1)b-(B2)c-(D)-(B3)d-(C2)e-(B4))-A2
Formula I
where A1 is a bond between the linker and polypeptide targeting moiety; A2 is a bond between the small molecule moiety and the linker; B1, B2, B3, and B4 each, independently, is selected from optionally substituted C1-C2 alkyl, optionally substituted C1-C3 heteroalkyl, O, S, and NRN; RN is hydrogen, optionally substituted C1-4 alkyl, optionally substituted C2-4 alkenyl, optionally substituted C2-4 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted C6-12 aryl, or optionally substituted C1-7 heteroalkyl; C1 and C2 are each, independently, selected from carbonyl, thiocarbonyl, sulphonyl, or phosphoryl; a, b, c, d, e, and f are each, independently, 0 or 1 ; and D is optionally substituted C1-10 alkyl, optionally substituted C2-10 alkenyl, optionally substituted C2-10 alkynyl, optionally substituted C2-6 heterocyclyl, optionally substituted Ce-12 aryl, optionally substituted C2-C10 polyethylene glycol, or optionally substituted C1-10 heteroalkyl, or a chemical bond linking A1-(B1)a-(C1)b-(B2)c- to -(B3)d-(CV(BVA2.
Polypeptides
Polypeptides include, for example, any of a variety of hematologic agents (including, for instance, erythropoietin, blood-clotting factors, etc.), interferons, colony stimulating factors, antibodies, enzymes, and hormones. The identity of a particular polypeptide is not intended to limit the present disclosure, and any polypeptide of interest can be a polypeptide in the present methods.
In some embodiments, the polypeptide is an ion channel, such as a leukocyte ion channel (e.g., CRAC or Kv1.3), a TRP channel (e.g., TRPV1), a purinergic receptor (e.g., a P2X or P2Y receptor), or an epithelial sodium channel (ENaC).
In some embodiments, the polypeptide is a GPCR, such as an adenosine receptor (AR), an endothelin receptor (ETR), a bradykinin receptor (BKR), an angiotensin receptor (AIR or AMR), a cannabinoid receptor (CNR), a muscarinic receptor, a neurotensin receptor (NTR), a C5a receptor (C5aR), a purinergic receptor (e.g., a P2X or P2Y receptor), calcitonin gene-related peptide receptor (CGRP-R), or glucagon-like peptide 1 receptor (GLP1 R).
In some embodiments, the polypeptide is an enzyme, such an enzyme of the PCSK family (e.g., furin), matriptase, prostasin, MT1 -MMP (also called MMP14), a disintegrin and metalloproteinase
(ADAMS), Factor Xia, Factor D, transglutaminases 2, cathepsin S, CD73, CD39, or membrane guanylyl cyclase C.
Polypeptide Targeting Moieties
A reference polypeptide described herein can include a target-binding domain that binds to a target of interest (e.g., binds to an antigen). For example, a polypeptide, such as an antibody, can bind to a transmembrane polypeptide (e.g., receptor) or ligand (e.g., a growth factor). In some embodiments, the extracellular target proteins of the present invention include proteins which have a small molecule binding site (e.g., an active site). Exemplary molecular targets (e.g., antigens) for polypeptides described herein (e.g., antibodies) include GPCRs (e.g., Class A GPCRs such as CXCR4, Class B GPCRs, Class C
GPCRs, Class D GPCRs, Class E GPCRs and Class F GPCRs), ion channels (e.g., Trp channels, Nav 1 .7 channels, and CRAC channels), and enzymes (e.g., carbonic anhydrases and metalloproteases).
Antibodies
An IgG antibody consists of two identical light polypeptide chains and two identical heavy polypeptide chains linked together by disulfide bonds. The first domain located at the amino terminus of each chain is variable in amino acid sequence, providing the antibody binding specificities found in each individual antibody. These are known as variable heavy (VH) and variable light (VL) regions. The other domains of each chain are relatively invariant in amino acid sequence and are known as constant heavy (CH) and constant light (CL) regions. For an IgG antibody, the light chain includes one variable region (VL) and one constant region (CL). An IgG heavy chain includes a variable region (VH), a first constant region (CH1), a hinge region, a second constant region (CH2), and a third constant region (CH3). In IgE and IgM antibodies, the heavy chain includes an additional constant region (CH4).
Antibodies described herein can include, for example, monoclonal antibodies, polyclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, camelized antibodies, chimeric antibodies, single-chain Fvs (scFv), disulfide-linked Fvs (sdFv), and anti-idiotypic (anti-Id) antibodies, and antigen-binding fragments of any of the above. Antibodies can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2) or subclass.
The term "antigen binding fragment" of an antibody, as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen. Examples of binding fragments encompassed within the term "antigen binding fragment" of an antibody include a Fab fragment, a F(ab')2 fragment, a Fd fragment, a Fv fragment, a scFv fragment, a dAb fragment (Ward et al., (1989) Nature 341 :544-546), and an isolated complementarity determining region (CDR). These antibody fragments can be obtained using conventional techniques known to those with skill in the art, and the fragments can be screened for utility in the same manner as are intact antibodies.
Antibodies or fragments described herein can be produced by any method known in the art for the synthesis of antibodies (see, e.g., Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring
Harbor Laboratory Press, 2nd ed. 1988); Brinkman et al., 1995, J. Immunol. Methods 182:41 -50; WO 92/22324; WO 98/46645). Chimeric antibodies can be produced using the methods described in, e.g., Morrison, 1985, Science 229:1202, and humanized antibodies by methods described in, e.g., U.S. Pat. No. 6,180,370.
Additional antibodies described herein are bispecific antibodies and multivalent antibodies, as described in, e.g., Segal et al., J. Immunol. Methods 248:1 -6 (2001); and Tutt et al., J. Immunol. 147: 60 (1991).
Other Polypeptide Targeting Moieties
Other polypeptides may be used as targeting moieties, e.g., antibody-like scaffold proteins or antibody mimetics such as fibronectin type III domains, DARPins, or centyrins. In some embodiments, the targeting moiety is a non-antibody protein scaffold, such as a knottin, an affibody, a green fluorescent protein, an ankryn repreat protein, an SH2 domain, or a PDZ domain. Exemplary protein scaffolds of the invention are described in Stern, L.A., et al., Curr. Opion. in Chem. Engineering, 2013, 2:425-432; Banta, S. et al., Annu. Rev. Biomed. Eng., 2013, 15:93-1 13; Skrlec, K., Trends in Biotechnology, 2015, 33(7):408-418; and Huang, H. et al., Methods Mol. Biol. 2017, 1555:225-254, each of which is incorporated herein with respect to the protein scaffolds therein.
In some embodiments, polypeptide targeting moieties may include monobodies constructed using a fibronectin type III domain (e.g., tenth type III domain of human fibronectin). In some embodiments, the polypeptide targeting moiety is a tenth type III domain of human fibronectin, or a polypeptide variant thereof, having at least 80% sequence identity with SEQ ID NO: 1 .
SEQ ID NO: 1
VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGS STATISGLKPGVDYTIT VYAVTGRGDSPASSKPISINYRT
In some embodiments, the polypeptide targeting moiety is an engineered or diversified polypeptide variant of SEQ ID NO: 1 . For example, the polypeptide targeting moiety may be an engineered or diversified variant of the fibronectin type III domain of SEQ ID NO: 1 , wherein the polypeptide variant includes mutations to one or more amino acids of the peptide (e.g., one or more solvent exposed amino acids of the polypeptide). In particular, loops BC, DE, and FG of the tenth type III domain of human fibronectin (bold in SEQ ID NO. 1) are structurally analogous to the antibody complementarity-determining regions H1 , H2, and H3, respectively, and may be diversified or engineered to select for binding to a target (e.g., a polypeptide target). Three additional loops, AB, CD, and EF, are also candidates for engineering or diversification. See, for example, Lipovsek, D. Protein Eng Des Sel. 24(1 -2):3-9 (201 1).
In some embodiments, the polypeptide targeting moiety in an engineered or diversified variant of the tenth type III domain of human fibronectin, where the BC, DE, or FG loop regions may include one or more mutations relative to SEQ ID NO: 1 . In some embodiments, the polypeptide targeting moiety is an engineered or diversified variant of the tenth type III domain of human fibronectin, having at least 80% sequence identity SEQ ID NO: 2, where "X" is any amino acid, and "m," "n," and "k" each, independently, have a value of 2 or greater (e.g., 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20).
SEQ ID NO: 2
VSDVPRDLEVVAATPTSLLISWD(X)mYYRITYGETGGNSPVQEFTVPG(X)nATISGLKPGVDYTITVYAV (X)KSSKPISINYRT
Libraries of antibody-like scaffold proteins (e.g., fibronectin type III domains) may be generated using molecular display and directed evolution techniques known in the art such as phage display, DNA or RNA display, or yeast surface display.
Protein Variants
A protein or polypeptide variant, as described herein, generally has an amino acid sequence that shows significant (e.g., 80% or more, i.e., 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) identity with that of a reference polypeptide but includes a limited number of particular amino acid changes (e.g., insertions, deletions, or substitutions, either conservative or non-conservative and/or including one or more amino acid variants or analogs [e.g., D-amino acids, desamino acids]) relative to the reference polypeptide. In certain embodiments, a variant shares a relevant biological activity (e.g., binding to a particular compound or moiety thereof) with the reference polypeptide; in some such embodiments, the variant displays such activity at a level that is not less than about 50% of that of the reference polypeptide and/or is not less than about 0.5 fold below that of the reference polypeptide.
In some embodiments, a variant polypeptide has an amino acid sequence that differs from that of a reference polypeptide at least (or only) in that the variant has a larger number of cysteine residues and/or has one or more cysteine residues at a position corresponding to a non-cysteine residue in the reference polypeptide. For example, in some embodiments, addition of one or more cysteine residues to the amino or carboxy terminus of any of a polypeptide as described herein can facilitate conjugation of such polypeptide by, e.g., disulfide bonding.
In some embodiments, amino acid substitutions can be conservative (i.e., wherein a residue is replaced by another of the same general type or group) or non-conservative (i.e., wherein a residue is replaced by an amino acid of another type). In some embodiments, a naturally occurring amino acid can be substituted for a non-naturally occurring amino acid (i.e., non-naturally occurring conservative amino acid substitution or a non-naturally occurring non-conservative amino acid substitution), or vice versa.
Polypeptides made synthetically can include substitutions of amino acids not naturally encoded by DNA (e.g., non-naturally occurring or unnatural amino acid). Examples of non-naturally occurring amino acids include D-amino acids, an amino acid having an azide-containing side chain, an amino acid having an acetylaminomethyl group attached to a sulfur atom of a cysteine, a pegylated amino acid, the omega amino acids of the formula NH2(CH2)nCOOH wherein n is 2-6, neutral nonpolar amino acids, such as sarcosine, t-butyl alanine, t-butyl glycine, N-methyl isoleucine, and norleucine. Phenylglycine may substitute for Trp, Tyr, or Phe; citrulline and methionine sulfoxide are neutral nonpolar, cysteic acid is acidic, and ornithine is basic. Proline may be substituted with hydro xyproline and retain the conformation conferring properties.
Analogs may be generated by substitutional mutagenesis and retain the structure (e.g., a local structure or global structure) of the original protein. Examples of substitutions identified as "conservative substitutions" are shown in Table 1 . If such substitutions result in a change not desired, then other type of substitutions, denominated "exemplary substitutions" in Table 1 , or as further described herein in reference to amino acid classes, are introduced and the products screened.
Substantial modifications in function or immunological identity are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the protein backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Naturally occurring residues are divided into groups based on common side chain properties:
(1) hydrophobic: norleucine, methionine (Met), Alanine (Ala), Valine (Val), Leucine (Leu), Isoleucine (He), Histidine (His), Tryptophan (Trp), Tyrosine (Tyr), Phenylalanine (Phe),
(2) neutral hydrophilic: Cysteine (Cys), Serine (Ser), Threonine (Thr)
(3) acidic/negatively charged: Aspartic acid (Asp), Glutamic acid (Glu)
(4) basic: Asparagine (Asn), Glutamine (Gin), Histidine (His), Lysine (Lys), Arginine (Arg)
(5) residues that influence chain orientation: Glycine (Gly), Proline (Pro);
(6) aromatic: Tryptophan (Trp), Tyrosine (Tyr), Phenylalanine (Phe), Histidine (His),
(7) polar: Ser, Thr, Asn, Gin
(8) basic positively charged: Arg, Lys, His, and;
(9) charged: Asp, Glu, Arg, Lys, His
Other amino acid substitutions are listed in Table 1 .
Table 1. Amino acid substitutions
Cys (C) Ser Ser
Gin (Q) Asn Asn
Glu (E) Asp Asp
Gly (G) Pro Pro
His (H) Asn, Gin, Lys, Arg Arg
He (1) Leu, Val, Met, Ala, Phe, norleucine Leu
Leu (L) Norleucine, lie, Val, Met, Ala, Phe lie
Lys (K) Arg, Gin, Asn Arg
Met (M) Leu, Phe, lie Leu
Phe (F) Leu, Val, He, Ala Leu
Pro (P) Gly Gly
Ser (S) Thr Thr
Thr (T) Ser Ser
Trp (W) Tyr Tyr
Tyr (Y) Trp, Phe, Thr, Ser Phe
Val (V) lie, Leu, Met, Phe, Ala, norleucine Leu
Protein Variants with Altered Reactive Amino Acid Profiles
In some embodiments, a protein or polypeptide variant may include the addition of one or more reactive amino acid residues (e.g., cysteines) to a protein (e.g., at the amino or carboxy terminus of any of the proteins described herein) can facilitate conjugation of these proteins by, e.g., disulfide bonding. In some embodiments, one or more reactive amino acids (e.g., cysteines) may be removed to decrease the number of possible conjugation sites on a protein. Amino acid substitutions can be conservative (i.e., wherein a residue is replaced by another of the same general type or group) or non-conservative (i.e., wherein a residue is replaced by an amino acid of another type). In addition, a naturally occurring amino acid can be substituted for a non-naturally occurring amino acid (i.e., non-naturally occurring conservative amino acid substitution or a non-naturally occurring non-conservative amino acid substitution).
Libraries
In some embodiments, the compounds, small molecule moieties, and/or polypeptide targeting moieties of the invention are members of libraries. Libraries including the compounds, small molecule moieties, and/or polypeptide targeting moieties of the invention may be tagged to assist in identification of library members. For example, the libraries may be tagged using any method known in the art such as DNA display libraries (also known as DNA-encoded libraries), RNA display libraries, yeast display libraries, or phage display libraries. Tagged libraries offer advantages such as allowing the screening of large libraries in one pot. In some embodiments, the compounds, small molecule moieties, and/or
polypeptide targeting moieties of the invention are members of large libraries (e.g., libraries including at least 105 members). In some embodiments, a library of the invention includes between about 102 to 1020 complexes (e.g., about 102 to 103, 102 to 104, 102 to 105, 102 to 106, 102 to 107, 102 to 108, 102 to 109, 102 to 1010, 102 to 1011 , 102 to 1012, 102 to 1013, 102 to 1014, 102 to 1015, 102 to 1016, 102 to 1017, 102 to 1018, 102 to 1019, 104 to 105, 104 to 106, 104 to 107, 104 to 108, 104 to 109, 104 to 1010, 104 to 1011 , 104 to 1012, 104 to 1013, 104 to 1014, 104 to 1015, 104 to 1016, 104 to 1017, 104 to 1018, 104 to 1019, 104 to 1020, 105 to 106, 105 to 107, 105 to 108, 105 to 109, 105 to 1010, 105 to 1011 , 105 to 1012, 105 to 1013, 105 to 1014, 105 to 1015, 105 to 1016, 105 to 1017, 105 to 1018, 105 to 1019, or 105 to 1020 members. Library Generation
Libraries useful in the methods of the invention may be prepared using any method known in the art. In some embodiments, libraries of polypeptide targeting moieties (e.g., fibronectin type III domains) may be prepared by a designed sitewise diversification strategy utilizing high throughput evolution and bioinformatics. In some embodiments, the members of the library may be prepared with only one reactive amino acid residue or with one optimal reactive amino acid residue. For example, libraries of polypeptide targeting moieties may be prepared using methods similar to those described in Woldring et al. PLoS One 10:e0138956 (2015), the methods of which are herein incorporated by reference. In some embodiments, the library of polypeptide targeting moieties is a synthetic antibody library. Synthetic antibody libraries may be prepared using any method known in the art. For example, a synthetic antibody library may be prepared by utilizing a CDR randomization method such as those described in Chen et al. Methods in
Mol. Biol. 1 131 :1 13-131 (2014) and Mandrup et al. PLoS One 8(10):e76834 (2013), the methods of which are herein incorporated by reference. The libraries of polypeptide targeting moieties may be DNA or RNA display libraries, yeast display libraries, or phage display libraries.
Libraries of polypeptide targeting moieties may be conjugated to one or more small molecule moieties to prepare a library of bifunctional compounds for use in the methods of the invention. The polypeptide targeting moieties may be conjugated to the one or more small molecule moieties via a linker (e.g., a polyethylene-containing linker). In some embodiments, all of the polypeptide targeting moieties in the library are conjugated to the same small molecule moiety. In some embodiments, all of the polypeptide targeting moieties in the library are conjugated to the small molecule moiety with the same linker. In some embodiments, the polypeptide targeting moieties in the library are conjugated to a small molecule moiety with different linkers.
Library Screening
The libraries of bifunctional compounds of the invention may be screened for the ability to modulate the activity of a target protein using any method known in the art. In some embodiments, libraries of bifunctional compound may be screened for activity using flow cytometry methods, magnetic selection methods, or pull down methods. In some embodiments, the libraries of bifunctional compounds
may be screened for activity using fluorescence based competition assays. For example, libraries of bifunctional compounds may be screened using methods described in Cho et al. Protein Eng. Des. Sel. 23:567-577 (2010); Tillotson, et al. Methods 60:27-37 (2013); Wang et al. J. Immunol. Methods 304:30-42 (2005); Wang et al. Nat. Methods 4:143-145 (2007); or Hoogenboom Nature Biotech. 23:1 105-1 116 (2005), the methods of each of which are herein incorporated by reference. The identity of the bifunctional compounds in the library with optimal activity may be determined utilizing any method known in the art. For example, if the bifunctional compound library is a DNA or RNA display library, the identity of the bifunctional compounds may be determined by sequencing the DNA or RNA tag on each compound. If the bifunctional compound library is a yeast display library, the identity of the bifunctional compound may be determined by sequencing the enriched yeast plasmid.
Target Proteins
A target protein (e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein) is any protein whose activity is desirably altered. In one example, a target protein mediates a disease condition or a symptom of a disease condition. As such, a desirable therapeutic effect can be achieved by modulating (inhibiting or increasing) its activity.
Target proteins can be naturally occurring, e.g., wild type. Alternatively, a target protein can vary from the wild type protein but still retain biological function, e.g., as an allelic variant, a splice mutant or a biologically active fragment. In some embodiments, a target protein is a transmembrane protein.
In some embodiments, the target protein is a GPCR. In some embodiments, the target protein is a Rhodopsin-like receptor such as a protein encoded by the gene CCR1 ; CCR2; CCR3; CCR4; CCR5;
CCR8; CCRL2; XCR1 ; CX3CR1 ; GPR137B; CCRL1 ; CCR6; CCR7; CCR9; CCR10; CXCR3; CXCR4;
CXCR5; CXCR6; CXCR7; IL8RA; IL8RB; GPR182; DARC; GPER; AGTR1 ; AGTR2; AGTRL1 ; BDKRB1 ; BDKRB2; GPR15; GRP25; OPRD1 ; OPRK1 ; OPRM1 ; OPRL1 ; SSTR1 ; SSTR2; SSTR3; SSTR4; SSTR5;
NPBWR1 ; NPBWR2; GPR1 ; GALR1 ; GALR2; GALR3; CYSLTR1 ; CYSLTR2; LTB4R; LTB4R2; RXFP1 ;
RXFP2; RXFP3; RXFP4; KISS1 R; MCHR1 ; UTS2R; CCKAR; CCKBR; NPFFR1 ; NPFFR2; HCRTR1 ;
HCRTR2; AVPR1A; AVPR1 B; AVPR2; GNRHR; QRFPR; GPR22; GPR176; BRS3; NMBR; GRPR;
EDNRA; EDNRB; GPR37; NMUR1 ; NMUR2; NTSR1 ; NTSR2; TRHR; GHSR; GPR39; MLNR; C3AR1 ; C5AR1 ; CMKLR1 ; FPR1 ; FPRL1 ; FPRL2; MAS1 ; MAS1 L; GPR1 ; GPR32; GPR44; GPR77; MTNR1 A;
MTNR1 B; TACR1 ; TACR2; TACR3; NPYR; NPY2R; PPYR1 ; NPY5R; PRLHR; PROKR1 ; PROKR2;
GPR19; GPR50; GPR75; GPR83; FSHR; LHCGR; TSHR; LGR4; LGR5; LGR6; FFAR1 ; FFAR2; FFAR3;
GPR42; P2RY1 ; P2RY2; P2RY4; P2RY6; P2RY8; P2RY1 1 ; HCAR1 ; HCAR2; HCAR3; GPR31 ; GPR82;
OXFR1 ; SUCNR1 ; P2RY12; P2RY13; P2RY14; GPR34; GPR87; GPR171 ; PTAFR; CNR1 ; CNR2;
LPAR1 ; LPAR2; LPAR3; S1 PR1 ; S1 PR2; S1 PR3; S1 PR4; S1 PR5; MC1 R; MC3R; MC4R; MC5R; MC2R;
GPR3; GPR6; GPR12; PTGDR; PTGER1 ; PTGER2; PTGER3; PTGER4; PTGFR; PTGIR; TBXA2R;
LPAR4; LPAR5; LPAR6; P2RY10; F2RL1 ; F2RL2; F2RL3; GPR183; GPR4; GPR65; GPR68; GPR17;
GPR18; GPR20; GPR35; GPR55; F2R; RHO; OPN1 SW; OPN1 MW; OPN1 LW; OPN3; OPN4; OPN5;
RGR; RRH ; 5-HT; HT2RA; HT2RB; HT2RC; HTR6; ADRA1 A; ADRA1 B; ADRA1 D; ADRA2A; DARA2B;
ADRA2C; ADRB1 ; ADRB2; ADRB3; DRD1 ; DRD2; DRD3; DRD4; DRD5; TAAR1 ; TAAR2; TAAR3;
TAAR5; TAAR6; TAAR8; TAAR9; HRH2; HRH1 ; HRH3; HRH4; ADORA1 ; ADORA2A; ADORA2B;
ADORA3; CHRM1 ; CHRM2; CHRM3; CHRM4; CHRM5; GPR21 ; GPR27; GPR45; GPR52; GPR61 ;
GPR63; GPR78; GPR84; GPR85; GPR88; GPR101 ; GPR161 ; GPR173; HTR1A; HTR1 B; HTR1 D;
HTR1 E; HTR1 F; HTR4; HTR5A; HTR7; VN1 R1 ; VN1 R2; VN1 R3; VN1 R4; or VN1 R5. In some embodiments, the target protein is a Secretin receptor such as a protein encoded by the gene
ADCYAP1 R1 ; CALCR; CRHR1 ; CRHR2; GIPR; GCGR; GLP1 R; GLP2R; GHRHR; PTHR1 ; PTHR2; SCTR; VIPR1 ; VIPR2; BAM ; BAI2; BAI3; CD97; CELSR1 ; CELSR2; CELSR3; EMR1 ; EMR2; EMR3;
EMR4; CPR56; CPR64; GPR97; GPR110; GPR11 1 ; GPR1 12; GPR1 13; GPR1 14; GPR1 15; GPR123;
GPR125; GPR126; GPR128; GPR133; GPR144; GPR157; ELTD1 ; LPHN1 ; LPHN2; LPHN3; GPR1 16;
HCTR-5; HCTR-6; KPG 006; or KPG 008. In some embodiments, the target protein is a metabotropic glutamate receptor such as a protein encoded by the gene GRM1 ; GRM5; GRM2; GRM3; GRM4; GRM6; GRM7; or GRM8. In some embodiments, the target protein is a cyclic AMP receptor. In some embodiments, the target protein is a Frizzled receptor family such as a protein encoded by the gene
FZD1 ; FZD2; FZD3; FZD4; FZD5; FZD6; FZD7; FZD8; FZD9; or FZD10. In some embodiments, the target protein is smoothened.
In some embodiments, the target protein is an ion channel. In some embodiments, the target protein is a calcium activated potassium channel such as a protein encoded by the gene KCNMA1 ;
KCNC1 ; KCNN2; KCNN3; KCNN4; KCNT1 ; KCNT2; or KCNU1 . In some embodiments, the target protein is a CatSper and Two-pore channel such as a protein encoded by the gene CATPSER1 ; CATSPER2;
CATSPER3; CATSPER4; TPCN1 ; or TPCN2. In some embodiments, the target protein is a cyclic nucleotide-regulated channels such as a protein encoded by the gene CNGA1 ; CNGA2; CNGA3;
CNGA4; CNGB1 ; CNGB3; HCN1 ; HCN2; HCN3; or HCN4. In some embodiments, the target protein is an inwardly rectifying potassium channel such as a protein encoded by the gene KCNJ1 ; KCNJ2;
KCNJ12; KCNJ4; KCNJ14; KCNJ3; KCNJ6; KCNJ9; KCNJ5; KCNJ10; KCNJ15; KCNJ16; KCNJ8;
KCNJ1 1 ; or KCNJ13. In some embodiments, the target protein is a ryanodine receptor such as a protein encoded by the gene RYR1 ; RYR2; or RYR3. In some embodiments, the target protein is a transient receptor potential channel such as a protein encoded by the gene TRPAA1 ; TRPC1 ; TRPC2; TRPC3;
TRPC4; TRPC5; TRPC6; TRPC7; TRPM1 ; TRPM2; TRPM3; TRPM4; TRPM5; TRPM6; TRPM7; TRPM8;
MCOLN1 ; MCOLN2; MCOLN3; PKD2; PKD2L1 ; PDK2L2; TRPV1 ; TRPV2; TRPV3; TRPV4; TRPV5; or
TRPV6. In some embodiments, the target protein is a two-P potassium channel such as a protein encoded by the gene KCNK1 ; KCNK2; KCNK3; KCNK4; KCNK5; KCNK6; KCNK7; KCNK9; KCNK10; KCNK12; KCNK13; KCNK15; KCNK16; KCNK17; or KCNK18. In some embodiments, the target protein is a voltage-gated calcium channel such as a protein encoded by the gene CACNA1 S; CACNA1 C;
CACNA1 D; CACNA1 F; CACNA1A; CACNA1 B; CACNA1 E; CACNA1 G; CACNA1 H; or CACNAH In
some embodiments, the target protein is a voltage-gated potassium channel such as a protein encoded by the gene KCNA1 ; KCNA2; KCNA3; KCNA4; KCNA5; KCNA6; KCNA7; KCNA10; KCNB1 ; KCNB2; KCNC1 ; KCNC2; KCNC3; KCNC4; KCND1 ; KCND2; KCND3; KCNF1 ; KCNG1 ; KCNG1 ; KCNG2;
KCNG3; KCNG4; KCNQ1 ; KCNQ2; KCNQ3; KCNQ4; KCNQ5; KCNV1 ; KCNV2; KCNS1 ; KCNS2;
KCNS3; KCNH1 ; KCNH5; KCNH2; KCNH6; KCNH7; KCNH8; KCNH3; or KCNH4. In some
embodiments, the target protein is a voltage-gated proton channel such as a protein encoded by the gene HVCN1. In some embodiments, the target protein is a voltage-gated sodium channel such as a protein encoded by the gene SCN1A; SCN2A; SCN3A; SCN4A; SCN5A; SCN8A; SCN9A; SCN10A; or SCN11A.
In some embodiments, the target protein is an enzyme. In some embodiments, the target protein is a oxidoreductase, dehydrogenase, luciferase, DMSO reductase, alcohol dehydrogenase (NAD), alcohol dehydrogenase (NADP), homoserine dehydrogenase, aminopropanol oxidoreductase, diacetyl reductase, glycerol dehydrogenase, propanediol-phosphate dehydrogenase, glycerol-3-phosphate dehydrogenase (NAD+), D-xylulose reductase, L-xylulose reductase, lactate dehydrogenase, malate dehydrogenase, isocitrate dehydrogenase, HMG-CoA reductase, glucose oxidase, L-gulonolactone oxidase, thiamine oxidase, xanthine oxidase, acetaldehyde dehydrogenase, glyceraldehyde 3-phosphate dehydrogenase, pyruvate dehydrogenase, oxoglutarate dehydrogenase, biliverdin reductase, protoporphyrinogen oxidase, monoamine oxidase, dihydrofolate reductase, methylenetetrahydrofolate reductase, sarcosine oxidase, dihydrobenzophenanthridine oxidase, NADH dehydrogenase, urate oxidase, nitrite reductase, nitrate reductase, glutathione reductase, thioredoxin reductase, sulfite oxidase, cytochrome c oxidase, coenzyme Q - cytochrome c reductase, catechol oxidase, laccase, cytochrome c peroxidase, catalase, myeloperoxidase, thyroid peroxidase, glutathione peroxidase, 4- hydroxyphenylpyruvate dioxygenase, renilla-luciferin 2-monooxygenase, cypridina-luciferin 2- monooxygenase, firefly luciferase, watasenia-luciferin 2-monooxygenase, oplophorus-luciferin 2- monooxygenase, cytochrome P450 oxidase, cytochrome P450, aromatase, a protein encoded by the gene CYP2D6, CYP2E1 , or CYP3A4, cytochrome P450 oxidase, nitric oxide dioxygenase, nitric oxide synthase, aromatase, a protein encoded by the gen CYP2D6, CYP2E1 , or CYP3A4, phenylalanine hydroxylase, tyrosinase, superoxide dismutase, ceruloplasmin, nitrogenase, deiodinase, glutathione S- transferase, Catechol-O-methyl transferase, DNA methyltransferase, histone methyltransferase, ornithine transcarbamoylase, aminolevulinic acid synthase, choline acetyltransferase, Factor XIII, gamma glutamyl transpeptidase, transglutaminase, hypoxanthine-guanine phosphoribosyltransferase, thiaminase, alanine transaminase, aspartate transaminase, butyrate kinase, hydrolytic enzyme, nuclease, endonuclease, exonuclease, acid hydrolase, phospholipase A, acetylcholinesterase, cholinesterase, lipoprotein lipase, ubiquitin carboxy-terminal hydrolase L1 , phosphatase, alkaline phosphatase, fructose bisphosphatase, phospholipase C, cGMP specific phosphodiesterase type 5, phospholipase D, restriction enzyme Type 1 , deoxyribonuclease I, RNase H, ribonuclease, amylase, sucrase, chitinase, lysozyme, maltase, lactase, beta-galactosidase, hyaluronidase, adenosylmethionine hydrolase, S-adenosyl-L-homocysteine hydrolase, alkenylglycerophosphocholine hydrolase, alkenylglycerophosphoethanolamine hydrolase,
cholesterol-5,6-oxide hydrolase, hepoxilin-epoxide hydrolase, isochorismatase, leukotriene-A4 hydrolase, limonene-1 ,2-epoxide hydrolase, microsomal epoxide hydrolase, trans-epoxysuccinate hydrolase, alanine aminopeptidase, angiotensin converting enzyme, serine protease, chymotrypsin, trypsin, thrombin, Factor X, plasmin, acrosin, Factor VII, Factor IX, prolyl oligopeptidase, Factor XI, elastase, Factor XII, proteinase K, tissue plasminogen activator, Protein C, separase, pepsin, rennet, renin, trypsinogen, plasmepsin, matrix metalloproteinase, metalloendopeptidase, urease, beta-lactamase, arginase, adenosine deaminase, GTP cyclohydrolase I, nitrilase, helicase, DnaB helicase, RecQ helicase, ATPase,
NaKATPase, ATP synthase, kynureninase, ornithine decarboxylase, uridine monophosphate synthetase, aromatic-L-amino-acid decarboxylase, rubisCO, carbonic anhydrase, tryptophan synthase, phenylalanine ammonia-lyase, cystathionine gamma-lyase, cystathionine beta-lyase, leukotriene C4 synthase, dichloromethane dehalogenase, halohydrin dehalogenase, adenylate cyclase, guanylate cyclase, phenylalanine racemase (ATP-hydrolysing), serine racemase, mandelate racemase, UDP-glucose 4- epimerase, methylmalonyl CoA epimerase, a protein encoded by the gene FKBP1A, FKBP1 B, FKBP2, FKBP3, FKBP5, FKBP6, FKBP8, FKBP9, FKBP10, FKBP52, or FKBPL, cyclophilin, parvulin, prolyl isomerase, 2-chloro-4-carboxymethylenebut-2-en-1 ,4-olide isomerase, beta-carotene isomerase, farnesol 2-isomerase, furylfuramide isomerase, linoleate isomerase, maleate isomerase, maleylacetoacetate isomerase, maleylpyruvate isomerase, parvulin, photoisomerase, prolycopene isomerase, prolyl isomerase, retinal isomerase, retinol isomerase, zeta-carotene isomerase, enoyl CoA isomerase, protein disulfide isomerase, phosphoglucomutase, muconate cycloisomerase, 3-carboxy-cis,cis-muconate cycloisomerase, tetrahydroxypteridine cycloisomerase, inositol-3-phosphate synthase, carboxy-cis.cis- muconate cyclase, chalcone isomerase, chloromuconate cycloisomerase, (+)-bornyl diphosphate synthase, cycloeucalenol cycloisomerase, alpha-pinene-oxide decyclase, dichloromuconate
cycloisomerase, copalyl diphosphate synthase, ent-copalyl diphosphate synthase, syn-copalyl- diphosphate synthase, terpentedienyl-diphosphate synthase, halimadienyl-diphosphate synthase, (S)- beta-macrocarpene synthase, lycopene epsilon-cyclase, lycopene beta-cyclase, prosolanapyrone-lll cycloisomerase, D-ribose pyranase, topoisomerase, 6-carboxytetrahydropterin synthase, FARSB, glutamine synthetase, argininosuccinate synthetase, CTP synthase, pyruvate carboxylase, acetyl-CoA carboxylase, or DNA ligase. Methods of Preparation
The compounds of the invention may be prepared using methods known in the art. For example, a small molecule moiety may be conjugated to a linker which includes a cross-linking group (e.g., a maleimide) to produce a compound of Formula VII:
A-L-B
Formula VII
wherein A includes a small molecule moiety;
L is a linker; and
B is a cross-linking moiety.
The compound of Formula VII may then be reacted with a polypeptide targeting moiety including one or more reactive amino acid residues (e.g., a free cysteine, a lysine, or a non-natural amino acid). In some embodiments, the small molecule moiety is conjugated to the polypeptide targeting moiety in a site-specific manner. In some embodiments, the site of conjugation is a solvent exposed amino acid of the polypeptide targeting moiety. In some embodiments, the site of conjugation is a solvent exposed amino acid located within the polypeptide chain (e.g., a solvent exposed amino acid residue located in a solvent exposed loop). In some embodiments, the site of conjugation is located at or near the terminus (e.g., within 10 amino acid residues of the C-terminus or within 10 amino acid residues of the N-terminus) of the polypeptide. In some embodiments, the polypeptide targeting moiety has been modified to include a reactive amino acid residue at a specific site. In some embodiments, the polypeptide targeting moiety has been modified to include no more than one reactive amino acid residue or no more than one reactive residue of a particular type (e.g., no more than one cysteine, no more than one lysine). In some embodiments, when the polypeptide targeting moiety is an antibody, the small molecule moiety is conjugated via a reactive amino acid residue in a CDR (e.g., CDR1) of the antibody. In some embodiments, the small molecule moiety is conjugated to the polypeptide targeting moiety via a glycosylation site. In some embodiments, the small molecule moiety is conjugated to the polypeptide targeting moiety via a framework residue distinct from the antigen binding site.
In some embodiments, a free cysteine utilized to conjugate a small molecule moiety to a polypeptide targeting moiety is produced by reducing the polypeptide targeting moiety under conditions sufficient to reduce at least one disulfide bond (e.g., a disulfide bond in the CDR or a loop region of the polypeptide targeting moiety). For example, the small molecule moiety may be conjugated to the polypeptide targeting moiety using methods similar to those described in Badescu, et al. Bioconjug. Chem. 25(3) :460-469 (2014); Badescu et al. Bioconjug. Chem. 25(6):1 124-1 136 (2014); Bryant et al. Mol. Pharm. 12(6):1872-1879 (2015); Schumacher et al. Org. Biomol. Chem. 7261 -7269 (2014); or Bryden et al. Bioconjug. Chem. 61 1 -617 (2014), the methods of each of which are herein incorporated by reference.
In some embodiments, a small molecule is conjugated to a polypeptide (e.g., via a linker) by enzymatic ligation. Enzymatic ligation may be performed by various techniques known to one in the art. For example, enzymatic ligation may be performed by (a) prenylation of CaaX motifs with protein farnesyltransferase (e.g., a described in Rose, M.W., et al., Biopolymers, 2005, 80, 164-171 ; and Hurwitz, H. I.; Casey, P. J. Curr. Topics Membr. 2002, 52, 531-550); (b) conjugation of [a]-LPETG and GGG-[b] with sortase A (e.g., as described in Levary, D., et al., PLOS One, 201 1 , 6, e18342); (c) ligation with lipoic acid ligase (Lpl) at Lpl acceptor peptide (e.g., as described in Fernandez-Suarez M, et al., Nat Biotech. 2007, 25, 1483-1487); or (d) using a transglutaminase reaction (e.g., as described in Strop, P. et al., Chemistry and Biology, 2013, 20, 161 -167).
Uses
Treatment of diseases or disorders
Compounds described herein may be useful in the methods of treating diseases or disorders related to the target proteins described herein, and, while not bound by theory, are believed to exert their desirable effects through their ability to modulate (e.g., positively or negatively modulate) the activity of a target protein (e.g., a eukaryotic target protein such as a mammalian target protein or a fungal target protein or a prokaryotic target protein such as a bacterial target protein).
Pharmaceutical Compositions
For use as treatment of human and animal subjects, the compounds of the invention can be formulated as pharmaceutical or veterinary compositions. Depending on the subject to be treated, the mode of administration, and the type of treatment desired— e.g., prevention, prophylaxis, or therapy— the compounds are formulated in ways consonant with these parameters. A summary of such techniques is found in Remington: The Science and Practice of Pharmacy, 21st Edition, Lippincott Williams & Wilkins, (2005); and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York, each of which is incorporated herein by reference.
Compounds described herein may be present in amounts totaling 1 -95% by weight of the total weight of the composition. The composition may be provided in a dosage form that is suitable for intraarticular, oral, parenteral (e.g., intravenous, intramuscular), rectal, cutaneous, subcutaneous, topical, transdermal, sublingual, nasal, vaginal, intravesicular, intraurethral, intrathecal, epidural, aural, or ocular administration, or by injection, inhalation, or direct contact with the nasal, genitourinary, reproductive or oral mucosa. Thus, the pharmaceutical composition may be in the form of, e.g., tablets, capsules, pills, powders, granulates, suspensions, emulsions, solutions, gels including hydrogels, pastes, ointments, creams, plasters, drenches, osmotic delivery devices, suppositories, enemas, injectables, implants, sprays, preparations suitable for iontophoretic delivery, or aerosols. The compositions may be formulated according to conventional pharmaceutical practice.
In general, for use in treatment, compounds described herein may be used alone, or in combination with one or more other active agents. An example of other pharmaceuticals to combine with the compounds described herein would include pharmaceuticals for the treatment of the same indication. Another example of a potential pharmaceutical to combine with compounds described herein would include pharmaceuticals for the treatment of different yet associated or related symptoms or indications. Depending on the mode of administration, compounds will be formulated into suitable compositions to permit facile delivery. Each compound of a combination therapy may be formulated in a variety of ways that are known in the art. For example, the first and second agents of the combination therapy may be formulated together or separately. Desirably, the first and second agents are formulated together for the simultaneous or near simultaneous administration of the agents.
Compounds of the invention may be prepared and used as pharmaceutical compositions comprising an effective amount of a compound described herein and a pharmaceutically acceptable carrier or excipient, as is well known in the art. In some embodiments, a composition includes at least two different pharmaceutically acceptable excipients or carriers.
Formulations may be prepared in a manner suitable for systemic administration or topical or local administration. Systemic formulations include those designed for injection (e.g., intramuscular, intravenous or subcutaneous injection) or may be prepared for transdermal, transmucosal, or oral administration. A formulation will generally include a diluents as well as, in some cases, adjuvants, buffers, preservatives and the like. Compounds can be administered also in liposomal compositions or as microemulsions.
For injection, formulations can be prepared in conventional forms as liquid solutions or suspensions or as solid forms suitable for solution or suspension in liquid prior to injection or as emulsions. Suitable excipients include, for example, water, saline, dextrose, glycerol and the like. Such compositions may also contain amounts of nontoxic auxiliary substances such as wetting or emulsifying agents, pH buffering agents and the like, such as, for example, sodium acetate, sorbitan monolaurate, and so forth.
Various sustained release systems for drugs have also been devised. See, for example, U.S. patent No. 5,624,677, which is herein incorporated by reference.
Systemic administration may also include relatively noninvasive methods such as the use of suppositories, transdermal patches, transmucosal delivery and intranasal administration. Oral administration is also suitable for compounds of the invention. Suitable forms include syrups, capsules, and tablets, as is understood in the art.
Each compound of a combination therapy, as described herein, may be formulated in a variety of ways that are known in the art. For example, the first and second agents of the combination therapy may be formulated together or separately.
The individually or separately formulated agents can be packaged together as a kit. Non-limiting examples include, but are not limited to, kits that contain, e.g., two pills, a pill and a powder, a suppository and a liquid in a vial, two topical creams, etc. The kit can include optional components that aid in the administration of the unit dose to subjects, such as vials for reconstituting powder forms, syringes for injection, customized IV delivery systems, inhalers, etc. Additionally, the unit dose kit can contain instructions for preparation and administration of the compositions. The kit may be manufactured as a single use unit dose for one subject, multiple uses for a particular subject (at a constant dose or in which the individual compounds may vary in potency as therapy progresses); or the kit may contain multiple doses suitable for administration to multiple subjects ("bulk packaging"). The kit components may be assembled in cartons, blister packs, bottles, tubes, and the like.
Formulations for oral use include tablets containing the active ingredient(s) in a mixture with nontoxic pharmaceutically acceptable excipients. These excipients may be, for example, inert diluents or
fillers (e.g., sucrose, sorbitol, sugar, mannitol, microcrystalline cellulose, starches including potato starch, calcium carbonate, sodium chloride, lactose, calcium phosphate, calcium sulfate, or sodium phosphate); granulating and disintegrating agents (e.g., cellulose derivatives including microcrystalline cellulose, starches including potato starch, croscarmellose sodium, alginates, or alginic acid); binding agents (e.g., sucrose, glucose, sorbitol, acacia, alginic acid, sodium alginate, gelatin, starch, pregelatinized starch, microcrystalline cellulose, magnesium aluminum silicate, carboxymethylcellulose sodium, methylcellulose, hydroxypropyl methylcellulose, ethylcellulose, polyvinylpyrrolidone, or polyethylene glycol); and lubricating agents, glidants, and antiadhesives (e.g., magnesium stearate, zinc stearate, stearic acid, silicas, hydrogenated vegetable oils, or talc). Other pharmaceutically acceptable excipients can be colorants, flavoring agents, plasticizers, humectants, buffering agents, and the like.
Two or more compounds may be mixed together in a tablet, capsule, or other vehicle, or may be partitioned. In one example, the first compound is contained on the inside of the tablet, and the second compound is on the outside, such that a substantial portion of the second compound is released prior to the release of the first compound.
Formulations for oral use may also be provided as chewable tablets, or as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluents (e.g., potato starch, lactose, microcrystalline cellulose, calcium carbonate, calcium phosphate or kaolin), or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example, peanut oil, liquid paraffin, or olive oil. Powders, granulates, and pellets may be prepared using the ingredients mentioned above under tablets and capsules in a conventional manner using, e.g., a mixer, a fluid bed apparatus or a spray drying equipment.
Dissolution or diffusion controlled release can be achieved by appropriate coating of a tablet, capsule, pellet, or granulate formulation of compounds, or by incorporating the compound into an appropriate matrix. A controlled release coating may include one or more of the coating substances mentioned above and/or, e.g., shellac, beeswax, glycowax, castor wax, carnauba wax, stearyl alcohol, glyceryl monostearate, glyceryl distearate, glycerol palmitostearate, ethylcellulose, acrylic resins, dl- polylactic acid, cellulose acetate butyrate, polyvinyl chloride, polyvinyl acetate, vinyl pyrrolidone, polyethylene, polymethacrylate, methylmethacrylate, 2-hydroxymethacrylate, methacrylate hydrogels, 1 ,3 butylene glycol, ethylene glycol methacrylate, and/or polyethylene glycols. In a controlled release matrix formulation, the matrix material may also include, e.g., hydrated methylcellulose, carnauba wax and stearyl alcohol, carbopol 934, silicone, glyceryl tristearate, methyl acrylate-methyl methacrylate, polyvinyl chloride, polyethylene, and/or halogenated fluorocarbon.
The liquid forms in which the compounds and compositions of the present invention can be incorporated for administration orally include aqueous solutions, suitably flavored syrups, aqueous or oil suspensions, and flavored emulsions with edible oils such as cottonseed oil, sesame oil, coconut oil, or peanut oil, as well as elixirs and similar pharmaceutical vehicles.
Generally, when administered to a human, the oral dosage of any of the compounds of the combination of the invention will depend on the nature of the compound, and can readily be determined by one skilled in the art. Typically, such dosage is normally about 0.001 mg to 2000 mg per day, desirably about 1 mg to 1000 mg per day, and more desirably about 5 mg to 500 mg per day. Dosages up to 200 mg per day may be necessary.
Administration of each drug in a combination therapy, as described herein, can, independently, be one to four times daily for one day to one year, and may even be for the life of the subject. Chronic, long-term administration may be indicated. EXAMPLES
Example 1. Determination of optimal binding sites, linkers, and small molecule moieties
A non-binding fibronectin type III domain is mutated to contain a single cysteine at specific positions (e.g., G79, T28, R30, R78, D80, S53, T71 , K63, or L19). The fibronectin type III domains are displayed on the surface of a yeast cell. For example, using the methods described in Chen et al.
Methods Enzymol. 523:303-326 (2013) and/or Boder et al. Nat. Biotechnol. 15:553-557 (1997).
Small molecule moieties (e.g., sulfonamide-containing small molecule moieties) are conjugated to the mutated fibronectin type III domains via a cross-linking group (e.g., a maleimide). If more than one small molecule moiety is used, the bifunctional compounds with different small molecule moieties or different linkers may be separated.
The bifunctional compounds are combined with a target protein (e.g., a carbonic anhydrase such as carbonic anhydrase 9 or carbonic anhydrase 2) and the binding of the bifunctional compound to the target is determined, e.g., using a fluorescence based competition assay.
Example 2. Preparation of Bifunctional Compound Libraries
Bifunctional compounds identified in Example 1 which are determined to bind to the target protein are utilized as starting points for libraries.
A library of fibronectin type III domains identified in Example 1 as resulting in bifunctional compounds capable of binding the target protein is prepared by a designed sitewise diversification strategy of the remainder of the paratope (e.g., diversification of any amino acid except the added cysteine) developed through high throughput evolution and bioinformatics. For example, diversification is conducted using methods described in Woldring et al. PLoS One 10:e0138956 (2015).
The library of fibronectin type III domains is introduced into the yeast display system by homologous recombination. The displayed fibronectin type III domains are conjugated to the small molecule moieties (e.g., via a cross-linking moiety such as a maleimide-containing cross-linking moiety).
Example 3. Screening of bifunctional compound against target protein
Bifunctional compounds are screened for activity against target proteins, e.g., using flow cytometry, magnetic selection, or yeast pull down assays. For example, bifunctional compounds are screened with flow cytometry with fluorescently labeled human lysate or yeast pull-down on adherent human cell monolayers as described in Cho et al. Protein Eng. Des. Sel. 23:567-577 (2010); Tillotson, et al. Methods 60:27-37 (2013); Wang et al. J. Immunol. Methods 304:30-42 (2005); or Wang et al. Nat. Methods 4:143-145 (2007).
The identity of bifunctional compounds which bind to the target protein are determined by sequencing enriched yeast plasmid.
Example 4. Identification of bifunctional compounds which bind carbonic anhydrase
Bifunctional compounds comprising a fibronectin type III domain (Fn) conjugated via a linker to acetazolamide (AAZ) were identified by screening yeast-displayed Fn-AAZ libraries for their ability to bind either carbonic anhydrase 9 (CA9) or carbonic anhydrase 2 (CA2). Selection of an Fn-AAZ library against CA9 produced Fn-AAZ clones that bind with high affinity to CA9, including Fn-AAZ clones that bind to CA9 with higher affinity than either Fn or AAZ, alone. Selected Fn-AAZ clones also showed increased specificity for CA9 over related carbonic anhydrase 2 (CA2). Selection of an Fn-AAZ library against CA2 produced Fn-AAZ clones that bind with high affinity to CA2. Target biotinylation
5 μΜ recombinant His-tagged human carbonic anhydrase 9 (CA9, Sino Biological) was incubated with 500 μΜ EZ-link NHS-Biotin (Thermo) in PBS, pH 7.4 for 4 hours at room temperature.
Approximately 2 biotin molecules conjugated per CA9 molecule was confirmed by MALDI-TOF mass spectrometry. Carbonic anhydrase 2 (CA2, Sino Biological) was biotinylated in the same manner at 15 μΜ with 135 μΜ NHS-Biotin, and conjugation was again confirmed by MALDI-TOF. Unreacted biotin was removed by two sequential desaltings using Zeba 7K desalting spin columns (Thermo).
Yeast display of fibronectin clones
Plasmids encoding single clones pCT-FnR (a hydrophilic fibronectin domain binder to rabbit IgG) and pCT-FnR-T28C were transformed into EBY100 yeast following the EZ yeast method (Zymo
Research). Plasmids were generated using standard cloning techniques. Transformed yeast were grown by shaking at 30°C in SD-CAA (16.8 g/L sodium citrate dihydrate, 3.9 g/L citric acid, 20.0 g/L dextrose, 6.7 g/L yeast nitrogen base, 5.0 g/L casamino acids) media and induced by transferring to SG-CAA (10.2 g/L sodium phosphate dibasic heptahydrate, 8.6 g/L sodium phosphate monobasic monohydrate, 19.0 g/L galactose, 1 .0 g/L dextrose, 6.7 g/L yeast nitrogen base, 5.0 g/L casamino acids) media and shaking for at least 4 hours at 30°C.
Selection of sites for conjugation to small molecules
The structure of Fn was evaluated to select amino acids (e.g., solvent exposed amino acids) for conjugation to a small molecule (AAZ) (Figures 2A-B).
As shown in Figures 3A-C, Maleimide-fluorescein is effectively conjugated to yeast-displayed Fn with a single cysteine. EBY100 yeast, transformed with pCT-FnR or pCT-FnR-T28C vector, were induced to display the indicated Fn clone. Two million induced yeast were washed in PBS, pH 7.4 and incubated with maleimide-fluorescein in 50 μΙ_ PBS, pH 7.4 at room temperature. Yeast were washed with PBS +1 g/L BSA (PBSA) and analyzed via flow cytometry.
As shown in Figure 4, Maleimide-AAZ is effectively conjugated to yeast-displayed Fn. EBY100 yeast, transformed with pCT-FnR-T28C vector, were induced to display the Fn clone. Two million induced yeast were washed in PBS, pH 7.4 and incubated with 0 or 2 μΜ maleimide-PEG3-AAZ in PBS, pH 7.4 for 2 hours. Yeast were then incubated with 2 μΜ maleimide-fluorescein in PBS, pH 7.4 for 2 hours. Yeast were washed with PBSA and analyzed via flow cytometry. Unlabeled yeast were included as a control. Conjugation with maleimide-AAZ reduced fluorescein conjugation by 70%, which is consistent with effective AAZ conjugation.
Single clone and library conjugation to small molecules
Two million induced yeast expressing selected fibronectin clones were washed in PBS, pH 6.5, then incubated in 50 μΙ_ PBS, pH 6.5 with 0.02, 0.2, or 2 μΜ fluorescein-5-maleimide (Pierce) or maleimide-XPEG-Acetazolamide (AAZ) for 10 minutes, 30 minutes, 1 , or 2 hours at room temperature while rocking. Yeast were washed 2x in 1 mL PBS, pH 7.4 +1 g/L BSA (PBSA) to remove unconjugated small molecule. Library conjugations were performed on 3.4 x 109 (15x diversity) transformed and induced yeast expressing the designed libraries in 2 mL PBS, pH 6.5 with 8 μΜ maleimide-XPEG-AAZ for 2 hours at room temperature while rocking. Small molecules with PEG linkers of lengths 2, 3, 5, and 7 were conjugated in separate reactions. After incubation, yeast were washed 4 times in 50 mL PBSA to remove unconjugated small molecule and the 4 conjugated yeast populations were pooled.
Library construction
Oligonucleotides encoding the Fn-Cys yeast-displayed designed libraries were synthesized by IDT DNA Technologies, amplified by overlap extension PCR, and transformed into EBY100 by homologous recombination with the pCT vector following the protocol by Woldring, D.R., et al. PLoS One. 10:e0138956 (2015). As shown in Figure 7, the indicated sites were diversified using degenerate codons to allow the indicated amino acids. 20* refers to a biased composition that balances amino acid frequencies observed in human antibody complementarity-determining regions as well as evolved fibronectin domains (Woldring, et al. PLOS One 2015). Loop lengths are varied by including or excluding codons at sites 27, 28, 55, 81 , and 82. In one library, site 28 was conserved as cysteine. In a second library, site 80 was
conserved as cysteine. Both libraries had 200 million transformants in yeast.
Sequence analysis confirms that library construction matches design.
Magnetic bead selection
15x diversity, small molecule conjugated libraries were incubated with 10 μΙ_ streptavidin coated dynabeads (Thermo) for 1 hour at room temperature while tumbling. Unbound yeast were removed and again incubated with 10 μΙ_ streptavidin coated Dynabeads. Unbound yeast were removed and incubated with 35.5 nM biotinylated CA9 in PBSA for 30 minutes at room temperature. Yeast were washed 4x in 2 mL PBSA, then incubated with 10 uL streptavidin coated Dynabeads in 1 ml_ PBSA for 1 hour at room temperature. Beads were washed 2x in PBSA, resuspended in SD-CAA media and incubated overnight while shaking at 30°C. Beads were then removed and the yeast were induced in SG-CAA for subsequent magnetic bead sorting, sorting by flow cytometry, or analysis.
Target binding and flow cytometry
Fluorescein-5-maleimide conjugated to yeast-displayed FN was detected directly on a BD Accuri
C6 flow cytometer using the standard equipped 488 nm excitation laser and 533/30 nm emission filter. In binding experiments, yeast-displaying Fn were conjugated with maleimide-XPEG-AAZ as described above. Yeast were incubated to equilibrium with indicated concentrations of biotinylated target at room temperature in sufficient volume of PBSA to ensure at least 10-fold molar excess of target to Fn. Primary antibody against c-MYC (9E10) was also included in the target incubation. Yeast were then washed in cold PBSA and incubated with streptavidin-AF647 (Thermo) and goat anti-mouse-FITC (Thermo) for 15 minutes at 4°C. Yeast were again washed in cold PBSA and analyzed using a BD Accuri C6 flow cytometer equipped with the standard 488 nm laser and 533/30 nm emission filter for FITC detection and the 640 nm laser and 675/25 nm emission filter for AF647 detection.
Yeast-displayed Fn-AAZ is functional at multiple conjugation sites
As shown in Figure 6A-B, yeast-displayed Fn-AAZ is functional at multiple conjugation sites. Yeast displaying FnR or a single mutant (D80, R78, R30, or T28) were conjugated with maleimide- fluorescein or
maleimide-PEG-AAZ. Yeast were washed with PBSA, incubated with 250 nM biotinylated carbonic anhydrase 9, washed with PBSA, and incubated with AlexaFluorconjugated streptavidin. Yeast were washed and analyzed by flow cytometry. All four conjugation sites exhibit functional binding.
Fn-AAZ conjugates can be selected for binding to carbonic anhydrase 9
As shown in Figure 5, yeast-displayed Fn-AAZ libraries were determined to bind carbonic anhydrase. Yeast displayed FnR or FnRT28C were conjugated with maleimide-fluorescein or maleimide- PEG3-AAZ. Yeast were washed with PBSA, incubated with 250 nM biotinylated carbonic anhydrase 9,
washed with PBSA, and incubated with AlexaFluoroconjugated streptavidin. Yeast were washed and analyzed by flow cytometry. Bare yeast were also included for comparison. Dramatically increased carbonic anhydrase binding was observed for FnR-T28C + maleimide-PEG3-AAZ relative to both the non-cysteine control and the maleimide-fluorescein controlA
As shown in Figure 8, Fn and AAZ provide mutual benefit in target binding. Yeast-displayed Fn libraries were sorted for binding to carbonic anhydrase using one magnetic bead selection (Ackerman, et al. Biotech. Prog. 2009). The resulting populations (Lib 0.1), as well as the FnR control, were conjugated with maleimide-PEG-AAZ (or not conjugated as a control). Yeast were labeled with 35.5 nM biotinylated carbonic anhydrase 9, washed, and labeled with AlexaFluor647-conjugated streptavidin. Yeast were also labeled with mouse anti-c-MYC antibody and AlexaFluor488-conjugated anti-mouse antibody to identify full-length Fn in the library populations (FnR lacks the c-MYC epitope). Binding is enabled by the combination of select Fn clones and the AAZ conjugation. AAZ conjugation by itself is insufficient to provide binding at this concentration in the context of FnR and many library variants. Fn variants by themselves (no AAZ) are unable to provide binding at this concentration.
As shown in Figure 9, Fn-AAZ conjugates bind strongly to carbonic anhydrase 9. Yeast- displayed Fn libraries were sorted twice for binding to carbonic anhydrase (two bead sorts for PEG2 and PEG3 populations; one bead sort and one flow cytometric sort for PEG5 and PEG7 populations). The resulting populations were conjugated with maleimide-PEG-AAZ. Yeast were labeled with 0.1 or 1 nM biotinylated carbonic anhydrase 9 (0.1 nM for PEG5 and PEG7; 1 nM for PEG2 and PEG3), washed, and labeled with AlexaFluor647-conjugated streptavidin. Yeast were also labeled with mouse anti-c-MYC antibody and AlexaFluor488-conjugated anti-mouse antibody to identify full-length Fn in the library populations.
Selection of Fn-AAZ conjugates that bind selectively to carbonic anhydrase 9
As shown in Figure 10, Fn-AAZ clones selected for binding to carbonic anhydrase 9 were found to bind selectively to carbonic anhydrase 9 (CA9) over carbonic anhydrase 2 (CA2). Yeast-Fn-AAZ populations enriched for CA9 binding were induced to display Fn and conjugated with maleimide- PEG-AAZ and washed. Conjugated yeast were labeled with 0.1 nM biotinylated CA9 or 10 nM biotinylated CA2, washed, and labeled with AlexaFluor647-conjugated streptavidin. Yeast were also labeled with mouse anti-c-MYC antibody and AlexaFluor488-conjugated anti-mouse antibody to identify full-length Fn in the library populations. CA9 specific binding is observed in both the T28C libraries and the D80C libraries.
By contrast, Figure 11 , shows that, in the absence of conjugation to an Fn domain, AAZ- Fluorescein shows relatively little selectivity for CA9 (Kd = 340nM) over CA2 (Kd = 560 nM).
Fn-AAZ can be selected for binding to carbonic anhydrase 2
As shown in Figure 12, libraries of yeast-displayed Fn-AAZ conjugates can be enriched to identify clones that bind with high affinity to carbonic anhydrase 2. Yeast-displayed Fn libraries were sorted twice for binding to carbonic anhydrase 2 (two bead sorts for PEG3 population; one bead sort and one flow cytometric sort for PEG5 and PEG7 populations). The resulting populations were conjugated with maleimide-PEG-AAZ. Yeast were labeled with 2.5 nM biotinylated carbonic anhydrase 2, washed, and labeled with AlexaFluor647-conjugated streptavidin. Yeast were also labeled with mouse anti-c-MYC antibody and AlexaFluor488-conjugated anti-mouse antibody to identify full-length Fn in the library populations.
Fn-AAZ conjugate clones identified having high affinity for carbonic anhydrase 9
Fn-AAZ clones selected for binding to carbonic anhydrase 9 were expressed, purified, and sequenced according to methods well-known to one of skill in the art. Figures 13A-C show the results of an exemplary expression and purification of an Fn-AAZ clone. As shown in Figure 14A-B, two Fn-AAZ conjugates were further characterized following expression and purification. A first Fn-AAZ clone (Clone 0.3.10) was identified that has 10-fold higher affinity to carbonic anhydrase 9 when compared to Fn that has not been conjugated to AAZ (Figure 14A). The sequence of the selected fibronectin type III domain of the first Fn-AAZ conjugate corresponds to SEQ ID NO:3. A second Fn-AAZ clone (Clone 0.3.9) was identified that has approximately 6-fold higher affinity to carbonic anhydrase 9 when compared to Fn that has not been conjugated to AAZ (Figure 14B). The sequence of the selected fibronectin type III domain of the second Fn-AAZ conjugate corresponds to SEQ ID NO:4. The sequences of the selected fibronectin type III domains of several other Fn-AAZ conjugates having high affinity and selectivity for carbonic anhydrase 9 are provided in SEQ ID NOs: 5-8. SEQ ID NO: 3
MASSSDSPRNLEVTNATPNSLTISWDSYLDCAYYYRITYGETGGNSPSQEFTVPGYTNSVTISGLKPGQD YTITVYAVASSNDVSNPISINYRTEIDKPSQGS
SEQ ID NO: 4
MASSSDSPRNLEVTNATPNSLTISWDDSYCVIYYRITYGETGGNSPSQEFTVPGYTNSVTISGLKPGQDY TITVYAVTDYSKLDPSNPISINYRTEIDKPSQGS
SEQ ID NO: 5
MASSSDSPRNLEVTNATPNSLTISWDYHQNGCAVSYRITYGETGGNSPSQEFTVPGYYDTYSATISGLKP GQDYTITVYAVTGYNDDSNPISINYRTEIDKPSQGS
SEQ ID NO: 6
MASSSDSPRNLEVTNATPNSLTISWDYSYCVLYYRITYGETGGNSPSQEFTVPGYYYSATISGLKPGQDY TITVYAVTDTGDESNPISINYRTEIDKPSQGS
SEQ ID NO: 7
MASSSDSPRNLEVTNATPNSLTISWDYSYCVLSYRITYGETGGNSPSQEFTVPGYYTSATISGLKPGQDY TITVYAVATIDYKDSNPISINYRTEIDKPSQGS
SEQ ID NO: 8
MASSSDSPRNLEVTNATPNSLTISLDDPSFCVIYYRITYGETGGNSPSQEFTVPGYTNTATISGLKPGQDY T IT VYAVASYG YLTSN P IS I N YRT E I DKPSQGS
Example 5. Identification of bifunctional compounds which bind CXCR4
Libraries of bifunctional compounds were constructed by site-specific conjugation of a fibronectin type III domain (Fn), at either Cys28 or Cys80, to a cyclic peptide CXCR4 antagonist (CP) via a linker. The yeast-displayed Fn-CP libraries were screened for their ability to bind polypeptide target, CXCR4. Figure 15 shows the % yield of yeast recovered following two rounds of FACS sorting of the yeast- displayed libraries of Fn-CPs. The resulting Fn-CPs are further enriched by additional rounds of sorting, and the resulting enriched populations are characterized for their ability to bind CXCR4, as previously described and by other methods known to one or skill in art. Individual Fn-CP clones are selected from the enriched population, and are further expressed, purified, and characterized for their ability to bind CXCR4 and related target.
OTHER EMBODIMENTS
It is to be understood that while the present disclosure has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the present disclosure, which is defined by the scope of the appended claims. Other aspects, advantages, and alterations are within the scope of the following claims.
Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments in accordance with the invention described herein. The scope of the present invention is not intended to be limited to the above
Description, but rather is as set forth in the appended claims.
In the claims, articles such as "a," "an," and "the" may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include "or" between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise
relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
It is also noted that the term "comprising" is intended to be open and permits but does not require the inclusion of additional elements or steps. When the term "comprising" is used herein, the term "consisting of is thus also encompassed and disclosed.
Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or subrange within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
In addition, it is to be understood that any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Since such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the compositions of the invention (e.g., any polynucleotide or protein encoded thereby; any method of production; any method of use) can be excluded from any one or more claims, for any reason, whether or not related to the existence of prior art.
Claims
What is claimed:
1. A synthetic bifunctional compound, or a pharmaceutically acceptable salt thereof, that modulates the activity of an extraceliuiar target protein, the compound comprising a polypeptide targeting moiety thai binds to the extraceliuiar target protein covalent!y conjugated to a small molecule moiety that binds to the extracellular target protein,
wherein the bifunctional compound binds to the target protein with at least 5-fold greater affinity and/or 5-foid greater selectivity than the affinity of each of the polypeptide targeting moiety and the small mo!ecule moiety alone.
2. The synthetic bifunctional compound of claim 1 , wherein the polypeptide targeting moiety is an antibody or an antigen binding fragment thereof or a fibronectin type ill domain.
3. The synthetic bifunctional com ound of claim 2, wherein the antibody or an antigen binding fragment thereof is an antibody or a fibronectin type ill domain.
4. The synthetic bifuncSonai compound of any one of claims 1 to 3, wherein the polypeptide targeting moiety does not bind at a small molecule binding site of the extracellular target protein.
5. The synthetic bifuncSonai compound of any one of claims 1 to 4, wherein the small molecule moiety binds the extracellular target protein with low affinity when not eovaleniiy conjugated io the polypeptide targeting moiety.
6. The synthetic bifunctional compound of any one of claims 1 to 5, wherein the small moiecule moiety binds at the active site of the extraceliuiar target protein.
7. The synthetic bifuncSonai compound of any one of claims 1 to 6, wherein the extracellular target protein beiongs to a family of extracellular proteins and the smaii mo!ecuie moiety binds to at least two members of the famly of extracellular proteins.
8. The synthetic bifuncSonai compound of any one of ciaims 1 to 7, wherein the small molecule moiety is covaient!y conjugated to the polypeptide targeting moiety via a linker.
9. The synthetic bifunctional compound of any one of ciaims 9, wherein the linker is conjugated to the polypeptide targeting moiety via a solvent exposed amino acid
10. The synthetic Afunctional compound of claim 8 or 9, wherein the linker is conjugated to the polypeptide targeting moiety via a cysteine, a lysine, or a non-naturai amino acid.
11. The synthetic Afunctional compound of any one of claims 8 to 10, wherein the linker is conjugated to the polypeptide targeting moiety by enzymatic ligation.
12. The synthetic Afunctional compound of a y one of claims 8 to 11 , wherein the linker comprises one or more amino acids and the bond conjugating the linker to the polypeptide targeting moiety is a peptide bond.
13. The synthetic Afunctional compound of any one of claims 8 to 10, wherein the linker has the structure of Formula I:
A1-{B1MC¾-{B2}h-(0)-{B3HC2)r(B4}k-A2
Formula i
wherein A's is a bond between the linker and polypeptide targeting moiety; A2 is a bond between the small molecule moiety and the Sinker; B\ B2 B3, and B4 each, independently, is selected from optionally substituted C 1-C2 alkyi, optionally substituted C1-C3 heteroalkyl, O, S, and NRN; N is hydrogen, optionally substituted C ; .< alkyi, optionally substituted C2-4 aikenyL optionally substituted C2-4 aikynyi, optionally substituted C2-6 heterocyclyl, optionally substituted C6-i2 aryl, or optionally substituted C1-7 heteroaikyi; C1 and C2 are each, independently, selected from carbonyl, thiocarbonyi, sulphonyl, or phosphory!; f, g, h, i, j, and k are each, independently, 0 or 1; and D is optionally substituted C1-10 alkyi, optionally substituted C2-10 alkenyi, optionally substituted C2-S0 aikynyi, optionally substituted C2-S heierocyclyl, optionally substituted Ce-i2 aryi, optionally substituted C2-C10 polyethylene glycol, or optionally substituted Ci :« heteroaikyi, or a chemical bond linking A1-{B1)i-(C1)3-iB2)h- to -{Β3>-(02¾-(Β )¾- A2.
14. The synthetic bifunctionai compound of any one of claims 1 to 13, wherein the srnaii molecule moiety and the polypeptide targeting moiety bind to different sties on the extracellular target protein.
15. The synthetic bifunctionai compound of any one of claims 1 to 14, wherein the off-rale of the binding of the synthetic bifunctionai compound to the extracellular protein is slower than the turnover of the extracellular target protein.
18. The synthetic bifunctionai compound of any one of claims 1 to 15, wherein the synthetic bifunctionai compound inhibits the activity of the extracellular target protein.
17. The synthetic bifunctionai compound of any one of claims 1 to 16, wherein the extraceiiuiar target protein is a soluble protein.
18. The synthetic bifunctionai compound of any one of claims 1 to 17, wherein the extraceiiuiar target protein is a membrane-bound protein.
19. The synthetic bifunctionai compound of any one of claims 1 to 16, wherein the extracellular target protein is a transmembrane protein.
20. The synthetic bifunctionai compound of any one of claims 1 to 19, wherein the extracellular target protein is a carbonic anhydrase.
21. The synthetic bifunctionai compound of claim 20, wherein the small molecule moiety is a sulfonamide.
22. The synthetic bifunctionai compound of claim 20 or 21 , wherein the small molecule moiety comprises the structure of Formula II:
Formula II
wherein R■ is optionaiiy substituted C i-Ce aikyi, optionaiiy substituted Ci-Cs heteroa!kyi, optionaiiy substituted Cs-do ary!, or optionally substituted C2-C9 heteroaryi.
23. The synthetic bifunctionai compound of an one of claims 1 to 19, wherein the extracellular target protein is a metai!oprotease.
24. The synthetic bifunctionai compound of claim 23, wherein the small molecule moiety is a hydroxamic acid.
25. The synthetic bifunctionai compound of claim 23 or 24, wherein the small molecule moiety comprises the structure of Formula Hi:
Formula lit
■wherein R2 is optionaiiy substituted Ci-Cs aikyi, optionaiiy substituted C1-C5 heteroalky!, optionaiiy substituted Ce-Cic aryi, or optionaiiy substituted Gz-Cs heteroaryi.
28. The synthetic bifunctionai compound of any one of ciaims 1 to 19, wherein the extracellular target protein is PS A.
27. The bifunctionai compound of claim 26, wherein the smaii molecule moiety is a thiadiazole sulfonamide or comprises a glutamate-urea-iysine moiety.
28. The bifunctionai compound of ciaim 26 or 27, wherein the smail molecule moiety comprises the structure of Formul
Formula IV Formula V
wherein 3 is optionally substituted Gt-Cs alkyl or opiionaiiy substituted Ci-Cs heteroalkyi
(e.g., -NHC{0)-}; and
R4 is opiionaiiy substituted C -Cs aSkyl, opiionaiiy substituted Gt-Ce heteroalkyi, opiionaiiy substituted Cs-do aryi, opiionaiiy substituted C2-C3 heieroaryi, or optionally substituted Cs-Cis aryi Ci-Cs alky!, or opiionaiiy substituted C2-C9 heieroaryi C f-Cs alky!.
29. The bifunctionai compound of ciaim 28, wherein the smaii molecule moiet comprises the structure:
30. The bifunctionai compound of any one of ciaims 1 to 19, wherein the extracellular target protein is CXC 4.
31 . The bifunctionai compound of ciaim 30, wherein the sma!i molecule moiety is a cyclic peptide.
32. The bifunctionai compound of ciaim 30 or 31 , wherein the smaii molecule moiety comprises the structure of Formula VI:
Formula V!
wherein R5 is optionaSly substituied Ci-Ce aikyl, optionaiiy substituted Ci-Cs heteroalky!. optionally substituted Ce-Cie aryi, optionaiiy substituted C2-C3 heteroaryi, or optionally substituted Cg-Cio ary! Ci-Ce alky!. or optionaiiy substituted C2-C9 heteroaryi CI-CB alky!.
33. The bifunciionai compound of claim 32, wherein the small molecule moiety comprises the structure:
34. A method of identifying a compound that modulates the activity of a target protein, the method comprising:
(a) providing two or more synthetic Afunctional compounds comprising a pc!ypeptide targeting moiety covaient!y conjugated to a small molecule moiety; and
(b) contacting a target protein with the two or more synthetic bifunciionai compounds;
(c) determining the binding of the two or more synthetic bifunciionai compounds to the target protein,
wherein a compound is identified as modulating the activity of the target protein if the synthetic bifunctionai compound binds to the target protein with at ieast 5-fold greater affinity and/or 5-fold greater selectivity than the affinity of each of the polypeptide targeting moiety and the small molecule alone.
35. The method of claim 34, wherein the target protein is an extracellular target protein.
38. The method of claim 34 or 35, wherein the small moiecuie moiety of each of the two or more synthetic bifunctionaS compounds is the same or the polypeptide targeting moiety of each of the too or more synthetic bifunctional compounds is the same.
37. The method of any one of claims 34 to 36, wherein the polypeptide targeting moiety is an antibody or an antigen binding fragment thereof or fttaronectin type i!l domain.
38. The method of claim 37, wherein the antibody or an antigen binding fragment thereof is an antibody or a fibronectin type Hi domain.
39. The method of any one of claims 34 to 38, wherein the polypeptide targeting moiety does not bind at a smali moiecuie binding site of the target protein.
40. The method of any one of ciaims 34 to 39, wherein the smali molecule moiety binds the target protein with low affinity when not covaient!y conjugated to the polypeptide targeting moiety.
41 . The method of any one of ciaims 34 to 40, wherein the smali moiecuie moiety binds at a smali moiecuie binding site of the extracellular target protein.
42. The method of any one of ciaims 34 to 41 , wherein the target protein belongs to a famly of proteins and the small moiecuie moiety binds to at Ieast two members of the fam ily of proteins.
43. The method of any one of claims 34 to 42, wherein the small moiecuie moiety is covaientiy conjugated to the polypeptide targeting moiety via a linker.
44. The method of claim 43, wherein the linker is conjugated to the polypeptide targeting moiety via a solvent exposed amino acid.
45. The method of claim 43 or 44, wherein the linker is conjugated to the polypeptide targeting moiety via a cysteine, a lysine, or a non-natural amino acid.
46. The synthetic Afunctional compound of any one of claims 43 to 45, wherein the linker is conjugated to the poiypeptide targeting moiety by enzymatic ligation.
47. The synthetic Afunctional compound of any one of claims 43 to 46 , wherein the linker comprises one or more amino acids and the bond conjugating the linker to the polypeptide targeting moiety is a peptide bond.
48. The method of any one of claims 43 to 45, wherein the linker has the structure of Formula 1:
A B'MC B^ DMB'MC^B A2
Formula i
wherein A1 is a bond between the linker and polypeptide targeting moiety; A2 is a bond between the small molecule moiety and the linker; B B2 B3, and B4 each, independently, is selected from optionally substituted C -C2 aikyl, optionally substituted C1-C3 heteroalkyi, O, S, and NRN; RK is hydrogen, optionally substituted C1-4 alkyl, optionally substituted G2-4 aikeny!, optionally substituted G2-4 aikynyl, optionally substituted C2-6 heterocyclyl, optionally substituted Ce-iz aryl, or optionaSiy substituted C1-7 heteroalkyi; C1 and C2 are each, independently, selected from carbonyi, thiocarbonyi, sulphonyl, or phosphoryl; f, g, h, S, ], and k are each, independently, 0 or 1 ; and D is optionally substituted C1-10 alkyl, optionally substituted C2-10 aSkenyi, optionally substituted C2-10 aikynyl, optionally substituted C2-S heterocycly!, optionally substituted C&-12 ary!, optbnaily substituted C2-C1G polyethylene glycol, or optionally substituted C1-10 heteroalkyi, or a chemical bond linking AMB^MC 'k-fB2)*'- to -{B3MC2 j-(B )k-A2.
49. The method of any one of claims 34 to 48, wherein the small molecule moiety and the polypeptide targeting moiety bind to different sites on the target protein.
50. The method of any one of claims 34 to 49, wherein the off-rate of the binding of the synthetic bifunctional compound to the target protein is slower than the turnover of the target protein .
51 . The method of any one of ciaims 34 to 50, wherein the synthetic bifunctional compound inhibits the activity of the target protein.
52. The method of any one of claims 34 to 5 , wherein the extracellular target protein is a soluble protein.
53. The method of any one of claims 34 to 52, wherein the extracellular target protein is a membrane-bound protein.
54. The synthetic Afunctional compound of any one of claims 34 to 51 , wherein the extracellular target protein is a transmembrane protein.
55. The method of any one of claims 34 to 54, wherein the extracellular target protein is a carbonic anhydrase.
56. The method of claim 55, wherein the smali molecule moiety is a sulfonamide.
57. The method of claim 55 or 56, wherein the small mo!ecuie moiety comprises the structure of
Formula i!:
■S-NH-
Formula II
wherein R■ is optionally substituted C -C aikyi, optionally substituted Ci-Cs heteroalkyi, optionally substituted Cs-do ary!, or optionally substituted C2-C9 heteroaryi.
58. The method of any one of claims 34 to 54, wherein the extracellular target protein is a metal loprotease.
59. The method of claim 58, wherein the small molecule moiety is a hydroxamic acid.
60. The method of claim 53 or 59, wherein the small mo!ecuie moiety comprises the structure of Formula ill:
Formula lil
wherein R2 is optionally substituted Ci-C6 aikyi, optionally substituted Ci-Cs heteroalkyi, optionally substituted Ce-Cie ary!, or optionally substituted Ci-Cs heteroaryi.
61. The method of any one of claims 34 to 54, wherein the extracellular target protein is PSMA.
62. The method of claim 61 , wherein the smali molecule moiety is a thiadiazo!e sulfonamide or comprises a giutamate-urea-lysine moiety.
63. The method of claim 61 or 62, wherein the small molecule moiety comprises the staicture of Formula IV or Formula V:
Formula IV Formula V
wherein R3 is optionaiiy substituted C i-Ce aikyi or optionaiiy substituted Ci-Cs heteroalkyi
(e.g., -NHC(O)-); and
R4 is optionaiiy substituted Cs-Cs aikyi, optionally substituted Ci-Ce heteroaikyl optionaiiy substituted Ce-Cic aryL optionally substituted C2-G9 heteroaryi, or optionally substituted Ce-Cio aryl Ci-Cs aikyi, or optionaiiy substituted C2-C9 heteroaryi Ci-Ce aikyi.
64. The method of claim 63, wherein the smali molecule moiety comprises the structure:
65. The method of any one of ciaims 34 to 54, wherein the extracellular target protein is GXCR4.
66. The method of claim 65, wherein the small molecule moiety is a cyclic peptide.
67. The method of claim 65 or 66, wherein the small moiecuie moiety comprises the structure of Forrnuia V!:
Formula Vi
wherein R5 is optionally substituted Ci-Cs alkyi, optionally substituted Ci-Ce heteroalkyL optionally substituted Ce-Cto aryi, optionally substituted C2-C9 heteroaryl, or optionally substituted Ce-Cso aryi Ci-Ce aiky!, or optionally substituted C2-C9 heteroaryl Ci-Ge alkyi.
68. The method of claim 87, wherein the smali molecule moiety comprises the structure:
69. The method of any one of claims 34 to 68, wherein the polypeptide targeting moiety is a member of a library of polypeptide targeting moieties.
70. The method of claim 69, wherein the library of polypeptide targeting moiety comprises at least 10- polypeptide targeting moieties.
71. The method of claim 69 or 70, wherein the library of polypeptide targeting moieties is a DNA display library, an NA display library, a yeast display library, or a phage display library.
72. The method of claim 71 , wherein the library of polypeptide targeting moieties is a DNA display library or RNA display library.
73. The method of any one of claims 34 to 72, wherein the binding of the two or more synthetic Afunctional compounds to the target protein is determined using a cell-based assay.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/096,259 US20190144503A1 (en) | 2016-04-27 | 2017-04-27 | Methods for the identification of bifunctional compounds |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662328355P | 2016-04-27 | 2016-04-27 | |
| US62/328,355 | 2016-04-27 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017187183A1 true WO2017187183A1 (en) | 2017-11-02 |
Family
ID=58745264
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB2017/051188 Ceased WO2017187183A1 (en) | 2016-04-27 | 2017-04-27 | Methods for the identification of bifunctional compounds |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US20190144503A1 (en) |
| WO (1) | WO2017187183A1 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020162959A1 (en) * | 2019-02-07 | 2020-08-13 | The General Hospital Corporation | Carotenoids for treating or preventing nausea |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| US5624677A (en) | 1995-06-13 | 1997-04-29 | Pentech Pharmaceuticals, Inc. | Controlled release of drugs delivered by sublingual or buccal administration |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US20150104808A1 (en) * | 2013-10-14 | 2015-04-16 | Janssen Biotech, Inc. | Cysteine Engineered Fibronectin Type III Domain Binding Molecules |
-
2017
- 2017-04-27 US US16/096,259 patent/US20190144503A1/en not_active Abandoned
- 2017-04-27 WO PCT/GB2017/051188 patent/WO2017187183A1/en not_active Ceased
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| US5624677A (en) | 1995-06-13 | 1997-04-29 | Pentech Pharmaceuticals, Inc. | Controlled release of drugs delivered by sublingual or buccal administration |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| US20150104808A1 (en) * | 2013-10-14 | 2015-04-16 | Janssen Biotech, Inc. | Cysteine Engineered Fibronectin Type III Domain Binding Molecules |
Non-Patent Citations (54)
| Title |
|---|
| "Encyclopedia of Pharmaceutical Technology", 1988, MARCEL DEKKER |
| "Pharmaceutical Salts: Properties, Selection, and Use", 2008, WILEY-VCH |
| "Remington: The Science and Practice of Pharmacy", 2005, LIPPINCOTT WILLIAMS & WILKINS |
| BADESCU ET AL., BIOCONJUG. CHEM., vol. 25, no. 3, 2014, pages 460 - 469 |
| BADESCU ET AL., BIOCONJUG. CHEM., vol. 25, no. 6, 2014, pages 1124 - 1136 |
| BANTA, S. ET AL., ANNU. REV. BIOMED. ENG., vol. 15, 2013, pages 93 - 113 |
| BENNECHE ET AL., EUR. J. MED. CHEM., vol. 28, 1993, pages 463 |
| BERGE ET AL., J. PHARMACEUTICAL SCIENCES, vol. 66, 1977, pages 1 - 19 |
| BIOCHEM. J., vol. 91, 1964, pages 589 |
| BODER ET AL., NAT. BIOTECHNOL., vol. 15, 1997, pages 553 - 557 |
| BRINKMAN ET AL., J. IMMUNOL. METHODS, vol. 182, 1995, pages 41 - 50 |
| BRYANT ET AL., MOL. PHARM., vol. 12, no. 6, 2015, pages 1872 - 1879 |
| BRYDEN ET AL., BIOCONJUG. CHEM., 2014, pages 611 - 617 |
| C. H. KIM ET AL: "Bispecific small molecule-antibody conjugate targeting prostate cancer", PROCEEDINGS NATIONAL ACADEMY OF SCIENCES PNAS, vol. 110, no. 44, 14 October 2013 (2013-10-14), US, pages 17796 - 17801, XP055376021, ISSN: 0027-8424, DOI: 10.1073/pnas.1316026110 * |
| CHEN ET AL., METHODS ENZYMOL., vol. 523, 2013, pages 303 - 326 |
| CHEN ET AL., METHODS IN MOL. BIOL., vol. 1131, 2014, pages 113 - 131 |
| CHO ET AL., PROTEIN ENG. DES. SEL., vol. 23, 2010, pages 567 - 577 |
| FABIAN BULLER ET AL: "Selection of Carbonic Anhydrase IX Inhibitors from One Million DNA-Encoded Compounds", ACS CHEMICAL BIOLOGY, vol. 6, no. 4, 15 April 2011 (2011-04-15), pages 336 - 344, XP055183690, ISSN: 1554-8929, DOI: 10.1021/cb1003477 * |
| FERNANDEZ-SUAREZ M ET AL., NAT BIOTECH., vol. 25, 2007, pages 1483 - 1487 |
| GREENE: "Protective Groups in Organic Synthesis", 1999, JOHN WILEY & SONS |
| GURD, METHODS ENZYMOL., vol. 11, 1967, pages 532 |
| HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| HERRIOT, ADV. PROTEIN CHEM., vol. 3, 1947, pages 169 |
| HERZIG ET AL., BIOPOLYMERS, vol. 2, 1964, pages 349 |
| HOOGENBOOM, NATURE BIOTECH., vol. 23, 2005, pages 1105 - 1116 |
| HUANG, H. ET AL., METHODS MOL. BIOL., vol. 1555, 2017, pages 225 - 254 |
| HUNTER; LUDWIG, J. AM. CHEM. SOC., vol. 84, 1962, pages 3491 |
| HURWITZ, H. I.; CASEY, P. J., CURR. TOPICS MEMBR., vol. 52, 2002, pages 531 - 550 |
| JAMES A. VAN DEVENTER ET AL: "A platform for constructing, evaluating, and screening bioconjugates on the yeast surface", PROTEIN ENGINEERING, DESIGN AND SELECTION, vol. 29, no. 11, 11 August 2016 (2016-08-11), GB, pages 485 - 494, XP055384547, ISSN: 1741-0126, DOI: 10.1093/protein/gzw029 * |
| LEVARY, D. ET AL., PLOS ONE, vol. 6, 2011, pages E18342 |
| M. BODANSKY: "Principles of Peptide Synthesis", 1984, SPRINGER-VERLAG |
| MANDRUP ET AL., PLOS ONE, vol. 8, no. 10, 2013, pages E76834 |
| MCKENZIE ET AL., J. PROTEIN CHEM., vol. 7, 1988, pages 581 |
| MORRISON, SCIENCE, vol. 229, 1985, pages 1202 |
| ROSE, M.W. ET AL., BIOPOLYMERS, vol. 80, 2005, pages 164 - 171 |
| ROSS, J. ADV. CANCER RES., vol. 2, 1954, pages 1 |
| SCHUMACHER ET AL., ORG. BIOMOL. CHEM., 2014, pages 7261 - 7269 |
| SEGAL ET AL., J. IMMUNOL. METHODS, vol. 248, 2001, pages 1 - 6 |
| SKRLEC, K., TRENDS IN BIOTECHNOLOGY, vol. 33, no. 7, 2015, pages 408 - 418 |
| SMYTH ET AL., J. AM. CHEM. SOC., vol. 82, 1960, pages 4600 |
| STERN, L.A. ET AL., CURR. OPION. IN CHEM. ENGINEERING, vol. 2, 2013, pages 425 - 432 |
| STROP, P. ET AL., CHEMISTRY AND BIOLOGY, vol. 20, 2013, pages 161 - 167 |
| TIETZE, CHEM. BER., vol. 124, 1991, pages 1215 |
| TILLOTSON ET AL., METHODS, vol. 60, 2013, pages 27 - 37 |
| TRAUT ET AL., BIOCHEMISTRY, vol. 12, 1973, pages 3266 |
| TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 |
| WANG ET AL., J. IMMUNOL. METHODS, vol. 304, 2005, pages 30 - 42 |
| WANG ET AL., NAT. METHODS, vol. 4, 2007, pages 143 - 145 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WEBB ET AL., BIOCONJUGATE CHEM., vol. 1, 1990, pages 96 |
| WETZ ET AL., ANAL. BIOCHEM., vol. 58, 1974, pages 347 |
| WOLDRING ET AL., PLOS ONE, vol. 10, 2015, pages E0138956 |
| WOLDRING, D.R. ET AL., PLOS ONE., vol. 10, 2015, pages E0138956 |
| WONG, BIOCHEMISTRY, vol. 24, 1979, pages 5337 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020162959A1 (en) * | 2019-02-07 | 2020-08-13 | The General Hospital Corporation | Carotenoids for treating or preventing nausea |
| US11001870B2 (en) | 2019-02-07 | 2021-05-11 | The General Hospital Corporation | Carotenoids for treating or preventing nausea |
Also Published As
| Publication number | Publication date |
|---|---|
| US20190144503A1 (en) | 2019-05-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11987590B2 (en) | Compounds that participate in cooperative binding and uses thereof | |
| JP7781821B2 (en) | Methods and reagents for analyzing protein-protein interfaces | |
| Michino et al. | A single glycine in extracellular loop 1 is the critical determinant for pharmacological specificity of dopamine D2 and D3 receptors | |
| ES2948915T3 (en) | Novel structure of TNFá for use in therapy | |
| CN110831632A (en) | Compounds involved in synergistic binding and uses thereof | |
| KR20210135518A (en) | Anti-TREM2 antibodies and methods of use thereof | |
| CA3000822A1 (en) | Methods and reagents for analyzing protein-protein interfaces | |
| CA3222082A1 (en) | Bis-benzimidazole sting agonist immunoconjugates, and uses thereof | |
| AU2022218165B2 (en) | Anti-met antibodies and uses thereof | |
| US20220119546A1 (en) | Plectin-1 binding antibodies and uses thereof | |
| US20240101642A1 (en) | System and method for homogenous gpcr phosphorylation and identification of beta-2 adrenergic receptor positive allosteric modulators | |
| US20260000781A1 (en) | Fc conjugates including an inhibitor of cd73 and uses thereof | |
| US20190144503A1 (en) | Methods for the identification of bifunctional compounds | |
| US12264163B2 (en) | Compounds and methods for treating fibrotic pathologies | |
| WO2014074628A1 (en) | Compounds for treating hiv and methods for using the compounds | |
| US12578343B2 (en) | Selective ACKR3 modulators and uses thereof | |
| Huber | Targeting the Intracellular Allosteric Binding Site (IABS) of G Protein-Coupled Receptors (GPCRs) | |
| Zacarías et al. | Design and characterization of an intracellular covalent ligand for CC Chemokine Receptor 2 (CCR2) | |
| Johnson | Discovery and Characterization of Chemical Tools for Chromatin and Kinase Biology | |
| Booe | Modulation of Cgrp and Adrenomedullin Peptide Selectivity by Receptor Activity-modifying Proteins | |
| JP2000026315A (en) | Evaluation of calcium channel activator | |
| CN101312967A (en) | Carbamate compounds as 5-HT4 receptor agonists |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17724867 Country of ref document: EP Kind code of ref document: A1 |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 17724867 Country of ref document: EP Kind code of ref document: A1 |

























