WO2017156090A2 - METHODS TO TARGET PKD1/PKD2 lON CHANNEL COMPLEX - Google Patents
METHODS TO TARGET PKD1/PKD2 lON CHANNEL COMPLEX Download PDFInfo
- Publication number
- WO2017156090A2 WO2017156090A2 PCT/US2017/021309 US2017021309W WO2017156090A2 WO 2017156090 A2 WO2017156090 A2 WO 2017156090A2 US 2017021309 W US2017021309 W US 2017021309W WO 2017156090 A2 WO2017156090 A2 WO 2017156090A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- pkd2
- pkd1
- cell
- pkdl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6872—Intracellular protein regulatory factors and their receptors, e.g. including ion channels
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/10—Screening for compounds of potential therapeutic value involving cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/34—Genitourinary disorders
- G01N2800/347—Renal failures; Glomerular diseases; Tubulointerstitial diseases, e.g. nephritic syndrome, glomerulonephritis; Renovascular diseases, e.g. renal artery occlusion, nephropathy
Definitions
- PTD Polycystic kidney disease
- ADPKD Autosomal dominant polycystic kidney disease
- ADPKD type 1 and PKD2 gene mutations cause ADPKD type 2.
- the invention in some aspects relates to methods for identifying a compound that modulates polycystin-1 (PKD1) and/or polycystin-2 (PKD2) activity or plasma
- the method involves contacting a cell having a plasma membrane PKD1/PKD2 with a test compound, detecting whether PKD1/PKD2 activity is modulated in the presence of the test compound with respect to PKD1/PKD2 activity in the absence of the test compound, and wherein if the PKD1/PKD2 activity is modulated then the test compound is a compound that modulates PKD1/PKD2 activity.
- the method of detection comprises a voltage-clamp, patch clamp, x-ray crystallization, electron microscopy, circular dichroism, Fourier transform infra-red spectroscopy, electron spin resonance, nuclear magnetic resonance
- test compound in some embodiments comprises a small molecule, peptide, nucleic acid or polysaccharide including, but not limited to antibodies, biologies, an inhibitor of PKD1/PKD2 activity, an activator of PKD1/PKD2 activity, or a trafficking modulator to the plasma membrane or primary cilium.
- the PKDl is a chimera. In other embodiments the PKD2 is a chimera.
- the PKDl and/or PKD2 includes an intracellular or extracellular tag.
- the tag may be selected from the group consisting of a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
- the N-terminal truncations of PKDl enhance PKD2 surface trafficking. In other embodiments the C-terminal truncations of PKDl enhance PKD2 surface trafficking.
- PKD1/PKD2 in the plasma membrane comprises a modified PKDl.
- the modified PKDl may be, for example, a polycystin-1, modified polycystin-lLl, modified polycystin-lL2, modified polycystin-1 L3 with it's
- the extracellular N-terminus replaced by the P2Y12-N-terminus or any other N-terminal domain that enhances surface trafficking of the PKD1/PKD2 complex.
- the N-terminal domain is not P2Y12.
- the modified PKD1/PKD2 complex contains ADPKD disease causing mutations in either PKDl or PKD2, which either affect plasma membrane trafficking (see FIGs 14-15) or alter PKD1/PKD2 ion channel function.
- ADPKD disease causing mutations in either PKDl or PKD2 which either affect plasma membrane trafficking (see FIGs 14-15) or alter PKD1/PKD2 ion channel function.
- the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8 and/or the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
- the invention is a cell having a PKD1/PKD2 in a plasma membrane.
- the PKDl and/or PKD2 is a chimera.
- PKD2 contains channel activating or inhibiting mutations.
- the PKDl and/or PKD2 includes an intracellular or extracellular tag.
- the tag may be selected from the group consisting of a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
- the PKD1 in the plasma membrane PKD1/PKD2 comprises a modified PKD1.
- the PKD1 comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8 and/or the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
- the cell in some embodiments is a human embryonic kidney (HEK) cell. In yet other embodiments the cell is an inner medullary collecting duct (IMCD) cell.
- HEK human embryonic kidney
- IMCD inner medullary collecting duct
- the modified PKD1 in some embodiments is a modified polycystin-lLl, modified polycystin-lL2, modified polycystin-lL3 or P2Y12-PKD1.
- a chimeric PKD1 comprising a C-terminal PKD1 fragment linked to an N- terminal plasma membrane insertion domain is provided in other aspects of the invention.
- the plasma membrane insertion domain is P2Y12.
- the PKD1 includes an intracellular or extracellular tag.
- the tag is selected from the group consisting of a HA tag, His-tag, GFP, mCherry, ires GFP, YFP, BirA, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
- the C-terminal PKD1 fragment in some embodiments is SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
- the N-terminal plasma membrane insertion domain in other embodiments is SEQ ID NO: 9, SEQ ID NO: 10.
- the invention is a nucleic acid encoding a chimeric PKD1 comprising a C-terminal PKD1 fragment linked to an N-terminal plasma membrane insertion domain.
- the N-terminal domain is not P2Y12.
- the nucleic acid encoding the C-terminal PKD1 fragment comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
- the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
- the nucleic acid encoding the N-terminal plasma membrane insertion domain is SEQ ID NO: 9 or SEQ ID NO: 10.
- the vector comprises an inducible promoter and wherein the inducible promoter consists of an araS promoter, tf55a promoter, araC promoter, or a tetracycline promoter.
- the vector comprises a dual expression vector
- PKD1 and PKD2 allowing simultaneous expression of PKD1 and PKD2 with similar protein levels (SEQ ID NO: 12 and SEQ ID NO: 13 having SEQ ID NO: 7 and or 8 inserted therein).
- the invention is a kit having a container housing a first expression vector comprising a nucleic acid encoding a chimeric PKDl comprising a C- terminal PKDl fragment linked to an N-terminal plasma membrane insertion domain, a container housing a second expression vector comprising a nucleic acid encoding a PDK2, and instructions for generating a cell line using the first and second expression vectors.
- the PKDl and/or the PKD2 is intracellularly or extracellularly tagged.
- the tag may be selected from the group consisting of a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
- the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
- the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
- a stable inducible cell line expressing PKDl chimera/PKD2 in the plasma membrane is provided in other aspects of the invention.
- the cell line consists of inducible and non-inducible HEK cells or CHO cells.
- the N-terminal or C-terminal truncations of PKDl enhance PKD2 surface trafficking.
- the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
- the PKD2 comprises SEQ ID NO: 1,SEQ ID NO: 2 or SEQ ID NO: 11.
- the invention is a stable inducible cell line expressing PKDl chimera/PKD2 in the primary cilium.
- the cell line consists of mEVICD3, hRPE, MDCK or LLC-PK1 cells or other ciliated cell lines.
- ciliated primary cells for expression of PKDl chimera/PKD2 are isolated from ⁇ 13 ⁇ -mCherry -GECOl.2 transgenic mice (FIG. 16) or human tissue.
- ciliated primary cells also express a calcium sensitive fluorescent protein in primary cilia.
- the cell line consists of HEK cells or CHO cells.
- the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
- the PKD2 in other embodiments is SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
- the modified PKD1/PKD2 complex contains ADPKD disease causing mutations in either PKD1 or PKD2 which affects plasma membrane trafficking and/or alters PKD1/PKD2 ion channel function, including gain-of-function mutations in PKD1/PKD2.
- compositions for treatment of a particular condition specifically includes, also, the composition for use in the treatment of that particular condition, as well as use of the composition for the manufacture of a medicament for the treatment of that particular condition.
- Polycystin ion channels comprise PKD1 and PKD2 subunits.
- FIG. 2. P2Y12-PKD1 chimera reduces the size of PKD1 significantly.
- FIG. 3 Targeting PKD1/P2Y12 chimera to the plasma membrane.
- the PKD1 chimera is 3.8 kb instead of 12 kb (M[Start] ⁇ - YPYDVPDYA (SEQ ID NO: 20)[HA- tag]— QAVDNLTSAPGNTSLCTRDYKITQ (SEQ ID NO: 21)[hP2Y12-NT]— ).
- Four P2Y12-PKD1 chimeras were generated varying in length of PKD1 N-terminus.
- FIG. 4 Sequence comparison of human, mouse and rat PKD1 and PKD1L1.
- FIG. 5 P2Y12-PKD1-4 localizes to the plasma membrane only with PKD2 present.
- FIG. 6 P2Y12-PKD1-3 localizes to the plasma membrane only with PKD2 present.
- FIG. 7. P2Y12-PKD1-2 does not localize to the plasma membrane with PKD2 present.
- FIG. 8 Surface HA staining is not accomplished beyond position Prot 3a.
- hPKDl is shown by SEQ ID NOs: 22-25 from left to right; hPDKlLl is shown by SEQ ID NOs: 26-29 from left to right; hPDKlL2 is shown by SEQ ID NOs: 30-33 from left to right; hPDKlL3 is shown by SEQ ID NOs: 34-37 from left to right; and hPDKlREJ is shown by SEQ ID NOs: 38-41 from left to right.
- FIG. 9 Schematic showing mTRPV3 having an extracellular FLAG insertion allowing quantification of ion channels in the plasma membrane.
- FIG. 10 Schematic showing FLAG insertion in extracellular domain of PKD2 using Protter visualization software.
- the criteria for insertion were 1) different sequences between PKD2 and PKD2-L1 and 2) D/E and K in proximity.
- DYKDDDDK is SEQ ID NO: 42.
- a FLAG epitope was inserted at nine different positions and tested for surface immunoreactivity
- FIG. 11 Staining of PKD2-FLAG5, the only position that gave a positive FLAG immuno staining .
- FIG. 12 Generation of stable cell lines. Reliable co-expression of two proteins is required. Tet-inducible dual promoter was used: Tet-on HEK cell line (Clontech). Tet activator expressing mIMCD3 cell line was generated. Tet-on cell clones with best and worst cilia were selected: EVICD17 and IMCD 28.
- FIG. 13 Schematic drawing of assay to screen for plasma membrane and cilia localization of PKD1 and PKD2 proteins simultaneously. A HEK tet- inducible cell line expressing P2Y12-PKD1-4 and PKD2-FLAG generates robust plasma membrane staining for both HA and FLAG.
- a mIMCD3 tet-inducible cell line expressing P2Y12- PKD1-4 and PKD2-FLAG shows prominent cilia localization of PKD1 and PKD2. Both cell lines were stained live with anti-HA and anti-FLAG antibodies to ensure integrity of the plasma membrane and thus only immunolabeling of plasma membrane inserted PKD1/PKD2.
- FIG. 14 Randomly chosen ADPKD disease causing mutations in PKD1 affect cell surface trafficking of the PKD1/PKD2 complex to various degrees. R3750Q and Q3751X mutations impair surface trafficking of the channel complex
- FIG. 15 Randomly chosen ADPKD disease causing mutations in PKD2. All mutations impair surface trafficking of the channel complex.
- FIG. 16 Ciliary targeted calcium sensor transgenic mouse model.
- FIG. 17 Expression of extracellular domains of PKD1 and PKD1-L1 in yeast
- ADPKD Autosomal dominant polycystic kidney disease
- Most patients presenting with the disease have a mutation in a PKD1 or PKD2 gene encoding for a membrane spanning polycystin protein present in kidney cells.
- the function of the polycystin proteins are not well understood and successful therapies targeting the protein have not been developed.
- the polycystin protein complex can be targeted to the plasma membrane and is thus amenable for functional and surface trafficking/protein folding assays and methods described herein.
- a PKDl chimera /PKD2 has been developed which is able to be expressed in the plasma membrane.
- the PKD1 gene provides instructions for making a protein called polycystin- 1.
- the protein consists of a large N-terminus (3000 aa), 11 transmembrane domains and an intracellular C-terminus implicated in the interaction with PKD2. Its positioning in the membrane of kidney cells allows it to interact with other proteins, carbohydrates, and fat molecules (lipids) outside the cell and to receive signals that help the cell respond to its environment. These signals instruct the cell to undergo certain changes, such as maturing to take on specialized functions.
- Polycystin- 1 is also found in cell structures called primary cilia.
- Primary cilia are tiny, fingerlike projections that line the small tubes where urine is formed (renal tubules).
- renal tubules researchers believe that primary cilia sense the movement of fluid through these tubules, which appears to help maintain the tubules' size and structure.
- the interaction of polycystin- 1 and polycystin-2 in renal tubules promotes the normal development and function of the kidneys.
- the PKD2 gene belongs to a family of genes called TRP (transient receptor potential cation channels) as well as a family of genes called EF-hand domain containing (EF-hand domain containing).
- TRP transient receptor potential cation channels
- EF-hand domain containing EF-hand domain containing
- the PKD2 gene provides instructions for making a protein called polycystin-2.
- Polycystin-2 likely functions as a channel spanning the cell membrane of kidney cells. In conjunction with polycystin- 1, the channel transports positively charged atoms (ions), including calcium ions, into the cell.
- the methods of the invention involve the discovery of constructs that target the PKD1/PKD2 channel complex to the plasma membrane and thus allow functional characterization and screening for activators and inhibitors of the ion channel complex.
- the invention involves a PKD1 chimera/PKD2 that is modified to achieve membrane expression. For instance, a chimera of an N-terminal protein fused to a truncated form of PKD1 can enhance the cell surface trafficking.
- a chimera of the invention is a N-terminal protein-PKDl fragment.
- An N-terminal protein, as used herein is a signal peptide that enhances trafficking to the plasma membrane.
- the peptide is signal peptide.
- the N-terminal protein is an N-terminal region of a GPCR. GPCR's are well known in the art.
- the N terminal protein is an N-terminus of P2Y12. In other embodiments the N-terminus is a 20-30 amino acid N-terminus of a cell surface protein that promotes cell surface delivery.
- a PKD1 fragment is a functionally active fragment of PKD1.
- the PKD1 fragment is a C-terminal fragment of PKD1. It may be between 500 and 1,500 amino acids in length in some embodiments.
- the PKD1 is a chimera, wherein N-terminal truncations of PKD1 enhance PKD2 surface trafficking.
- the PKD1 is a chimera, wherein C-terminal truncations of PKD1 enhance PKD2 surface trafficking.
- the functionally active fragment of PKD1 is the entire extracellular domain of PKD1 or PKD1-L1 or PKD1-L2 or PKD1-L3 or fragments thereof expressed and purified from heterologous expression systems such as Pichia pastoris, insect cells or mammalian cell lines such as HEK or CHO cells. It may be between 200 and 3000 amino acids in length.
- aspects of the invention relate to in vitro and/or in vivo assays for identifying compounds that reduce the negative effects of defects in PKD1/PKD2.
- a candidate compound is identified in an assay as modulating ion transport function of PKD1/PKD2.
- aspects of the invention may be implemented in any suitable assay format, including, for example, a high throughput assay format.
- a high throughput screen (HTS) format of more than about 10,000, more than 100,000 (e.g., >110,000) compounds may be used to identify compounds that modulate
- a first screen (e.g., high throughput screens) may be used to identify one or more candidate compounds that have at least a threshold effect on PKD1/PKD2 activity.
- a threshold effect may be an increase or decrease of PKD1/PKD2 activity of at least 5%, at least 10%, 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, 80-90%, 90-95%, 95%- 100% relative to a control level of PKD1/PKD2 activity in the absence of a compound or in the presence of a compound that is known to have little or no effect on PKD1/PKD2 activity (negative control) or to have a modulatory effect (positive control).
- a candidate compound that is identified in a first screen may be evaluated in a second screen to confirm that it is useful as a therapeutic agent.
- the compound may be further evaluated in vitro or in vivo to determine whether it selectively promotes or inhibits physiological function in the cell.
- a cell- based PKD1/PKD2 assay in the presence or absence of a test compound may be used in conjunction or independently of an in vitro assay to evaluate further physiological effects of candidate test compounds. It should be appreciated that in some embodiments downstream readouts associated with PKD1/PKD2 activity also may be used to evaluate the effects of one or more test compounds.
- the test compound comprises a small molecule, peptide, nucleic acid or polysaccharide including, but not limited to antibodies and biologies.
- test compound comprises an inhibitor of PKD1/PKD2 activity. In other embodiments, the test compound comprises an activator of
- the test compound comprises a trafficking modulator. In some embodiments, the test compound comprises a trafficking modulator to the plasma membrane or primary cilium that corrects misfolding of PKD1 or PKD2 due to point mutations in the proteins resulting in reduced plasma membrane trafficking of the protein complex. In some embodiments the test compound or candidate compound is a modulator of PKD1/PKD2 activity.
- a modulator of PKD1/PKD2 activity is an agonist, an antagonist, an inverse agonist, a positive allosteric regulator or a negative allosteric regulator of PKD1/PKD2 activity.
- An "agonist” is a molecule capable, on its own, of increasing the activity of PKD1/PKD2.
- an "antagonist” is a molecule capable of inhibiting the activating effect of an agonist.
- An "inverse agonist” is a molecule capable of inhibiting the constitutive activity of PKD1/PKD2, i.e. the activity measurable in the absence of any agonist, when such an activity is effectively measurable.
- An inverse agonist is also capable of inhibiting the effect of an agonist. It is therefore also an antagonist.
- a "positive allosteric regulator” is a molecule capable of facilitating the action of an agonist.
- a “negative allosteric regulator” is a molecule capable of decreasing the effect of an agonist.
- PKD1/PKD2 activity may be treated with the compounds identified according to the screening methods of the invention
- the compounds identified in the screening assays described herein are useful as therapeutic, diagnostic and/or research reagents. Mutations in polycystin 1 and 2 manifest in severe ciliopathies.
- compounds that modulate PKD1/PKD2 activity may be useful as therapeutic agents.
- the active compounds may be therapeutic agents in the treatment of kidney disease such as
- ADPKD Autosomal dominant polycystic kidney disease
- cyst formation disorders involving cilia such as meduloblastoma, glioblastoma, and basal cell carcinoma
- vascular disease such as cardiac vascular disease.
- ADPKD is generally a late-onset multisystem disorder characterized by: bilateral renal cysts; cysts in other organs including the liver, seminal vesicles, pancreas, and arachnoid membrane; vascular abnormalities including intracranial aneurysms, dilatation of the aortic root, and dissection of the thoracic aorta; mitral valve prolapse; and abdominal wall hernias. Renal manifestations include hypertension, renal pain, and renal insufficiency. Approximately 50% of individuals with ADPKD have end-stage renal disease (ESRD) by age 60 years. About 95% of individuals with ADPKD have an affected parent; at least 10% of families can be traced to de novo mutation.
- ESRD end-stage renal disease
- Polycystic kidney disease 1 (autosomal dominant) is also known as Lov-1, PBP, Pc-1, PCI, TRPPl, and PKD1.
- Polycystic kidney disease 2 (autosomal dominant) is also known as APKD2, PC2, PKD4, Pc-2, TRPP2, and PKD2.
- liver cysts the most common extrarenal manifestation of ADPKD
- the prevalence of intracranial aneurysms is higher in those with a positive family history of aneurysms or subarachnoid hemorrhage (22%) than in those without such a family history (6%).
- Mitral valve prolapse the most common valvular abnormality, occurs in up to 25% of affected individuals.
- Substantial variability in severity of renal disease and other extrarenal manifestations occurs even within the same family.
- the diagnosis of ADPKD is established primarily by imaging studies of the kidneys. In approximately 85% of individuals with ADPKD, pathogenic variants in PKD1 are causative; in approximately 15% of individuals, pathogenic variants in PKD2 are causative.
- Therapeutic interventions aimed at slowing the progression of ESRD in ADPKD include control of hypertension and hyperlipidemia, dietary protein restriction, control of acidosis, and prevention of hyperphosphatemia.
- Most individuals with polycystic liver disease have no symptoms and require no treatment.
- the mainstay of therapy for ruptured or symptomatic intracranial aneurysm is surgical clipping of the ruptured aneurysm at its neck; however, for some individuals, endovascular treatment with detachable platinum coils may be indicated.
- Thoracic aortic replacement is indicated when the aortic root diameter exceeds established size (Harris PC, Torres VE. Polycystic Kidney Disease, Autosomal Dominant. 2002 Jan 10 [Updated 2015 Jun 11].
- Pagon RA Adam MP, Ardinger HH, et al., editors. GENERE VIE WS ® [Internet]. Seattle (WA): University of Washington, Seattle; 1993-2016).
- methods of detection comprise a voltage-clamp, patch clamp, x-ray crystallization, electron microscopy, circular dichroism, Fourier transform infra-red spectroscopy, electron spin resonance, nuclear magnetic resonance
- PTD1/PKD2 activity comprising contacting a cell having a plasma membrane PKD 1/PKD2 with a test compound, detecting whether PKD 1/PKD2 activity is modulated in the presence of the test compound with respect to PKD1/PKD2 activity in the absence of the test compound, and wherein if the PKD1/PKD2 activity is modulated then the test compound is a compound that modulates PKD1/PKD2 activity.
- the PKD1 is a chimera, wherein the PKD1 includes an intracellular or extracellular tag.
- the PKD2 is a chimera, wherein the PKD2 includes an intracellular or extracellular tag.
- the tag can be, but is not limited to a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
- the modified PKD1/PKD2 complex contains ADPKD disease causing mutations in either PKD1 or PKD2, which either affect plasma membrane trafficking (see FIGs 14-15) or alter PKD1/PKD2 ion channel function.
- ADPKD disease causing mutations in either PKD1 or PKD2 which either affect plasma membrane trafficking (see FIGs 14-15) or alter PKD1/PKD2 ion channel function.
- a nucleic acid or polypeptide sequence that is "derived from” a designated sequence refers to a sequence that corresponds to a region of the designated sequence. For nucleic acid sequences, this encompasses sequences that are homologous or complementary to the sequence, as well as “sequence-conservative variants" and
- “function-conservative variants” Sequence-conservative variants are those in which a change of one or more nucleotides in a given codon position results in no alteration in the amino acid encoded at that position.
- Function-conservative variants are those in which a given amino acid residue in a polypeptide has been changed without altering the overall conformation and function of the native polypeptide, including, but not limited to, replacement of an amino acid with one having similar physico-chemical properties (such as, for example, acidic, basic, hydrophobic, and the like).
- “Function-conservative" variants also include any polypeptides that have the ability to elicit antibodies specific to a designated polypeptide.
- Conservative substitutions typically include the substitution of one amino acid for another with similar characteristics, e.g., substitutions within the following groups:
- valine glycine; glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
- Other conservative substitutions are known in the art.
- the invention encompasses sequence-conservative variants and function-conservative variants of these sequences.
- the nucleic acids may be DNA, RNA, DNA/RNA duplexes, protein-nucleic acid (PNA), or derivatives thereof.
- the PKD1 in the plasma membrane PKD1/PKD2 comprises a modified PKD1.
- the modified PKD1 is a P2Y12- PKD1, P2Y12-1L1, P2Y12-1L2, or P2Y12-1L3.
- the PKD1 comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8 or sequence-conservative or function-conservative variants thereof.
- the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11 or sequence-conservative or function-conservative variants thereof.
- the invention consists of a cell having a PKD1/PKD2 in a plasma membrane, wherein the PKD1 is a chimera and/or the PKD2 is a chimera.
- the PKD1 includes a tag and/or the PKD2 includes a tag.
- the tag can be, but is not limited to a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
- the PKDl in the plasma membrane PKD1/PKD2 comprises a modified PKDl.
- the PKDl can comprise SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO:7, SEQ ID NO: 8 or sequence-conservative or function-conservative variants thereof.
- the PKD2 can comprise SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11 or sequence-conservative or function-conservative variants thereof.
- the cell is a human embryonic kidney (HEK) cell. In other embodiments, the cell is an inner medullary collecting duct (IMCD) cell.
- the modified PKDl is a modified polycystin-lLl, modified polycystin- 1L2, modified polycystin-lL3 or P2Y12-PKD1. In some embodiments, the N-terminus of the modified PKDl does not contain P2Y12.
- the invention includes an inducible cell line expressing PKDl chimera/PKD2 in the plasma membrane.
- the cell line consists of HEK cells or CHO cells.
- the cell line used for inducible PKD1/PKD2 expression contains a primary cilium such as mIMCD3, hRPE, MDCK or LLC-PK1 cells. This allows quantification of protein trafficking to both plasma membrane and primary cilium.
- the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8 or sequence-conservative or function-conservative variants thereof.
- the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11 or sequence-conservative or function-conservative variants thereof.
- the invention includes a stable inducible cell line expressing PKDl chimera/PKD2 in the primary cilium.
- the cell line consists of EVICD3 cells or other ciliated cell lines or ciliated primary cells.
- the invention cell line consists of HEK cells or CHO cells.
- the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8 or sequence-conservative or function- conservative variants thereof.
- the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11 or sequence-conservative or function-conservative variants thereof.
- the invention includes a chimeric PKDl comprising a C- terminal PKDl fragment linked to an N-terminal plasma membrane insertion domain.
- the plasma membrane insertion domain is P2Y12.
- the PKDl can, in some embodiments, include an extracellular tag.
- the C-terminal PKDl fragment comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO:
- the N-terminal plasma membrane insertion domain comprises SEQ ID NO: 9, SEQ ID NO: 10 or sequence-conservative or function- conservative variants thereof.
- the invention includes a nucleic acid encoding a chimeric
- PKDl comprising a C-terminal PKDl fragment linked to an N-terminal plasma membrane insertion domain.
- the C-terminal PKDl fragment comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO:
- the N-terminal plasma membrane insertion domain comprises SEQ ID NO: 7 or sequence-conservative or function-conservative variants thereof.
- the N-terminal plasma membrane insertion domain comprises SEQ ID NO: 8 or sequence-conservative or function-conservative variants thereof.
- nucleic acid encoding the N- terminal plasma membrane insertion domain is SEQ ID NO: 9, SEQ ID NO: 10 or sequence-conservative or function-conservative variants thereof.
- the sequences are of human origin.
- the sequences can be of xenarthra, chiroptera, carnivora, cetacea, dermoptera, macroscelidea, proboscidea, lagomorpha, artiodactyla, peris sodactyla, hyracoidea, insectivora, marsupialia, monotremata, pholidota, primates, rodentia, pinnipedia, sirenia, or scandentia origins.
- engineered constructs and/or engineered nucleic acids are included within a "vector".
- a vector is a nucleic acid (e.g., DNA) used as a vehicle to artificially carry genetic material (e.g., an engineered nucleic acid) into another cell where, for example, it can be replicated and/or expressed.
- Biological vectors include, but are not limited to, plasmids, phagemids, viruses, other vehicles derived from viral or bacterial sources that have been manipulated by the insertion or incorporation of the nucleic acid sequences of the invention, and free nucleic acid fragments which can be linked to the nucleic acid sequences of the invention.
- a non-limiting example of a vector is a plasmid. Plasmids are double-stranded generally circular DNA sequences that are capable of automatically replicating in a host cell.
- Plasmid vectors typically contain an origin of replication that allows for semi- independent replication of the plasmid in the host and also the transgene insert. Plasmids may have more features, including, for example, a "multiple cloning site," which includes nucleotide overhangs for insertion of a nucleic acid insert, and multiple restriction enzyme consensus sites to either side of the insert.
- Viral vectors are a preferred type of biological vector and include, but are not limited to, nucleic acid sequences from the following viruses: retroviruses, such as Moloney murine leukemia virus; Harvey murine sarcoma virus; murine mammary tumor virus; Rous sarcoma virus; adenovirus; adeno-associated virus; SV40-type viruses;
- retroviruses such as Moloney murine leukemia virus; Harvey murine sarcoma virus; murine mammary tumor virus; Rous sarcoma virus; adenovirus; adeno-associated virus; SV40-type viruses;
- polyoma viruses polyoma viruses; poxviruses; Epstein-Barr viruses; papilloma viruses; herpes virus; vaccinia virus; and polio virus.
- Epstein-Barr viruses Epstein-Barr viruses
- papilloma viruses papilloma viruses
- herpes virus vaccinia virus
- polio virus polio virus
- the invention consists of a vector comprising a nucleic acid encoding a chimeric PKD1 comprising a C-terminal PKD1 fragment linked to an N- terminal plasma membrane insertion domain.
- the vector comprises SEQ ID NO: 12, SEQ ID NO: 13 or sequence-conservative or function- conservative variants thereof.
- Engineered constructs of the present disclosure comprise, in some embodiments, promoters operably linked to a nucleotide sequence (e.g., encoding a protein of interest).
- a "promoter” is a control region of a nucleic acid at which initiation and rate of transcription of the remainder of a nucleic acid are controlled.
- a promoter may also contain sub-regions at which regulatory proteins and molecules may bind, such as RNA polymerase and other transcription factors. Promoters may be constitutive, inducible, activatable, repressible, tissue-specific or any combination thereof.
- a promoter drives expression or drives transcription of the nucleic acid sequence that it regulates.
- a promoter is considered to be "operably linked" when it is in a correct functional location and orientation in relation to the nucleotide sequence it regulates to control ("drive") transcriptional initiation and/or expression of that sequence.
- Promoters of an engineered nucleic acid construct may be "inducible promoters," which refer to promoters that are characterized by regulating (e.g., initiating or activating) transcriptional activity when in the presence of, influenced by or contacted by an inducer signal.
- An inducer signal may be endogenous or a normally exogenous condition (e.g., light), compound (e.g., chemical or non-chemical compound) or protein that contacts an inducible promoter in such a way as to be active in regulating
- a "signal that regulates transcription" of a nucleic acid refers to an inducer signal that acts on an inducible promoter.
- a signal that regulates transcription may activate or inactivate transcription, depending on the regulatory system used. Activation of transcription may involve directly acting on a promoter to drive transcription or indirectly acting on a promoter by inactivating a repressor that is preventing the promoter from driving transcription.
- deactivation of transcription may involve directly acting on a promoter to prevent transcription or indirectly acting on a promoter by activating a repressor that then acts on the promoter.
- the administration or removal of an inducer signal results in a switch between activation and inactivation of the transcription of the operably linked nucleic acid sequence.
- the active state of a promoter operably linked to a nucleic acid sequence refers to the state when the promoter is actively regulating transcription of the nucleic acid sequence (i.e., the linked nucleic acid sequence is expressed).
- the inactive state of a promoter operably linked to a nucleic acid sequence refers to the state when the promoter is not actively regulating transcription of the nucleic acid sequence (i.e., the linked nucleic acid sequence is not expressed).
- An inducible promoter of the present disclosure may be induced by (or repressed by) one or more physiological condition(s), such as changes in light, pH, temperature, radiation, osmotic pressure, saline gradients, cell surface binding, and the concentration of one or more extrinsic or intrinsic inducing agent(s).
- An extrinsic inducer signal or inducing agent may comprise, without limitation, amino acids and amino acid analogs, saccharides and polysaccharides, nucleic acids, protein transcriptional activators and repressors, cytokines, toxins, petroleum-based compounds, metal containing compounds, salts, ions, enzyme substrate analogs, hormones or combinations thereof.
- Inducible promoters of the present disclosure include any inducible promoter described herein or known to one of ordinary skill in the art.
- the inducible promoter consists of an araS promoter, tf55a promoter, araC promoter, or a tetracycline promoter.
- Other examples of inducible promoters include, without limitation, chemically/biochemically-regulated and physically-regulated promoters such as alcohol-regulated promoters, tetracycline-regulated promoters (e.g.,
- anhydrotetracycline (aTc)-responsive promoters and other tetracycline-responsive promoter systems which include a tetracycline repressor protein (tetR), a tetracycline operator sequence (tetO) and a tetracycline transactivator fusion protein (tTA)), steroid- regulated promoters (e.g., promoters based on the rat glucocorticoid receptor, human estrogen receptor, moth ecdysone receptors, and promoters from the
- metal-regulated promoters e.g., promoters derived from metallothionein (proteins that bind and sequester metal ions) genes from yeast, mouse and human
- pathogenesis-regulated promoters e.g., induced by salicylic acid, ethylene or benzothiadiazole (BTH)
- temperature/heat-inducible promoters e.g., heat shock promoters
- light-regulated promoters e.g., light responsive promoters from plant cells.
- inducible promoters of the present disclosure function in prokaryotic cells (e.g., bacterial cells).
- prokaryotic cells e.g., bacterial cells.
- inducible promoters for use prokaryotic cells include, without limitation, bacteriophage promoters (e.g. Plslcon, T3, T7, SP6, PL) and bacterial promoters (e.g., Pbad, PmgrB, Ptrc2, Plac/ara, Ptac, Pm), or hybrids thereof (e.g. PLlacO, PLtetO).
- inducible promoters of the present disclosure function in eukaryotic cells (e.g., mammalian cells).
- inducible promoters for use eukaryotic cells include, without limitation, chemically-regulated promoters (e.g., alcohol-regulated promoters, tetracycline-regulated promoters, steroid-regulated promoters, metal-regulated promoters, and pathogenesis-related (PR) promoters) and physically-regulated promoters (e.g., temperature-regulated promoters and light-regulated promoters).
- chemically-regulated promoters e.g., alcohol-regulated promoters, tetracycline-regulated promoters, steroid-regulated promoters, metal-regulated promoters, and pathogenesis-related (PR) promoters
- physically-regulated promoters e.g., temperature-regulated promoters and light-regulated promoters.
- the invention includes a kit comprising a container housing a first expression vector comprising a nucleic acid encoding a chimeric PKDl comprising a C-terminal PKDl fragment linked to an N-terminal plasma membrane insertion domain, a container housing a second expression vector comprising a nucleic acid encoding a PKD2, and instructions for generating a cell line using the first and second expression vectors.
- PKDl and PKD2 are dually expressed from the same expression vector.
- the PKDl is tagged. In other embodiments, the PKD2 is tagged.
- the tag is selected from the group consisting of a HA tag, His-tag, GFP, YFP; BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
- the PKD1 comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8 or sequence- conservative or function-conservative variants thereof.
- the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11 or sequence-conservative or function-conservative variants thereof. That is, the kit can include a description of use of the compositions as discussed herein. Instructions also may be provided for producing cells and/or screening cells by any suitable technique.
- kits described herein may also contain one or more containers, which may contain the composition and other ingredients as previously described.
- the kits also may contain instructions for mixing, diluting, and/or administrating the compositions of the invention in some cases.
- ADPKD mutations occur in a putative receptor ion channel complex.
- PKD2 is a member of the transient channel family (TRP channels).
- TRP channels transient channel family
- PKD1 and PKD2 localize to primary cilia (FIG. 13).
- PKD1 and PKD1-L1 have 11 transmembranes of unknown function.
- PKD2 and PKD2-L1 are in the TRP channel subfamily.
- Polycystins form heteromeric complexes (FIG. 1).
- P2Y12-PKD1 chimera reduces the size of PKD1 significantly (FIG. 2).
- SEQ ID NO: 20 is YPYDVPDYA and SEQ ID NO: 21 is QAVDNLTSAPGNTSLCTRDYKITQ.
- the wild- type PKD1 consists of approximately 4000 amino acids, whereas the P2Y12-PKD1 consists of approximately 1000 amino acids.
- Four PKDl chimeras were generated and tested (FIG. 3, 4).
- FIG. 4 shows sequence comparisons of human, mouse and rat PKDl and PKD1L1 with position of P2Y12 fusion to PKDl indicated by an arrow.
- SEQ ID NOs: 43-48 from top to bottom, respectively.
- PKD1/P2Y12 chimera could be targeted to the plasma membrane.
- Various chimeras were tested.
- the PKDl chimera is 3.8 kb instead of 12 kb (M[Start] ⁇ - YPYDVPDYA (SEQ ID NO: 20)[HA-tag]—
- QAVDNLTSAPGNTSLCTRDYKITQ (SEQ ID NO: 21)[hP2Y12-NT]— ). Staining of live cells with anti-HA antibody detects the PKDl chimera in plasma membrane.
- P2Y12- PKD1-4 localized to the plasma membrane only with PKD2 present (FIG. 5).
- P2Y12- PKD1-3 localized to the plasma membrane only with PKD2 present (FIG. 6).
- P2Y12- PKD1-2 did not localize to the plasma membrane with PKD2 present (FIG. 7).
- FIG. 8 shows that surface HA staining is not accomplished beyond N-terminal fusion of P2Y12 to PKDl at position Prot 3a.
- FIG. 9 shows a Protter visualization of mTRPV3 FLAG insertion.
- the right panels show images of surface FLAG, GFP-TRPV3, and an overlay.
- Flag insertion in extracellular domain of PKD2 using Protter visualization software is shown in FIG. 10.
- the criteria for insertion were 1) different sequences between PKD2 and PKD2-L1 and 2) D/E and K in proximity.
- DYKDDDDK is SEQ ID NO: 42 PKD2-FLAG5 was shown to work.
- FIG. 11 shows that upon co-transfection of P2Y12-PKD1-4 with PKD2-FLAG5 both epitopes are recognized in the plasma membrane using anti-HA and anti-FLAG antibodies.
- FIG. 12 shows pTRE3G-BI and images of IMCD 28 and IMCD 17.
- Stable cell lines were generated. Reliable co-expression of two proteins was required.
- a Tet- inducible dual promoter was used (Tet-on HEK cell line, Clontech).
- a Tet activator expressing mIMCD3 cell line was generated as well. Tet-on cell clones with best and worst cilia were selected: IMCD 17 and IMCD 28.
- FIG. 13 shows schematic drawing of assay to detect PKDl and PKD2 in the plasma membrane and primary cilium.
- HA and FLAG tag are visualized in the plasma membrane by incubating live cells with fluorescent dye conjugated anti-HA and anti- FLAG antibodies.
- fluorescent dye conjugated anti-HA and anti- FLAG antibodies Thus only membrane inserted PKD1/PKD2 proteins are immunolabeled, while intracellular localized proteins are not detected.
- FIG. 14 shows examples of pathogenic point mutations in
- PKDl causing ADPKD using the assay shown in FIG. 13. 5 randomly chosen mutations in PKDl affect surface trafficking of the PKD1/PKD2 complex to various degrees.
- FIG. 15 shows examples of pathogenic point mutations in PKD2 causing
- FIG. 17 shows expression of extracellular domains of PKDl and PKD1-L1 in yeast (Pichia pastoris).
- the Pichia Pastoris expression system which is commercially available from Life Technologies, was used for expression of the protein fragments. Nickel columns were used to purify the expressed proteins. The three purified proteins, are shown in Fig. 17, right panel.
- the DNA sequence of PKDl extracellular fragments are shown in SEQ ID NOs: 14, 16 and 18.
- the protein sequences are shown in SEQ ID NOs: 15, 17, and 19.
- PKDl extracellular fragment domains PKDI-PKDX
- SEQ ID NO: 14 The DNA sequence was cloned into expression vector pPIC9 (Life Technologies) for expression and purification in Pichia Pastoris. His tag used for purification is underlined.
- PKDl extracellular fragment domains PKDI-PKDX expressed in Pichia Pastoris using pPIC9 expression vector (Life Technologies) is shown in SEQ ID NO: 15. His tag used for purification is underlined.
- DNA sequence of PKDl extracellular fragment (PKD domain XII and REJ).
- DNA sequence shown in SEQ ID NO: 16 was cloned in to expression vector pPIC9 (Life Technologies) for expression and purification in Pichia Pastoris. His tag used for purification is underlined.
- REJ expressed in Pichia Pastoris using pPIC9 expression vector (Life Technologies) is shown in SEQ ID NO: 17. His tag used for purification is underlined.
- PKD1 extracellular fragment domains PKDI-PKDX expressed in Pichia Pastoris using pPIC9 expression vector (Life Technologies) is shown in SEQ ID NO: 19. His tag used for purification is underlined.
- sequences described herein are intended to designate the sequence with or without the presence of a FLAG or His tag and may be claimed with or without the FLAG or His tag (underlined sequence).
- MYPYDVPDYAQAVDNLTSAPGNTSLCTRDYKITQ (SEQ ID NO: 10) hPKD2 protein sequence without FLAG seq
- DNA sequence of PKD1 extracellular fragment (PKD domain XII and RE J). DNA sequence was cloned in to expression vector pPIC9 (Life Technologies) for expression and purification in Pichia Pastoris. His tag used for purification is underlined. (SEQ ID NO: 16)
- NRS AQFE A ATS PS PRRV A YHWDFGDGS PGQDTDEPRAEHS YLRPGD YRV
- DNA sequence of PKD1L1 extracellular fragment was cloned into expression vector pPIC9 (Life Technologies) for expression and purification in Pichia Pastoris. His tag used for purification is underlined. (SEQ ID NO: 18)
- PKD 1 extracellular fragment domains PKDI-PKDX expressed in Pichia Pastoris using pPIC9 expression vector (Life Technologies). His tag used for purification is underlined. (SEQ ID NO: 19)
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Cell Biology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Toxicology (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Tropical Medicine & Parasitology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Peptides Or Proteins (AREA)
- Other Investigation Or Analysis Of Materials By Electrical Means (AREA)
- Investigating, Analyzing Materials By Fluorescence Or Luminescence (AREA)
Abstract
Methods for identifying compounds that modulate polycystin-l/polycystin-2 (PKD1/PKD2) ion channel activity or cilium/plasma membrane trafficking are provided. Related reagents and uses of the compounds are also provided.
Description
METHODS TO TARGET PKD1/PKD2 ION CHANNEL COMPLEX
RELATED APPLICATIONS
This application claims the benefit under 35 U.S.C. § 119 of United States Provisional Application Nos. 62/305,160, filed March 8, 2016, and pending U.S. Application No.
62/306,399, filed March 10, 2016, the entire contents of each of which are incorporated herein by reference.
BACKGROUND OF INVENTION
Polycystic kidney disease (PKD) is a genetic disease characterized by the growth of numerous fluid-filled cysts in the kidneys. Autosomal dominant polycystic kidney disease (ADPKD) is generally a late-onset multisystem disorder characterized by cysts in the kidneys and other organs, affecting 1 in 800 people. There is currently no treatment for prevention of PKD. Treatments ease the symptoms of ADPKD, and if the kidneys fail, end-stage kidney disease treatments such as dialysis or transplantation are necessary. Mutations are found in the PKD1 and PKD2 genes. PKD1 gene mutations cause
ADPKD type 1, and PKD2 gene mutations cause ADPKD type 2.
SUMMARY OF INVENTION
The invention in some aspects relates to methods for identifying a compound that modulates polycystin-1 (PKD1) and/or polycystin-2 (PKD2) activity or plasma
membrane/primary cilium trafficking. The method involves contacting a cell having a plasma membrane PKD1/PKD2 with a test compound, detecting whether PKD1/PKD2 activity is modulated in the presence of the test compound with respect to PKD1/PKD2 activity in the absence of the test compound, and wherein if the PKD1/PKD2 activity is modulated then the test compound is a compound that modulates PKD1/PKD2 activity.
In some embodiments the method of detection comprises a voltage-clamp, patch clamp, x-ray crystallization, electron microscopy, circular dichroism, Fourier transform infra-red spectroscopy, electron spin resonance, nuclear magnetic resonance
spectroscopy, flow cytometry, immunodetection fluorescence techniques, surface
biotinylation, calcium imaging techniques, or atomic force microscopy.
The test compound in some embodiments comprises a small molecule, peptide, nucleic acid or polysaccharide including, but not limited to antibodies, biologies, an
inhibitor of PKD1/PKD2 activity, an activator of PKD1/PKD2 activity, or a trafficking modulator to the plasma membrane or primary cilium.
In some embodiments the PKDl is a chimera. In other embodiments the PKD2 is a chimera. Optionally the PKDl and/or PKD2 includes an intracellular or extracellular tag. The tag may be selected from the group consisting of a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
In some embodiments the N-terminal truncations of PKDl enhance PKD2 surface trafficking. In other embodiments the C-terminal truncations of PKDl enhance PKD2 surface trafficking.
In some embodiments PKD1/PKD2 in the plasma membrane comprises a modified PKDl. The modified PKDl may be, for example, a polycystin-1, modified polycystin-lLl, modified polycystin-lL2, modified polycystin-1 L3 with it's
extracellular N-terminus replaced by the P2Y12-N-terminus or any other N-terminal domain that enhances surface trafficking of the PKD1/PKD2 complex. In some embodiments, the N-terminal domain is not P2Y12.
In other embodiments the modified PKD1/PKD2 complex contains ADPKD disease causing mutations in either PKDl or PKD2, which either affect plasma membrane trafficking (see FIGs 14-15) or alter PKD1/PKD2 ion channel function. This approach allows screening for compounds that correct the folding of mutated PKDl or PKD2 and thus promote plasma membrane/primary cilium trafficking of the
PKD1/PKD2 complex.
In other embodiments the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8 and/or the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
In other aspects the invention is a cell having a PKD1/PKD2 in a plasma membrane. The PKDl and/or PKD2 is a chimera. In other embodiments PKD2 contains channel activating or inhibiting mutations. In some embodiments the PKDl and/or PKD2 includes an intracellular or extracellular tag. The tag may be selected from the group consisting of a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
In some embodiments the PKD1 in the plasma membrane PKD1/PKD2 comprises a modified PKD1.
In other embodiments the PKD1 comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8 and/or the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
The cell in some embodiments is a human embryonic kidney (HEK) cell. In yet other embodiments the cell is an inner medullary collecting duct (IMCD) cell.
The modified PKD1 in some embodiments is a modified polycystin-lLl, modified polycystin-lL2, modified polycystin-lL3 or P2Y12-PKD1.
A chimeric PKD1 comprising a C-terminal PKD1 fragment linked to an N- terminal plasma membrane insertion domain is provided in other aspects of the invention. In some embodiments the plasma membrane insertion domain is P2Y12. In other embodiments the PKD1 includes an intracellular or extracellular tag. In yet other embodiments the tag is selected from the group consisting of a HA tag, His-tag, GFP, mCherry, ires GFP, YFP, BirA, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags. The C-terminal PKD1 fragment in some embodiments is SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8. The N-terminal plasma membrane insertion domain in other embodiments is SEQ ID NO: 9, SEQ ID NO: 10.
In other aspects the invention is a nucleic acid encoding a chimeric PKD1 comprising a C-terminal PKD1 fragment linked to an N-terminal plasma membrane insertion domain. In some embodiments, the N-terminal domain is not P2Y12. In some embodiments the nucleic acid encoding the C-terminal PKD1 fragment comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8. In other embodiments the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11. In yet other embodiments the nucleic acid encoding the N-terminal plasma membrane insertion domain is SEQ ID NO: 9 or SEQ ID NO: 10.
A vector, of any of the nucleic acids described herein is provided. In some embodiments the vector comprises an inducible promoter and wherein the inducible promoter consists of an araS promoter, tf55a promoter, araC promoter, or a tetracycline promoter. In other embodiments the vector comprises a dual expression vector
(pTRE3G-Bi, Takara Bio) allowing simultaneous expression of PKD1 and PKD2 with
similar protein levels (SEQ ID NO: 12 and SEQ ID NO: 13 having SEQ ID NO: 7 and or 8 inserted therein).
In other aspects the invention is a kit having a container housing a first expression vector comprising a nucleic acid encoding a chimeric PKDl comprising a C- terminal PKDl fragment linked to an N-terminal plasma membrane insertion domain, a container housing a second expression vector comprising a nucleic acid encoding a PDK2, and instructions for generating a cell line using the first and second expression vectors. In some embodiments the PKDl and/or the PKD2 is intracellularly or extracellularly tagged. The tag may be selected from the group consisting of a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags. In some embodiments the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8. In other embodiments the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
A stable inducible cell line expressing PKDl chimera/PKD2 in the plasma membrane is provided in other aspects of the invention. In some embodiments the cell line consists of inducible and non-inducible HEK cells or CHO cells. In some embodiments, the N-terminal or C-terminal truncations of PKDl enhance PKD2 surface trafficking. In other embodiments the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8. In yet other embodiments the PKD2 comprises SEQ ID NO: 1,SEQ ID NO: 2 or SEQ ID NO: 11.
In other aspects the invention is a stable inducible cell line expressing PKDl chimera/PKD2 in the primary cilium. In some embodiments the cell line consists of mEVICD3, hRPE, MDCK or LLC-PK1 cells or other ciliated cell lines. In other embodiments ciliated primary cells for expression of PKDl chimera/PKD2 are isolated from ΑΛ13Β -mCherry -GECOl.2 transgenic mice (FIG. 16) or human tissue. In other embodiments ciliated primary cells also express a calcium sensitive fluorescent protein in primary cilia. In other embodiments the cell line consists of HEK cells or CHO cells. In yet other embodiments the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8. The PKD2 in other embodiments is SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
In some embodiments the modified PKD1/PKD2 complex contains ADPKD disease causing mutations in either PKD1 or PKD2 which affects plasma membrane trafficking and/or alters PKD1/PKD2 ion channel function, including gain-of-function mutations in PKD1/PKD2.
Other advantages and novel features of the present invention will become apparent from the following detailed description of various non-limiting embodiments of the invention when considered in conjunction with the accompanying figures. In cases where the present specification and a document incorporated by reference include conflicting and/or inconsistent disclosure, the present specification shall control.
Several methods are disclosed herein of administering to a subject a composition for treatment of a particular condition. It is to be understood that in each such aspect of the invention, the invention specifically includes, also, the composition for use in the treatment of that particular condition, as well as use of the composition for the manufacture of a medicament for the treatment of that particular condition.
This invention is not limited in its application to the details of construction and the arrangement of components set forth in the following description or illustrated in the drawings. The invention is capable of other embodiments and of being practiced or of being carried out in various ways. Also, the phraseology and terminology used herein is for the purpose of description and should not be regarded as limiting. The use of "including," "comprising," or "having," "containing," "involving," and variations thereof herein, is meant to encompass the items listed thereafter and equivalents thereof as well as additional items.
BRIEF DESCRIPTION OF DRAWINGS
The accompanying drawings are not intended to be drawn to scale. In the drawings, each identical or nearly identical component that is illustrated in various figures is represented by a like numeral. For purposes of clarity, not every component may be labeled in every drawing. In the drawings:
FIG. 1. Polycystin ion channels comprise PKD1 and PKD2 subunits.
FIG. 2. P2Y12-PKD1 chimera reduces the size of PKD1 significantly. SEQ ID
NO: 20 is YPYDVPDYA and SEQ ID NO: 21 is QAVDNLTSAPGNTSLCTRDYKITQ.
FIG. 3. Targeting PKD1/P2Y12 chimera to the plasma membrane. The PKD1 chimera is 3.8 kb instead of 12 kb (M[Start]~- YPYDVPDYA (SEQ ID NO: 20)[HA- tag]— QAVDNLTSAPGNTSLCTRDYKITQ (SEQ ID NO: 21)[hP2Y12-NT]— ). Four P2Y12-PKD1 chimeras were generated varying in length of PKD1 N-terminus.
FIG. 4. Sequence comparison of human, mouse and rat PKD1 and PKD1L1.
SEQ ID NOs: 43-48 from top to bottom, respectively. Positions of P2Y12 fusion to PKD1 N-terminus are indicated with an arrow.
FIG. 5. P2Y12-PKD1-4 localizes to the plasma membrane only with PKD2 present.
FIG. 6. P2Y12-PKD1-3 localizes to the plasma membrane only with PKD2 present.
FIG. 7. P2Y12-PKD1-2 does not localize to the plasma membrane with PKD2 present.
FIG. 8. Surface HA staining is not accomplished beyond position Prot 3a.
hPKDl is shown by SEQ ID NOs: 22-25 from left to right; hPDKlLl is shown by SEQ ID NOs: 26-29 from left to right; hPDKlL2 is shown by SEQ ID NOs: 30-33 from left to right; hPDKlL3 is shown by SEQ ID NOs: 34-37 from left to right; and hPDKlREJ is shown by SEQ ID NOs: 38-41 from left to right.
FIG. 9. Schematic showing mTRPV3 having an extracellular FLAG insertion allowing quantification of ion channels in the plasma membrane.
FIG. 10. Schematic showing FLAG insertion in extracellular domain of PKD2 using Protter visualization software. The criteria for insertion were 1) different sequences between PKD2 and PKD2-L1 and 2) D/E and K in proximity. DYKDDDDK is SEQ ID NO: 42. A FLAG epitope was inserted at nine different positions and tested for surface immunoreactivity
FIG. 11. Staining of PKD2-FLAG5, the only position that gave a positive FLAG immuno staining .
FIG. 12. Generation of stable cell lines. Reliable co-expression of two proteins is required. Tet-inducible dual promoter was used: Tet-on HEK cell line (Clontech). Tet activator expressing mIMCD3 cell line was generated. Tet-on cell clones with best and worst cilia were selected: EVICD17 and IMCD 28.
FIG. 13. Schematic drawing of assay to screen for plasma membrane and cilia localization of PKD1 and PKD2 proteins simultaneously. A HEK tet- inducible cell line expressing P2Y12-PKD1-4 and PKD2-FLAG generates robust plasma membrane staining for both HA and FLAG. A mIMCD3 tet-inducible cell line expressing P2Y12- PKD1-4 and PKD2-FLAG shows prominent cilia localization of PKD1 and PKD2. Both cell lines were stained live with anti-HA and anti-FLAG antibodies to ensure integrity of the plasma membrane and thus only immunolabeling of plasma membrane inserted PKD1/PKD2.
FIG. 14. Randomly chosen ADPKD disease causing mutations in PKD1 affect cell surface trafficking of the PKD1/PKD2 complex to various degrees. R3750Q and Q3751X mutations impair surface trafficking of the channel complex
FIG. 15. Randomly chosen ADPKD disease causing mutations in PKD2. All mutations impair surface trafficking of the channel complex.
FIG. 16. Ciliary targeted calcium sensor transgenic mouse model.
FIG. 17. Expression of extracellular domains of PKD1 and PKD1-L1 in yeast
{Pichia pastoris).
DETAILED DESCRIPTION
Autosomal dominant polycystic kidney disease (ADPKD) is a severe disorder which currently has no treatment. Most patients presenting with the disease have a mutation in a PKD1 or PKD2 gene encoding for a membrane spanning polycystin protein present in kidney cells. The function of the polycystin proteins are not well understood and successful therapies targeting the protein have not been developed. It has been discovered, surprisingly, according to the invention, that the polycystin protein complex can be targeted to the plasma membrane and is thus amenable for functional and surface trafficking/protein folding assays and methods described herein. A PKDl chimera /PKD2 has been developed which is able to be expressed in the plasma membrane. Prior to the instant invention, attempts to develop a functional membrane bound polycystin ion channel complex have not been successful. The ability to target the polycystin ion channel complex to the plasma membrane or primary cilium and to quantify protein levels in plasma or primary cilium membrane using extracellular tags
has broad implications for studying the regulation of PKD as well as for identifying modulators of natural channels.
The PKD1 gene provides instructions for making a protein called polycystin- 1. The protein consists of a large N-terminus (3000 aa), 11 transmembrane domains and an intracellular C-terminus implicated in the interaction with PKD2. Its positioning in the membrane of kidney cells allows it to interact with other proteins, carbohydrates, and fat molecules (lipids) outside the cell and to receive signals that help the cell respond to its environment. These signals instruct the cell to undergo certain changes, such as maturing to take on specialized functions.
Polycystin- 1 is also found in cell structures called primary cilia. Primary cilia are tiny, fingerlike projections that line the small tubes where urine is formed (renal tubules). Researchers believe that primary cilia sense the movement of fluid through these tubules, which appears to help maintain the tubules' size and structure. The interaction of polycystin- 1 and polycystin-2 in renal tubules promotes the normal development and function of the kidneys.
The PKD2 gene belongs to a family of genes called TRP (transient receptor potential cation channels) as well as a family of genes called EF-hand domain containing (EF-hand domain containing). The PKD2 gene provides instructions for making a protein called polycystin-2. Polycystin-2 likely functions as a channel spanning the cell membrane of kidney cells. In conjunction with polycystin- 1, the channel transports positively charged atoms (ions), including calcium ions, into the cell.
Prior to the instant invention the skilled artisan has not been able to reliably record PKD1/PKD2 currents, because the proteins (full-length) do not traffic to the plasma membrane. As a result a cell based screen for modulators such as agonists or antagonists has not been developed. The methods of the invention involve the discovery of constructs that target the PKD1/PKD2 channel complex to the plasma membrane and thus allow functional characterization and screening for activators and inhibitors of the ion channel complex. In particular the invention involves a PKD1 chimera/PKD2 that is modified to achieve membrane expression. For instance, a chimera of an N-terminal protein fused to a truncated form of PKD1 can enhance the cell surface trafficking. In some embodiments, a chimera of the invention is a N-terminal protein-PKDl fragment.
An N-terminal protein, as used herein is a signal peptide that enhances trafficking to the plasma membrane. In some embodiments, the peptide is signal peptide. Preferably the N-terminal protein is an N-terminal region of a GPCR. GPCR's are well known in the art. In some embodiments the N terminal protein is an N-terminus of P2Y12. In other embodiments the N-terminus is a 20-30 amino acid N-terminus of a cell surface protein that promotes cell surface delivery.
A PKD1 fragment is a functionally active fragment of PKD1. In some
embodiments the PKD1 fragment is a C-terminal fragment of PKD1. It may be between 500 and 1,500 amino acids in length in some embodiments. Thus, in some embodiments, the PKD1 is a chimera, wherein N-terminal truncations of PKD1 enhance PKD2 surface trafficking. In some embodiments, the PKD1 is a chimera, wherein C-terminal truncations of PKD1 enhance PKD2 surface trafficking. In another embodiment the functionally active fragment of PKD1 is the entire extracellular domain of PKD1 or PKD1-L1 or PKD1-L2 or PKD1-L3 or fragments thereof expressed and purified from heterologous expression systems such as Pichia pastoris, insect cells or mammalian cell lines such as HEK or CHO cells. It may be between 200 and 3000 amino acids in length.
Aspects of the invention relate to in vitro and/or in vivo assays for identifying compounds that reduce the negative effects of defects in PKD1/PKD2. In some embodiments, a candidate compound is identified in an assay as modulating ion transport function of PKD1/PKD2. Aspects of the invention may be implemented in any suitable assay format, including, for example, a high throughput assay format. For example, a high throughput screen (HTS) format of more than about 10,000, more than 100,000 (e.g., >110,000) compounds may be used to identify compounds that modulate
PKD1/PKD2 activity. In some embodiments, a first screen (e.g., high throughput screens) may be used to identify one or more candidate compounds that have at least a threshold effect on PKD1/PKD2 activity. In some embodiments, a threshold effect may be an increase or decrease of PKD1/PKD2 activity of at least 5%, at least 10%, 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, 80-90%, 90-95%, 95%- 100% relative to a control level of PKD1/PKD2 activity in the absence of a compound or in the presence of a compound that is known to have little or no effect on PKD1/PKD2 activity (negative control) or to have a modulatory effect (positive control).
In some embodiments, a candidate compound that is identified in a first screen may be evaluated in a second screen to confirm that it is useful as a therapeutic agent. Thus, the compound may be further evaluated in vitro or in vivo to determine whether it selectively promotes or inhibits physiological function in the cell. Accordingly, a cell- based PKD1/PKD2 assay in the presence or absence of a test compound may be used in conjunction or independently of an in vitro assay to evaluate further physiological effects of candidate test compounds. It should be appreciated that in some embodiments downstream readouts associated with PKD1/PKD2 activity also may be used to evaluate the effects of one or more test compounds.
In some embodiments, the test compound comprises a small molecule, peptide, nucleic acid or polysaccharide including, but not limited to antibodies and biologies.
In some embodiments, the test compound comprises an inhibitor of PKD1/PKD2 activity. In other embodiments, the test compound comprises an activator of
PKD1/PKD2 activity. In some embodiments, the test compound comprises a trafficking modulator. In some embodiments, the test compound comprises a trafficking modulator to the plasma membrane or primary cilium that corrects misfolding of PKD1 or PKD2 due to point mutations in the proteins resulting in reduced plasma membrane trafficking of the protein complex. In some embodiments the test compound or candidate compound is a modulator of PKD1/PKD2 activity. A modulator of PKD1/PKD2 activity is an agonist, an antagonist, an inverse agonist, a positive allosteric regulator or a negative allosteric regulator of PKD1/PKD2 activity. An "agonist" is a molecule capable, on its own, of increasing the activity of PKD1/PKD2. An "antagonist" is a molecule capable of inhibiting the activating effect of an agonist. An "inverse agonist" is a molecule capable of inhibiting the constitutive activity of PKD1/PKD2, i.e. the activity measurable in the absence of any agonist, when such an activity is effectively measurable. An inverse agonist is also capable of inhibiting the effect of an agonist. It is therefore also an antagonist. A "positive allosteric regulator" is a molecule capable of facilitating the action of an agonist. A "negative allosteric regulator" is a molecule capable of decreasing the effect of an agonist.
It should be appreciated that any conditions associated with aberrant
PKD1/PKD2 activity may be treated with the compounds identified according to the screening methods of the invention The compounds identified in the screening assays
described herein are useful as therapeutic, diagnostic and/or research reagents. Mutations in polycystin 1 and 2 manifest in severe ciliopathies. Thus, compounds that modulate PKD1/PKD2 activity may be useful as therapeutic agents. For instance the active compounds may be therapeutic agents in the treatment of kidney disease such as
Autosomal dominant polycystic kidney disease (ADPKD), cyst formation, disorders involving cilia such as meduloblastoma, glioblastoma, and basal cell carcinoma, and vascular disease such as cardiac vascular disease.
ADPKD is generally a late-onset multisystem disorder characterized by: bilateral renal cysts; cysts in other organs including the liver, seminal vesicles, pancreas, and arachnoid membrane; vascular abnormalities including intracranial aneurysms, dilatation of the aortic root, and dissection of the thoracic aorta; mitral valve prolapse; and abdominal wall hernias. Renal manifestations include hypertension, renal pain, and renal insufficiency. Approximately 50% of individuals with ADPKD have end-stage renal disease (ESRD) by age 60 years. About 95% of individuals with ADPKD have an affected parent; at least 10% of families can be traced to de novo mutation. Polycystic kidney disease 1 (autosomal dominant) is also known as Lov-1, PBP, Pc-1, PCI, TRPPl, and PKD1. Polycystic kidney disease 2 (autosomal dominant) is also known as APKD2, PC2, PKD4, Pc-2, TRPP2, and PKD2.
The prevalence of liver cysts, the most common extrarenal manifestation of ADPKD, increases with age and may have been underestimated by ultrasound studies. The prevalence of intracranial aneurysms is higher in those with a positive family history of aneurysms or subarachnoid hemorrhage (22%) than in those without such a family history (6%). Mitral valve prolapse, the most common valvular abnormality, occurs in up to 25% of affected individuals. Substantial variability in severity of renal disease and other extrarenal manifestations occurs even within the same family. The diagnosis of ADPKD is established primarily by imaging studies of the kidneys. In approximately 85% of individuals with ADPKD, pathogenic variants in PKD1 are causative; in approximately 15% of individuals, pathogenic variants in PKD2 are causative.
Therapeutic interventions aimed at slowing the progression of ESRD in ADPKD include control of hypertension and hyperlipidemia, dietary protein restriction, control of acidosis, and prevention of hyperphosphatemia. Most individuals with polycystic liver disease have no symptoms and require no treatment. The mainstay of therapy for
ruptured or symptomatic intracranial aneurysm is surgical clipping of the ruptured aneurysm at its neck; however, for some individuals, endovascular treatment with detachable platinum coils may be indicated. Thoracic aortic replacement is indicated when the aortic root diameter exceeds established size (Harris PC, Torres VE. Polycystic Kidney Disease, Autosomal Dominant. 2002 Jan 10 [Updated 2015 Jun 11]. In: Pagon RA, Adam MP, Ardinger HH, et al., editors. GENERE VIE WS ® [Internet]. Seattle (WA): University of Washington, Seattle; 1993-2016).
In some embodiments, methods of detection comprise a voltage-clamp, patch clamp, x-ray crystallization, electron microscopy, circular dichroism, Fourier transform infra-red spectroscopy, electron spin resonance, nuclear magnetic resonance
spectroscopy, flow cytometry, immunodetection fluorescence techniques, surface biotinylation, calcium imaging techniques, or atomic force microscopy. These methods assist in identifying a compound that modulates polycystin-l/polycystin-2
(PKD1/PKD2) activity, comprising contacting a cell having a plasma membrane PKD 1/PKD2 with a test compound, detecting whether PKD 1/PKD2 activity is modulated in the presence of the test compound with respect to PKD1/PKD2 activity in the absence of the test compound, and wherein if the PKD1/PKD2 activity is modulated then the test compound is a compound that modulates PKD1/PKD2 activity.
In some embodiments, the PKD1 is a chimera, wherein the PKD1 includes an intracellular or extracellular tag. In some embodiments, the PKD2 is a chimera, wherein the PKD2 includes an intracellular or extracellular tag.
In some embodiments, the tag can be, but is not limited to a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
In other embodiments the modified PKD1/PKD2 complex contains ADPKD disease causing mutations in either PKD1 or PKD2, which either affect plasma membrane trafficking (see FIGs 14-15) or alter PKD1/PKD2 ion channel function. This approach allows screening for compounds that correct the folding of mutated PKD1 or PKD2 and thus promote plasma membrane/primary cilium trafficking of the
PKD 1/PKD2 complex.
A nucleic acid or polypeptide sequence that is "derived from" a designated sequence refers to a sequence that corresponds to a region of the designated sequence. For nucleic acid sequences, this encompasses sequences that are homologous or complementary to the sequence, as well as "sequence-conservative variants" and
"function-conservative variants." For polypeptide sequences, this encompasses
"function-conservative variants." Sequence-conservative variants are those in which a change of one or more nucleotides in a given codon position results in no alteration in the amino acid encoded at that position. Function-conservative variants are those in which a given amino acid residue in a polypeptide has been changed without altering the overall conformation and function of the native polypeptide, including, but not limited to, replacement of an amino acid with one having similar physico-chemical properties (such as, for example, acidic, basic, hydrophobic, and the like). "Function-conservative" variants also include any polypeptides that have the ability to elicit antibodies specific to a designated polypeptide.
Conservative substitutions typically include the substitution of one amino acid for another with similar characteristics, e.g., substitutions within the following groups:
valine, glycine; glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. Other conservative substitutions are known in the art. The invention encompasses sequence-conservative variants and function-conservative variants of these sequences. The nucleic acids may be DNA, RNA, DNA/RNA duplexes, protein-nucleic acid (PNA), or derivatives thereof.
In some embodiments, the PKD1 in the plasma membrane PKD1/PKD2 comprises a modified PKD1. In some embodiments, the modified PKD1 is a P2Y12- PKD1, P2Y12-1L1, P2Y12-1L2, or P2Y12-1L3. In some embodiments, the PKD1 comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8 or sequence-conservative or function-conservative variants thereof. In some embodiments, the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11 or sequence-conservative or function-conservative variants thereof.
In some embodiments, the invention consists of a cell having a PKD1/PKD2 in a plasma membrane, wherein the PKD1 is a chimera and/or the PKD2 is a chimera. In some embodiments, the PKD1 includes a tag and/or the PKD2 includes a tag. In some
embodiments, the tag can be, but is not limited to a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags. In some embodiments, the PKDl in the plasma membrane PKD1/PKD2 comprises a modified PKDl. For example, the PKDl can comprise SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO:7, SEQ ID NO: 8 or sequence-conservative or function-conservative variants thereof. The PKD2 can comprise SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11 or sequence-conservative or function-conservative variants thereof.
In some embodiments, the cell is a human embryonic kidney (HEK) cell. In other embodiments, the cell is an inner medullary collecting duct (IMCD) cell. In some embodiments, the modified PKDl is a modified polycystin-lLl, modified polycystin- 1L2, modified polycystin-lL3 or P2Y12-PKD1. In some embodiments, the N-terminus of the modified PKDl does not contain P2Y12.
In some embodiments, the invention includes an inducible cell line expressing PKDl chimera/PKD2 in the plasma membrane. In some embodiments, the cell line consists of HEK cells or CHO cells. In some embodiments the cell line used for inducible PKD1/PKD2 expression contains a primary cilium such as mIMCD3, hRPE, MDCK or LLC-PK1 cells. This allows quantification of protein trafficking to both plasma membrane and primary cilium. In some embodiments, the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8 or sequence-conservative or function-conservative variants thereof. In other embodiments, the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11 or sequence-conservative or function-conservative variants thereof.
In some embodiments, the invention includes a stable inducible cell line expressing PKDl chimera/PKD2 in the primary cilium. In some embodiments, the cell line consists of EVICD3 cells or other ciliated cell lines or ciliated primary cells. In some embodiments, the invention cell line consists of HEK cells or CHO cells. In some embodiments, the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8 or sequence-conservative or function- conservative variants thereof. In other embodiments, the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11 or sequence-conservative or function-conservative variants thereof.
In some embodiments, the invention includes a chimeric PKDl comprising a C- terminal PKDl fragment linked to an N-terminal plasma membrane insertion domain. In other embodiments, the plasma membrane insertion domain is P2Y12. The PKDl can, in some embodiments, include an extracellular tag. In some embodiments, the C-terminal PKDl fragment comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO:
6, SEQ ID NO: 7, SEQ ID NO: 8 or sequence-conservative or function-conservative variants thereof. In other embodiments, the N-terminal plasma membrane insertion domain comprises SEQ ID NO: 9, SEQ ID NO: 10 or sequence-conservative or function- conservative variants thereof.
In some embodiments, the invention includes a nucleic acid encoding a chimeric
PKDl comprising a C-terminal PKDl fragment linked to an N-terminal plasma membrane insertion domain. In some embodiments, the C-terminal PKDl fragment comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO:
7, SEQ ID NO: 8 or sequence-conservative or function-conservative variants thereof. In other embodiments, the N-terminal plasma membrane insertion domain comprises SEQ
ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 10 or sequence-conservative or function- conservative variants thereof. In some embodiments, the nucleic acid encoding the N- terminal plasma membrane insertion domain is SEQ ID NO: 9, SEQ ID NO: 10 or sequence-conservative or function-conservative variants thereof.
In some embodiments, the sequences are of human origin. In other embodiments, the sequences can be of xenarthra, chiroptera, carnivora, cetacea, dermoptera, macroscelidea, proboscidea, lagomorpha, artiodactyla, peris sodactyla, hyracoidea, insectivora, marsupialia, monotremata, pholidota, primates, rodentia, pinnipedia, sirenia, or scandentia origins.
In some embodiments, engineered constructs and/or engineered nucleic acids are included within a "vector". A vector is a nucleic acid (e.g., DNA) used as a vehicle to artificially carry genetic material (e.g., an engineered nucleic acid) into another cell where, for example, it can be replicated and/or expressed.
Biological vectors include, but are not limited to, plasmids, phagemids, viruses, other vehicles derived from viral or bacterial sources that have been manipulated by the insertion or incorporation of the nucleic acid sequences of the invention, and free nucleic acid fragments which can be linked to the nucleic acid sequences of the invention. A
non-limiting example of a vector is a plasmid. Plasmids are double-stranded generally circular DNA sequences that are capable of automatically replicating in a host cell.
Plasmid vectors typically contain an origin of replication that allows for semi- independent replication of the plasmid in the host and also the transgene insert. Plasmids may have more features, including, for example, a "multiple cloning site," which includes nucleotide overhangs for insertion of a nucleic acid insert, and multiple restriction enzyme consensus sites to either side of the insert.
Viral vectors are a preferred type of biological vector and include, but are not limited to, nucleic acid sequences from the following viruses: retroviruses, such as Moloney murine leukemia virus; Harvey murine sarcoma virus; murine mammary tumor virus; Rous sarcoma virus; adenovirus; adeno-associated virus; SV40-type viruses;
polyoma viruses; poxviruses; Epstein-Barr viruses; papilloma viruses; herpes virus; vaccinia virus; and polio virus. One can readily employ other vectors not named but known in the art.
In some embodiments, the invention consists of a vector comprising a nucleic acid encoding a chimeric PKD1 comprising a C-terminal PKD1 fragment linked to an N- terminal plasma membrane insertion domain. In some embodiments, the vector comprises SEQ ID NO: 12, SEQ ID NO: 13 or sequence-conservative or function- conservative variants thereof.
Engineered constructs of the present disclosure comprise, in some embodiments, promoters operably linked to a nucleotide sequence (e.g., encoding a protein of interest). A "promoter" is a control region of a nucleic acid at which initiation and rate of transcription of the remainder of a nucleic acid are controlled. A promoter may also contain sub-regions at which regulatory proteins and molecules may bind, such as RNA polymerase and other transcription factors. Promoters may be constitutive, inducible, activatable, repressible, tissue-specific or any combination thereof.
A promoter drives expression or drives transcription of the nucleic acid sequence that it regulates. A promoter is considered to be "operably linked" when it is in a correct functional location and orientation in relation to the nucleotide sequence it regulates to control ("drive") transcriptional initiation and/or expression of that sequence.
Promoters of an engineered nucleic acid construct may be "inducible promoters," which refer to promoters that are characterized by regulating (e.g., initiating or
activating) transcriptional activity when in the presence of, influenced by or contacted by an inducer signal. An inducer signal may be endogenous or a normally exogenous condition (e.g., light), compound (e.g., chemical or non-chemical compound) or protein that contacts an inducible promoter in such a way as to be active in regulating
transcriptional activity from the inducible promoter. Thus, a "signal that regulates transcription" of a nucleic acid refers to an inducer signal that acts on an inducible promoter. A signal that regulates transcription may activate or inactivate transcription, depending on the regulatory system used. Activation of transcription may involve directly acting on a promoter to drive transcription or indirectly acting on a promoter by inactivating a repressor that is preventing the promoter from driving transcription.
Conversely, deactivation of transcription may involve directly acting on a promoter to prevent transcription or indirectly acting on a promoter by activating a repressor that then acts on the promoter.
The administration or removal of an inducer signal results in a switch between activation and inactivation of the transcription of the operably linked nucleic acid sequence. Thus, the active state of a promoter operably linked to a nucleic acid sequence refers to the state when the promoter is actively regulating transcription of the nucleic acid sequence (i.e., the linked nucleic acid sequence is expressed). Conversely, the inactive state of a promoter operably linked to a nucleic acid sequence refers to the state when the promoter is not actively regulating transcription of the nucleic acid sequence (i.e., the linked nucleic acid sequence is not expressed).
An inducible promoter of the present disclosure may be induced by (or repressed by) one or more physiological condition(s), such as changes in light, pH, temperature, radiation, osmotic pressure, saline gradients, cell surface binding, and the concentration of one or more extrinsic or intrinsic inducing agent(s). An extrinsic inducer signal or inducing agent may comprise, without limitation, amino acids and amino acid analogs, saccharides and polysaccharides, nucleic acids, protein transcriptional activators and repressors, cytokines, toxins, petroleum-based compounds, metal containing compounds, salts, ions, enzyme substrate analogs, hormones or combinations thereof.
Inducible promoters of the present disclosure include any inducible promoter described herein or known to one of ordinary skill in the art. In some embodiments, the inducible promoter consists of an araS promoter, tf55a promoter, araC promoter, or a
tetracycline promoter. Other examples of inducible promoters include, without limitation, chemically/biochemically-regulated and physically-regulated promoters such as alcohol-regulated promoters, tetracycline-regulated promoters (e.g.,
anhydrotetracycline (aTc)-responsive promoters and other tetracycline-responsive promoter systems, which include a tetracycline repressor protein (tetR), a tetracycline operator sequence (tetO) and a tetracycline transactivator fusion protein (tTA)), steroid- regulated promoters (e.g., promoters based on the rat glucocorticoid receptor, human estrogen receptor, moth ecdysone receptors, and promoters from the
steroid/retinoid/thyroid receptor superfamily), metal-regulated promoters (e.g., promoters derived from metallothionein (proteins that bind and sequester metal ions) genes from yeast, mouse and human), pathogenesis-regulated promoters (e.g., induced by salicylic acid, ethylene or benzothiadiazole (BTH)), temperature/heat-inducible promoters (e.g., heat shock promoters), and light-regulated promoters (e.g., light responsive promoters from plant cells).
In some embodiments, inducible promoters of the present disclosure function in prokaryotic cells (e.g., bacterial cells). Examples of inducible promoters for use prokaryotic cells include, without limitation, bacteriophage promoters (e.g. Plslcon, T3, T7, SP6, PL) and bacterial promoters (e.g., Pbad, PmgrB, Ptrc2, Plac/ara, Ptac, Pm), or hybrids thereof (e.g. PLlacO, PLtetO). In some embodiments, inducible promoters of the present disclosure function in eukaryotic cells (e.g., mammalian cells). Examples of inducible promoters for use eukaryotic cells include, without limitation, chemically- regulated promoters (e.g., alcohol-regulated promoters, tetracycline-regulated promoters, steroid-regulated promoters, metal-regulated promoters, and pathogenesis-related (PR) promoters) and physically-regulated promoters (e.g., temperature-regulated promoters and light-regulated promoters).
In some embodiments, the invention includes a kit comprising a container housing a first expression vector comprising a nucleic acid encoding a chimeric PKDl comprising a C-terminal PKDl fragment linked to an N-terminal plasma membrane insertion domain, a container housing a second expression vector comprising a nucleic acid encoding a PKD2, and instructions for generating a cell line using the first and second expression vectors. In some embodiments PKDl and PKD2 are dually expressed from the same expression vector. In some embodiments, the PKDl is tagged. In other
embodiments, the PKD2 is tagged. In some embodiments, the tag is selected from the group consisting of a HA tag, His-tag, GFP, YFP; BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags. In some embodiments, the PKD1 comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8 or sequence- conservative or function-conservative variants thereof. In other embodiments, the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11 or sequence-conservative or function-conservative variants thereof. That is, the kit can include a description of use of the compositions as discussed herein. Instructions also may be provided for producing cells and/or screening cells by any suitable technique.
The kits described herein may also contain one or more containers, which may contain the composition and other ingredients as previously described. The kits also may contain instructions for mixing, diluting, and/or administrating the compositions of the invention in some cases.
The present invention is further illustrated by the following Examples, which in no way should be construed as further limiting. The entire contents of all of the references (including literature references, issued patents, published patent applications, and co-pending patent applications) cited throughout this application are hereby expressly incorporated by reference.
EXAMPLES
Example 1: Autosomal Dominant Polycystic Kidney Disease
ADPKD mutations occur in a putative receptor ion channel complex. PKD2 is a member of the transient channel family (TRP channels). PKD1 and PKD2 localize to primary cilia (FIG. 13).
PKD1 and PKD1-L1 have 11 transmembranes of unknown function. PKD2 and PKD2-L1 are in the TRP channel subfamily. Polycystins form heteromeric complexes (FIG. 1).
P2Y12-PKD1 chimera reduces the size of PKD1 significantly (FIG. 2). P2Y12
N-terminus has been used for GPCR's to enhance surface trafficking. SEQ ID NO: 20 is YPYDVPDYA and SEQ ID NO: 21 is QAVDNLTSAPGNTSLCTRDYKITQ. The wild- type PKD1 consists of approximately 4000 amino acids, whereas the P2Y12-PKD1
consists of approximately 1000 amino acids. Four PKDl chimeras were generated and tested (FIG. 3, 4). FIG. 4 shows sequence comparisons of human, mouse and rat PKDl and PKD1L1 with position of P2Y12 fusion to PKDl indicated by an arrow. SEQ ID NOs: 43-48 from top to bottom, respectively.
Next, an experiment was set-up to identify if a PKD1/P2Y12 chimera could be targeted to the plasma membrane. Various chimeras were tested. The PKDl chimera is 3.8 kb instead of 12 kb (M[Start]~- YPYDVPDYA (SEQ ID NO: 20)[HA-tag]—
QAVDNLTSAPGNTSLCTRDYKITQ (SEQ ID NO: 21)[hP2Y12-NT]— ). Staining of live cells with anti-HA antibody detects the PKDl chimera in plasma membrane. P2Y12- PKD1-4 localized to the plasma membrane only with PKD2 present (FIG. 5). P2Y12- PKD1-3 localized to the plasma membrane only with PKD2 present (FIG. 6). P2Y12- PKD1-2 did not localize to the plasma membrane with PKD2 present (FIG. 7).
FIG. 8 shows that surface HA staining is not accomplished beyond N-terminal fusion of P2Y12 to PKDl at position Prot 3a.
FIG. 9 shows a Protter visualization of mTRPV3 FLAG insertion. The right panels show images of surface FLAG, GFP-TRPV3, and an overlay.
Flag insertion in extracellular domain of PKD2 using Protter visualization software is shown in FIG. 10. Nine positions were tested with only one resulting in surface FLAG staining. The criteria for insertion were 1) different sequences between PKD2 and PKD2-L1 and 2) D/E and K in proximity. DYKDDDDK is SEQ ID NO: 42 PKD2-FLAG5 was shown to work. FIG. 11 shows that upon co-transfection of P2Y12-PKD1-4 with PKD2-FLAG5 both epitopes are recognized in the plasma membrane using anti-HA and anti-FLAG antibodies.
FIG. 12 shows pTRE3G-BI and images of IMCD 28 and IMCD 17. Stable cell lines were generated. Reliable co-expression of two proteins was required. A Tet- inducible dual promoter was used (Tet-on HEK cell line, Clontech). A Tet activator expressing mIMCD3 cell line was generated as well. Tet-on cell clones with best and worst cilia were selected: IMCD 17 and IMCD 28.
FIG. 13 shows schematic drawing of assay to detect PKDl and PKD2 in the plasma membrane and primary cilium. HA and FLAG tag are visualized in the plasma membrane by incubating live cells with fluorescent dye conjugated anti-HA and anti- FLAG antibodies. Thus only membrane inserted PKD1/PKD2 proteins are
immunolabeled, while intracellular localized proteins are not detected. On the right: HEK 3G cells (top) and mIMCD3 (bottom) stable clones express P2Y12-PKD1- 4+PKD2-FLAG5 after 24 hour doxycycline induction are shown. While PKDl and PKD2 localize to the plasma membrane in HEK cells both proteins traffic to the primary cilium in mIMCD3 cells. FIG. 14 shows examples of pathogenic point mutations in
PKDl causing ADPKD using the assay shown in FIG. 13. 5 randomly chosen mutations in PKDl affect surface trafficking of the PKD1/PKD2 complex to various degrees.
FIG. 15 shows examples of pathogenic point mutations in PKD2 causing
ADPKD using the assay shown in FIG. 13. 5 randomly chosen mutations in PKD2 all abolish surface trafficking of the PKD1/PKD2 complex. A ciliary targeted calcium sensor transgenic mouse model is seen in FIG. 16.
FIG. 17 shows expression of extracellular domains of PKDl and PKD1-L1 in yeast (Pichia pastoris). The Pichia Pastoris expression system, which is commercially available from Life Technologies, was used for expression of the protein fragments. Nickel columns were used to purify the expressed proteins. The three purified proteins, are shown in Fig. 17, right panel. The DNA sequence of PKDl extracellular fragments are shown in SEQ ID NOs: 14, 16 and 18. The protein sequences are shown in SEQ ID NOs: 15, 17, and 19.
The DNA sequence of PKDl extracellular fragment (domains PKDI-PKDX) is shown in SEQ ID NO: 14. The DNA sequence was cloned into expression vector pPIC9 (Life Technologies) for expression and purification in Pichia Pastoris. His tag used for purification is underlined.
The protein sequence of PKDl extracellular fragment (domains PKDI-PKDX) expressed in Pichia Pastoris using pPIC9 expression vector (Life Technologies) is shown in SEQ ID NO: 15. His tag used for purification is underlined.
The DNA sequence of PKDl extracellular fragment (PKD domain XII and REJ). DNA sequence (shown in SEQ ID NO: 16) was cloned in to expression vector pPIC9 (Life Technologies) for expression and purification in Pichia Pastoris. His tag used for purification is underlined.
The protein sequence of PKDl extracellular fragment (PKD domain XII and
REJ) expressed in Pichia Pastoris using pPIC9 expression vector (Life Technologies) is shown in SEQ ID NO: 17. His tag used for purification is underlined.
The DNA sequence of PKD1L1 extracellular fragment. DNA sequence was cloned into expression vector pPIC9 (Life Technologies) for expression and purification in Pichia Pastoris is shown in SEQ ID NO: 18. His tag used for purification is underlined.
The protein sequence of PKD1 extracellular fragment (domains PKDI-PKDX) expressed in Pichia Pastoris using pPIC9 expression vector (Life Technologies) is shown in SEQ ID NO: 19. His tag used for purification is underlined.
Each of the sequences described herein are intended to designate the sequence with or without the presence of a FLAG or His tag and may be claimed with or without the FLAG or His tag (underlined sequence).
Sequences 1-19: hPKD2 DNA sequence with extracellular FLAG tag
atggtgaactccagtcgcgtgcagcctcagcagcccggggacgccaagcggccgcccgcgccccgcgcgccggacccgg gccggctgatggctggctgcgcggccgtgggcgccagcctcgccgccccgggcggcctctgcgagcagcggggcctgga gatcgagatgcagcgcatccggcaggcggccgcgcgggaccccccggccggagccgcggcctccccttctcctccgctctc gtcgtgctcccggcaggcgtggagccgcgataaccccggcttcgaggccgaggaggaggaggaggaggtggaaggggaa gaaggcggaatggtggtggagatggacgtagagtggcgcccgggcagccggaggtcggccgcctcctcggccgtgagctc cgtgggcgcgcggagccgggggcttgggggctaccacggcgcgggccacccgagcgggaggcggcgccggcgagagg accagggcccgccgtgccccagcccagtcggcggcggggacccgctgcatcgccacctccccctggaagggcagccgcc ccgagtggcctgggcggagaggctggttcgcgggctgcgaggtctctggggaacaagactcatggaggaaagcagcactaa ccgagagaaataccttaaaagtgttttacgggaactggtcacatacctcctttttctcatagtcttgtgcatcttgacctacggcatga tgagctccaatgtgtactactacacccggatgatgtcacagctcttcctagacacccccgtgtccaaaacggagaaaactaacttt aaaactctgtcttccatggaagacttctggaagttcacagaaggctccttattggatgggctgtactggaagatgcagcccagca accagactgactacaaagacgatgacgacaagagtttcatcttctatgagaacctgctgttaggggttccacgaatacggcaact ccgagtcagaaatggatcctgctctatcccccaggacttgagagatgaaattaaagagtgctatgatgtctactctgtcagtagtg aagatagggctccctttgggccccgaaatggaaccgcttggatctacacaagtgaaaaagacttgaatggtagtagccactggg gaatcattgcaacttatagtggagctggctattatctggatttgtcaagaacaagagaggaaacagctgcacaagttgctagcctc aagaaaaatgtctggctggaccgaggaaccagggcaacttttattgacttctcagtgtacaacgccaacattaacctgttctgtgt ggtcaggttattggttgaattcccagcaacaggtggtgtgattccatcttggcaatttcagcctttaaagctgatccgatatgtcaca acttttgatttcttcctggcagcctgtgagattatcttttgtttctttatcttttactatgtggtggaagagatattggaaattcgcattcac aaactacactatttcaggagtttctggaattgtctggatgttgtgatcgttgtgctgtcagtggtagctataggaattaacatatacag
aacatcaaatgtggaggtgctactacagtttctggaagatcaaaatactttccccaactttgagcatctggcatattggcagataca gttcaacaatatagctgctgtcacagtattttttgtctggattaagctcttcaaattcatcaattttaacaggaccatgagccagctctc gacaaccatgtctcgatgtgccaaagacctgtttggctttgctattatgttcttcattattttcctagcgtatgctcagttggcatacctt gtctttggcactcaggtcgatgacttcagtactttccaagagtgtatcttcactcaattccgtatcattttgggcgatatcaactttgca gagattgaggaagctaatcgagttttgggaccaatttatttcactacatttgtgttctttatgttcttcattcttttgaatatgtttttggcta tcatcaatgatacttactctgaagtgaaatctgacttggcacagcagaaagctgaaatggaactctcagatcttatcagaaagggc taccataaagctttggtcaaactaaaactgaaaaaaaataccgtggatgacatttcagagagtctgcggcaaggaggaggcaag ttaaactttgacgaacttcgacaagatctcaaagggaagggccatactgatgcagagattgaggcaatattcacaaagtacgacc aagatggagaccaagaactgaccgaacatgaacatcagcagatgagagacgacttggagaaagagagggaggacctggatt tggatcacagttctttaccacgtcccatgagcagccgaagtttccctcgaagcctggatgactctgaggaggatgacgatgaag atagcggacatagctccagaaggaggggaagcatttctagtggcgtttcttacgaagagtttcaagtcctggtgagacgagtgg accggatggagcattccatcggcagcatagtgtccaagattgacgccgtgatcgtgaagctagagattatggagcgagccaaa ctgaagaggagggaggtgctgggaaggctgttggatggggtggccgaggatgaaaggctgggtcgtgacagtgaaatccat agggaacagatggaacggctagtacgtgaagagttggaacgctgggaatccgatgatgcagcttcccagatcagtcatggttta ggcacgccagtgggactaaatggtcaacctcgccccagaagctcccgcccatcttcctcccaatctacagaaggcatggaagg tgcaggtggaaatgggagttctaatgtccacgtatga (SEQ ID NO: 1) hPKD2 protein sequence with FLAG sequence (FLAG tag underlined)
mvnssrvqpqqpgdakrppaprapdpgrlmagcaavgaslaapgglceqrgleiemqrirqaaardppagaaaspsppl sscsrqawsrdnpgfeaeeeeeevegeeggmvvemdvewrpgsrrsaassavssvgarsrglggyhgaghpsgrrrrre dqgppcpspvgggdplhrhlplegqpprvawaerlvrglrglwgtrlmeesstnrekylksvlrelvtyllflivlciltygm mssnvvvvtrmmsqlfldtpvsktektnfktlssmedf
prirqlrvrngscsipqdlrdeikecydvysvssedrapfgprngtawiytsekdlngsshwgiiatysgagyyldlsrtreet aaqvaslldcnvwldrgtratfidfsvynaninlfcvvrllvefpatggvipswqfqplkliryvttfdfflaaceiifcffifyyvv eeileirihklhyfrsfwncldvvivvlsvvaiginiyrtsnvevllqfledqntfpnfehlaywqiqfnniaavtvffvwiklf kfinfnrtmsqlsttmsrcakdlfgfaimffiffl
fvffmffillnmflaiindtysevksdlaqqkaemelsdlirkgyhkalvklklld ntvddiseslrqgggklnfdelrqdlkg kghtdaeieaiftkydqdgdqeltehehqqmrddlekeredldldhsslprpmssrsfprslddseedddedsghssrrrgsi s sgv s yeef qvlvrrvdrmehsig siv skidavivkleimeraklkrrevlgrlldgv aederlgrdseihreqmerlvreele rwesddaasqishglgtpvglngqprprssrpsssqstegmegaggngssnvhv* (SEQ ID NO: 2)
DNA sequence of P2Y12/PKD1-3 that traffics the PKD1/PKD2 complex to the plasma membrane (HA-tag in capital letters, P2Y12 N-terminus, underlined)
atgTACCCATACGATGTTCCAGATTACGCTcaagccgtcgacaacctcacctctgcgcctggtaacac cagtctgtgcaccagagactacaaaatcacccagaccgccttcggcgccagcctcttcgtgcccccaagccatgtccgctttgt gtttcctgagccgacagcggatgtaaactacatcgtcatgctgacatgtgctgtgtgcctggtgacctacatggtcatggccgcc atcctgcacaagctggaccagttggatgccagccggggccgcgccatccctttctgtgggcagcggggccgcttcaagtacg agatcctcgtcaagacaggctggggccggggctcaggtaccacggcccacgtgggcatcatgctgtatggggtggacagcc ggagcggccaccggcacctggacggcgacagagccttccaccgcaacagcctggacatcttccggatcgccaccccgcac agcctgggtagcgtgtggaagatccgagtgtggcacgacaacaaagggctcagccctgcctggttcctgcagcacgtcatcgt cagggacctgcagacggcacgcagcgccttcttcctggtcaatgactggctttcggtggagacggaggccaacgggggcctg gtggagaaggaggtgctggccgcgagcgacgcagcccttttgcgcttccggcgcctgctggtggctgagctgcagcgtggct tctttgacaagcacatctggctctccatatgggaccggccgcctcgtagccgtttcactcgcatccagagggccacctgctgcgt tctcctcatctgcctcttcctgggcgccaacgccgtgtggtacggggctgttggcgactctgcctacagcacggggcatgtgtcc aggctgagcccgctgagcgtcgacacagtcgctgttggcctggtgtccagcgtggttgtctatcccgtctacctggccatcctttt tctcttccggatgtcccggagcaaggtggctgggagcccgagccccacacctgccgggcagcaggtgctggacatcgacag ctgcctggactcgtccgtgctggacagctccttcctcacgttctcaggcctccacgctgagcaggcctttgttggacagatgaag agtgacttgtttctggatgattctaagagtctggtgtgctggccctccggcgagggaacgctcagttggccggacctgctcagtg acccgtccattgtgggtagcaatctgcggcagctggcacggggccaggcgggccatgggctgggcccagaggaggacggc ttctccctggccagcccctactcgcctgccaaatccttctcagcatcagatgaagacctgatccagcaggtccttgccgagggg gtcagcagcccagcccctacccaagacacccacatggaaacggacctgctcagcagcctgtccagcactcctggggagaag acagagacgctggcgctgcagaggctgggggagctggggccacccagcccaggcctgaactgggaacagccccaggcag cgaggctgtccaggacaggactggtggagggtctgcggaagcgcctgctgccggcctggtgtgcctccctggcccacgggc tcagcctgctcctggtggctgtggctgtggctgtctcagggtgggtgggtgcgagcttccccccgggcgtgagtgttgcgtggc tcctgtccagcagcgccagcttcctggcctcattcctcggctgggagccactgaaggtcttgctggaagccctgtacttctcactg gtggccaagcggctgcacccggatgaagatgacaccctggtagagagcccggctgtgacgcctgtgagcgcacgtgtgccc cgcgtacggccaccccacggctttgcactcttcctggccaaggaagaagcccgcaaggtcaagaggctacatggcatgctgc ggagcctcctggtgtacatgctttttctgctggtgaccctgctggccagctatggggatgcctcatgccatgggcacgcctaccgt ctgcaaagcgccatcaagcaggagctgcacagccgggccttcctggccatcacgcggtctgaggagctctggccatggatgg cccacgtgctgctgccctacgtccacgggaaccagtccagcccagagctggggcccccacggctgcggcaggtgcggctgc aggaagcactctacccagaccctcccggccccagggtccacacgtgctcggccgcaggaggcttcagcaccagcgattacg acgttggctgggagagtcctcacaatggctcggggacgtgggcctattcagcgccggatctgctgggggcatggtcctgggg ctcctgtgccgtgtatgacagcgggggctacgtgcaggagctgggcctgagcctggaggagagccgcgaccggctgcgctt
cctgcagctgcacaactggctggacaacaggagccgcgctgtgttcctggagctcacgcgctacagcccggccgtggggctg cacgccgccgtcacgctgcgcctcgagttcccggcggccggccgcgccctggccgccctcagcgtccgcccctttgcgctgc gccgcctcagcgcgggcctctcgctgcctctgctcacctcggtgtgcctgctgctgttcgccgtgcacttcgccgtggccgagg cccgtacttggcacagggaagggcgctggcgcgtgctgcggctcggagcctgggcgcggtggctgctggtggcgctgacg gcggccacggcactggtacgcctcgcccagctgggtgccgctgaccgccagtggacccgtttcgtgcgcggccgcccgcgc cgcttcactagcttcgaccaggtggcgcagctgagctccgcagcccgtggcctggcggcctcgctgctcttcctgcttttggtca aggctgcccagcagctacgcttcgtgcgccagtggtccgtctttggcaagacattatgccgagctctgccagagctcctggggg tcaccttgggcctggtggtgctcggggtagcctacgcccagctggccatcctgctcgtgtcttcctgtgtggactccctctggag cgtggcccaggccctgttggtgctgtgccctgggactgggctctctaccctgtgtcctgccgagtcctggcacctgtcacccctg ctgtgtgtggggctctgggcactgcggctgtggggcgccctacggctgggggctgttattctccgctggcgctaccacgccttg cgtggagagctgtaccggccggcctgggagccccaggactacgagatggtggagttgttcctgcgcaggctgcgcctctgga tgggcctcagcaaggtcaaggagttccgccacaaagtccgctttgaagggatggagccgctgccctctcgctcctccaggggc tccaaggtatccccggatgtgcccccacccagcgctggctccgatgcctcgcacccctccacctcctccagccagctggatgg gctgagcgtgagcctgggccggctggggacaaggtgtgagcctgagccctcccgcctccaagccgtgttcgaggccctgctc acccagtttgaccgactcaaccaggccacagaggacgtctaccagctggagcagcagctgcacagcctgcaaggccgcagg agcagccgggcgcccgccggatcttcccgtggcccatccccgggcctgcggccagcactgcccagccgccttgcccgggc cagtcggggtgtggacctggccactggccccagcaggacaccccttcgggccaagaacaaggtccaccccagcagcactta g (SEQ ID NO: 3) Protein sequence of P2Y12/PKD1-3 that traffics the PKD1/PKD2 complex to the plasma membrane (HA-tag +P2Y12 N-terminus, underlined)
MYPYDVPDYAQAVDNLTSAPGNTSLCTRDYKITQTAFGASLFVPPSHVRFVFPE
PTADVNYIVMLTCAVCLVTYMVMAAILHKLDQLDASRGRAIPFCGQRGRFKYEI
LVKTGWGRGSGTTAHVGIMLYGVDSRSGHRHLDGDRAFHRNSLDIFRIATPHSL GS VWKIR VWHDNKGLS P A WFLQH VIVRDLQT ARS AFFLVND WLS VETE ANGGL VEKE VLA AS D A ALLRFRRLLV AELQRGFFD KFHWLS rWDRPPRS RFTRIQR ATCC VLLICLFLG AN A VW YG A VGDS A YS TGH VS RLS PLS VDT V A VGLVS S V V V YP VY LAILFLFRMSRSKVAGSPSPTPAGQQVLDIDSCLDSSVLDSSFLTFSGLHAEQAFV GQMKSDLFLDDSKSLVCWPSGEGTLSWPDLLSDPSIVGSNLRQLARGQAGHGL GPEEDGFS LAS P YS P AKS FS AS DEDLIQQ VLAEG VS S P APTQDTHMETDLLS S LS S TPGEKTETLALQRLGELGPPSPGLNWEQPQAARLSRTGLVEGLRKRLLPAWCAS LAHGLS LLLV A V A V A VS GW VG AS FPPG VS V A WLLS S S AS FLAS FLG WEPLK VLL
EALYFSLVAKRLHPDEDDTLVESPAVTPVSARVPRVRPPHGFALFLAKEEARKV KRLHGMLRS LLV YMLFLLVTLLAS YGD AS CHGH A YRLQS AIKQELHS RAFLAIT RS EELWPWM AH VLLP Y VHGNQS S PELGPPRLRQ VRLQE ALYPDPPGPRVHTCS A AGGFSTSDYDVGWESPHNGSGTWAYSAPDLLGAWSWGSCAVYDSGGYVQELG LS LEES RDRLRFLQLHNWLDNRS R A VFLELTR YS P A VGLH A A VTLRLEFP A AGR ALAALSVRPFALRRLSAGLSLPLLTSVCLLLFAVHFAVAEARTWHREGRWRVLR LGAWARWLLVALTAATALVRLAQLGAADRQWTRFVRGRPRRFTSFDQVAQLS S A ARGLA AS LLFLLLVKA AQQLRFVRQWS VFGKTLCR ALPELLG VTLGLV VLG VAYAQLAILLVSSCVDSLWSVAQALLVLCPGTGLSTLCPAESWHLSPLLCVGLW ALRLWGALRLGAVILRWRYHALRGELYRPAWEPQDYEMVELFLRRLRLWMGL S KVKEFRHKVRFEGMEPLPS RS S RGS KVSPD VPPPS AGS DAS HPS TS S S QLDGLS V SLGRLGTRCEPEPSRLQAVFEALLTQFDRLNQATEDVYQLEQQLHSLQGRRSSR AP AGS S RGPS PGLRP ALPS RLARAS RG VDLATGPS RTPLR AKNKVHPS S T . (SEQ ID NO: 4)
DNA sequence of P2Y12/PKD1-4 that targets the PKD1/PKD2 complex to the plasma membrane (HA-tag in capital letters, P2Y12 N-terminus underlined)
atgTACCCATACGATGTTCCAGATTACGCTcaagccgtcgacaacctcacctctgcgcctggtaacac cagtctgtgcaccagagactacaaaatcacccaggtccgctttgtgtttcctgagccgacagcggatgtaaactacatcgtcatg ctgacatgtgctgtgtgcctggtgacctacatggtcatggccgccatcctgcacaagctggaccagttggatgccagccggggc cgcgccatccctttctgtgggcagcggggccgcttcaagtacgagatcctcgtcaagacaggctggggccggggctcaggta ccacggcccacgtgggcatcatgctgtatggggtggacagccggagcggccaccggcacctggacggcgacagagccttc caccgcaacagcctggacatcttccggatcgccaccccgcacagcctgggtagcgtgtggaagatccgagtgtggcacgaca acaaagggctcagccctgcctggttcctgcagcacgtcatcgtcagggacctgcagacggcacgcagcgccttcttcctggtc aatgactggctttcggtggagacggaggccaacgggggcctggtggagaaggaggtgctggccgcgagcgacgcagccct tttgcgcttccggcgcctgctggtggctgagctgcagcgtggcttctttgacaagcacatctggctctccatatgggaccggccg cctcgtagccgtttcactcgcatccagagggccacctgctgcgttctcctcatctgcctcttcctgggcgccaacgccgtgtggta cggggctgttggcgactctgcctacagcacggggcatgtgtccaggctgagcccgctgagcgtcgacacagtcgctgttggc ctggtgtccagcgtggttgtctatcccgtctacctggccatcctttttctcttccggatgtcccggagcaaggtggctgggagccc gagccccacacctgccgggcagcaggtgctggacatcgacagctgcctggactcgtccgtgctggacagctccttcctcacgt tctcaggcctccacgctgagcaggcctttgttggacagatgaagagtgacttgtttctggatgattctaagagtctggtgtgctggc cctccggcgagggaacgctcagttggccggacctgctcagtgacccgtccattgtgggtagcaatctgcggcagctggcacg gggccaggcgggccatgggctgggcccagaggaggacggcttctccctggccagcccctactcgcctgccaaatccttctca
gcatcagatgaagacctgatccagcaggtccttgccgagggggtcagcagcccagcccctacccaagacacccacatggaa acggacctgctcagcagcctgtccagcactcctggggagaagacagagacgctggcgctgcagaggctgggggagctggg gccacccagcccaggcctgaactgggaacagccccaggcagcgaggctgtccaggacaggactggtggagggtctgcgg aagcgcctgctgccggcctggtgtgcctccctggcccacgggctcagcctgctcctggtggctgtggctgtggctgtctcagg gtgggtgggtgcgagcttccccccgggcgtgagtgttgcgtggctcctgtccagcagcgccagcttcctggcctcattcctcgg ctgggagccactgaaggtcttgctggaagccctgtacttctcactggtggccaagcggctgcacccggatgaagatgacaccc tggtagagagcccggctgtgacgcctgtgagcgcacgtgtgccccgcgtacggccaccccacggctttgcactcttcctggcc aaggaagaagcccgcaaggtcaagaggctacatggcatgctgcggagcctcctggtgtacatgctttttctgctggtgaccctg ctggccagctatggggatgcctcatgccatgggcacgcctaccgtctgcaaagcgccatcaagcaggagctgcacagccgg gccttcctggccatcacgcggtctgaggagctctggccatggatggcccacgtgctgctgccctacgtccacgggaaccagtc cagcccagagctggggcccccacggctgcggcaggtgcggctgcaggaagcactctacccagaccctcccggccccagg gtccacacgtgctcggccgcaggaggcttcagcaccagcgattacgacgttggctgggagagtcctcacaatggctcgggga cgtgggcctattcagcgccggatctgctgggggcatggtcctggggctcctgtgccgtgtatgacagcgggggctacgtgcag gagctgggcctgagcctggaggagagccgcgaccggctgcgcttcctgcagctgcacaactggctggacaacaggagccg cgctgtgttcctggagctcacgcgctacagcccggccgtggggctgcacgccgccgtcacgctgcgcctcgagttcccggcg gccggccgcgccctggccgccctcagcgtccgcccctttgcgctgcgccgcctcagcgcgggcctctcgctgcctctgctca cctcggtgtgcctgctgctgttcgccgtgcacttcgccgtggccgaggcccgtacttggcacagggaagggcgctggcgcgtg ctgcggctcggagcctgggcgcggtggctgctggtggcgctgacggcggccacggcactggtacgcctcgcccagctgggt gccgctgaccgccagtggacccgtttcgtgcgcggccgcccgcgccgcttcactagcttcgaccaggtggcgcagctgagct ccgcagcccgtggcctggcggcctcgctgctcttcctgcttttggtcaaggctgcccagcagctacgcttcgtgcgccagtggt ccgtctttggcaagacattatgccgagctctgccagagctcctgggggtcaccttgggcctggtggtgctcggggtagcctacg cccagctggccatcctgctcgtgtcttcctgtgtggactccctctggagcgtggcccaggccctgttggtgctgtgccctgggac tgggctctctaccctgtgtcctgccgagtcctggcacctgtcacccctgctgtgtgtggggctctgggcactgcggctgtggggc gccctacggctgggggctgttattctccgctggcgctaccacgccttgcgtggagagctgtaccggccggcctgggagcccca ggactacgagatggtggagttgttcctgcgcaggctgcgcctctggatgggcctcagcaaggtcaaggagttccgccacaaag tccgctttgaagggatggagccgctgccctctcgctcctccaggggctccaaggtatccccggatgtgcccccacccagcgct ggctccgatgcctcgcacccctccacctcctccagccagctggatgggctgagcgtgagcctgggccggctggggacaaggt gtgagcctgagccctcccgcctccaagccgtgttcgaggccctgctcacccagtttgaccgactcaaccaggccacagagga cgtctaccagctggagcagcagctgcacagcctgcaaggccgcaggagcagccgggcgcccgccggatcttcccgtggcc catccccgggcctgcggccagcactgcccagccgccttgcccgggccagtcggggtgtggacctggccactggccccagca ggacaccccttcgggccaagaacaaggtccaccccagcagcacttag (SEQ ID NO: 5)
Protein sequence of P2Y12/PKD1-4 that targets the PKD1/PKD2 complex to the plasma membrane (HA-tag +P2Y12 N-terminus, underlined)
MYPYDVPDYAQAVDNLTSAPGNTSLCTRDYKITQVRFVFPEPTADVNYIVMLTC AVCLVTYMVMAAILHKLDQLDASRGRAIPFCGQRGRFKYEILVKTGWGRGSGT TAHVGIMLYGVDSRSGHRHLDGDRAFHRNSLDIFRIATPHSLGSVWKIRVWHDN KGLS P A WFLQH VIVRDLQT ARS AFFLVND WLS VETE ANGGLVEKE VLA AS DA A LLRFRRLLVAELQRGFFDKHIWLSIWDRPPRSRFTRIQRATCCVLLICLFLGANAV W YG A VGDS A YS TGH VS RLS PLS VDT V A VGLVS S V V V YP V YLAILFLFRMS RS KV AGSPSPTPAGQQVLDIDSCLDSSVLDSSFLTFSGLHAEQAFVGQMKSDLFLDDSK S LVC WPS GEGTLS WPDLLS DPS IVGS NLRQLARGQ AGHGLGPEEDGFS LAS P YS P AKS FS AS DEDLIQQ VLAEG VS S P APTQDTHMETDLLS S LS S TPGEKTETLALQRL GELGPPSPGLNWEQPQAARLSRTGLVEGLRKRLLPAWCASLAHGLSLLLVAVA V A VS GW VG AS FPPG VS V A WLLS S S AS FLAS FLGWEPLKVLLE ALYFS LV AKRLH PDEDDTLVESPAVTPVSARVPRVRPPHGFALFLAKEEARKVKRLHGMLRSLLVY MLFLLVTLLAS YGD AS CHGH A YRLQS AIKQELHS RAFLAITRS EELWPWM AH VL LP Y VHGNQS S PELGPPRLRQ VRLQE ALYPDPPGPRVHTCS A AGGFS TS D YD VGW ESPHNGSGTWAYSAPDLLGAWSWGSCAVYDSGGYVQELGLSLEESRDRLRFLQ LHNWLDNRS R A VFLELTRYS P A VGLH A A VTLRLEFP A AGRALA ALS VRPF ALRR LSAGLSLPLLTSVCLLLFAVHFAVAEARTWHREGRWRVLRLGAWARWLLVALT A AT ALVRLAQLG A ADRQWTRF VRGRPRRFTS FDQ V AQLS S A ARGLA AS LLFLL LVKAAQQLRFVRQWSVFGKTLCRALPELLGVTLGLVVLGVAYAQLAILLVSSC VDSLWSVAQALLVLCPGTGLSTLCPAESWHLSPLLCVGLWALRLWGALRLGAV ILRWRYHALRGELYRPAWEPQDYEMVELFLRRLRLWMGLSKVKEFRHKVRFE GMEPLPS RS S RGS KVSPD VPPPS AGS DAS HPSTS S S QLD GLS VS LGRLGTRCEPEP S RLQ A VFE ALLTQFDRLNQ ATED V YQLEQQLHS LQGRRS S RAP AGS S RGPS PGL RP ALPS RLARAS RG VDLATGPS RTPLR AKNKVHPS S T . (SEQ ID NO: 6)
DNA sequence of PKD1 truncation that traffics the PKD1/PKD2 complex to the plasma membrane
atgaagcggctgcacccggatgaagatgacaccctggtagagagcccggctgtgacgcctgtgagcgcacgtgtgccccgc gtacggccaccccacggctttgcactcttcctggccaaggaagaagcccgcaaggtcaagaggctacatggcatgctgcgga gcctcctggtgtacatgctttttctgctggtgaccctgctggccagctatggggatgcctcatgccatgggcacgcctaccgtctg
caaagcgccatcaagcaggagctgcacagccgggccttcctggccatcacgcggtctgaggagctctggccatggatggcc cacgtgctgctgccctacgtccacgggaaccagtccagcccagagctggggcccccacggctgcggcaggtgcggctgca ggaagcactctacccagaccctcccggccccagggtccacacgtgctcggccgcaggaggcttcagcaccagcgattacga cgttggctgggagagtcctcacaatggctcggggacgtgggcctattcagcgccggatctgctgggggcatggtcctggggct cctgtgccgtgtatgacagcgggggctacgtgcaggagctgggcctgagcctggaggagagccgcgaccggctgcgcttcc tgcagctgcacaactggctggacaacaggagccgcgctgtgttcctggagctcacgcgctacagcccggccgtggggctgca cgccgccgtcacgctgcgcctcgagttcccggcggccggccgcgccctggccgccctcagcgtccgcccctttgcgctgcg ccgcctcagcgcgggcctctcgctgcctctgctcacctcggtgtgcctgctgctgttcgccgtgcacttcgccgtggccgaggc ccgtacttggcacagggaagggcgctggcgcgtgctgcggctcggagcctgggcgcggtggctgctggtggcgctgacgg cggccacggcactggtacgcctcgcccagctgggtgccgctgaccgccagtggacccgtttcgtgcgcggccgcccgcgcc gcttcactagcttcgaccaggtggcgcagctgagctccgcagcccgtggcctggcggcctcgctgctcttcctgcttttggtcaa ggctgcccagcagctacgcttcgtgcgccagtggtccgtctttggcaagacattatgccgagctctgccagagctcctgggggt caccttgggcctggtggtgctcggggtagcctacgcccagctggccatcctgctcgtgtcttcctgtgtggactccctctggagc gtggcccaggccctgttggtgctgtgccctgggactgggctctctaccctgtgtcctgccgagtcctggcacctgtcacccctgc tgtgtgtggggctctgggcactgcggctgtggggcgccctacggctgggggctgttattctccgctggcgctaccacgccttgc gtggagagctgtaccggccggcctgggagccccaggactacgagatggtggagttgttcctgcgcaggctgcgcctctggat gggcctcagcaaggtcaaggagttccgccacaaagtccgctttgaagggatggagccgctgccctctcgctcctccaggggct ccaaggtatccccggatgtgcccccacccagcgctggctccgatgcctcgcacccctccacctcctccagccagctggatggg ctgagcgtgagcctgggccggctggggacaaggtgtgagcctgagccctcccgcctccaagccgtgttcgaggccctgctca cccagtttgaccgactcaaccaggccacagaggacgtctaccagctggagcagcagctgcacagcctgcaaggccgcagga gcagccgggcgcccgccggatcttcccgtggcccatccccgggcctgcggccagcactgcccagccgccttgcccgggcc agtcggggtgtggacctggccactggccccagcaggacaccccttcgggccaagaacaaggtccaccccagcagcacttag (SEQ ID NO: 7) Protein sequence of a PKD1 truncation that traffics the PKD1/PKD2 complex to the plasma membrane
mlfl-lhpdeddtlvespavtpvsarvprvrpphgfalflakeearkv]fl"lhgmlrsllvymlfllvtllasygdaschghayrl qsaikqelhsraflaitrseelwpwmahvllpyvhgnqsspelgpprlrqvrlqealypdppgprvhtcsaaggfstsdydv gwesphngsgtwaysapdllgawswgscavydsggyvqelglsleesrdrlrflqlhnwldnrsravfleltryspavglh aavtlrlefpaagralaalsvrpfal saglslplltsvclllfavhfavaeartwhregrwrvlrlgawarwllvaltaatalvrl aqlgaadrqwtrfvrgrprrftsfdqvaqlssaarglaasllflllvkaaqqlrfvrqwsvfgktlcralpellgvtlglvvlgvay aqlaillvsscvdslwsvaqallvlcpgtglstlcpaeswhlspllcvglwalrlwgalrlgavilrwryhalrgelyrpawepq
dyemvelflrrlrlwmglskvkefrhkvrfegmeplpsrssrgskvspdvpppsagsdashpstsssqldglsvslgrlgtrc epep srlqavf ealltqfdrlnqatedvyqleqqlhslqgrr s srap ag s srgp spglrp alp srlarasrg vdlatgp srtplrak nkvhpsst* (SEQ ID NO: 8) HA-tag in capital letters, P2Y12 N-terminus
atgTACCCATACGATGTTCCAGATTACGCTcaagccgtcgacaacctcacctctgcgcctggtaacac cagtctgtgcaccagagactacaaaatcacccag (SEQ ID NO: 9)
HA-tag + P2Y12 N-terminus
MYPYDVPDYAQAVDNLTSAPGNTSLCTRDYKITQ (SEQ ID NO: 10) hPKD2 protein sequence without FLAG seq
mvnssrvqpqqpgdakrppaprapdpgrlmagcaavgaslaapgglceqrgleiemqrirqaaardppagaaaspsppl sscsrqawsrdnpgfeaeeeeeevegeeggmvvemdvewrpgsrrsaassavssvgarsrglggyhgaghpsgrrrrre dqgppcpspvgggdplhrhlplegqpprvawaerlvrglrglwgtrlmeesstnrekylksvlrelvtyllflivlciltygm mssnvyyytrmmsqlfldtpvsktektnfktlssmedfwkftegslldglywkmqpsnqtsfifyenlllgvprirqlrvrn gscsipqdlrdeikecydvysvssedrapfgpmgtawiytsekdlngsshwgiiatysgagyyldlsrtreetaaqvaslkk nvwldrgtratfidfsvynaninlfcvvrllvefpatggvipswqfqplklk^
lhyfrsfwncldvvivvlsvvaiginiyrtsnvevllqfledqntfpnfehlaywqiqfnniaavtvffvwiklfkfinfnrtm qlsttmsrcakdlfgfaimffiiflayaqlaylvfgtqvddfstfqeciftqfriilgdinfaeieeanrvlgpiyfttfvffm mflaiindtysevksdlaqqkaemelsdlirkgyhkalvklklld ntvddiseslrqgggklnfdelrqdlkgkghtdaeiea iftkydqdgdqeltehehqqmrddlekeredldldhsslprpmssrsfprslddseedddedsghssrrrgsissgvsyeef qvlvrrvdrmehsigsivskidavivkleimerakltoevlgrlldgvaederlgrdseihreqmerlvreelem sqishglgtpvglngqprprssrpsssqstegmegaggngssnvhv* (SEQ ID NO: 11) pTRE3G-Bi vector DNA sequence (Takara-Bioscience, Inc)
agcgatctgacggttcactaaacgagctctgcttatataggcctcccaccgtacacgccacctcgacatactcgagtttactccct atcagtgatagagaacgtatgaagagtttactccctatcagtgatagagaacgtatgcagactttactccctatcagtgatagaga acgtataaggagtttactccctatcagtgatagagaacgtatgaccagtttactccctatcagtgatagagaacgtatctacagttta ctccctatcagtgatagagaacgtatatccagtttactccctatcagtgatagagaacgtataagctttaggcgtgtacggtgggc gcctataaaagcagagctcgtttagtgaaccgtcagatcgcctggagcaattccacaacacttttgtcttataccaactttccgtac cacttcctaccctcgtaaagtcgacaccggggcccagatctccgcggggatccatcgatccgcggccgccggcgatatctcca
gaggatcataatcagccataccacatttgtagaggttttacttgctttaaaaaacctcccacacctccccctgaacctgaaacataa aatgaatgcaattgttgttgttaacttgtttattgcagcttataatggttacaaataaagcaatagcatcacaaatttcacaaataaagc atttttttcactgccccgagcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaa ggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccagga accgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcaga ggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgc cgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcaatgctcacgctgtaggtatctcagttcggtgta ggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgag tccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtg ctacagagttcttgaagtggtggcctaactacggctacactagaaggacagtatttggtatctgcgctctgctgaagccagttacc ttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattac gcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaaggg attttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagt aaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactc cccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcacc ggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatcc agtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgt ggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaa aaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgc ataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcgg cgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaac gttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttca gcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacg gaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtat ttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgtcggcagtgaaaaaaatgctttattt gtgaaatttgtgatgctattgctttatttgtaaccattataagctgcaataaacaagttaacaacaacaattgcattcattttatgtttcag gttcagggggaggtgtgggaggttttttaaagcaagtaaaacctctacaaatgtggtatggctgattatgatcctctagacatatgc tgcagacgcgtggtacccccggggaattctccag (SEQ ID NO: 12). DNA sequence of pEGFP backbone vector with ires mCherry
tagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccg cctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccatt
gacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtacgccccctattgac gtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttatgggactttcctacttggcagtacatctacgtatta gtcatcgctattaccatggtgatgcggttttggcagtacatcaatgggcgtggatagcggtttgactcacggggatttccaagtctc caccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaacaactccgccccattgac gcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctggtttagtgaaccgtcagatccgctagcgctacc ggactcagatctcgagctcaagcttcgaattctgcagtcgacggtaccgcggcgctacgtaaattccgccccccccccccctaa cgttactggccgaagccgcttggaataaggccggtgtgcgtttgtctatatgttattttccaccatattgccgtcttttggcaatgtga gggcccggaaacctggccctgtcttcttgacgagcattcctaggggtctttcccctcycgccaaaggaatgcaaggtctgttgaa tgtcgtgaaggaagcagttcctctggaagcttcttgaagacaaacaacgtctgtagcgaccctttgcaggcagcggaacccccc acctggcgacaggtgcctctgcggccaaaagccacgtgtatmagatacacctgcaaaggcggcacaaccccagtgccacgt tgtgagttggatagttgtggaaagagtcaaatggctctcctcaagcgtattcaacaaggggctgaaggatgcccagaaggtacc ccattgtatgggatctgatctggggcctcgrtrcacatgctttacatgtgtttagtcgaggttaaaaaaacgtctaggccccccgaa ccacggggacgtggttttcctttgaaaaacacgatgataatatggccamaammawratggtgagcaagggcgaggaggat aacatggccatcatcaaggagttcatgcgcttcaaggtgcacatggagggctccgtgaacggccacgagttcgagatcgagg gcgagggcgagggccgcccctacgagggcacccagaccgccaagctgaaggtgaccaagggtggccccctgcccttcgc ctgggacatcctgtcccctcagttcatgtacggctccaaggcctacgtgaagcaccccgccgacatccccgactacttgaagct gtccttccccgagggcttcaagtgggagcgcgtgatgaacttcgaggacggcggcgtggtgaccgtgacccaggactcctcc ctgcaggacggcgagttcatctacaaggtgaagctgcgcggcaccaacttcccctccgacggccccgtaatgcagaagaaga ccatgggctgggaggcctcctccgagcggatgtaccccgaggacggcgccctgaagggcgagatcaagcagaggctgaag ctgaaggacggcggccactacgacgctgaggtcaagaccacctacaaggccaagaagcccgtgcagctgcccggcgccta caacgtcaacatcaagttggacatcacctcccacaacgaggactacaccatcgtggaacagtacgaacgcgccgagggccgc cactccaccggcggcatggacgagctgtacaagtaagcggccgcgactctagatcataatcagccataccacatttgtagaggt tttacttgctttaaaaaacctcccacacctccccctgaacctgaaacataaaatgaatgcaattgttgttgttaacttgtttattgcagc ttataatggttacaaataaagcaatagcatcacaaatttcacaaataaagcatttttttcactgcattctagttgtggtttgtccaaactc atcaatgtatcttaaggcgtaaattgtaagcgttaatattttgttaaaattcgcgttaaatttttgttaaatcagctcattttttaaccaata ggccgaaatcggcaaaatcccttataaatcaaaagaatagaccgagatagggttgagtgttgttccagtttggaacaagagtcca ctattaaagaacgtggactccaacgtcaaagggcgaaaaaccgtctatcagggcgatggcccactacgtgaaccatcacccta atcaagttttttggggtcgaggtgccgtaaagcactaaatcggaaccctaaagggagcccccgatttagagcttgacggggaaa gccggcgaacgtggcgagaaaggaagggaagaaagcgaaaggagcgggcgctagggcgctggcaagtgtagcggtcac gctgcgcgtaaccaccacacccgccgcgcttaatgcgccgctacagggcgcgtcaggtggcacttttcggggaaatgtgcgc ggaacccctatttgtttatttttctaaatacattcaaatatgtatccgctcatgagacaataaccctgataaatgcttcaataatattgaa aaaggaagagtcctgaggcggaaagaaccagctgtggaatgtgtgtcagttagggtgtggaaagtccccaggctccccagca
ggcagaagtatgcaaagcatgcatctcaattagtcagcaaccaggtgtggaaagtccccaggctccccagcaggcagaagtat gcaaagcatgcatctcaattagtcagcaaccatagtcccgcccctaactccgcccatcccgcccctaactccgcccagttccgc ccattctccgccccatggctgactaattttttttatttatgcagaggccgaggccgcctcggcctctgagctattccagaagtagtg aggaggcttttttggaggcctaggcttttgcaaagatcgatcaagagacaggatgaggatcgtttcgcatgattgaacaagatgg attgcacgcaggttctccggccgcttgggtggagaggctattcggctatgactgggcacaacagacaatcggctgctctgatgc cgccgtgttccggctgtcagcgcaggggcgcccggttctttttgtcaagaccgacctgtccggtgccctgaatgaactgcaaga cgaggcagcgcggctatcgtggctggccacgacgggcgttccttgcgcagctgtgctcgacgttgtcactgaagcgggaagg gactggctgctattgggcgaagtgccggggcaggatctcctgtcatctcaccttgctcctgccgagaaagtatccatcatggctg atgcaatgcggcggctgcatacgcttgatccggctacctgcccattcgaccaccaagcgaaacatcgcatcgagcgagcacgt actcggatggaagccggtcttgtcgatcaggatgatctggacgaagagcatcaggggctcgcgccagccgaactgttcgcca ggctcaaggcgagcatgcccgacggcgaggatctcgtcgtgacccatggcgatgcctgcttgccgaatatcatggtggaaaat ggccgcttttctggattcatcgactgtggccggctgggtgtggcggaccgctatcaggacatagcgttggctacccgtgatattg ctgaagagcttggcggcgaatgggctgaccgcttcctcgtgctttacggtatcgccgctcccgattcgcagcgcatcgccttcta tcgccttcttgacgagttcttctgagcgggactctggggttcgaaatgaccgaccaagcgacgcccaacctgccatcacgagatt tcgattccaccgccgccttctatgaaaggttgggcttcggaatcgttttccgggacgccggctggatgatcctccagcgcgggg atctcatgctggagttcttcgcccaccctagggggaggctaactgaaacacggaaggagacaataccggaaggaacccgcgc tatgacggcaataaaaagacagaataaaacgcacggtgttgggtcgtttgttcataaacgcggggttcggtcccagggctggca ctctgtcgataccccaccgagaccccattggggccaatacgcccgcgtttcttccttttccccaccccaccccccaagttcgggt gaaggcccagggctcgcagccaacgtcggggcggcaggccctgccatagcctcaggttactcatatatactttagattgattta aaacttcatttttaatttaaaaggatctaggtgaagatcctttttgataatctcatgaccaaaatcccttaacgtgagttttcgttccact gagcgtcagaccccgtagaaaagatcaaaggatcttcttgagatcctttttttctgcgcgtaatctgctgcttgcaaacaaaaaaac caccgctaccagcggtggtttgtttgccggatcaagagctaccaactctttttccgaaggtaactggcttcagcagagcgcagat accaaatactgtccttctagtgtagccgtagttaggccaccacttcaagaactctgtagcaccgcctacatacctcgctctgctaat cctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccgggttggactcaagacgatagttaccggataaggcgca gcggtcgggctgaacggggggttcgtgcacacagcccagcttggagcgaacgacctacaccgaactgagatacctacagcg tgagctatgagaaagcgccacgcttcccgaagggagaaaggcggacaggtatccggtaagcggcagggtcggaacaggag agcgcacgagggagcttccagggggaaacgcctggtatctttatagtcctgtcgggtttcgccacctctgacttgagcgtcgattt ttgtgatgctcgtcaggggggcggagcctatggaaaaacgccagcaacgcggcctttttacggttcctggccttttgctggccttt tgctcacatgttctttcctgcgttatcccctgattctgtggataaccgtattaccgccatgcat (SEQ ID NO: 13)
DNA sequence of PKD1 extracellular fragment (domains PKDI-PKDX). DNA sequence was cloned into expression vector pPIC9 (Life Technologies) for expression and purification in Pichia Pastoris. His tag used for purification is underlined.
gccacacgctgggacttcggagacggctccgccgaggtggatgccgctgggccggctgcctcgcatcgctatgtg ctgcctgggcgctatcacgtgacggccgtgctggccctgggggccggctcagccctgctggggacagacgtgcaggtggaa gcggcacctgccgccctggagctcgtgtgcccgtcctcggtgcagagtgacgagagccttgacctcagcatccagaaccgcg gtggttcaggcctggaggccgcctacagcatcgtggccctgggcgaggagccggcccgagcggtgcacccgctctgcccct cggacacggagatcttccctggcaacgggcactgctaccgcctggtggtggagaaggcggcctggctgcaggcgcaggag cagtgtcaggcctgggccggggccgccctggcaatggtggacagtcccgccgtgcagcgcttcctggtctcccgggtcacca ggagcctagacgtgtggatcggcttctcgactgtgcagggggtggaggtgggcccagcgccgcagggcgaggccttcagcc tggagagctgccagaactggctgcccggggagccacacccagccacagccgagcactgcgtccggctcgggcccaccgg gtggtgtaacaccgacctgtgctcagcgccgcacagctacgtctgcgagctgcagcccggaggcccagtgcaggatgccga gaacctcctcgtgggagcgcccagtggggacctgcagggacccctgacgcctctggcacagcaggacggcctctcagcccc gcacgagcccgtggaggtcatggtattcccgggcctgcgtctgagccgtgaagccttcctcaccacggccgaatttgggaccc aggagctccggcggcccgcccagctgcggctgcaggtgtaccggctcctcagcacagcagggaccccggagaacggcag cgagcctgagagcaggtccccggacaacaggacccagctggcccccgcgtgcatgccagggggacgctggtgccctgga gccaacatctgcttgccgctggacgcctcctgccacccccaggcctgcgccaatggctgcacgtcagggccagggctacccg gggccccctatgcgctatggagagagttcctcttctccgttcccgcggggccccccgcgcagtactcggtcaccctccacggc caggatgtcctcatgctccctggtgacctcgttggcttgcagcacgacgctggccctggcgccctcctgcactgctcgccggct cccggccaccctggtccccaggccccgtacctctccgccaacgcctcgtcatggctgccccacttgccagcccagctggagg gcacttgggcctgccctgcctgtgccctgcggctgcttgcagccacggaacagctcaccgtgctgctgggcttgaggcccaac cctggactgcggctgcctgggcgctatgaggtccgggcagaggtgggcaatggcgtgtccaggcacaacctctcctgcagct ttgacgtggtctccccagtggctgggctgcgggtcatctaccctgccccccgcgacggccgcctctacgtgcccaccaacggc tcagccttggtgctccaggtggactctggtgccaacgccacggccacggctcgctggcctgggggcagtgtcagcgcccgctt tgagaatgtctgccctgccctggtggccaccttcgtgcccggctgcccctgggagaccaacgataccctgttctcagtggtagc actgccgtggctcagtgagggggagcacgtggtggacgtggtggtggaaaacagcgccagccgggccaacctcagcctgc gggtgacggcggaggagcccatctgtggcctccgcgccacgcccagccccgaggcccgtgtactgcagggagtcctagtga ggtacagccccgtggtggaggccggctcggacatggtcttccggtggaccatcaacgacaagcagtccctgaccttccagaa cgtggtcttcaatgtcatttatcagagcgcggcggtcttcaagctctcactgacggcctccaaccacgtgagcaacgtcaccgtg aactacaacgtaaccgtggagcggatgaacaggatgcagggtctgcaggtctccacagtgccggccgtgctgtcccccaatg ccacgctagcactgacggcgggcgtgctggtggactcggccgtggaggtggccttcctgtggacctttggggatggggagca ggccctccaccagttccagcctccgtacaacgagtccttcccggttccagacccctcggtggcccaggtgctggtggagcaca
atgtcatgcacacctacgctgccccaggtgagtacctcctgaccgtgctggcatctaatgccttcgagaacctgacgcagcagg tgcctgtgagcgtgcgcgcctccctgccctccgtggctgtgggtgtgagtgacggcgtcctggtggccggccggcccgtcacc ttctacccgcacccgctgccctcgcctgggggtgttctttacacgtgggacttcggggacggctcccctgtcctgacccagagc cagccggctgccaaccacacctatgcctcgaggggcacctaccacgtgcgcctggaggtcaacaacacggtgagcggtgcg gcggcccaggcggatgtgcgcgtctttgaggagctccgcggactcagcgtggacatgagcctggccgtggagcagggcgc ccccgtggtggtcagcgccgcggtgcagacgggcgacaacatcacgtggaccttcgacatgggggacggcaccgtgctgtc gggcccggaggcaacagtggagcatgtgtacctgcgggcacagaactgcacagtgaccgtgggtgcggccagccccgccg gccacctggcccggagcctgcacgtgctggtcttcgtcctggaggtgctgcgcgttgaacccgccgcctgcatccccacgcag cctgacgcgcggctcacggcctacgtcaccgggaacccggcccactacctcttcgactggaccttcggggatggctcctccaa cacgaccgtgcgggggtgcccgacggtgacacacaacttcacgcggagcggcacgttccccctggcgctggtgctgtccag ccgcgtgaacagggcgcattacttcaccagcatctgcgtggagccagaggtgggcaacgtcaccctgcagccagagaggca gtttgtgcagctcggggacgaggcctggctggtggcatgtgcctggcccccgttcccctaccgctacacctgggactttggcac cgaggaagccgcccccacccgtgccaggggccctgaggtgacgttcatctaccgagacccaggctcctatcttgtgacagtca ccgcgtccaacaacatctctgctgccaatgactcagccctggtggaggtgcaggagcccgtgctggtcaccagcatcaaggtc aatggctcccttgggctggagctgcagcagccgtacctgttctctgctgtgggccgtgggcgccccgccagctacctgtgggat ctgggggacggtgggtggctcgagggtccggaggtcacccacgcttacaacagcacaggtgacttcaccgttagggtggcc ggctggaatgaggtgagccgcagcgaggcctggctcaatgtgacggtgaagcggcgcgtgcgggggctcgtcgtcaatgca agccgcacggtggtgcccctgaatgggagcgtgagcttcagcacgtcgctggaggccggcagtgatgtgcgctattcctgggt gctctgtgaccgctgcacgcccatccctgggggtcctaccatctcttacaccttccgctccgtgggcaccttcaatatcatcgtca cggctgagaacgaggtgggctccgcccaggacagcatcttcgtctatgtcctgcagctcatagaggggctgcaggtggtggg cggtggccgctacttccccaccaaccacacggtacagctgcaggccgtggttagggatggcaccaacgtctcctacagctgga ctgcctggagggacaggggcccggccctggccggcagcggcaaaggcttctcgctcaccgtgctcgaggccggcacctac catgtgcagctgcgggccaccaacatgctgggcagcgcctgggccgactgcaccatggacttcgtggagcctgtggggtggc tgatggtggccgcctccccgaacccagctgccgtcaacacaagcgtcaccctcagtgccgagctggctggtggcagtggtgtc gtatacacttggtccttggaggaggggctgagctgggagacctccgagccatttaccacccatagcttccccacacccggcctg cacttggtcaccatgacggcagggaacccgctgggctcagccaacgccaccgtggaagtggatgtgcaggtgcctgtgagtg gcctcagcatcagggccagcgagcccggacaccatcaccatcaccatcaccatcaccattag (SEQ ID NO: 14)
Protein sequence of PKD 1 extracellular fragment (domains PKDI-PKDX) expressed in Pichia Pastoris using pPIC9 expression vector (Life Technologies). His used for purification is underlined. (SEQ ID NO: 15)
ATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTD VQ VE A AP A ALELVCPS S VQS DES LDLS IQNRGGS GLE A A YS IV ALGEEP AR A VHP LCPSDTEIFPGNGHCYRLVVEKAAWLQAQEQCQAWAGAALAMVDSPAVQRFL VSRVTRSLDVWIGFSTVQGVEVGPAPQGEAFSLESCQNWLPGEPHPATAEHCVR LGPTGWCNTDLCSAPHSYVCELQPGGPVQDAENLLVGAPSGDLQGPLTPLAQQ DGLSAPHEPVEVMVFPGLRLSREAFLTTAEFGTQELRRPAQLRLQVYRLLSTAGT PENGSEPESRSPDNRTQLAPACMPGGRWCPGANICLPLDASCHPQACANGCTSG PGLPGAPYALWREFLFSVPAGPPAQYSVTLHGQDVLMLPGDLVGLQHDAGPGA LLHCSPAPGHPGPQAPYLSANASSWLPHLPAQLEGTWACPACALRLLAATEQLT VLLGLRPNPGLRLPGR YE VR AE VGNG VS RHNLS C S FD V VS P V AGLR VIYP APRD GRLYVPTNGSALVLQVDSGANATATARWPGGSVSARFENVCPALVATFVPGCP WETNDTLFS V V ALPWLS EGEH V VD V V VENS AS RANLS LR VT AEEPICGLR ATPS PE AR VLQG VLVRYS P V VE AGS DM VFRWTINDKQS LTFQN V VFN VIYQS A A VFK LS LT AS NH VS N VT VN YN VT VERMNRMQGLQ VS T VP A VLS PN ATLALT AG VLVD SAVEVAFLWTFGDGEQALHQFQPPYNESFPVPDPSVAQVLVEHNVMHTYAAPG E YLLT VLAS N AFENLTQQ VP VS VR AS LPS V A VG VS DG VLV AGRP VTF YPHPLPS P GGVLYTWDFGDGSPVLTQSQPAANHTYASRGTYHVRLEVNNTVSGAAAQADV RVFEELRGLS VDMS L A VEQG AP V V VS A A VQTGDNIT WTFDMGD GT VLS GPE AT VEHVYLRAQNCTVTVGAASPAGHLARSLHVLVFVLEVLRVEPAACIPTQPDARL TAYVTGNPAHYLFDWTFGDGSSNTTVRGCPTVTHNFTRSGTFPLALVLSSRVNR AHYFTSICVEPEVGNVTLQPERQFVQLGDEAWLVACAWPPFPYRYTWDFGTEE A APTR ARGPE VTFIYRDPGS YLVT VT AS NNIS A ANDS ALVE VQEP VL VTS IKVNG S LGLELQQP YLFS A VGRGRP AS YLWDLGD GGWLEGPE VTH A YNS TGDFT VR V A GWNE VS RS E A WLN VT VKRR VRGLV VN AS RT V VPLNGS VSFSTSLEAGS D VR YS WVLCDRCTPIPGGPTISYTFRSVGTFNIIVTAENEVGSAQDSIFVYVLQLIEGLQV VGGGRYFPTNHTVQLQAVVRDGTNVSYSWTAWRDRGPALAGSGKGFSLTVLE AGT YH VQLRATNMLGS A W ADCTMDFVEP VGWLM V A AS PNP A A VNTS VTLS A ELAGGSGVVYTWSLEEGLSWETSEPFTTHSFPTPGLHLVTMTAGNPLGSANATV E VD VQ VP VS GLS IRAS EPGHHHHHHHHHH . (SEQ ID NO: 15)
DNA sequence of PKD1 extracellular fragment (PKD domain XII and RE J). DNA sequence was cloned in to expression vector pPIC9 (Life Technologies) for
expression and purification in Pichia Pastoris. His tag used for purification is underlined. (SEQ ID NO: 16)
aaccgctcggcgcagtttgaggccgccaccagccccagcccccggcgtgtggcctaccactgggactttggggat gggtcgccagggcaggacacagatgagcccagggccgagcactcctacctgaggcctggggactaccgcgtgcaggtgaa cgcctccaacctggtgagcttcttcgtggcgcaggccacggtgaccgtccaggtgctggcctgccgggagccggaggtggac gtggtcctgcccctgcaggtgctgatgcggcgatcacagcgcaactacttggaggcccacgttgacctgcgcgactgcgtcac ctaccagactgagtaccgctgggaggtgtatcgcaccgccagctgccagcggccggggcgcccagcgcgtgtggccctgcc cggcgtggacgtgagccggcctcggctggtgctgccgcggctggcgctgcctgtggggcactactgctttgtgtttgtcgtgtc atttggggacacgccactgacacagagcatccaggccaatgtgacggtggcccccgagcgcctggtgcccatcattgagggt ggctcataccgcgtgtggtcagacacacgggacctggtgctggatgggagcgagtcctacgaccccaacctggaggacggc gaccagacgccgctcagtttccactgggcctgtgtggcttcgacacagagggaggctggcgggtgtgcgctgaactttgggcc ccgcgggagcagcacggtcaccattccacgggagcggctggcggctggcgtggagtacaccttcagcctgaccgtgtggaa ggccggccgcaaggaggaggccaccaaccagacggtgctgatccggagtggccgggtgcccattgtgtccttggagtgtgt gtcctgcaaggcacaggccgtgtacgaagtgagccgcagctcctacgtgtacttggagggccgctgcctcaattgcagcagc ggctccaagcgagggcggtgggctgcacgtacgttcagcaacaagacgctggtgctggatgagaccaccacatccacgggc agtgcaggcatgcgactggtgctgcggcggggcgtgctgcgggacggcgagggatacaccttcacgctcacggtgctgggc cgctctggcgaggaggagggctgcgcctccatccgcctgtcccccaaccgcccgccgctggggggctcttgccgcctcttcc cactgggcgctgtgcacgccctcaccaccaaggtgcacttcgaatgcacgggctggcatgacgcggaggatgctggcgccc cgctggtgtacgccctgctgctgcggcgctgtcgccagggccactgcgaggagttctgtgtctacaagggcagcctctccagc tacggagccgtgctgcccccgggtttcaggccacacttcgaggtgggcctggccgtggtggtgcaggaccagctgggagcc gctgtggtcgccctcaacaggtctttggccatcaccctcccagagcccaacggcagcgcaacggggctcacagtctggctgca cgggctcaccgctagtgtgctcccagggctgctgcggcaggccgatccccagcacgtcatcgagtactcgttggccctggtca ccgtgctgaacgagtacgagcgggccctggacgtggcggcagagcccaagcacgagcggcagcaccgagcccagatacg caagaacatcacggagactctggtgtccctgagggtccacactgtggatgacatccagcagatcgctgctgcgctggcccagt gcatggggcccagcagggagctcgtatgccgctcgtgcctgaagcagacgctgcacaagctggaggccatgatgctcatcct gcaggcagagaccaccgcgggcaccgtgacgcccaccgccatcggagacagcatcctcaacatcacaggagacctcatcc acctggccagctcggacgtgcgggcaccacagccctcagagctgggagccgagtcaccatctcggatggtggcgtcccagg cctacaacctgacctctgccctcatgcgcatcctcatgcgctcccgcgtgctcaacgaggagcccctgacgctggcgggcgag gagatcgtggcccagggcaagcgctcggacccgcggagcctgctgtgctatggcggcgccccagggcctggctgccacttc tccatccccgaggctttcagcggggccctggccaacctcagtgacgtggtgcagctcatctttctggtggactccaatccctttcc ctttggctatatcagcaactacaccgtctccaccaaggtgcaccatcaccatcaccatcaccatcaccattag (SEQ ID NO: 16)
Protein sequence of PKD 1 extracellular fragment (PKD domain XII and REJ) expressed in Pichia Pastoris using pPIC9 expression vector (Life Technologies). His tag used for purification is underlined. (SEQ ID NO: 17)
NRS AQFE A ATS PS PRRV A YHWDFGDGS PGQDTDEPRAEHS YLRPGD YRV
QVNASNLVSFFVAQATVTVQVLACREPEVDVVLPLQVLMRRSQRNYLEAHVDL RDCVTYQTEYRWEVYRTASCQRPGRPARVALPGVDVSRPRLVLPRLALPVGHY CF VFV VS FGDTPLTQS IQ AN VT V APERLVPIIEGGS YR VWS DTRDLVLDGS ES YD PNLEDGDQTPLSFHWACVASTQREAGGCALNFGPRGSSTVTIPRERLAAGVEYT FSLTVWKAGRKEEATNQTVLIRSGRVPIVSLECVSCKAQAVYEVSRSSYVYLEG RCLNCSSGSKRGRWAARTFSNKTLVLDETTTSTGSAGMRLVLRRGVLRDGEGY TFTLTVLGRSGEEEGCASIRLSPNRPPLGGSCRLFPLGAVHALTTKVHFECTGWH DAEDAGAPLVYALLLRRCRQGHCEEFCVYKGSLSSYGAVLPPGFRPHFEVGLAV V VQDQLG A A V V ALNRS LAITLPEPNGS ATGLT VWLHGLT AS VLPGLLRQ ADPQ HVIEYSLALVTVLNEYERALDVAAEPKHERQHRAQIRKNITETLVSLRVHTVDDI QQIAAALAQCMGPSRELVCRSCLKQTLHKLEAMMLILQAETTAGTVTPTAIGDSI LNITGDLIHLAS S D VR APQPS ELG AES PS RM V AS Q A YNLTS ALMRILMRS R VLNE EPLTLAGEEIVAQGKRSDPRSLLCYGGAPGPGCHFSIPEAFSGALANLSDVVQLIF LVDS NPFPFG YIS N YT VS TKVHHHHHHHHHH . (SEQ ID NO: 17)
DNA sequence of PKD1L1 extracellular fragment. DNA sequence was cloned into expression vector pPIC9 (Life Technologies) for expression and purification in Pichia Pastoris. His tag used for purification is underlined. (SEQ ID NO: 18)
atggccgaggaggcagcccagaacatttctgatgaccaggaaaggtgtctccaggctgcctgctgcctttcctttggt ggtgagctgtctgtgagcactgacaagagctggggtcttcatctgtgcagctgtagccctcctggaggtggattgtgggtcgag gtctatgctaatcatgtgcttcttatgagtgatgggaagtgtggctgtccttggtgtgctctgaatggaaaggcagaagaccggga atcacagagcccatcctcatcagcttccaggcagaagaacatttggaaaacaactagcgaagcagcgttaagtgttgttaatgaa aaaacacaggctgttgttaatgaaaaaacacaggcgcctctggattgtgataacagtgctgatagaattccccacaaacctttcat tataatcgcaagggcctggagcagtggtggccccaggttccatcacaggcggctgtgtgctactgggaccgcagacagcaca ttctctgctcttctccagctccagggcaccacttctgcagcagctccctgcagcctgaagatggaggcttcctgctgtgtcctgag actgctgtgctgtgcggaggatgtggccacggggctgcttcctgggactgtcacgatggagacccccaccaaggtggccaga cccactcagaccagctcccagcgagtgcccctgtggccgatttcacattttcccacttctcccagaagctcccacggccttccgc
ctggcattcctcgcacccccagcttcacggcatcgcagtctggttctgagatcctctatccccctactcagcatcctcctgtggcc atcctagctcgaaattctgataacttcatgaaccctgttcttaattgctccctggaagtggaagctcgggcacctccaaatctggga ttccgtgttcatatggcttctggagaggctctctgtctgatgatggatttcggggacagttctggggttgaaatgaggctacacaac atgtctgaggcaatggcggtgactgcctaccaccagtactcaaaaggtattttttttcatcttttacattttcagttggatatgtccacc tacaaagaagcagagacacaaaatacaactttaaatgtttacttgtgccaaagtgaaaacagctgcctggaagactcagacccc agtaaccttggatatgagcttatttctgcctttgtcaccaaaggagtctatatgctcaaggctgttatttataacgagtttcatggaacc gaagtggagcttgggccttattatgtggagattggccatgaggccgtgtctgcgttcatgaactccagcagtgtccatgaagatg aagtgcttgtctttgctgactcccaagtgaatcagaaaagcactgtggttatacatcactttccatctattccttcatataacgtgtcct ttatttctcagactcaagtgggtgacagccaggcttggcacagcatgactgtctggtataagatgcaatccgtctctgtctacacaa atggaactgtgtttgccacagacacagacattacatttacagctgttaccaaggaaacaatacccctggaatttgagtggtattttg gagaggacccaccagtgaggacaacttcaagaagcattaaaaaaagactcagcatcccccaatggtatcgtgtgatggttaag gcttccaacaggatgagcagtgtggtctctgagccccatgtcatcagggtgcagaagaaaattgtggccaatcggctccaccat caccatcaccatcaccatcaccattag(SEQ ID NO: 18)
Protein sequence of PKD 1 extracellular fragment (domains PKDI-PKDX) expressed in Pichia Pastoris using pPIC9 expression vector (Life Technologies). His tag used for purification is underlined. (SEQ ID NO: 19)
MAEEAAQNISDDQERCLQAACCLSFGGELSVSTDKSWGLHLCSCSPPGG GLW VE V Y ANH VLLMS DGKC GCPWC ALNGKAEDRES QS PS S S AS RQKNIWKTTS EAALSVVNEKTQAVVNEKTQAPLDCDNSADRIPHKPFIIIARAWSSGGPRFHHRR LCATGTADSTFSALLQLQGTTSAAAPCSLKMEASCCVLRLLCCAEDVATGLLPG TVTMETPTKVARPTQTSSQRVPLWPISHFPTSPRSSHGLPPGIPRTPSFTASQSGSEI LYPPTQHPPVAILARNSDNFMNPVLNCSLEVEARAPPNLGFRVHMASGEALCLM MDFGDS S GVEMRLHNMSEAM A VTA YHQ YS KGIFFHLLHFQLDMS TYKE AETQ NTTLN V YLCQS ENSCLEDSDPS NLG YELIS AFVTKG V YMLKA VIYNEFHGTE VEL GP Y Y VEIGHE A VS AFMNS S S VHEDE VLVFADS Q VNQKS T V VIHHFPS IPS YNVS FI SQTQVGDSQAWHSMTVWYKMQSVSVYTNGTVFATDTDITFTAVTKETIPLEFE W YFGEDPP VRTTS RS IKKRLS IPQW YRVM VKAS NRMS S V VS EPH VIR VQKKIV A NRLHHHHHHHHHH. (SEQ ID NO: 19)
All references cited herein are fully incorporated by reference. Having thus described several aspects of at least one embodiment of this invention, it is to be appreciated various alterations, modifications, and improvements will readily occur to
those skilled in the art. Such alterations, modifications, and improvements are intended to be part of this disclosure, and are intended to be within the spirit and scope of the invention. Accordingly, the foregoing description and drawings are by way of example only.
Claims
1. A method for identifying a compound that modulates polycystin-l/polycystin- 2 (PKD1/PKD2) activity, comprising:
contacting a cell having a plasma membrane PKD1/PKD2 with a test compound, detecting whether PKD1/PKD2 activity is modulated in the presence of the test compound with respect to PKD1/PKD2 activity in the absence of the test compound, and wherein if the PKD1/PKD2 activity is modulated then the test compound is a compound that modulates PKD1/PKD2 activity.
2. The method of claim 1, wherein the method of detection comprises a voltage- clamp, patch clamp, x-ray crystallization, electron microscopy, circular dichroism,
Fourier transform infra-red spectroscopy, electron spin resonance, nuclear magnetic resonance spectroscopy, flow cytometry, immunodetection fluorescence techniques, surface biotinylation, calcium imaging techniques, or atomic force microscopy.
3. The method of claim 1, wherein the test compound comprises a small molecule, peptide, nucleic acid or polysaccharide including, but not limited to antibodies and biologies.
4. The method of claim 1, wherein the test compound comprises an inhibitor of PKD1/PKD2 activity.
5. The method of claim 1, wherein the test compound comprises an activator of PKD1/PKD2 activity.
6. The method of claim 1, wherein the test compound comprises a trafficking modulator to the plasma membrane or primary cilium.
7. The method of claim 1, wherein the PKD1 or PKD2 is a chimera.
8. The method of claim 1, wherein the PKD1 or PKD2 includes an intracellular or extracellular tag.
9. The method of claim 1, wherein N-terminal truncations of PKD1 enhance PKD2 surface trafficking.
10. The method of claim 1, wherein C-terminal truncations of PKD1 enhance PKD2 surface trafficking.
11. The method of claim 9-10, wherein the tag is selected from the group consisting of a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry,
FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
12. The method of claim 1, wherein PKDl in the plasma membrane PKD1/PKD2 comprises a modified PKDl.
13. The method of claim 12, wherein the modified PKD 1 is a P2Y 12-PKD 1
P2Y12-PKD1L1, P2Y12-PKD1L2 or P2Y2-PKD1L3.
14. The method of claim 12, wherein the N-terminus of the modified PKDl does not contain P2Y12.
15. The method of claim 12, wherein the modified PKD1/PKD2 complex contains autosomal dominant polycystic kidney disease (ADPKD) causing mutations in either PKDl or PKD2 which affects plasma membrane trafficking and/or alters
PKD1/PKD2 ion channel function.
16. The method of claim 12, wherein the modified PKD1/PKD2 complex contains ADPKD causing mutations in PKDl which affects plasma membrane trafficking and/or alters PKD1/PKD2 ion channel function.
17. The method of claim 12, wherein the modified PKD1/PKD2 complex contains ADPKD disease causing mutations in either PKDl or PKD2 which affects or alters PKD1/PKD2 ion channel function.
18. The method of claim 1, wherein the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
19. The method of claim 1, wherein the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
20. A cell having a PKD1/PKD2 in a plasma membrane.
21. The cell of claim 20, wherein the PKDl is a chimera.
22. The cell of claim 20, wherein the PKD2 is a chimera.
23. The cell of claim 20, wherein the PKDl includes an intracellular or extracellular tag.
24. The cell of claim 20, wherein the PKD2 includes an intracellular or extracellular tag.
25. The cell of claims 23 and 24, wherein the tag is selected from the group consisting of a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry,
FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
26. The cell of claim 20, wherein PKD1 in the plasma membrane PKD1/PKD2 comprises a modified PKD1.
27. The cell of claim 20, wherein the PKD1 comprises SEQ ID NO: 3, SEQ ID
NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
28. The cell of claim 20, wherein the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
29. The cell of claim 20, wherein the cell is a human embryonic kidney (HEK) cell or Chinese hamster ovary cell (CHO).
30. The cell of claim 20, wherein the cell consists of an inner medullary collecting duct (IMCD) cell, a retinal pigmented epithelial (RPE cell), Madin-Darby canine kidney (MDCK) cell or porcine kidney (PK1) cell.
31. The cell of claim 26, wherein the modified PKD1 is a modified polycystin- 1L1, modified polycystic 1L2, modified polycystic 1L3 or P2Y12-PKD1.
32. A chimeric PKD1 comprising a C-terminal PKD1 fragment linked to an N- terminal plasma membrane insertion domain.
33. The chimeric PKD1 of claim 32, wherein the plasma membrane insertion domain is P2Y12.
34. The chimeric PKD1 of claim 32, wherein the plasma membrane insertion domain is not P2Y12.
35. The chimeric PKD1 of claim 32, wherein the PKD1 includes an intracellular or extracellular tag.
36. The chimeric PKD1 of claim 35, wherein the tag is selected from the group consisting of a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry,
FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
37. The chimeric PKD1 of claim 32, wherein the C-terminal PKD1 fragment comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
38. The chimeric PKD1 of claim 32, wherein the N-terminal plasma membrane insertion domain comprises SEQ ID NO: 9 and SEQ ID NO: 10.
39. A nucleic acid encoding a chimeric PKDl comprising a C-terminal PKDl domain linked to an N-terminal plasma membrane insertion domain.
40. The nucleic acid of claim 39, wherein the nucleic acid encoding the C- terminal PKDl fragment comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
41. The nucleic acid of claim 39, wherein the nucleic acid encoding the N- terminal plasma membrane insertion domain is SEQ ID NO: 9 or SEQ ID NO: 10.
42. A vector, comprising the nucleic acid of claim 39.
43. The vector of claim 42, wherein the vector comprises an inducible promoter and wherein the inducible promoter consists of an araS promoter, tf55a promoter, araC promoter, or a tetracycline promoter.
44. The vector of claim 42, wherein the vector comprises SEQ ID NO: 12 or SEQ ID NO: 13.
45. A kit comprising
a container housing a first expression vector comprising a nucleic acid encoding a chimeric PKDl comprising a C-terminal PKDl fragment linked to an N-terminal plasma membrane insertion domain,
a container housing a second expression vector comprising a nucleic acid encoding a PDK2, and
instructions for generating a cell line using the first and second expression vectors.
46. The kit of claim 45, wherein the PKDl is intracellularly or extracellularly tagged.
47. The kit of claim 45, wherein the PKD2 is intracellularly or extracellularly tagged.
48. The kit of claims 46 and 47, wherein the tag is selected from the group consisting of a HA tag, His-tag, GFP, YFP, BirA, mCherry, ires GFP, ires mCherry, FLAG tag, and covalent labeling of fusion proteins using SNAP-, CLIP-, ACP- and MCP-tags.
49. The kit of claim 45, wherein the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
50. The kit of claim 45, wherein the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or 11.
51. A stable inducible cell line expressing PKDl chimera/PKD2 in the plasma membrane.
52. The cell line of claim 51, wherein the cell line consists of HEK cells or CHO cells.
53. The cell of claim 51, wherein the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
54. The cell of claim 51, wherein the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
55. A stable inducible cell line expressing PKDl chimera/PKD2 in the primary cilium.
56. The cell line of claim 55, wherein the cell line consists of mIMCD3, hRPE, MDCK or LLC-PK1 cells or other ciliated cell lines.
57. The cell line of claim 55, wherein the cell line consists of HEK cells or CHO cells.
58. The cell line of claim 55, wherein N-terminal truncations of PKDl enhance PKD2 surface trafficking.
59. The cell line of claim 55, wherein C-terminal truncations of PKDl enhance PKD2 surface trafficking.
60. The cell of claim 55, wherein the PKDl comprises SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.
61. The cell of claim 56, wherein the PKD2 comprises SEQ ID NO: 1, SEQ ID NO: 2 or SEQ ID NO: 11.
62. The cell of claim 51, wherein the modified PKD1/PKD2 complex contains
ADPKD disease causing mutations in either PKDl or PKD2 which affects plasma membrane trafficking and/or alters PKD1/PKD2 ion channel function.
63. The cell of any of the preceding claims, wherein the modified PKD1/PKD2 complex contains ADPKD disease causing mutations in either PKDl or PKD2 which affects plasma membrane trafficking and/or alters PKD1/PKD2 ion channel function.
64. The cell of any of the preceding claims, wherein the modified PKD1/PKD2 complex contains ADPKD disease causing mutations in either PKDl or PKD2 which affects or alters PKD1/PKD2 ion channel function.
65. The cell of claim 64, wherein the mutations include gain-of-function mutations in PKD1/PKD2.
66. The cell line of claim 55, wherein the cell is a ciliated primary cell isolated from Arll3B-mCherry-GECO 1.2 transgenic mice or human tissue.
67. A method of quantifying polycystin ion channel function comprising, quantifying by either patch clamping of primary cilia or changes in fluorescence intensity of a calcium sensor in primary cilium of the ciliated primary cells of claim 66.
68. A composition comprising an extracellular domain of PKDl or PKD1-L1 having an amino acid sequence as shown in any of SEQ ID NOs: 15, 17, and 19, and a carrier.
69. A nucleic acid sequence encoding the extracellular domain of PKDl or PKDl -LI of claim 68.
70. The nucleic acid sequence of claim 69, wherein the nucleic acid has a sequence selected from SEQ ID NOs: 14, 16 and 18.
71. The cell of claim 20, wherein the PKD2 contains channel activating mutations.
72. The cell of claim 20, wherein the PKD2 contains channel inhibiting mutations.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/083,479 US20200209259A1 (en) | 2016-03-08 | 2017-03-08 | Methods to target pkd1/pkd2 ion channel complex |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662305160P | 2016-03-08 | 2016-03-08 | |
| US62/305,160 | 2016-03-08 | ||
| US201662306399P | 2016-03-10 | 2016-03-10 | |
| US62/306,399 | 2016-03-10 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2017156090A2 true WO2017156090A2 (en) | 2017-09-14 |
| WO2017156090A3 WO2017156090A3 (en) | 2018-07-19 |
Family
ID=59789820
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/021309 Ceased WO2017156090A2 (en) | 2016-03-08 | 2017-03-08 | METHODS TO TARGET PKD1/PKD2 lON CHANNEL COMPLEX |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US20200209259A1 (en) |
| WO (1) | WO2017156090A2 (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4667628A1 (en) * | 2024-06-19 | 2025-12-24 | Albert-Ludwigs-Universität Freiburg Körperschaft des öffentlichen Rechts | Synthetic lethality to treat autosomal dominant polycystic kidney disease (adpkd) |
| WO2025261741A1 (en) * | 2024-06-19 | 2025-12-26 | Albert-Ludwigs-Universitaet Freiburg Koerperschaft Des Oeffentlichen Rechts | Synthetic lethality to treat autosomal dominant polycystic kidney disease (adpkd) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN116063456A (en) * | 2022-08-25 | 2023-05-05 | 湖北工业大学 | Blocking peptide of target PKD2 and application thereof in preparation of medicines for treating polycystic kidney disease |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1995018225A1 (en) * | 1993-12-24 | 1995-07-06 | Medical Research Council | Polycystic kidney disease 1 gene and uses thereof |
| US6638726B1 (en) * | 2000-01-06 | 2003-10-28 | Mount Sinai School Of Medicine Of New York University | Screening methods for compounds useful in the treatment of polycystic kidney disease |
| US20080063601A1 (en) * | 2004-11-15 | 2008-03-13 | Yale University | Compositions and methods relating to polycystic kidney disease |
| US7629134B2 (en) * | 2006-07-10 | 2009-12-08 | Duke University | Sour taste receptor compositions and methods |
-
2017
- 2017-03-08 WO PCT/US2017/021309 patent/WO2017156090A2/en not_active Ceased
- 2017-03-08 US US16/083,479 patent/US20200209259A1/en not_active Abandoned
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4667628A1 (en) * | 2024-06-19 | 2025-12-24 | Albert-Ludwigs-Universität Freiburg Körperschaft des öffentlichen Rechts | Synthetic lethality to treat autosomal dominant polycystic kidney disease (adpkd) |
| WO2025261741A1 (en) * | 2024-06-19 | 2025-12-26 | Albert-Ludwigs-Universitaet Freiburg Koerperschaft Des Oeffentlichen Rechts | Synthetic lethality to treat autosomal dominant polycystic kidney disease (adpkd) |
Also Published As
| Publication number | Publication date |
|---|---|
| US20200209259A1 (en) | 2020-07-02 |
| WO2017156090A3 (en) | 2018-07-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Medcalf et al. | Temperature-sensitive lesions in two influenza A viruses defective for replicative transcription disrupt RNA binding by the nucleoprotein | |
| Parmar et al. | Beta2-adrenergic receptor homodimers: Role of transmembrane domain 1 and helix 8 in dimerization and cell surface expression | |
| Milasta et al. | Interactions between the Mas-related receptors MrgD and MrgE alter signalling and trafficking of MrgD | |
| Perrone et al. | The thyroid transcription factor 2 (TTF-2) is a promoter-specific DNA-binding independent transcriptional repressor | |
| CN111856024B (en) | Method for detecting interaction between biological membrane proteins and kit used in method | |
| US20200209259A1 (en) | Methods to target pkd1/pkd2 ion channel complex | |
| Chakraborty et al. | Expression of G protein-coupled receptors in Mammalian cells | |
| JP5553326B2 (en) | Single molecule probe and use thereof | |
| Lock et al. | One motif to bind them: a small-XXX-small motif affects transmembrane domain 1 oligomerization, function, localization, and cross-talk between two yeast GPCRs | |
| JP6555677B2 (en) | A set of proteins that form dimers in a light-dependent manner | |
| Kimura et al. | Protein phosphatase 2A interacts with the Na+, K+-ATPase and modulates its trafficking by inhibition of its association with arrestin | |
| Ho et al. | Method for rapid optimization of recombinant GPCR protein expression and stability using virus-like particles | |
| CN103097408A (en) | Method for producing cAMP using chimeric olfactory receptor | |
| JP2005525111A (en) | Leptin receptor ligand detection method | |
| JP2011067190A (en) | Single molecular format probe and utilization of the same | |
| JP2019039711A (en) | Olfactory receptor response measurement method | |
| WO2000008133A9 (en) | NOVEL G PROTEIN-COUPLED RECEPTOR cDNA SEQUENCE | |
| US9012602B2 (en) | Macaca fascicularis CCL17 | |
| JP7025041B2 (en) | Mutant-introduced thyrotropin receptor | |
| CN112921053B (en) | A dual-induction mCreER system that can track cell differentiation and development and its establishment and application | |
| RS62032B1 (en) | Prenylation assay | |
| Arimochi et al. | Stable expression and visualization of Mat-8 (FXYD-3) tagged with a fluorescent protein in Chinese Hamster Ovary (CHO)-K1 cells | |
| US20120264231A1 (en) | Assay for orai calcium channel regulators | |
| EP1716177B1 (en) | Cytochrome c protein and assay | |
| JP6525199B2 (en) | Insulin detection method and insulin detection kit |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17763975 Country of ref document: EP Kind code of ref document: A2 |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 17763975 Country of ref document: EP Kind code of ref document: A2 |