WO2017139659A1 - Rothia subtilisins, s8a family proteases, as therapeutic enzymes for application in gluten-intolerance disorders - Google Patents
Rothia subtilisins, s8a family proteases, as therapeutic enzymes for application in gluten-intolerance disorders Download PDFInfo
- Publication number
- WO2017139659A1 WO2017139659A1 PCT/US2017/017491 US2017017491W WO2017139659A1 WO 2017139659 A1 WO2017139659 A1 WO 2017139659A1 US 2017017491 W US2017017491 W US 2017017491W WO 2017139659 A1 WO2017139659 A1 WO 2017139659A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- subtilisin
- gluten
- rothia
- enzyme
- composition
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/52—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES, NOT OTHERWISE PROVIDED FOR; PREPARATION OR TREATMENT THEREOF
- A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
- A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
- A23L33/135—Bacteria or derivatives thereof, e.g. probiotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/48—Hydrolases (3) acting on peptide bonds (3.4)
- A61K38/482—Serine endopeptidases (3.4.21)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
- C12Y304/21026—Prolyl oligopeptidase (3.4.21.26), i.e. proline-specific endopeptidase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
- C12Y304/21062—Subtilisin (3.4.21.62)
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
Definitions
- the field of the invention relates to gluten-degrading enzymes and/or the treatment of celiac disease or a related disorder.
- Celiac disease also called celiac sprue or gluten-sensitive enteropathy
- celiac sprue is a disease which develops in susceptible individuals in response to the intake of dietary gluten.
- the disease is caused by an immune reaction to gluten, most noticeably, to gliadin-derived peptides. These peptides elicit an immune response damaging the villi, which are tiny protrusions that line the small intestine. Their destruction causes malabsorbtion of nutrients leading to a variety of generalized gastro-intestinal disease symptoms such as diarrhea and abdominal pain. Additional and secondary symptoms include weight loss, fatigue, anemia, osteopenia and skin and tooth enamel defects.
- a related disease/disorder is dermatitis herpetiformis, which is a chronic eruption of the skin characterized by clusters of intensely pruritic vesicles, papules, and urticaria-like lesions. IgA deposits occur in almost all normal-appearing and perilesional skin. Asymptomatic gluten-sensitive enteropathy is found in 75 to 90% of patients and in some of their relatives. Onset is usually gradual. Itching and burning are severe, and scratching often obscures the primary lesions with eczematization of nearby skin, leading to an erroneous diagnosis of eczema. Strict adherence to a gluten-free diet for prolonged periods may control the disease in some patients, obviating or reducing the requirement for drug therapy.
- Dapsone, sulfapyridine and colchicines are sometimes prescribed for relief of itching.
- Gluten allergy/gluten intolerance is a related ailment which results from overreaction of a subject's immune system to gluten and gliadin that are normally considered harmless.
- the symptoms are very similar to celiac sprue or gluten-sensitive enteropathy but without the enteropathy.
- Afflicted subjects have an abundance of IgG, IgA antibodies against ⁇ / ⁇ -gliadin.
- Typical symptoms are abdominal pain, gas, bloating and diarrhea; there is a general feeling of sickness and fatigue after grain-based products are consumed.
- Severe allergy can led to Gluten-sensitive idiopathic neuropathy where the typical symptoms are ataxia and peripheral neuropathies because the primary tissue targeted are the central nervous system and peripheral nerves.
- oral corticosteroids e.g., prednisone 10 to 20 mg b.i.d
- prednisone 10 to 20 mg b.i.d may induce response.
- the gluten-free diet advice is to be followed for a lifetime, and intake of gluten, even in small amounts, can cause an immediate immunological response.
- the development of a non-dietary therapy would allow patients to lead a more normal life and find a broad application in the gluten-sensitive patient population.
- gluten containing foods contain another class of non-gluten proteins with innate immune stimulatory and thus proinflammatory activity, namely the amylase .trypsin inhibitors (ATIs ).
- ATIs amylase .trypsin inhibitors
- ATIs induce the condition of non-celiac wheat sensitivity (formerly "gluten sensitivity") which worsens both intestinal and extraintestinla chronic inflammatory diseases, including inflammatory bowel diseases, and autoimmune diseases like SLE, multiple sclerosis, the metabolic syndrome or allergic asthma - therefore affecting even more people that celiac disease.
- these diseases are not exacerbated by gluten.
- a protease that would degrade and thus inactivate ATIs in gluten containing food stuffs would be highly desirable.
- compositions, formulations, foodstuffs, and methods described herein are based, in part, on the discovery of subtilisins and subtilisin-like enzymes from Rothia species bacteria that are found in human plaque or saliva. These subtilisins and subtilisin-like enzymes from Rothia species bacteria have gluten-degrading activity.
- the subtilisins and subtilisin-like, gluten-degrading enzymes of Rothia were identified as members of the subtilisin protease family, and the gluten-degrading activities of this class of enzymes were shown to extend beyond the Rothia genus.
- subtilisins and subtilisin-like enzymes were able to degrade amylase-trypsin inhibitors (ATIs) that are highly resistant to degradation by mammalian digestive enzymes.
- ATIs amylase-trypsin inhibitors
- a dietary enzyme that could eliminate immunotoxicity of both gluten and ATIs would clearly be beneficial for the treatment of the spectrum of wheat (cereal)-associated gastrointestinal disorders comprising CD and NCWS.
- These subtilisins and subtilisin-like, gluten- degrading enzymes can be formulated for the treatment of celiac disease, non-celiac/non-allergy wheat sensitivity due to ATIs, and/or a related disorder, and are especially useful for oral delivery as they retain their activity.
- Embodiments of the present disclosure relate to use of subtilisins and subtilisin-like enzymes having gluten-degrading activities from the Rothia bacteria spp. for the production of formulations and compositions comprising the subtilisins and subtilisin-like enzymes therein, the methods of treatment of gluten-containing foodstuff, and for the methods of treating individuals with gluten allergy or celiac disease.
- Gluten degrading enzymes have been isolated from Rothia mucilaginosa ATCC 25296 and Rothia aeria (e.g., R. aeria Oral Taxon 188, also called Rothia species ot 188, Rothia sp. HOT-188, R. aeria strain F0474 (HMP ID 1324), R.
- aeria HM-818 and R. aeria strain WSA
- subtilisins that belonging to the S8A family of serine protease family.
- the Rothia sp. derived subtilisin-like enzymes have the conserved catalytic triad composed of a Ser (S), His (H), and Asp (D) residues that is characteristic of the serine protease family.
- the Rothia subtilisin enzymes are potent at cleaving proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and Xi is a hydrophobic amino acid; e.g.
- subtilisins can useful for breaking down proline -glutamine rich proteins and peptides such as glutens, gliadins and peptides that are resistant to further digestion by other peptidases where these have been shown to elicit an immune response in celiac disease (CD).
- CD celiac disease
- the inventors have also developed a method that effectively kills bacteria, while fully preserving their enzymatic activities therein.
- the inventors treated four gluten-degrading microbial strains with ethanol (e.g.,1%, 2%, 50%) for a period of time (e.g., 30 min-1 hr). Treatment with ethanol effectively kills the bacteria, so that the bacteria cannot replicate and are not viable.
- compositions comprising of such ethanol-treated and lyophilized bacteria would be useful for the methods described herein, for example, for the production or treatment or both the production and treatment of gluten-containing foodstuff or amylase-trypsin inhibitor containing foodstuff, and for the methods of treating individuals with gluten allergy or CD, and other related disorders described herein.
- subtilisins for the methods of production or treatment or both production and treatment of gluten-containing foodstuff or amylase - trypsin inhibitor containing foodstuff, and for the methods of treating individuals with gluten allergy or CD, and other related disorders described herein.
- compositions and formulations of compositions comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein for for methods of the production or treatment or both production and treatment of gluten-containing foodstuff or amylase-trypsin inhibitor containing foodstuff, and for the methods of treating individuals with gluten allergy or celiac disease, or other related disorders described herein.
- gluten-free foodstuff compositions comprising a gluten-containing foodstuff in an admixture with a formulation or a composition comprising an isolated subtilisin or a subtilisin-like enzyme or both a subtilisin and a subtilisin-like enzyme derived a Rothia bacteria sp. as described herein, e.g., SEQ. ID. NO: 1-3, 33 and 34. More than one isolated subtilisin or a subtilisin-like enzyme is comtemplated.
- the gluten-free foodstuff compositions comprise a gluten-containing foodstuff in an admixture with a formulation or a composition comprising an isolated subtilisin and/or subtilisin-like enzyme derived Rothia bacteria sp. and at least another isolated endopeptidase selected from a gluten-degrading enzyme from Rothia species bacteria, an isolated glutamine endopeptidase and a prolyl endopeptidase. Combinations of two or more isolated
- endopeptidases are comtemplated, e.g., gluten-degrading enzyme and an isolated glutamine
- endopeptidase or an isolated glutamine endopeptidase and a prolyl endopeptidase, in addition the isolated subtilisin and/or subtilisin-like enzyme derived Rothia bacteria sp.
- a foodstuff comprising a formulation or a composition comprising a subtilisin enzyme derived from a. Rothia sp. bacteria described herein.
- a method for degrading gluten or attenuating gluten toxicity in a gluten-containing foodstuff comprises contacting the gluten-containing foodstuff with an effective dose of a formulation or composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
- a formulation or composition comprising (a) an isolated subtilisin and/or subtilisin-like enzyme derived from a Rothia sp. bacteria, and (b) a prolyl endopeptidase (PEP).
- PEP prolyl endopeptidase
- a formulation or composition comprising (a) an isolated subtilisin and/or subtilisin-like enzyme derived from a Rothia sp. bacteria, and (b) an additional glutamine endopeptidase that is a not a subtilisin and/or subtilisin-like enzyme.
- a formulation or composition comprising (a) an isolated subtilisin and/or subtilisin-like enzyme derived from a Rothia sp. bacteria, and (b) an additional gluten-degrading enzyme derived from a Rothia sp. bacteria and the gluten-degrading enzyme is a not a subtilisin and/or subtilisin-like enzyme.
- a method for treating celiac disease or a related disorder such as gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis, the method comprising administering to a subject an effective dose of a formulation or composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or administering an effective dose of any one composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
- a subtilisin enzyme derived from a Rothia sp. bacteria to attenuate gluten toxicity in gluten-containing food stuff or for the treatment of celiac disease or a related disorder.
- subtilisin enzyme derived from a Rothia sp. bacteria for the manufacture of medicament to treat of celiac disease or a related disorder.
- a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or any one composition described herein to attenuate gluten toxicity in gluten-containing food stuff or for the treatment of celiac disease or a related disorder.
- a formulation or composition comprising a subtilisin enzyme derived from a. Rothia sp. bacteria, or any one composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein for the manufacture of medicament for the treatment of celiac disease or a related disorder.
- a foodstuff comprising a formulation or a composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria are cannot cell divide and are not alive or viable.
- a method for degrading gluten or attenuating gluten toxicity in a gluten-containing foodstuff or degrading an amylase-trypsin inhibitor in a foodstuff comprises contacting the gluten-containing foodstuff or the amylase-trypsin inhibitor containing foodstuff with an effective dose of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
- a formulation or composition comprising ethanol- treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
- a method for treating celiac disease or a related disorder such as gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis, the method comprising administering to a subject an effective dose of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
- a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein to attenuate gluten toxicity in gluten-containing food stuff or to degrade an amylase- trypsin inhibitor in a foodstuff for the treatment of celiac disease or a related disorder, wherein the bacteria cannot cell divide and are not alive or viable.
- a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein for the manufacture of medicament to treat of celiac disease or a related disorder, wherein the bacteria cannot cell divide and are not alive or viable.
- the contacting of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff is performed in vitro prior to consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
- the contacting of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff is performed in vivo concurrent with or after consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
- the administering of the formulation or composition is performed in vitro prior to consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
- the administering of the formulation or composition is performed in vivo concurrent with or after consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
- the administering of the formulation or composition is performed in vitro prior to and also concurrent with or after consumption of the gluten- containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
- the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, Rothia species ot 188 (strain WSA-8), Rothia sp. HOT-188, Rothia aeria strain F0474 (HMP ID 1324), Rothia aeria HM-818, Rothia aeria strain WSA-8, Rothia aeria BAV86562.1 and Rothia dentocariosa KGJ00122.1.
- the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa, Rothia aeria and Rothia dentocariosa.
- subtilisin comprises, or consists of, or consists essentially of the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243
- C6R5W1_9MICC C6R5W1_9MICC
- ROTMU0001_240 C6R5V8_9MICC proteins.
- SEQ, ID. NOS: 1-3 The hypothetical ROTMU0001_0241 (C6R5V9_9MICC) is protein WP 044143864.1, ROTMU0001_0243 (C6R5W1_9MICC) ) is protein WP_044143865.1, and ROTMU0001_240 (C6R5V8_9MICC) is protein WP 005509166.1.
- subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins.
- subtilisin is a truncated protein of the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) protein.
- ROTMU0001_0241 C6R5V9_9MICC
- ROTMU0001_0243 C6R5W1_9MICC
- ROTMU0001_240 C6R5V8_9MICC
- subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
- the subtilisin cleaves proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and Xi is a hydrophobic amino acid, i.e., cleaving at the peptide bond after X 1; e.g. the XPQ motif, where Q is glutamine and the cleavage occurs after Q.
- subtilisin cleaves proline-containing proteins after the proline in the XPXi motif.
- the subtilisin cleaves succinyl-Ala-Ala-Pro-Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after proline in the P2 position.
- the numbering of the amino acid position (e.g., PI, P2, P3) is with respect to the peptide bond that is cleaved by the enzyme described.
- the amino acid residue immediately upstream of the cleavage peptide bond is designated the position PI, the amino acid residue immediately upstream of the PI amino acid residue is P2.
- Phe PI position
- Pro P2 position
- Ala P3 and P4 positions.
- subtilisin degrades the highly immunogenic gliadin-derived 33 -mer peptide. In any aspect described herein, the subtilisin degrades an amylase -trypsin inhibitor.
- the presense of P 2 in this position is well known to interfere with protease activity.
- the subtilisin does not cleave the peptide bond after Phe.
- subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes.
- the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) or as described in Figures 2A-2E in the Example section; or have a predicted molecular weight of -125 kDa as described in the Example section.
- subtilisin undergoes activation to produce a shorter mature enzyme.
- the subtilisin undergoes activation from a -125 kDa protein to a -75-80 kDa protein as determined by SDS-PAGE.
- the subtilisin enzyme has a functional pH range of 6.0-10.0. as determined by detectable Z-YPQ-pNA cleaving activity described herein. For example, a detectable Z- YPQ-pNA cleaving activity within a 72 hour digestion period or substantially complete Z-YPQ-pNA cleavage within a 1 hour digestion period.
- the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
- the subtilisin enzyme is a R. mucilaginosa-derrved subtilisin enzyme.
- subtilisin is inhibited PMSF. In another embodiment, the subtilisin is 100% inhibited by ImM of PMSF.
- subtilisin is not inhibited by E64 or EDTA.
- subtilisin is not stable in acid conditions.
- subtilisin is lyophilized.
- the lyophilized subtilisin is formulated into granules or is encapsulated.
- subtilisin is a protein isolated from Rothia sp. bacteria.
- protein purification methods from cell extracts of Rothia sp. methods that are known in the art, for example, as described in the Example section.
- the subtilisin is an isolated recombinant protein.
- the subtilisin nucleic acid coding sequence is expressed in another organism other than Rothia sp.
- the subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 (See Section on subtilisins and subtilisin-like enzymes).
- subtilisin comprises SEQ. ID. NO: 1, 2 or 3.
- subtilisin consists of SEQ. ID. NO: 1, 2 or 3.
- subtilisin consists essentially of SEQ. ID. NO: 1, 2 or 3.
- subtilisin is SEQ. ID. NO: 1, 2 or 3.
- the formulation further comprising a prolyl endopeptidase (PEP).
- PEP prolyl endopeptidase
- the formulation further comprising at least one additional gluten- degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten- degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ-pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
- the at least one additional gluten-degrading enzyme is not a subtilisin or a subtilisin-like protein isolated from a Rothia sp. bacteria.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 is derived from the Rothia species Rothia species ot 188, also known as Rothia sp. HOT- 188 , Raeria strain F0474 (HMP ID 1324), R. aeria HM-818, and Rothia aeria strain WSA-8.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an iso-electric point in a pH range of 2.0-4.0, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight between 120-150kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight of 135-145kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight between 50 and 90kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 65 and 75 kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 75 and 80 kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 65 and 80 kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 retains activity at the pH between 2.5 and 5.0, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 degrades a gliadin protein, a fragment thereof, or a gluten-containing foodstuff or ingredient thereof.
- the degradation is partial.
- the degradation is complete.
- the fragment thereof is a 33-mer peptide of ot2-gliadin or a 26- mer domain derived from ⁇ -gliadin.
- the 33-mer peptide is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoe
- the 26-mer domain is FLQPQQPFPQQPQQPYPQQPQQPFPQ (SEQ ID NO: 6).
- the degradation by the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 occurs by cleaving the peptide bond after an amino acid sequence selected from the group consisting of -XPQ- -QQP-, -PPF-, - LPY-, -XPY- and - PFP-.
- the formulation or composition further comprising at least one isolated additional glutamine endopeptidase enzyme that cleaves a peptide bond after a QPF and a PFP motif in glutens.
- the at least one additional glutamine endopeptidase enzyme is not a subtilisin or a subtilisin-like protein isolated from a Rothia sp. bacteria.
- the degradation by the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 occurs by cleaving the peptide bond after an amino acid sequence selected from the group consisting of -XPQ-,-QQP-, -PPF-, - LPY- , -XPY- and - PFP-.
- degradation or digestion occurs by cleaving the peptide bonds after amino acid sequences XPQ and QQP; XPQ and PPF; XPQ and PFP; XPQ and LPY; QQP and LPY; PPF and LPY; PFP and LPY; XPQ, QQP and PPF; XPQ, QQP and LPY; QQP, PPF, and PFP; XPQ, PPF and PFP; QQP, PPF and PFP; QQP, PPF and LPY; XPQ, PPF and LPY; PY, PPF, and PFP; QQP, PFP and LPY; XPQ, PFP and LPY; XPQ, PFP and LPY; XPQ, QQP, PPF and LPY; XPQ, QQP, PPF and LPY; LPY, QQP, PPF and PFP; XPQ, QQP
- the PEP is derived from the microorganism selected from the group consisting of Aspergillus niger, Flavobacterium meningosepticum, Sphingomonas capsulata, Penicillium citrinum, Hordeum vulgar e, and Myxococcus xanthus.
- the formulation or composition further comprising a glutamine specific protease which is selected from the group consisting of Hordeum vulgare endoprotease, Aspergillus oryzae X-Pro dipeptidase, and Aspergillus saitoi carboxypeptidase.
- glutamine specific proteases as described in US Patent No. 7628985, the contents are incorporated by reference in their entirety.
- formulation or composition further comprising a
- composition is a pharmaceutical composition comprising the subtilisin described herein and a pharmaceutically acceptable carrier.
- the related disorder is selected from the group consisting of refractory celiac disease, gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis.
- treating or “treatment” with respect to a medical disease or disorder means to stabilize and/or improve the clinical symptoms of a subject afflicted with celiac disease or a related disorder.
- “treating” or “treatment” means to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression or anticipated progression of such condition, or bringing about ameliorations of the symptoms of the pathology.
- Evidence of a therapeutic effect may be any diminution in the severity of disease, particularly as measured by the severity of one or more symptoms such as fatigue, chronic diarrhea, malabsorption of nutrients, weight loss, abdominal distension, anemia, and other symptoms of Celiac Sprue.
- disease indicia include the presence of antibodies specific for glutens, the presence of antibodies specific for tissue transglutaminase, the presence of pro-inflammatory T cells and cytokines, damage to the villus structure of the small intestine as evidenced by histological or other examination, enhanced intestinal permeability, and the like.
- effective treatment according to the methods described herein is determined by a reduction in at least one symptom of Celiac Sprue, gluten allergy, gluten intolerance and/or dermatitis herpetiformis by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99% or even 100% (e.g., remission or absence of symptoms).
- treatment according to the methods and compositions described herein induces a state of remission in celiac disease, or a related disorder, or non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors.
- the term “treating" or “treatment” with respect to a gluten-containing foodstuff means degrading or digesting the foodstuff to reduce the production of toxic gluten oligopeptides when the foodstuff is subsequently ingested and further digestion by a subject.
- the subject is a human.
- "treating" or “treatment” of a gluten-containing foodstuff results in complete elimination of toxic gluten oligopeptides when the foodstuff is subsequently ingested and further digestion by a subject.
- the "treating" or “treatment” of a gluten-containing foodstuff results in at least 10% reduction of toxic gluten oligopeptides when the foodstuff is
- treatment of a gluten-containing foodstuff results in at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99% or even 100% reduction of toxic gluten oligopeptides when the foodstuff is subsequently ingested and further digestion by a subject.
- the term "effective dose" with respect to a medical disease or disorder refers to an amount of a biologically active molecule or conjugate thereof, enzyme, or bacterial formulation (e.g., probiotic formulation) sufficient to exhibit a detectable therapeutic effect, e.g. reduction in the symptoms associated with Celiac sprue, gluten allergy and/or dermatitis herpetiformis, e. g. fatigue, chronic diarrhea, malabsorption of nutrients, weight loss, abdominal distension, anemia, the presence of antibodies specific for tissue transglutaminase, the presence of pro-inflammatory T cells and cytokines, and damage to the villus structure of the small intestines.
- a biologically active molecule or conjugate thereof, enzyme, or bacterial formulation e.g., probiotic formulation
- the specific amount that is therapeutically effective can be readily determined by an ordinary medical practitioner, and can vary depending on factors known in the art, such as, for example, the subject's history and age, the stage of pathological processes, and the administration of other agents or therapeutics that inhibit pathological processes in Celiac sprue, gluten allergy and/or dermatitis herpetiformis.
- the term "effective dose” or "effective amount” with respect to the treatment of a gluten-containing foodstuff refers to the amount of a biologically active molecule or conjugate thereof, enzyme, or bacterial formulation (e.g., probiotic formulation) sufficient to produce at least 10% reduction of toxic gluten oligopeptides when the foodstuff is subsequently ingested and further digestion by a subject.
- an extract from a Rothia species refers to a clarified aqueous solution that formerly comprised a Rothia species for example, a suspension of Rothia species in phosphate buffered saline (PBS) that was agitated for 1 hour at room temperature and then centrifuged at 1000 x G for 10 minutes to sediment the bacteria.
- PBS phosphate buffered saline
- the supernatant PBS fluid is "an extract from a Rothia species”.
- a clarified saliva sample is "an extract from a Rothia species” .
- An extract from a Rothia species can also mean a clarified periplasmic extraction of a Rothia species, for example, a suspension of Rothia species in phosphate buffered saline (PBS) with 20% or 500 mM sucrose and is then agitated for 1 hour at 4°C and then centrifuged at 1000 x G for 10 minutes to sediment the bacteria. In the presence of high sucrose concentration, the bacteria undergo osmotic shock.
- PBS phosphate buffered saline
- Such methods of making periplasm extracts are well known to those skilled in the art, e. g. as described in US Patent 5856142.
- An extract from a Rothia species can also mean a clarified cell lysate of a Rothia species, wherein the bacteria are lysed in a suitable buffer and the lysate is centrifuged at 20,000 x G for 30 minutes to sediment the cell debris.
- Ultracentrifugation clarified cell lysate of a Rothia species is also "an extract from a Rothia species”.
- An extract from a Rothia species can also mean a chromatography fraction containing a a -70-80 kDa protein or a ⁇ 125- ⁇ 140kDA with gluten-degrading activity (e.g., glutamine endopeptidase activity) as assayed by gliadin zymography and other methods described herein.
- gluten-degrading activity e.g., glutamine endopeptidase activity
- a glutamine endopeptidase refers to a proteolytic peptidase that breaks peptide bonds of non-terminal amino acids (i.e. within a protein or peptide molecule) at the -XPQ- or -Xaa-Pro-Gln- triplet sequence and the breakage occurs immediately after the glutamine residue.
- X or Xaa any amino acids
- P or Pro proline
- a glutamine endopeptidase cleaves peptide bonds at either one of the following the -QQP-, and -PFP triplet sequences.
- a glutamine endopeptidase can also cleave a -XPY- or-Xaa-Pro-Tyr triplet sequence.
- a glutamine endopeptidase is capable of cleaving several of the -XPQ-, -QQP-, -PPF- and -PFP- triplet sequences.
- the term "glutamine endopeptidase” encompasses proteases that typically degrade salivary basic proline-rich proteins in saliva, and as such, have glutamine endopeptidase activity to degrade proline-rich glutens.
- the term "digest” or “degrade” with respect to a gluten- containing foodstuff, gluten, gliadin or fragment thereof refers to breaking a peptide bond in the protein or peptide molecule in the gluten-containing foodstuff, gluten, gliadin or fragment thereof.
- the term “acidic pH” refers to pH values less than 7.0 (e.g., 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5).
- the term “basic pH” refers to pH values greater than 8.0 (e.g., 8.5, 9.0, 9.5, 10.0, 10.5, 11.0, 11.5, 12.0, 12.5, 13.0, 13.5, 14.0).
- neutral pH refers to pH values from 7.0 to 8.0, inclusive (e.g., 7.0, 7.2, 7.4, 7.6, 7.8, 8.0).
- the term "attenuates gluten toxicity" refers to a decrease in the level of gluten proteins or gluten toxic intermediates (e.g., as measured in a subject having celiac disease and administered a gluten challenge) of at least 20% following treatment with the enzyme compositions described herein compared to an untreated subject; preferably the level of gluten proteins or gluten toxic intermediates are decreased by at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99%, or even 100% (i.e. no detectable glutens or gluten toxic intermediates).
- toxic intermediates refers to gluten protein fragments produced by the digestion of gluten with human digestive enzymes such as trypsin, chymotrypsin, and pepsin, that induce symptoms of celiac disease or a related disorder (see also "toxic gluten oligopeptides" definition herein).
- related disorder refers to diseases induced by gluten and include, but are not limited to, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, gluten allergy, refractory celiac disease, and dermatitis herpetiformis.
- admix in the context of gluten-containing foodstuff refers to mixing or blending with gluten-containing foodstuff.
- the product arising from the mixing or blending is an
- glutens refers to a mixture of proteins, including gliadins and glutelins, found in wheat grains, which are not soluble in water and which give wheat dough its elastic texture. "Glutens” also refer to the prolamine that are found in rye, barley, and oats.
- glutelin refers to prolamin-like proteins that are found in grass seeds, e. g. wheat, and are soluble in dilute acids or bases, detergents, chaotropic or reducing agents. "Glutelin” tend to be rich in prolines and glutamine.
- prolamins refers to a group of plant storage proteins having high proline content and is found in the seeds of cereal grains such as wheat (gliadin), barley (hordein), rye (secalin), corn (zein) and as a minor protein, avenin in oats. They are characterized by a high glutamine and proline content and are generally soluble only in strong alcohol solutions. Some prolamins, notably gliadin from wheat, and similar proteins found in the grass seed of the Triticeae species can induce celiac disease in genetically predisposed individuals.
- gliadin refers to the alcohol-soluble, glutamine and proline-rich prolamin glycoprotein that is found in wheat. This is one of the proteins that induce celiac disease in genetically predisposed individuals.
- gliadin sequences include but are not limited to wheat alpha gliadin sequences, for example as provided in GENBANK accession numbers AJ133612;
- a sequence of wheat omega gliadin is set forth in Genbank accession number AF280605.
- gluten-containing foodstuff refers to food and/or ingredients of food that has gluten and other proteins found in wheat, barley, and rye. "Gluten-containing foodstuff also refers to food and/or ingredients of foods that are made of wheat, barley, and rye. It is also contemplated that "gluten-containing foodstuff can be foodstuff that is merely contaminated with gluten by way of the use of common manufacturing equipment. For example, oats do not contain gluten, however, because oats are a major agricultural product they are handled by the same mills, processing plants, and grain elevators that handle wheat, barley and rye.
- gluten-containing foodstuff formulations of drugs, medications, vitamin supplements or mineral supplements that are contaminated by or prepared using gluten-containing foods such as wheat, barley, or rye.
- consuming gluten-containing foodstuff refers to ingesting food made of wheat, rye, and barley, e. g. pizza, cake, bread, etc. as well as ingesting food made with ingredients that are made with wheat, rye, and barley, e. g. soy sauce.
- the term "diagnosed of Celiac sprue, gluten allergy/gluten intolerance and/or dermatitis herpetiformis” refers to having the symptoms associated with Celiac sprue, gluten allergy and/or dermatitis herpetiformis, e. g. fatigue, chronic diarrhea, malabsorption of nutrients, weight loss, abdominal distension, anemia, the presence of antibodies specific for tissue transglutaminase (ATA), antibodies specific for ⁇ / ⁇ , ⁇ -gliadin (AGA), the presence of pro-inflammatory T cells and cytokines, and damage to the villus structure of the small intestines.
- ATA tissue transglutaminase
- AGA ⁇ / ⁇ , ⁇ -gliadin
- oligopeptides refers to peptides derived during normal human digestion of gliadins and related storage proteins from dietary cereals, e.g. wheat, rye, barley, and the like. Such oligopeptides act as antigens for T cells in Celiac Sprue.
- immunogenic peptides are usually from about 8 to 20 amino acids in length, more usually from about 10 to 18 amino acids.
- Such peptides may include PXP motifs, such as the motif PQPQLP (SEQ. ID. NO: 7).
- Toxic gluten oligopeptides also refers to peptides that comprise known T cell epitopes in gluten, e .g. QLQPFPQPQLPY (SEQ. ID. NO: 8) or PFPQPQLPY (SEQ. ID. NO: 9), PQPQLPYPQPQLPY (SEQ. ID. NO: 10) or PQPQLPYPQ (SEQ. ID. NO: 11), QPQQSFPQQQ (SEQ. ID. NO: 12) or PQQSFPQQ (SEQ. ID. NO: 13), QLQPFPQPELPY (SEQ. ID. NO: 14), PQPELPYPQPELPY (SEQ. ID. NO: 15), QPQQSFPEQQ (SEQ. ID. NO: 16);
- IQPQQPAQL (SEQ. ID. NO: 17); QQPQQPYPQ (SEQ. ID. NO: 18); SQPQQQFPQ (SEQ. ID. NO: 19); QQPFPQQPQ (SEQ. ID. NO: 20); or PFSQQQQPV (SEQ. ID. NO: 21), including 33-mer from alpha- gliadin, LQLQPF(PQPQLPY) 3 PQPQPF (SEQ. ID. NO: 5), and the 26-mer from gamma-gliadin, FLQPQQPFPQQPQQPYPQQPQPFPQ (SEQ. ID. NO: 6).
- isolated refers to an enzyme protein which is substantially or essentially free from bacterial components which normally accompany or interact with the enzyme as found in the bacteria.
- isolated can also refer to mixtures of enzyme proteins comprising a plurality of different enzymes substantially free from bacterial components (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more different enzymes).
- the term "inhibited” or “inhibition” when used in the context with the glutamine endopeptidase activity means the reduction of the cleavage of-XPQ-, -XPY-, -QQP-, -PPF- and/or - PFP-containing peptides by at least about 50%, about 60%, about 70%, about 80%, about 90%, about 100% (i.e., level of XPQ -containing peptides is undetectable by standard methods) by any assay described herein or known in the art, wherein X is any amino acid, P is proline, Q is glutamine, Y is tyrosine, and F is phenylalanine.
- the term "gluten degrading activity" with respect to the compositions comprising an isolated enzyme, a plurality of isolated enzymes, an extract from Rothia species, a plurality of extracts from more than one Rothia species, a Rothia species bacteria itself, or a plurality of Rothia species bacteria refers to the capability of the composition to cleave -XPQ-, -XPY-, -QQP-, -PPF- and/or -PFP- containing peptides by at least about 50%, about 60%, about 70%, about 80%, about 90%, about 100% (i.e., level of XPQ-containing peptides is undetectable by standard methods) by any assay described herein or known in the art, wherein X is any amino acid, P is proline and Q is glutamine.
- the cleavage is preferably at peptide bonds of non-terminal amino acids (i.e. within a protein or peptide molecule) and the breakage occurs immediately after the glutamine residue for -XPQ- sequence, immediately after the proline residue for - QQP- or -PFP- sequence, and immediately after the phenylalanine residue for -PPF- sequence.
- retain activity in acidic pH environment or "retain protease activity” refers to an isolated enzyme from Rothia species described herein that is still has gluten degrading activity when the enzyme is in an environment with pH less than 7.0.
- the term "inclusive" when used with pH or molecular weight of a molecule means that all possible gradation of the pH or molecular weight in contemplated within the specified range. For example, if pH is 3.0 to 4.0 inclusive, then pHs of 3.02, 3.1, 3.14, 3.2, 3.75, 3.99 etc are also contemplated.
- subtilisin and “subtilisin-like enzyme” means a protease that comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
- Subtilisin and subtilisin-like enzyme are used interchangeably when referring to the enzyme derived from the Rothia sp. bacteria.
- An enzyme that is "derived from Rothia sp.” means the enzyme is isolated directly from the bacteria or the enzyme is a recombinant expressed protein from a coding nucleic acid sequence deduced from the Rothia sp.”
- phrases "pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- phrases "pharmaceutically acceptable carrier” as used herein means a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in e.g., absorption, carrying or transporting the subject agents from one organ, or portion of the body, to another organ, or portion of the body.
- a pharmaceutically acceptable material such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in e.g., absorption, carrying or transporting the subject agents from one organ, or portion of the body, to another organ, or portion of the body.
- Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation, for example the carrier does not decrease the impact of the agent on the treatment.
- the term “comprising” or “comprises” is used in reference to compositions, methods, and respective component(s) thereof, that are essential to the invention, yet open to the inclusion of unspec
- the term "consisting essentially of” refers to those elements required for a given embodiment. The term permits the presence of elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment of the invention.
- compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.
- FIGS 1A-1C show the isolation of R. mucilaginosa gluten-degrading enzymes by DEAE chromatography.
- R. mucilaginosa cells were lysed, sonicated, the supernatant ultracentrifuged, and the pellet dissolved in n-Octyl- -D-glucopyranoside.
- Figure 1A shows the separation of proteins by DEAE chromatography applying an isocratic gradient containing 0.3M NaCl and 50 mM TrisHCl pH 7.0.
- Figure IB shows a representative SDS-PAGE gel of the DEAE chromatography fractions. Protein content in 100 ⁇ fraction aliquots investigated by 4-12% SDS PAGE.
- Figure 1C is a histogram showing the enzyme activity in 50 ⁇ fraction aliquots investigated with Z-YPQ-pNA as the substrate. The data shown are representative of two independent experiments.
- Figures 2A-2E demonstrate the identification of the gluten-degrading enzymes of R.
- Figure 2A shows a representative SDS-PAGE gel of the DEAE chromatography pooled fractions. Protein content in 400 ⁇ aliquots of F1-F7 were analyzed on a 4-12% SDS-PAGE gel.
- Figure 2B shows a representative gliadin zymogram gel of the DEAE chromatography pooled fractions. Gliadin-degrading enzyme activity in 200 ⁇ desalted aliquots of F1-F7 were analyzed on a 6% gliadin zymogram gel.
- Figure 2C shows a representative non-reducing PAGE gel of the DEAE chromatography fraction F2.
- the PAGE gel under non-reducing conditions of R. mucilaginosa enzyme preparation (Rmep) (F2) was loaded amounts 4, 8, 16, 32 ⁇ g protein in lanes 1-4, respectively.
- Figure 2D shows a representative casein zymogram of the DEAE chromatography fraction F2.
- the casein zymogram of F2 was loaded amounts 2, 4, 8, and 16 ⁇ g in lanes 1-4, respectively.
- Figure 2E is a table showing the proteins identified in excised gel bands labeled a-e in Figures 2C and 2D. The data shown are representative of at least four independent experiments.
- Figures 3A-3D are representative histograms showing the effects of pH and inhibitors on R. mucilaginosa enzyme preparation (Rmep) activity.
- Figure 3A shows the enzymatic activity of R. mucilaginosa enzyme preparation (Rmep) at various pH. Activity of Rmep in 0.1M Citric acid/0.2M phosphate buffer mixtures, pH 2-12, was measured with Suc-AAPF-pNA (SEQ. ID. NO: 4) (200 ⁇ ) as the substrate.
- Rmep R. mucilaginosa enzyme preparation
- FIG. 3B shows the inhibitor profile of R. mucilaginosa enzyme preparation (Rmep).
- Inhibitors AEBSF, Aprotinin, E-64, EDTA, PMSF and Eglin C were tested at final concentrations of 10 mM, 0.08 mM, 0.1 mM, 1.5 mM, 1 mM, and 0.06 ⁇ , respectively.
- Rmep was added at a final concentration of 5.7 ⁇ g/ml.
- the percent inhibition was determined from the ratio of the initial velocities of hydrolysis of Suc-AAPF-pNA (SEQ. ID. NO: 4) in the absence and presence of inhibitor.
- Figure 3C shows the inhibition of Bacillus subtilis sp. subtilisin A with a higher concentration Eglin C (1.2 ⁇ ).
- Figure 3D show the inhibition of R. mucilaginosa enzyme preparation (Rmep) with a higher concentration Eglin C (1.2 ⁇ ).
- Figures 4A-4E demonstrate the cleavage specificities of R. mucilaginosa enzyme preparation (Rmep) and B. subtilis subtilisin A.
- Figure 4A and Figure 4B are representative graphs of the hydrolysis of the substrates: Suc- AAPF-pNA (SEQ. ID. NO: 4), Z-YPQ-pNA, and Z- LPY -pNA, each at 200 ⁇ , by Rmep and subtilisin A, respectively, each at 1 ⁇ g/ml.
- Figure 4C show a representative graph of the hydrolysis of the substrate, LPY, by Rmep and subtilisin A at 5 ⁇ g/ml and extended incubation times.
- FIG. 4D and Figure 4E are representative graphs of the hydrolysis of gliadin-derived FRET substrates.
- FRET substrates containing QPQLPY (SEQ. ID. NO: 22), PQPQPQ (SEQ. ID. NO: 23) and QGSFQP (SEQ. ID. NO: 24), each at 100 ⁇ were incubated with Rmep ( Figure 4E) and subtilisin A ( Figure 4E), at 1 ⁇ g/ml and 0.5 ⁇ g/ml, respectively.
- Controls were boiled Rmep and subtilisin A incubated with PQPQLPY (+)(SEQ. ID. NO: 25), PQPQPQ (0)(SEQ. ID. NO: 23) and QGSFQP (*) (SEQ. ID. NO: 24) (no activity, baseline).
- Figures 5A-5D demonstrate the degradation of mixed gliadins by R. mucilaginosa enzyme preparation (Rmep) and the abolishment of immunogenic epitopes by Rmep.
- Figure 5A is a representative SDS-PAGE gel of non-digested gliadins (control) and Rmep- treated gliadins.
- Gliadins 250 ⁇ g/ml
- Rmep 50 mM Tris/HCl pH 8.0
- Rmep 50 mM Tris/HCl pH 8.0
- the bold arrow (left) points to the position of the major band in the gliadin preparation; the thin arrow (right) to the 125kDa band in the Rmep preparation, and the dotted arrows (right) to the gliadin degradation fragments.
- Figure 5B is a representative chromatogram of the RP-HPLC of the degradation of the immunogenic 33-mer peptide from a-gliadin. Arrow (top) points to the intact 33-mer.
- Figure 5C and Figure 5D show the assessment of the survival of epitopes in the gliadin-Rmep degradation mixture employing the R5 ELISA ( Figure 5C) or G12 ELISA ( Figure 5D) assays.
- Figures 6A-6D demonstrate the degradation of mixed gliadins by B. subtilisis subtilisin A and abolishment of immunogenic epitopes by B. subtilisis subtilisin A.
- Figure 6A is a representative SDS-PAGE gel of non-digested gliadins (control) and subtilisin A- treated gliadins. Gliadins (250 ⁇ g/ml) in 50 mM Tris/HCl pH 8.0 were incubated with subtilisin A at 57 ⁇ g/ml. Experiments were conducted as described in the legend of Figure 5 with subtilisin A instead of Rmep.
- Figure 6B is a representative chromatogram of the RP-HPLC of the degradation of the immunogenic 33-mer peptide from a-gliadin with subtilisin A. Arrow (top) points to the intact 33-mer.
- Figure 6C and Figure 6D show the assessment of the survival of epitopes in the gliadin- subtilisin A degradation mixture employing the R5 ELISA ( Figure 6C) or G12 ELISA ( Figure 6D) assays.
- FIG. 7 Domain composition of C6R5V9 9MICC.
- the protein of 1328 amino acids contains a peptidase S8 propeptide domain (also called proteinase inhibitor 19), a peptidase S8/S53 family domain, an immunoglobulin-like fold domain, and 3 surface layer homology domains. This figure is based on InterPro analysis.
- Figures 8A-8F demonstrate the gliadin degradation and epitope abolishment by a nattokinase enzyme (NattoK) derived from B. subtilis.
- NattoK nattokinase enzyme
- Figure 8A is a representative SDS-PAGE gel of non-digested gliadins (control) and NattoK - treated gliadins.
- Mixed gliadins G, 250 ⁇ g/ml
- NattoK 57 ⁇ g/ml
- Figure 8B is a representative SDS-PAGE gel of non-digested gliadins (control) and diluted NattoK-treated gliadins. Dilution series of NattoK (3.5-0.06 ⁇ g/ml) incubated for 30 min with mixed gliadins. Right lanes, gliadin (G) and NattoK (NK) control.
- Figure 8C show a representative graph of the hydrolysis of the substrate, Suc-AAPF-pNA (SEQ. ID. NO: 4), with a dilution series of NattoK.
- Suc-AAPF-pNA SEQ. ID. NO: 4
- Suc-AAPF-pNA SEQ. ID. NO: 4
- Hydrolysis was measured at 405 nm.
- Figure 8D is a representative chromatogram of the RP-HPLC analysis of the degradation of the gliadin-derived 33-mer (250 ⁇ g/ml) incubated for 0, 15, 30 and 120 min with NattoK 57 ⁇ g/ml).
- Figure 8E and Figure 8F show the assessment of the survival of epitopes in the gliadin- NattoK degradation mixture employing the R5 ELISA ( Figure 8E) or G12 ELISA ( Figure 8F) assays.
- Epitope abolishment in Mixed gliadins 250 ⁇ g/ml were incubated with NattoK (57 ⁇ g/ml) for 0, 15, 30 and 120 min and then assayed by the R5 ELISA or G12 ELISA.
- Figure 9 is a representative SDS-PAGE gel showing the gliadin degradation by a dilution series of Rmep from R. mucilaginosa.
- Mixed gliadins 250 ⁇ g/ml
- 50 mM Tris, pH 8.0 were incubated with Rmep ranging from 57 to 0.88 ⁇ g/ml for 30 min. Aliquots of 100 ⁇ are loaded on the gel.
- Figure 10 Multiple sequence alignment of subtilisins derived Rothia using CLUSTAL O (1.2.1) (SEQ ID NOS 43-58, 3, 59-63, 2, 64-66, 33, 67-81, 1, and 82-84, respectively, in order of appearance). Underlined enzymes, C6R5V8 9MICC, C6R5W1 9MICC, and C6R5V9 9MICC are those identified in this disclosure.
- Figure 11 shows the phylogenetic tree (Clustal Omega) of Rothia subtilisins revealing 8-9 distinct groups. Boxed are the enzymes identified in this disclosure.
- Figures 12A-12B show the identification of the gluten-degrading enzyme, subtilisin proteins from Rothia aeria.
- Figure 12A shows a representative SDS-PAGE gel part stained with Coomassie Brilliant Blue.
- Figure 12B shows a representative zymogram gel corresponding to the SDS-PAGE gel part, the zymogram was developed as a using externally added casein as the enzyme substrate to visualize bands with enzyme activity (indicated with an arrow). Bands 1-4 were excised and subjected to mass spectrometric analysis of the amino acid sequences and identification of the protein. The protein was identified as BAV86562.1 from Rothia aeria.
- Figure 13 show the CLUSTAL 2.0.12 alignment of protein KGJ00122.1 (SEQ ID NO: 33) from Rothia dentocariosa, and protein BAV86562.1 (SEQ ID NO: 34) from Rothia aeria. Both enzymes belong to the peptidase S8 family of subtilisin enzymes. The * symbol underneath the sequence indicates an identical amino acid at that position in both protein sequences. The proteins are >99% homologous.
- Figure 14 shows the alignment of the amino acid sequences of subtilisins from R. mucilaginosa (WP 044143865.1, (SEQ ID NO: 64); WP_044143864.1, (SEQ ID NO: 82)), R. aeria (BAV86562.1, (SEQ ID NO: 34)), B. licheniformis (P00780.1, (SEQ ID NO: 35)) and B. subtilis NAT (P35835.1, (SEQ ID NO: 35)).
- Underlined conserved amino acids are the D, H and S residues that participates in the catalytic triad of subtilisins.
- Figures 15A-15F show effective ATI degradation by subtilisins from B. subtilis (nattokinase). This demonstrates that nattokinase (and other subtilisin-related enzymes) can also be used to inactivated ATIs in gluten and thus be of benefit for patients with non-celiac wheat sensitivity.
- ATI 500 ⁇ g/ml
- Rmep from R. mucilaginosa
- Figure 15A Figure 15A or nattokinase from B.
- subtilis Figure 15C
- Figures 15B and 15D Gliadins (500 ⁇ g/ml) incubated with Rmep (Figure 15B) or nattokinase (Figure 15D) at 25 ⁇ g/ml.
- Figures 15E and 15F ATIs incubated with control heat inactivated enzymes, Rmep ( Figure 15E) or nattokinase ( Figure 15F).
- Figures 16A-16D demonstrate that ethanol treated gluten-degrading enzyme contain bacteria are not viable but their intrinsic gluten-degrading enzymatic activities are intact after ethanol treatment.
- the Rothia-derived proteins with gluten-degrading enzymatic activity were identified as hypothetical proteins ROTMU0001_0241 (C6R5V9_9MICC, WP_044143864.1 peptidase S8), ROTMU0001_0243 (C6R5W1_9MICC, WP_044143865.1 peptidase S8) and ROTMU0001_240 (C6R5V8_9MICC, WP_005509166.1 peptidase S8) SEQ ID NO: 1-3 respectively.
- a blast search revealed that these are subtilisin-like serine proteases belonging to the peptidase S8 family.
- the numbering of the amino acid position (e.g., PI, P2, P3) is with respect to the peptide bond that is cleaved by the enzyme described.
- the amino acid residue immediately upstream of the cleavage peptide bond is designated the position PI
- the amino acid residue immediately upstream of the PI amino acid residue is P2.
- Phe PI position
- Pro P2 position
- Ala P3 and P4 positions.
- FRET substrates of gliadin immunogenic epitopes comprising Xaa-Pro-Xaa motives were rapidly hydrolyzed.
- the Rothia subtilisins as well as other subtilisins from Bacillus sp.
- subtilisin A and nattokinase could degrade the highly immunogenic gliadin-derived 33-mer peptide. Furthermore, major gluten antigenic epitopes were efficiently eliminated by both subtilisins, as demonstrated with R5 and G12 gliadin ELISA assays. Therefore, this study identified Rothia and food-grade Bacillus subtilisins as promising new candidates for enzyme
- gluten-degrading enzyme formulations and compositions comprising subtilisin derived from Rothia species bacteria, as well as uses thereof in the treatment of CD or a related disorder, and the treatment of gluten-containing foodstuff.
- compositions described herein are advantageous over other Rothia species enzyme compositions in that they retain gluten-degrading activity over a wide range of pH and thus, are active throughout the digestive tract of a subject diagnosed with celiac disease or a related disorder or non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors.
- CD celiac disease
- the increased awareness for CD in the medical community and the general public has led to improved diagnosis and earlier initiation of preventive strategies.
- the prevalence of CD ranges between ⁇ 1 : 100-1 :200 in most populations (1).
- the development of CD is dependent on exogenous and host-associated factors, whereby ingested gluten is the direct trigger of the disease, and the presence of HLA-DQ2 or HLA-DQ8 alleles, and tissue transglutaminase (TG2) activity are the major contributing host-associated factors (2).
- the disease is characterized by inflammation and flattening of the duodenal and jejunal villi, with a broad spectrum of symptoms, ranging from a clinically silent disease to severe malabsorption and a high risk for secondary autoimmune diseases (3).
- the major therapies currently being pursued target the immunogenic gluten peptides and the immune system e.g. using a vaccine-based strategy, gluten-degrading enzymes, luminal gluten binders, and inhibitors of the body's enzyme tissue transglutaminase which potentiates gluten antigenicity by deamidation (7).
- Enzyme therapies cleave gluten and thereby abolish immunogenic epitopes before they reach the lamina intestinal of the small intestine where T cell activation occurs (8, 9).
- Enzyme therapeutics have advantages. First, enzyme therapeutics are targeting the most upstream trigger, i.e. antigenic gluten peptides, rather than endogenous molecules or cells downstream in the cascade of intestinal
- a foodstuff comprising a formulation or composition comprising a subtilisin enzyme derived from a. Rothia sp. bacteria.
- a method for degrading gluten or attenuating the gluten in a gluten-containing foodstuff comprises contacting the gluten-containing foodstuff or an amylase-trypsin inhibitor containing foodstuff with an effective dose of a formulation or composition comprising a subtilisin enzyme derived from a. Rothia sp. bacteria.
- composition comprising (a) an isolated subtilisin and/or subtilisin-like enzyme derived from a Rothia sp. bacteria, and (b) a prolyl endopeptidase (PEP).
- PEP prolyl endopeptidase
- a method for treating celiac disease or a related disorder such as gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis the method comprising administering to a subject an effective dose of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or administering an effective dose of any one composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
- a use of a subtilisin enzyme derived from a Rothia sp. bacteria to attenuate gluten toxicity in gluten-containing food stuff or for the treatment of celiac disease or a related disorder.
- subtilisin enzyme derived from a Rothia sp. bacteria for the manufacture of medicament to treat of celiac disease or a related disorder.
- a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or any one composition described herein to attenuate gluten toxicity in gluten-containing food stuff or for the treatment of celiac disease or a related disorder.
- a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or any one composition described herein for the manufacture of medicament for the treatment of celiac disease or a related disorder.
- a method for detoxifying gluten comprising contacting gluten-containing foodstuff with an effective amount of with an effective dose of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria or a composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
- a method for detoxifying an amylase-trypsin inhibitor comprising contacting an amylase-trypsin inhibitor-containing foodstuff with an effective amount of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria or a composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
- a method for detoxifying gluten comprising contacting a gluten-containing foodstuff with an effective amount of the isolated enzyme composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
- a method for detoxifying an amylase-trypsin inhibitor comprising contacting the amylase-trypsin inhibitor-containing foodstuff with an effective amount an isolated enzyme composition comprising a subtilisin enzyme derived from a Rothia sp.
- a gluten-free foodstuff composition comprising a gluten- containing foodstuff in an admixture with a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
- the subtilisin enzyme is isolated from a Rothia sp. bacteria.
- the subtilisin enzyme is a recombinant protein expressed from any protein expression system known in the art and the protein expression system is not Rothia sp. bacteria.
- the recombinant subtilisin enzyme is expressed in expression bacteria Escherichia coli.
- a gluten-free foodstuff composition comprising a gluten- containing foodstuff in an admixture with the isolated enzyme formulation or composition comprising subtilisin enzyme derived from a Rothia sp. bacteria described herein and/or the probiotic composition comprising a Rothia sp. bacteria that expresses subtilisin enzyme described herein.
- a method of killing gluten-degrading bacteria without affecting their enzyme activities therein comprises incubation the bacteria with ethanol for a period of time sufficient for the bacteria to not be able to cell divide.
- a method for detoxifying gluten comprising contacting gluten-containing foodstuff with an effective amount of with an effective dose of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten- degrading enzymatic activities therein described herein, wherein the bacteria are cannot cell divide and are not alive or viable.
- a method for detoxifying an amylase-trypsin inhibitor comprising contacting amylase-trypsin inhibitor-containing foodstuff with an effective amount of with an effective dose of a formulation formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria are cannot cell divide and are not alive or viable.
- a method for detoxifying gluten comprising contacting gluten-containing foodstuff with an effective amount of the isolated enzyme composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
- a method for detoxifying an amylase-trypsin inhibitor comprising contacting the amylase-trypsin inhibitor-containing foodstuff with an effective amount of ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria are cannot cell divide and are not alive or viable.
- a foodstuff comprising a formulation or a
- composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria are cannot cell divide and are not alive or viable.
- a gluten-free foodstuff composition comprising a gluten- containing foodstuff in an admixture with formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein, or with an effective amount of ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein, wherein the bacteria are cannot cell divide and are not alive or viable.
- a method for degrading gluten or attenuating gluten toxicity in a gluten-containing foodstuff or degrading an amylase-trypsin inhibitor in a foodstuff comprises contacting the gluten-containing foodstuff or the amylase-trypsin inhibitor containing foodstuff with an effective dose of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
- a formulation or composition comprising ethanol- treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
- a method for treating celiac disease or a related disorder such as gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis, the method comprising administering to a subject an effective dose of a formulation or composition comprising ethanol-treated, and
- lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
- a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein to attenuate gluten toxicity in gluten-containing food stuff or to degrade an amylase-trypsin inhibitor in foodstuff for the treatment of celiac disease or a related disorder, wherein the bacteria cannot cell divide and are not alive or viable.
- a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein for the manufacture of medicament to treat of celiac disease or a related disorder, wherein the bacteria cannot cell divide and are not alive or viable.
- the contacting of the gluten-containing food stuff is performed in vitro prior to consumption of the gluten-containing food stuff or the amylase- trypsin inhibitor containing foodstuff respectively.
- the contacting of the gluten-containing food stuff is performed in vivo concurrent with or after consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
- the administering of the formulation or composition is performed in vitro prior to consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
- the administering of the formulation or composition is performed in vivo concurrent with or after consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
- the administering of the formulation or composition is performed in vitro prior to and also concurrent with or after consumption of the gluten- containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
- the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, , Rothia species ot 188, Rothia sp. HOT-188, Rothia aeria strain F0474 (HMP ID 1324), Rothia aeria HM-818, Rothia aeria strain WSA-8, Rothia aeria BAV86562.1 and Rothia dentocariosa KGI00122.1.
- the Rothia sp. bacteria is selected from the group consisting of R. mucilaginosa, R. aeria and R. dentocariosa.
- the subtilisin has the sequence ROTMU0001 0241 (also identified as C6R5V9_9MICC and WP_044143864.1 peptidase S8), ROTMU0001_0243 (also identified as C6R5W1_9MICC and WP_044143865.1 peptidase S8) and ROTMU0001_240 (also identified as C6R5V8_9MICC and WP_005509166.1 peptidase S8), KGJ00122.1 peptidase S8, and BAV86562.1 glycerol-3 -phosphate ABC transporter.
- ROTMU0001 0241 also identified as C6R5V9_9MICC and WP_044143864.1 peptidase S8
- ROTMU0001_240 also identified as C6R5V8_9MICC and WP_005509166.1 peptidase S8
- KGJ00122.1 peptidase S8 and BAV86562.1 g
- subtilisin is at least 90% identical to the sequences of ROTMU0001_0241 (C6R5V9_9MICC;WP_044143864.1 peptidase S8), ROTMU0001_0243
- the subtilisin is derived from a Rothia spp. and degrades gluten G12 epitope at least 50% faster than Bacillus spp. -derived subtilisin.
- the gluten G12 epitope degradation assay are known in the art and can be performed using any assay known.
- the Rothia spp. subtilisin is at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, or at least 85%, at least 90% faster than Bacillus spp. derived subtilisin.
- the subtilisin comprises the conserved catalytic triad that is characteristic of the S8A family of serine protease family, the conserved catalytic triad being Asp (D), His (H) and Ser (S) in the D-H-S order in the polypeptide.
- Regions 4 to 7 flank the regions 1 to 3 are found in the Rothia subtilisins only.
- region 1 (region 1)YTH (region 6) (SEQ ID NO: 30)
- region 2AAGYGV region 7) (SEQ ID NO: 31 )
- subtilisin cleaves proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and Xi is a hydrophobic amino acid, i.e., cleaving at the peptide bond after X 1; e.g. the XPQ motif, where Q is glutamine, and subtilisin cleaves the peptide bond after Q.
- a hydrophobic amino acid is one that has a hydrophobic side chain.
- the nine amino acids that have hydrophobic side chains are glycine (Gly), alanine (Ala), valine (Val), leucine (Leu), isoleucine (He), proline (Pro), phenylalanine (Phe), methionine (Met), and tryptophan (Trp).
- the subtilisin cleaves succinyl-Ala-Ala-Pro-Phe- jparanitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after the proline located at the P2 position in the substrate.
- the downward arrow incidates the site of cleavage by subtilisin.
- the numbering of the amino acid position is with respect to the peptide bond that is cleaved by the enzyme described.
- the amino acid residue immediately upstream of the cleavage peptide bond has designate the position PI, the amino acid residue immediately upstream of the PI amino acid residue is P2.
- the peptide bond that is cleaved is that after Phe, and Phe is the amino acid residue at the P 1 position, and Pro is the amino acid residue at the P2 position.
- subtilisin degrades the highly immunogenic gliadin-derived 33 -mer peptide.
- F is the amino acid residue at the PI position
- P x is the amino acid residue at the P2 position
- Py is the amino acid in the P ⁇ position (downstream from the sessile bond).
- F phenylalanine
- P proline.
- P y is the amino acid residue at the PI position
- P x is the amino acid residue at the P2 position.
- subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes.
- the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel
- the subtilisin undergoes autocatalytic activation to produce a shorter mature enzyme.
- Autocatalytic activation refers to the self-cleavage exhibited by subtilisin on its own polypeptide to form a shorter polypeptide that has further enzymatic cleavage on other proteins.
- the self-cleaving brings forth the enzymatic cleavage activity using other proteins as substrate.
- the shorter mature enzyme subtilisin is about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis as described herein.
- the subtilisin enzyme has a functional pH range of 6.0-10.0. as determined by detectable Z-YPQ-pNA cleaving activity. For example, a detectable Z-YPQ-pNA cleaving activity within a 72 hour digestion period or substantially complete Z-YPQ-pNA cleavage within a 1 hour digestion period.
- the subtilisin enzyme from R. mucilaginosa has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
- the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
- subtilisin is inhibited by phenylmethane sulfonyl fluoride (PMSF), a serine protease inhibitor.
- PMSF phenylmethane sulfonyl fluoride
- subtilisin is 100% inhibited by ImM of PMSF.
- subtilisin is not inhibited by E64 or
- subtilisin is not stable in acid conditions.
- subtilisin is lyophilized.
- subtilisin is a protein isolated from Rothia sp. bacteria. For example, by protein purification methods from cell extracts of Rothia sp.
- the subtilisin is an isolated recombinant protein.
- the subtilisin nucleic acid coding sequence is expressed in another organism other than Rothia sp.
- expression in yeast or Escherichia coli Method of recombinantly expressing proteins in other eukaryote or prokaryotic protein expression systems are known in the art.
- subtilisin nucleic acid coding sequence is codon optimized for efficient protein expression for the selected eukaryote protein expression systems in order to produce large quantities of recombinant Rothia sp. subtilisin.
- subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1-3, 33, and 34. (See Section on subtilisins and subtilisin-like enzymes).
- subtilisin comprises SEQ. ID. NO: 1-3, 33, and 34.
- subtilisin consists essentially of SEQ. ID. NO: 1-3, 33, and 34.
- subtilisin is SEQ. ID. NO: 1-3, 33, and 34.
- the formulation or composition further comprising a prolyl endopeptidase (PEP).
- PEP are also known as prolyl oligopeptidase (POP) or post-proline cleaving enzyme.
- PEP degrade the nonapeptide bradykinin at the Pro-Phe bond.
- the PEP is derived from a microorganism selected from the group consisting of Aspergillus niger, Flavobacterium meningosepticum, Sphingomonas capsulata, Penicillium citrinum, Hordeum vulgar e, and Myxococcus xanthus .
- the formulation or composition further comprising at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria that is not a subtilisin or subtilisin-like enzyme and does not contain the conserved catalytic triad, amino acids D, H, and S in the catalytic domain of S8 protease family.
- the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ-pNA.
- the formulation or composition described, the at least one additional gluten-degrading enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 is derived from the Rothia species are the enzymes disclosed in the PCT Patent Application No: PCT/USl 1/43118, PCT Patent publication No: WO2012006384, and the US Patent Application No. 20130171109, the contents of each are incorporated by reference in their entity.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 is derived from the Rothia species Rothia species ot 188, also known as Rothia sp. HOT-188 , Rothia aeria strain F0474 (HMP ID 1324), Rothia aeria HM-818, and Rothia aeria strain WSA-8.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an iso-electric point in a pH range of 2.0-4.0, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight between 120-150kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight of 135-145kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight of 125-145kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight between 50 and 90kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 65 and 75 kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 65 and 80 kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 75 and 80 kDa, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 retains activity at the pH between 2.5 and 5.0, inclusive.
- the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 degrades a gliadin protein, a fragment thereof, or a gluten-containing foodstuff or ingredient thereof.
- the fragment thereof is a 33-mer peptide of ot2-gliadin or a 26- mer domain derived from ⁇ -gliadin.
- the 33-mer peptide is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoe
- LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF (SEQ. ID. NO: 5).
- the 26-mer domain is FLQPQQPFPQQPQQPYPQQPQQPFPQ (SEQ. ID. NO: 6).
- the degradation by the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 occurs by cleaving the peptide bond after an amino acid sequence selected from the group consisting of -XPQ- -QQP-, -PPF-, -LPY- and -PFP-.
- the formulation or composition further comprising at least one isolated additional glutamine endopeptidase enzyme that cleaves a peptide bond after a QPF and a PFP motif in glutens.
- the additional glutamine endopeptidase enzyme are those enzymes disclosed in the US Patent No. 8685392, the contents are incorporated by reference in its entity.
- the degradation by the subtilisin, or by the at least one enzyme that retains protease activity at acidic pH of 3.0 or the glutamine endopeptidase described herein is partial.
- the degradation is about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95%.
- Various percentages of degradation between 20% to 99% are encompassed herein.
- the degradation by the subtilisin, or by the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 or the glutamine endopeptidase described herein is complete.
- the degradation by the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 occurs by cleaving the peptide bond after an amino acid sequence selected from the group consisting of -XPQ-,-QQP-, -PPF-, -LPY- and -PFP-.
- degradation or digestion occurs by cleaving the peptide bonds after amino acid sequences XPQ and QQP; XPQ and PPF; XPQ and PFP; XPQ and LPY; QQP and LPY; PPF and LPY; PFP and LPY; XPQ, QQP and PPF; XPQ, QQP and LPY; QQP, PPF, and PFP; XPQ, PPF and PFP; QQP, PPF and LPY; XPQ, PPF and LPY; LPY, PPF, and PFP; QQP, PFP and LPY; XPQ, PFP and LPY; XPQ, PFP and LPY; XPQ, PFP and LPY; XPQ, QQP, PPF and LPY; LPY, QQP, PPF and LPY; XPQ, QQP, PPF and LPY; LPY,
- the formulation or composition further comprising a glutamine specific protease which is selected from the group consisting of Hordeum vulgare endoprotease,
- Aspergillus oryzae X-Pro dipeptidase and Aspergillus saitoi carboxypeptidase.
- glutamine specific proteases as described in US Patent No. 7628985, and US Patent Application Publication No. 20130171 109, the contents of each are incorporated by reference in their entirety).
- formulation or composition further comprising a
- the related disorder is selected from the group consisting of refractory celiac disease, gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis.
- the composition is formulated into granules. For example, lyophilized enzyme protein granular preparation.
- the composition comprises lyophilized enzyme protein preparation.
- the composition is an oral formulation, such as in the form of a capsule, liquid, tablet, suspension, or enteric coated capsule or tablet.
- composition is formulated for treatment of celiac disease or a related disorder in a subject
- the composition is formulated for treatment of a gluten- containing foodstuff prior to ingestion by a subject having celiac disease or a related disorder, wherein the gluten-containing foodstuff is degraded in vitro.
- the subtilisin that is derived from Rothia sp., the at least one gluten-degrading enzyme, the isolated enzyme composition and/or the probiotic composition is administered in an admixture with a gluten-containing foodstuff for the purpose of degrading the gluten in the food.
- the enzyme is admixed with the ingredients during the manufacture of the food. In one embodiment, the enzyme is admixed with the ingredients during the preparation and/or cooking of the food.
- the isolated subtilisin enzyme retains activity in the admixture.
- the gluten-containing foodstuff is degraded partially prior to ingestion by the subject.
- the gluten-containing foodstuff is partially degraded to about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% prior to ingestion by the subject.
- Various percentages of degradation between 20% to 99% are encompassed herein.
- the gluten-containing foodstuff is degraded completely prior to ingestion by the subject.
- subtilisin that is derived from Rothia sp., the at least one additional gluten-degrading enzyme, the isolated enzyme composition or formulation described herein is administered to the subject as an oral formulation.
- subtilisin that is derived from Rothia sp., the at least one additional gluten-degrading enzyme, the isolated enzyme composition or formulation described herein is administered just prior to, during or just after consumption of a gluten-containing foodstuff.
- the gastrointestinal (GI) tract consists of distinct but connected anatomical regions, comprising the oral cavity, the oesophagus, the stomach, the small and the large intestine (DeSesso JM, and Jacobson CF. Food Chem Toxicol 2001; 39:209-28).
- the oral microbiome is described in Dewhirst et al., J Bacteriol. 2010, 192:5002-17.
- the entire GI tract is colonized with microorganisms with colonization levels showing a gradient being lowest in the stomach and increasing in density toward the proximal and distal ends.
- the proximal region, the oral cavity provides a rich environment for bacterial colonization as it contains a variety of different habitats and ecological niches.
- the GI tract is considered a "super organ" with functions contributed by human as well as bacterial genes (Camp JG, et al. Gastroenterology 2009; 136: 1989-2002; Turnbaugh PJ, et al. Nature 2006; 444: 1027- 31).
- Most Gl-colonizing microorganisms live in symbiosis with the host.
- the mutually beneficial relationship between the host and its colonizers is most evident in aspects related to digestion. Complex carbohydrates that cannot be degraded by the arsenal of human digestive enzymes can in most cases be hydrolyzed by bacterial glycosidases.
- bacteria belonging to the Bacteroides genus turn the non-digestable polysaccharides into small chain fatty acids that are subsequently metabolized by the host (Turnbaugh PJ, et al. Nature 2006; 444: 1027- 31).
- Ingested proteins are in part degraded by host proteolytic enzymes such as pepsin, elastase, carboxypeptidase, trypsin, and chymotrypsin converting them into oligopeptides and single amino acids which can then enter the enterocyte via selective transporters and be further metabolized or transported (Daniel H. Annu Rev Physiol 2004; 66:361-84).
- this mechanism is contingent upon the susceptibility of the substrate proteins to digestion by host enzymes.
- gluten proteins comprising gliadins and glutenins
- gliadins and glutenins are abundantly contained in dietary products made of wheat, barley and rye (Wieser H. Food Microbiol 2007;24: 115-9). They are unusual with respect to their high content of the amino acids proline and glutamine, which are largely resistant to cleavage by the major human GI digestive enzymes (e.g., pepsin, trypsin, chymotrypsin). Thus pepsin or trypsin are unable to cleave the peptide bonds C-terminal to these residues (Siegel M, et al. Chem Biol 2006;
- Celiac sprue also known as celiac disease, gluten-sensitive enteropathy, and gluten-induced enteropathy, is a chronic disease of the digestive tract that interferes with the digestion and absorption of nutrients from food. People with celiac sprue cannot tolerate gluten. Celiac disease is an inherited, autoimmune disease in which the lining of the small intestine is damaged from eating gluten and other proteins found in wheat, barley, rye, and gluten-contaminated oats. There is a propensity of Celiac disease in individuals who possess the HLA-DQ8 class II antigen receptor gene.
- T helper 1 cells and cytokines can play a major role in a local inflammatory process leading to villus atrophy of the small intestine.
- the intestines contain projections, called villi that absorb nutrients.
- the lining villi become damaged due to the body's immune reaction. In undiagnosed or untreated celiac disease, these villi become flattened.
- Celiac sprue is often considered a malabsorption disorder. This affects the ability to absorb nutrients properly.
- the disease can develop at any point in life, from infancy to late adulthood. Those with a family member with celiac disease are at greater risk for developing the disease.
- the disorder is most common in Caucasians and those of European ancestry and women are affected more commonly than men.
- the symptoms of celiac disease can vary significantly from person to person. This is part of the reason the diagnosis is frequently delayed. For example, one person may have constipation, a second may have diarrhea, and a third may have no irregularity in stools.
- a non-limiting list of gastrointestinal symptoms include abdominal pain, abdominal distention, bloating, gas, indigestion, constipation, decreased appetite that may also be increased or unchanged, diarrhea, chronic or occasional lactose intolerance which is common upon diagnosis, but usually goes away following treatment, nausea and vomiting, stools that float, are foul smelling, bloody, or "fatty", and unexplained weight loss although people can be overweight or of normal weight upon diagnosis.
- non-intestinal symptoms include anemia (low red blood cell count), bone and joint pain, bone disease such as osteoporosis, kyphoscoliosis, and fracture, breathlessness due to anemia, bruising easily, dental enamel defects and discoloration, depression, fatigue, growth delay in children, hair loss, hypoglycemia, irritability and behavioral changes, malnutrition, mouth ulcers, muscle cramps, nosebleeds, seizures, short stature, unexplained skin disorders (dermatitis herpetiformis), swelling which can be general or abdominal, and vitamin or mineral deficiency which can include single or multiple nutrient (for example, iron, folate, vitamin K).
- anemia low red blood cell count
- bone disease such as osteoporosis, kyphoscoliosis, and fracture
- breathlessness due to anemia bruising easily, dental enamel defects and discoloration, depression, fatigue, growth delay in children
- hair loss, hypoglycemia irritability and behavioral changes
- malnutrition mouth ulcers
- corticosteroids such as prednisone
- prednisone may also be prescribed for short-term use or in patients suffering from refractory sprue. Following a well-balanced, gluten-free diet is generally the only treatment needed to stay well.
- the current diagnosis method includes a complete blood count (CBC) to detect signs of anemia, testing for an increase in alkaline phosphatase level which may indicate bone loss, testing for low cholesterol and albumin levels which may be signs of malabsorption and malnutrition, testing for an increase in liver enzymes and abnormal blood clotting, and detection of specific antibodies to tissue transglutaminase and gliadin.
- CBC complete blood count
- the health care provider will order these antibody tests if Celiac sprue is suspected. If the tests are positive, upper endoscopy is usually performed to sample a piece of tissue (biopsy) from the first part of the small intestine (duodenum).
- a follow-up biopsy or blood work may be ordered several months after the diagnosis and treatment to confirm the disease. Normal results mean that the patient has responded to treatment, thereby confirming the diagnosis.
- the subject treated according to the methods and compositions described herein has been diagnosed with Celiac Sprue, gluten allergy/gluten intolerance and/or dermatitis herpetiformis.
- the subject is a mammal, preferably a human.
- Current diagnosis methods for Celiac sprue include but are not limited to one or more of serological tests, e.g. anti-gliadin antibodies, anti-transglutaminase antibodies, anti-endomysial antibodies; endoscopic evaluation, e.g. to identify celiac lesions; histological assessment of small intestinal mucosa, e.g. to detect villous atrophy, crypt hyperplasia, infiltration of intra-epithelial lymphocytes; and any GI symptoms dependent on inclusion of gluten in the diet.
- serological tests e.g. anti-gliadin antibodies, anti-transglutaminase antibodies, anti-endomysial antibodies
- endoscopic evaluation e.g. to identify celiac lesions
- NCWS Non-celiac/non-allergy wheat sensitivity due to amylase-trypsin inhibitors (ATIs) has an estimated prevalence of 5-10% in wheat (cereal) consuming populations.
- NCWS is characterized by intestinal and extra-intestinal symptoms related to the consumption of gluten-containing foods that are also enriched in ATIs. The diagnosis is made after CD and wheat allergy have been excluded and if the patients display typical symptoms and complaints within hours to days after consumption of ATI- containing cereals, mainly wheat, and remission of these symptoms within a few hours to days after stopping their consumption 1.
- the wheat components responsible for the initiation of an innate immune responses to wheat and related cereals in NCWS have been identified as ATIs.
- ATIs are a family of disulfide-linked and protease resistant proteins that occur as monomers, dimers and tetramers with molecular weights ranging from 12-60 kDa. ATIs bind to and activate the TLR4-MD2-CD14 complex on mainly myeloid cells (dendritic cells, macrophages, monocytes), ultimately resulting in the release of proinflammatory innate cytokines.
- R. mucilaginosa proteins There were three sequences of R. mucilaginosa proteins identified in excised protein bands in the "Rmep" fraction in the Example section. These three R. mucilaginosa proteins have been identified and are shown here. Start codons were determined using Artemis (correcting the start codons listed for C6R5V9 and C6R5W1 at NCBI). Bold and underlined residues are the predicted signal peptide cleavage sites AHA, and conserved enzyme catalytic triad D-H-S that is characteristic of the S8 protease family. SEQ ID NOS: 1-3 in order of appearance.
- PVTVE ⁇ LDYKASGRGPHSHAFDL SSSARGQHGSDGFIKPDLAAPGTEIVSAAVGTGNKGVSFTGTS. ⁇ PHVAGVAALV QAHQDY PQMI KAAIiMNGASTPIK EQGAQYAVDRVGTGMVNARAAVDAKVIAYDAKTPE RVSTAFGVLEYTPDSGIQTVQREIVLDNTDSQAHTYTLSYEASTTIPGVEYSYPQQVSVGAGERK VTVTVTV RIDPSKLEKTMDPAMSADQVAQDWTTGKTLAAGKRQYIASASGRLIFSENGREAIRQSIHVAPKPVSKMRV DASRIDYKGISDKESTVTLRGTTLNQGGYRSLLGAFELGAVSDRIPSGQLKLPSNQSVDLQYVGAASDAPA LKAAGK PNDGSLFFGISTWGTWDSMHWGRQVQVQIDTNNDSTADYVLEVTREKGLDYPLVKVWSISGNAS TVVARYPLNSA
- the additional gluten-degrading enzymes or glutamine endoproteases useful for the methods, formulations, and compositions of this disclosure include those that have been previously disclosed in the PCT Patent Application No: PCT/US11/43118, PCT Patent publication No: WO2012006384, the US Patent Application No. 20130171109, US Patent No. 7628985, and US Patent No. 8685392the contents of each are incorporated by reference in their entity.
- the additional gluten-degrading enzymes or glutamine endoproteases useful for the methods, formulations, and compositions of this disclosure are derived from Rothia species bacteria and they retain gluten-degrading activity throughout a wide range of pH (e.g., pH 3.0-10), unlike the Rothia subtilisin or subtilisin-like enzymes that have gluten-degrading activity at a pH range of about 6.0-10.0 and have low or negligible gluten-degrading activity at pH values below 5.0 and pH higher than 10.0.
- these additional gluten-degrading enzymes are glutamine endopeptidases.
- the glutamine endopeptidase enzymes of a Rothia species described herein is capable of cleaving of any of the following peptides, including known T cell epitopes in gluten, under optimal conditions: QLQPFPQPQLPY (SEQ ID NO: 8) or PFPQPQLPY (SEQ ID NO: 9), PQPQLPYPQPQLPY (SEQ ID NO: 10) or PQPQLPYPQ (SEQ ID NO: 11), QPQQSFPQQQ (SEQ ID NO: 12) or PQQSFPQQQ (SEQ ID NO: 13), QLQPFPQPELPY (SEQ ID NO: 14),
- PQPELPYPQPELPY (SEQ ID NO: 15), QPQQSFPEQQ (SEQ ID NO: 16); IQPQQPAQL (SEQ ID NO: 17); QQPQQPYPQ (SEQ ID NO: 18); SQPQQQFPQ (SEQ ID NO: 19); QQPFPQQPQ (SEQ ID NO: 20); or PFSQQQQPV (SEQ ID NO: 8), including 33-mer from alpha-gliadin,
- the glutamine endopeptidase of a Rothia species described herein have a kcat/Km of at least about 2.5 s "1 M “1 , usually at least about 250 s "1 M “1 and preferably at least about 25000 s "1 for cleaving of any of the peptides described herein.
- a glutamine endopeptidase of a Rothia species described herein have a specificity kcat/Km>2 mM ' V 1 for the quenched fluorogenic substrate Abz-QPQQP-Tyr(N02)-D (SEQ ID NO: 37).
- Methods of assaying such enzymatic activities are known to those skilled in the art, e. g. by HPLC or fluorescence spectroscopy and as described, for example, in US Patent No. 7534426.
- suitable fluorophores can be attached to the amino- and carboxy-termini of the peptides.
- the additional gluten-degrading enzymes described herein are isolated enzymes, extracts, or enriched extracts derived from Rothia species bacteria (e.g., Rothia spp. ot 188, also known as Rothia sp. HOT-188 and Rothia aeria).
- Such gluten-degrading enzymes can be, in one embodiment, a glutamine endopeptidase enzyme (e.g., a metal-ion dependent serine protease).
- the glutamine endopeptidase enzyme present in the extract, derived or isolated from a Rothia species bacterium is inhibited by 1 mM 1-10 Phenanthroline.
- Addition of the serine protease inhibitor, phenylmethanesulphonylfluoride or phenylmethylsulphonyl fluoride (PMSF) can also inhibit YPQ, QQP, PPF and/or PFP cleavage activity, indicating that the enzyme is a serine protease.
- the glutamine endopeptidase enzyme present in the extract, derived or isolated from a Rothia species bacterium is inhibited by 0.1 - 1 mM PMSF.
- the glutamine endopeptidase enzyme present in the extract, derived or isolated from a Rothia species bacterium is inhibited by 0.1 - 1 mM 4-(2-Aminoethyl) benzenesulfonyl fluoride hydrochloride (AEBSF).
- AEBSF 4-(2-Aminoethyl) benzenesulfonyl fluoride hydrochloride
- the glutamine endopeptidase enzyme is isolated from a Rothia species bacterium by conventional protein purification methods known to those skilled in the art, e. g. as described in the Current Protocols in Molecular Biology and the Current Protocols in Protein Sciences.
- the protein fraction of an extract from a Rothia species bacterium can be concentrated by ammonium sulphate precipitation, and then purified by ion exchange chromatography on DEAE SEPHAROSE® CL- 6B and gel filtration on SEPHADEX® G-100.
- the enzyme can be at least 20% pure, at least 35% pure, at least 45% pure, at least 55% pure, at least 65% pure, at least 75% pure, at least 85% pure, at least 95% pure, at least 95% pure, at least 99% pure, wherein all the percentages between 20 and 99 are explicitly included.
- the enzyme or enzymes can be further purified, for example, from the 70 kDa, or 75-80 kDa, or -125 kDa fractions using standard purification schemes known in the art, e. g. size exclusion
- the bacteria can be lysed by standard methods known in the art, e. g. with lysozymes and treatment in a par bomb.
- the lysate can then be clarified by ultracentrifugation at 100,000 x G force for 1 hour at 4°C.
- the clarified lysate can then be concentrated and then fractioned with commercially available gel filtration matrix such as SEPHACRYL® (S-100 /200/300/400/500) from GE Healthcare Life Sciences.
- SEPHACRYL® SEPHACRYL®
- the enzymes can be further purified according to the methods described in the Example Section.
- the cleavage is at peptide bonds of non-terminal amino acids (i.e. within a protein or peptide molecule) immediately after the proline residue for - QQP- or -PFP- sequence, and immediately after the phenylalanine residue for -PPF- sequence.
- the enzymes with gluten-degrading activity at acidic pH described in the US Patent Application No. 20130171109 have a significant advantage over other microbial enzymes that degrade gluten due to their acidic character and ability to retain protease activity at varying pH (e.g., pH 3 to 10) including acidic pHs, such as those found in the stomach.
- the enzymes described herein have an isoelectric focusing point pH fractions of pH 2.5, 3 and 4. In the most acidic fraction (tested as described herein in the Examples section) a high molecular weight protease of approximately -125 kD to ⁇ 140kD can be isolated for use with the methods as described herein.
- the R. aeria enzyme retains gluten-degrading activity throughout a wide range of pH (e.g., 3-10).
- the term "retains gluten-degrading activity” or “retains activity” means that an enzyme as described herein retains at least 20% of the gluten-degrading activity (as measured by e.g., an in vitro gliadin or gliadin peptide cleavage assay as described in e.g., the Examples section) measured at a range of test pHs (e.g., in pHs of 2-12) compared to the activity measured at the environmental pH for the enzyme (e.g., pH 7-8 or the native pH environment in which the enzyme is found); preferably the enzyme retains at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99%, or even 100% of the activity compared to the activity measured when the assay is conducted at the enzyme'
- the isolated subtilisin enzyme together with the addition gluten- degrading enzyme described in this disclosure be taken prior to ingestion (e.g., 20 min to lhr before), concomitant with ingestion (e.g., at the same time), or shortly after ingestion (e.g., 20 min to lhr after) of a gluten-containing foodstuff.
- the enzymes described herein can transit the gastrointestinal tract with the gluten-containing foodstuff and can de-toxify gluten or fragments thereof that are formed during digestion. Since the enzymes are active in vitro at pHs observed in essentially every region of the gastrointestinal tract (e.g., oral cavity, stomach, small intestine etc), the enzymes with activity at acidic pH described in the US Patent Application No.
- 20130171109 will have a higher predicted efficiency for degrading gluten than a comparable enzyme that is inactivated by low pH (e.g., stomach pH).
- high efficiency for degrading gluten means that at least 20% more gluten will be degraded during passage through the gastrointestinal tract by the enzymes described herein (as measured by appearance of gluten degradation products or by a more favorable response of a subject to a gluten challenge) compared to an enzyme having similar activity but that does not operate at a wide range of pH (e.g., only works within a narrow pH range of 7-8); preferably at least 30% more, at least 40% more, at least 50% more, at least 60% more, at least 70% more, at least 80% more, at least 90% more, at least 95% more, at least 99% more, at least 1-fold more, at least 2-fold more, at least 5-fold more, at least 10- fold more, at least 20-fold more, at least 100-fold more, at least 200-fold more, at least 500-fold more, at least 1000-fold more gluten
- the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity at pH 2.5. In one embodiment, the enzyme described herein retains protease activity at pH 3.0. In another embodiment, the addition gluten- degrading enzyme described herein retains protease activity up to pH 7.0. In one embodiment, the addition gluten-degrading enzyme described herein retains protease activity between pH 2.5 to 7.0.
- the addition gluten-degrading enzyme described herein retains protease activity between pH 2.5 to 3.0, between pH 2.5 to 4.0, between pH 3.0 to 4.0, between pH 3.0 to 6.0, between pH 2.5 to 5.0, between pH 2.5 to 6.0, between pH 5.0 to 7.0, between pH 5.0 to 6.0, and between pH 6.0 to 7.0.
- the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 exhibits protease activity at pH 3.0 after 3-4 hours of digestion, e.g., in an in vitro gliadin degradation assay using a synthetic substrate Z-YPQ-pNA described herein.
- the addition gluten-degrading enzyme described herein exhibited at least 5% protease activity at pH 3.0 after 3-4 hours of digestion in comparison the activity observed when assayed at pH 8.0 for 3-4 hours.
- the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity at pH 2.5 and has an approximate molecular size of 140 kDa as determined by a gliadin zymogram or characterized as in Fig. 6. In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171 109 retains protease activity at pH 2.5 and has an approximate molecular size of 125 kDa as determined by a gliadin zymogram.
- the addition gluten-degrading enzyme described herein retains protease activity at pH 2.5 and has an approximate molecular size range of 120-150 kDa as determined by gliadin zymography. In another embodiment, the addition gluten- degrading enzyme described herein retains protease activity at pH 2.5 and has an approximate molecular size range of 135- 145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity at pH 2.5 and has an approximate molecular size range of 125-145 kDa as determined by gliadin zymography.
- the gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size of 140 kDa as determined by a gliadin zymogram or characterized as in Fig. 6.
- the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size of 125 kDa as determined by a gliadin zymogram.
- the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 120-150 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 135-145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten- degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 125-145 kDa as determined by gliadin zymography.
- the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 50-90 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 65-75 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 65-80 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 75-80 kDa as determined by gliadin zymography.
- the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size of 140 kDa as determined by a gliadin zymogram or characterized as in Fig. 6. In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size of 125 kDa as determined by a gliadin zymogram.
- the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size range of 120-150 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size range of 135-145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0- 7.0 and has an approximate molecular size range of 125-145 kDa as determined by gliadin zymography.
- the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size range of 50-90 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size range of 65-75 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0- 7.0 and has an approximate molecular size range of 65-80 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size range of 75-80 kDa as determined by gliadin zymography.
- the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size of 140 kDa as determined by a gliadin zymogram or characterized as in Fig. 6. In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size of 125 kDa as determined by a gliadin zymogram.
- the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size range of 120-150 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size range of 135-145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5- 5.0 and has an approximate molecular size range of 125-145 kDa as determined by gliadin zymography.
- the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size range of 50-90 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size range of 65-75 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5- 5.0 and has an approximate molecular size range of 65-80 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size range of 75-80 kDa as determined by gliadin zymography.
- the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size of 140 kDa as determined by a gliadin zymogram. In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size of 125 kDa as determined by a gliadin zymogram.
- the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 120-150 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 135- 145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 125-145 kDa as determined by gliadin zymography.
- the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 50-90 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 65-75 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 65-80 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 75-80 kDa as determined by gliadin zymography.
- a formulation as described herein comprises an isolated subtilisin enzyme derived from Rothia species bacteria.
- the formulation comprises an effective amount or effective does of the enzyme.
- the effective dose of the isolated subtilisin enzyme from the Rothia species bacterium is administered orally.
- pharmaceutical formulation and compositions are provide herein.
- the isolated subtilisin enzyme derived from Rothia species bacteria is admixed to the gluten-containing foodstuff.
- the subtilisin enzyme derived from Rothia species bacteria is mixed with the gluten-containing foodstuff prior to ingesting.
- the isolated subtilisin enzyme derived from Rothia species bacteria is formulated with a pharmaceutically acceptable excipient or carrier.
- the isolated subtilisin enzyme derived from Rothia species bacteria is formulated with a pharmaceutically acceptable excipient or carrier.
- compositions comprise an isolated subtilisin enzyme derived from Rothia species bacteria and a pharmaceutically acceptable excipient or carrier.
- the pharmaceutical formulation and compositions further comprise at least one addition gluten-degrading enzyme or a glutamine endoprotease.
- the pharmaceutical formulation and compositions further comprise a PEP.
- the isolated subtilisin enzyme derived from Rothia species bacteria is contained in a formulation that comprises an enteric coating.
- the isolated subtilisin enzyme derived from Rothia species bacteria is a lyophilized preparation.
- Lyophilization or freeze-drying is a means of drying achieved by freezing a wet substance and causing the ice to sublime directly to vapor by exposing it to a low partial pressure of water vapor.
- the substance may not be completely frozen, especially if non-aqueous solutions are present, and most lyophilization processes are completed by a period of desorption drying.
- the purpose of freeze-drying is to increase the shelf life, or preserve a specimen, be it food, microbial organisms, or, in some circumstances to decrease the size of the product.
- the isolated enzyme can be lyophilized.
- Lyophilization is preferably performed on an initially concentrated preparation, e.g. of at least about 1 mg/ml for isolated enzyme preparation and 1000 bacteria/ml.
- Additives can be added to improve enzyme stability in the lyophilization process if so desired.
- Such additives are known in the art, for example, PEG, albumin, dissacharides such as maltitol, mannitol, corn syrup solids, sorbitol and branched polymers of sucrose. These are described in U.S.
- Patent No: 6294365 the contents are incorporated here by reference. In some embodiments,
- lyophilization of an isolated enzyme can be performed without loss of specific activity (e.g., gluten- degrading activity). Lyophilized extracts are useful in the production of enteric -coated capsules, enteric- coated tablets, capsules, granules or tablets.
- the methods described herein further comprises administering an effective dose of subtilisin enzyme ranging from 0.01 mg to 500 mg/kg body weight.
- the formulations or compositions administered to the subject is a combination of subtilisin and at least one addition gluten-degrading enzyme or a glutamine endopeptidase described in this disclosure. This combination can further comprise a PEP.
- the prolyl endopeptidase can be provided in a separate formulation or can be formulated with the active species (e.g., extract, isolated enzyme etc) described herein.
- Prolyl endopeptidase PREP or PEP
- prolyl oligopeptidase EC 3.4.21.26
- PREP or PEP prolyl endopeptidase
- prolyl oligopeptidase EC 3.4.21.26
- the enzyme cleaves peptide bonds at the C-terminal side of proline residues. Its activity is confined to action on oligopeptides of less than 10 kDa and it has an absolute requirement for the trans-configuration of the peptide bond preceding proline.
- Some types of prolyl endopeptidase from A. Niger have been used in studies to decrease the propensity of gluten-containing wheat products to aggravate celiac disease (Stepniak D, et al., 2006, Am J Physiol Gastrointest Liver Physiol 291 (4):
- G621-9 e. g. PEP derived or isolated from Aspergillus niger, Flavobacterium meningosepticum, Sphingomonas capsulate, Penicillium citrinum, Lactobacillus helveticus and Myxococcus Xanthus in US Patent Application 20060002917 and 20080193436, and in US Patent Nos. 7563864, 7303871, and 7320788, the contents are incorporated here by reference.
- glutamine endopeptidase enzyme is active in a buffer that mimics the ion composition of saliva, e. g. saliva ion buffer described herein.
- the Rothia species bacteria is Rothia species ot 188 (also known as as Rothia sp. HOT-188, Rothia aeria strain F0474 (HMP ID 1324), Rothia aeria HM-818, and Rothia aeria strain WSA-8) and Rothia aeria.
- the effective dose of the subtilisin enzyme derived from Rothia species bacteria ranges from 0.01 mg to 500 mg/kg body weight when the formulation comprises the isolated subtilisin enzyme.
- the formulation is suitable for oral administration, e. g. a tablet or a capsule.
- the formulation comprises an enteric coating.
- the isolated subtilisin enzyme derived from Rothia species bacteria described herein are formulated into pharmaceutical compositions by combination with appropriate, pharmaceutically acceptable carriers or diluents, and are formulated into preparations in solid, semi-solid, or liquid forms, such as tablets, capsules, powders, granules, solutions, gels, and microspheres.
- administration of the extract, Rothia species bacteria, or the enzyme described herein can be achieved by oral administration.
- subtilisin enzyme derived from Rothia species bacteria described herein can be administered alone or in appropriate association, as well as in combination, with other pharmaceutically active compounds.
- the methods and compositions provided herein can be combined with pharmaceutically active compounds used in the treatment and alleviation of symptoms of Celiac Sprue including, but not limited to, the following: an inhibitor of tissue
- transglutaminase see US Patent No. 7579313
- an anti-inflammatory agent an anti-ulcer agent, a mast cell-stabilizing agent, and/or and anti-allergy agent.
- agents include HMG-CoA reductase inhibitors with anti-inflammatory properties such as compactin, lovastatin, simvastatin, pravastatin and atorvastatin; anti-allergic histamine HI receptor antagonists such as acrivastine, cetirizine, desloratadine, ebastine, fexofenadine, levocetirizine, loratadine and mizolastine; leukotriene receptor antagonists such as montelukast and zafirlukast; COX2 inhibitors such as celecoxib and rofecoxib; p38 MAP kinase inhibitors such as BIRB-796; and mast cell stabilizing agents such as sodium chromoglycate (chromolyn), perip
- the formulation or administration protocol combines an extract, Rothia species bacteria, subtilisin enzyme derived from Rothia species bacteria, and/or glutamine endopeptidase enzyme described herein with an inhibitor of transglutaminase 2 (TG2) (see US Patent No. 7579313).
- TG2 transglutaminase 2
- Such formulations can provide additional protection from gluten mediated enteropathy, as TG2 has been shown to have a significant pro-inflammatory effect on gluten peptides in the celiac gut.
- TG2 inhibitors containing halo-dihydroisoxazole, diazomethylketone or dioxoindole moieties are useful for this purpose.
- the formulation or administration protocol combines an extract, Rothia species bacteria, subtilisin enzyme derived from Rothia species bacteria, and/or glutamine endopeptidase enzyme described herein with an anti -inflammatory agent, e.g. a statin; p38 MAP kinase inhibitor; anti- TNFalpha agent; etc.
- an anti -inflammatory agent e.g. a statin; p38 MAP kinase inhibitor; anti- TNFalpha agent; etc.
- the formulation comprises the subtilisin enzyme derived from Rothia species bacteria, and/or an additional gluten-degrading enzyme, and/or the glutamine endopeptidase enzyme, and/or a PEP described herein or a PEGylated form thereof.
- PEGylation is the process of covalent attachment of poly (ethylene glycol) polymer chains to another molecule, normally a drug or therapeutic protein. PEGylation is routinely achieved by incubation of a reactive derivative of PEG with the target macromolecule.
- the covalent attachment of PEG to a drug or therapeutic protein can "mask" the agent from the host's immune system (reduced immunogenicity and antigenicity), increase the hydrodynamic size (size in solution) of the agent which prolongs its circulatory time by reducing renal clearance.
- PEGylation can also provide water solubility to hydrophobic drugs and proteins.
- the first step of the PEGylation is the suitable functionalization of the PEG polymer at one or both terminals.
- PEGs that are activated at each terminus with the same reactive moiety are known as "homobifunctional", whereas if the functional groups present are different, then the PEG derivative is referred as "heterobifunctional” or "heterofunctional.”
- the chemically active or activated derivatives of the PEG polymer are prepared to attach the PEG to the desired molecule.
- the choice of the suitable functional group for the PEG derivative is based on the type of available reactive group on the molecule that will be coupled to the PEG.
- typical reactive amino acids include lysine, cysteine, histidine, arginine, aspartic acid, glutamic acid, serine, threonine, and tyrosine.
- the N-terminal amino group and the C-terminal carboxylic acid can also be used.
- first generation PEG derivatives are generally reacting the PEG polymer with a group that is reactive with hydroxyl groups, typically anhydrides, acid chlorides, chloroformates and carbonates.
- a group that is reactive with hydroxyl groups typically anhydrides, acid chlorides, chloroformates and carbonates.
- more efficient functional groups such as aldehyde, esters, amides etc made available for conjugation.
- Preferred end groups for heterobifunctional PEGs are maleimide, vinyl sulfones, pyridyl disulfide, amine, carboxylic acids and NHS esters.
- compositions can be formulated for administration by any known route.
- the composition can be administered by a mucosal, pulmonary, topical, or other localized or systemic route (e.g., enteral and parenteral).
- parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intraventricular, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, sub capsular, subarachnoid, intraspinal, intracerebrospinal, and intrasternal injection, infusion and other injection or infusion techniques, without limitation. It is preferred herein that the formulations described herein are administered orally (or mixed with gluten- containing foodstuff) to a subject afflicted with celiac disease or
- subtilisin enzyme derived from Rothia species bacteria described herein can be used alone or in combination with appropriate additives to make tablets, powders, granules or capsules, for example, with conventional additives, such as lactose, mannitol, corn starch or potato starch; with binders, such as microcrystalline cellulose, cellulose derivatives, acacia, corn starch or gelatins; with disintegrants, such as corn starch, potato starch or croscarmellose sodium; with lubricants, such as talc or magnesium stearate; and if desired, with diluents, buffering agents, moistening agents, preservatives, colorants, and flavoring agents.
- conventional additives such as lactose, mannitol, corn starch or potato starch
- binders such as microcrystalline cellulose, cellulose derivatives, acacia, corn starch or gelatins
- disintegrants such as corn starch, potato starch or croscarmellose sodium
- a composition can be incorporated into an inert carrier in discrete units such as capsules, cachets, tablets or lozenges, each containing a predetermined amount of the active compound; as a powder or granules; or a suspension or solution in an aqueous liquid or non-aqueous liquid, e.g., a syrup, an elixir, an emulsion or a draught.
- Suitable carriers may be starches or sugars and include lubricants, flavorings, binders, and other materials of the same nature.
- a tablet can be made by compression or molding, optionally with one or more accessory ingredients.
- Compressed tablets can be prepared by compressing in a suitable machine the active compound in a free-flowing form, e.g., a powder or granules, optionally mixed with accessory ingredients, e.g., binders, lubricants, inert diluents, surface active or dispersing agents.
- Molded tablets can be made by molding in a suitable machine, a mixture of the powdered active compound with any suitable carrier.
- a syrup or suspension can be made by adding the extract, Rothia species bacteria, or isolated enzyme described herein to a concentrated, aqueous solution of a sugar, e.g., sucrose, to which can also be added any accessory ingredients.
- a sugar e.g., sucrose
- accessory ingredients may include flavoring, an agent to retard crystallization of the sugar or an agent to increase the solubility of any other ingredient, e.g., as a polyhydric alcohol, for example, glycerol or sorbitol.
- Orally-acceptable absorption enhancers include surfactants such as sodium lauryl sulfate, palmitoyl carnitine, Laureth-9, phosphatidylcholine, cyclodextrin and derivatives thereof; bile salts such as sodium deoxycholate, sodium taurocholate, sodium glycochlate, and sodium fusidate; chelating agents including citric acid and salicylates; and fatty acids (e.g., oleic acid, lauric acid, acylcarnitines, mono- and diglycerides).
- surfactants such as sodium lauryl sulfate, palmitoyl carnitine, Laureth-9, phosphatidylcholine, cyclodextrin and derivatives thereof
- bile salts such as sodium deoxycholate, sodium taurocholate, sodium glycochlate, and sodium fusidate
- chelating agents including citric acid and salicylates
- fatty acids e.g.,
- oral absorption enhancers include benzalkonium chloride, benzethonium chloride, CHAPS (3-(3- cholamidopropyl)-dimethylammonio-l-propanesulfonate), Big-CHAPS (N, N-bis(3-D- gluconamidopropyl)-cholamide), chlorobutanol, octoxynol-9, benzyl alcohol, phenols, cresols, and alkyl alcohols.
- An especially preferred oral absorption enhancer for the present invention is sodium lauryl sulfate.
- the formulations comprising theesubtilisin enzyme derived from Rothia species bacteria described herein and the oral formulations comprise enteric coatings, so that the subtilisin enzyme derived from Rothia species bacteria described herein is delivered to the intestinal tract.
- Enteric formulations are often used to protect an active ingredient from the strongly acid contents of the stomach. Such formulations are created by coating a solid dosage form with a film of a polymer that is insoluble in acid environments, and soluble in basic environments.
- Exemplary films are cellulose acetate phthalate, polyvinyl acetate phthalate, hydroxypropyl methylcellulose phthalate and hydroxypropyl methylcellulose acetate succinate, methacrylate copolymers, and cellulose acetate phthalate.
- a subtilisin enzyme derived from Rothia species bacteria described herein can be prepared as a tablet formulation comprising the extract, the Rothia species bacteria, or the enzyme described herein with an enteric polymer casing.
- An example of such a preparation can be found in WO2005/021002.
- the active material in the core can be present in a micronized or solubilized form.
- the core can contain additives conventional to the art of compressed tablets.
- Appropriate additives in such a tablet can comprise diluents such as anhydrous lactose, lactose monohydrate, calcium carbonate, magnesium carbonate, dicalcium phosphate or mixtures thereof; binders such as
- microcrystalline cellulose hydroxypropylmethylcellulose, hydroxypropyl-cellulose
- polyvinylpyrrolidone pre-gelatinised starch or gum acacia or mixtures thereof; disintegrants such as microcrystalline cellulose (fulfilling both binder and disintegrant functions) cross-linked
- the tablet comprises lactose as diluent.
- a binder is present, it is preferably hydroxypropylmethyl cellulose.
- the tablet comprises magnesium stearate as lubricant.
- the tablet comprises croscarmellose sodium as disintegrant.
- the tablet comprises microcrystalline cellulose.
- the diluent can be present in a range of 10 - 80% by weight of the core.
- the lubricant can be present in a range of 0.25 - 2% by weight of the core.
- the disintegrant can be present in a range of 1 - 10% by weight of the core.
- Microcrystalline cellulose if present, can be present in a range of 10 - 80% by weight of the core.
- the extract, the Rothia species bacteria, or the enzyme described herein preferably comprises between 10 and 50% of the weight of the core, more preferably between 15 and 35% of the weight of the core (calculated as free base equivalent).
- the core can contain any therapeutically suitable dosage level of the active ingredient, but preferably contains up to 150 mg as free base of the active ingredient.
- the core can contain 20, 30, 40, 50, 60, 80 or lOOmg as free base of the active ingredient.
- the active ingredient can be present as the free base, or as any pharmaceutically acceptable salt. If the active ingredient is present as a salt, the weight is adjusted such that the tablet contains the desired amount of active ingredient, calculated as free base of the salt.
- the active ingredient is present as a hydrochloride salt.
- the core can be made from a compacted mixture of its components.
- the components can be directly compressed, or can be granulated before compression.
- Such granules can be formed by a conventional granulating process as known in the art.
- the granules can be individually coated with an enteric casing, and then enclosed in a standard capsule casing.
- the core is surrounded by a casing which comprises an enteric polymer.
- enteric polymers are cellulose acetate phthalate, cellulose acetate succinate, methylcellulose phthalate, ethylhydroxycellulose phthalate, polyvinylacetate pthalate, polyvinylbutyrate acetate, vinyl acetate- maleic anhydride copolymer, styrene-maleic mono-ester copolymer, methyl aery late -methacrylic acid copolymer or methacry late -methacrylic acid-octyl acrylate copolymer. These can be used either alone or in combination, or together with other polymers than those mentioned above.
- the casing can also include insoluble substances which are neither decomposed nor solubilised in living bodies, such as alkyl cellulose derivatives such as ethyl cellulose, crosslinked polymers such as styrene-divinylbenzene copolymer, polysaccharides having hydroxyl groups such as dextran, cellulose derivatives which are treated with bifunctional crosslinking agents such as epichlorohydrin, dichlorohydrin or 1, 2-, 3, 4- diepoxybutane.
- the casing can also include starch and/or dextrin.
- Exemplary enteric coating materials are the commercially available EUDRAGIT® enteric polymers such as EUDRAGIT® L, EUDRAGIT® S and EUDRAGIT® NE used alone or with a plasticiser. Such coatings are normally applied using a liquid medium, and the nature of the plasticiser depends upon whether the medium is aqueous or non-aqueous.
- Plasticizers for use with aqueous medium include propylene glycol, triethyl citrate, acetyl triethyl citrate or CITROFLEX® or CITROFLEX® A2.
- Non-aqueous plasticizers include these, and also diethyl and dibutyl phthalate and dibutyl sebacate.
- a preferred plasticiser is triethyl citrate. The quantity of plasticiser included will be apparent to those skilled in the art.
- the casing can also include an anti-tack agent such as talc, silica or glyceryl monostearate.
- an anti-tack agent such as talc, silica or glyceryl monostearate.
- the anti-tack agent is glyceryl monostearate.
- the casing can include around 5 - 25 wt% Plasticiser and up to around 50 wt % of anti-tack agent, preferably 1-10 wt % of anti-tack agent.
- a surfactant can be included to aid with forming an aqueous suspension of the polymer.
- Many examples of possible surfactants are known to the person skilled in the art.
- Preferred examples of surfactants are polysorbate 80, polysorbate 20, or sodium lauryl sulphate.
- a surfactant can form 0.1 - 10% of the casing, preferably 0.2 - 5% and particularly preferably 0.5 - 2%
- seal coat included between the core and the enteric coating.
- a seal coat is a coating material which can be used to protect the enteric casing from possible chemical attack by any alkaline ingredients in the core.
- the seal coat can also provide a smoother surface, thereby allowing easier attachment of the enteric casing.
- a person skilled in the art would be aware of suitable coatings.
- the seal coat is made of an Opadry coating, and particularly preferably it is Opadry White OY-S-28876.
- lactose monohydrate, microcrystalline cellulose, the active ingredient- e. g. the extract form Rothia species, the hydroxypropyl methyl cellulose and half of the croscarmellose sodium are screened into a 10 Litre Fielder high-shear blender (any suitable high shear blender could be used) and blended for 5 minutes at 300 rpm with the chopper off. The mixture is then granulated by the addition of about 750 ml water whilst continuing to blend.
- the granules are dried in a Glatt 3/5 fluid bed drier, screened by Comil into a Pharmatec 5 Litre bin blender and then blended with any lactose anhydrous given in the formula plus the remainder of the croscarmellose sodium over 5 minutes at 20 rpm.
- Magnesium stearate is screened into the blender and the mixing process continued for a further 1 minute at 10 rpm.
- the lubricated mix is compressed using a Riva Piccolla rotary tablet press fitted with 9.5mm round normal convex punches (any suitable tablet press could be used).
- the sealcoat, and subsequently the enteric coat are applied by spraying of an aqueous suspension of the coat ingredients in a Manesty 10 coater using parameters for the coating process as recommended by the manufacturers of the coating polymers (again, any suitable coater could be used).
- enteric formulations comprise engineered polymer microspheres made of biologically erodable polymers, which display strong adhesive interactions with gastrointestinal mucus and cellular linings and can traverse both the mucosal absorptive epithelium and the follicle-associated epithelium covering the lymphoid tissue of Peyer's patches.
- the polymers maintain contact with intestinal epithelium for extended periods of time and actually penetrate it, through and between cells. See, for example, Mathiowitz et al. (1997) Nature 386 (6623): 410-414.
- Drug delivery systems can also utilize a core of superporous hydrogels (SPH) and SPH composite (SPHC), as described by Dorkoosh et al.
- enteric-coated preparations of this sort can be prepared by one skilled in the art, using these materials or their equivalents.
- compositions can be formulated as a sustained release composition.
- sustained- release means or delivery devices are known in the art and include, but are not limited to, sustained- release matrices such as biodegradable matrices or semi-permeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules that comprise the extract, Rothia species bacteria, or enzyme described herein
- a sustained-release matrix is a matrix made of materials, usually polymers, which are degradable by enzymatic or acid/base hydrolysis or by dissolution. Once inserted into the body, the matrix is acted upon by enzymes and body fluids.
- the sustained-release matrix desirably is chosen from biocompatible materials such as liposomes, polylactides (polylactic acid), polyglycolide (polymer of glycolic acid), polylactide co-glycolide (co-polymers of lactic acid and glycolic acid) polyanhydrides, poly(ortho)esters, polyproteins, hyaluronic acid, collagen, chondroitin sulfate, carboxylic acids, fatty acids, phospholipids, polysaccharides, nucleic acids, polyamino acids, amino acids such as phenylalanine, tyrosine, isoleucine, polynucleotides, polyvinyl propylene, polyvinylpyrrolidone and silicone.
- a preferred biodegradable matrix is a matrix of one of polylactide, polyglycolide, or polylactide co- glycolide (co-polymers of lactic acid and glycolic acid).
- Sustained-release matrices include polylactides (U.S. Pat. No. 3,773,919, EP 58,481), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (U. Sidman el al., Biopolymers 22:547- 556 (1983)), poly (2-hydroxyethyl methacrylate) (R. Langer et al., J. Biomed Mater. Res. 15: 167-277 (1981), and R. Langer, Chem. Tech. 12:98-105 (1982)), ethylene vinyl acetate (R. Langer et al, Id.) or poly-D- (-)-3-hydroxybutyric acid (EP 133,988). Sustained-release compositions also include
- liposomally entrapped extract Rothia species bacteria, or enzyme described herein.
- liposomes can be prepared by methods known per se: DE 3,218,121; Epstein, et al., Proc. Natl. Acad. Sci. USA
- the liposomes are of the small (about 200-800 Angstroms) unilamellar type in which the lipid content is greater than about 30 mol. percent cholesterol, the selected proportion being adjusted for the optimal therapy.
- biodegradable polymers and their use are described, for example, in detail in Brem et al. (1991, J. Neurosurg. 74:441-446).
- sustained release compositions see U.S. Pat. No. 3,773,919, EP 58,481A, U.S. Pat. No. 3,887,699, EP 158,277A, Canadian Patent No. 1176565, U. Sidman et al., Biopolymers 22:547 (1983) and R. Langer et al., Chem. Tech. 12:98 (1982).
- Microspheres formed of polymers or proteins are well known to those skilled in the art, and can be tailored for passage through the gastrointestinal tract directly into the blood stream. Alternatively, the compound can be incorporated and the microspheres or composite of microspheres, implanted for slow release over a period of time ranging from days to months. See, for example, U.S. Pat. Nos. 4,906,474, 4,925,673 and 3,625,214, and Jein, TIPS 19: 155-157 (1998), the contents of which are hereby incorporated by reference.
- Preferred micro particles are those prepared from biodegradable polymers, such as polyglycolide, polylactide and copolymers thereof. Those of skill in the art can readily determine an appropriate carrier system depending on various factors, including the desired rate of drug release and the desired dosage.
- compositions of the invention can be provided as a pharmaceutically acceptable base addition salt.
- “Pharmaceutically acceptable base addition salt” refers to those salts which retain the biological effectiveness and properties of the free acids, which are not biologically or otherwise undesirable. These salts are prepared from addition of an inorganic base or an organic base to the free acid.
- Salts derived from inorganic bases include, but are not limited to, the sodium, potassium, lithium, ammonium, calcium, magnesium, iron, zinc, copper, manganese, aluminum salts and the like.
- Preferred inorganic salts are the ammonium, sodium, potassium, calcium, and magnesium salts.
- Salts derived from organic bases include, but are not limited to, salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, such as
- Particularly preferred organic bases are isopropylamine, diethylamine, ethanolamine, trimethylamine, dicyclohexylamine, choline and caffeine.
- Examples of such carriers include ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts, or electrolytes such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, and polyethylene glycol.
- buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts, or electrolytes such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyr
- antioxidants e.g., ascorbic acid
- low molecular weight (less than about ten residues) polypeptides e.g., polyarginine or tripeptides
- proteins such as serum albumin, gelatin, or immunoglobulins
- hydrophilic polymers such as polyvinylpyrrolidone
- amino acids such as glycine, glutamic acid, aspartic acid, or arginine
- monosaccharides, disaccharides, and other carbohydrates including cellulose or its derivatives, glucose, mannose, or dextrins
- chelating agents such as EDTA, and sugar alcohols such as mannitol or sorbitol.
- the pharmaceutical formulation to be used for therapeutic administration must be sterile. Sterility is readily accomplished by filtration through sterile filtration membranes (e.g., 0.2 micron membranes).
- the subtilisin enzyme derived from Rothia species bacteria described herein can be administered in dosages of 0.01 mg to 500 mg/kg body weight per day, e.g. about 20, 100, 250, 500 or more mg/day or about 0.5, 1, 1.5, or more g/day for an average person for the enzyme.
- a typical dose of the enzyme described herein in subjects will be at least about 1 mg/adult subject, at least about 10 mg/adult subject; or at least about 50, 150, 250, 500 or more mg/adult subject.
- the dosage is no more than about 5 g, no more than about 1 g, or no more than about 500 mg/adult subject.
- Efficient proteolysis of gluten in vivo for an adult can, depending on diet and other factors, require at least about 500 units of a therapeutically efficacious the subtilisin enzyme derived from Rothia species bacteria or glutamine endopeptidase from Rothia species bacteria described herein.
- low dose of subtilisin enzyme glutamine endopeptidase such as 1000 units, can be used.
- glutamine endopeptidase such as 1000 units
- One unit is defined as the amount of enzyme required to hydrolyze 1 ⁇ of Z-KPQ-pNA or Z-YPQ-pNA per min under specified conditions.
- PEPs have specific activities in the range of 5-50 units/mg protein.
- barley EP-B2 whose specific activity is in the 1000 Units/mg range, as measured with Cbz-Phe-Arg-pNA
- low dose glutenase may consist of 10,000-100,000 Units
- high-dose PEPs contains as much as 1,000,000 Units. It will be understood by those of skill in the art that the dose can be raised, but that additional benefits may not be obtained by exceeding the useful dosage. Dosages will be appropriately adjusted for pediatric formulation. In children the effective dose may be lower, for example at least about 0.1, 0.5, 1, 10, 20, 100, 150, 250 or more mg.
- the compositions or formulations are admixed with gluten-containing foodstuff in vitro for the purpose of detoxifying the gluten-containing foodstuff, i.e., reducing the production of toxic gluten oligopeptides when ingested and further digested by a subject.
- the effective dosage for in vitro detoxification will depend on many factors, e.g., the degree of detoxification desired (partial or complete), the state of the gluten-containing foodstuff, the time and pH of digestion and the ratio of composition or formulation to the amount of gluten-containing foodstuff to be digested.
- a typical dose for the enzyme can be 10 units per 1 g for a 24 hour complete digestion.
- One skilled in the art will be able to vary the units in proportion to the amount of gluten-containing foodstuff and the time allowed for digestion to attained the desired level of digestion.
- a subject may influence the dosage and timing required to effectively treat a subject, including but not limited to the severity of the disease or disorder, previous treatments, the general health and/or age of the subject, and other diseases present.
- the dose levels can also depend on whether the extract, Rothia species bacteria, or enzyme is used, the severity of the symptoms and the susceptibility of the subject to side effects.
- the isolated enzyme can be more potent than the extract or the bacteria.
- treatment of a subject with a therapeutically effective dose can include a single treatment or a series of treatments.
- the therapeutic effect can be measured in terms of clinical outcome or can be determined by immunological or biochemical tests.
- suppression of the deleterious T-cell activity can be measured by enumeration of reactive Thl cells, by quantitating the release of cytokines at the sites of lesions, or using other assays for the presence of autoimmune T cells known in the art.
- the formulations of the extract, Rothia species bacteria, or enzyme described herein provided by the present invention provide improved formulations for oral administration.
- the present invention provides unit dose forms of the extract, Rothia species bacteria, or enzyme described herein suitable for administration with meals.
- the dosage of the therapeutic formulation will vary widely, depending upon the nature of the disease, the frequency of administration, the manner of administration, the clearance of the agent from the host, and the like.
- the initial dose can be larger, followed by smaller maintenance doses.
- the dose can be administered as infrequently as weekly or biweekly, or more often fractionated into smaller doses and administered daily, with meals, semi-weekly, or otherwise as needed to maintain an effective dosage level.
- Lyophilized formulations of subtilisin enzyme derived from Rothia species bacteria and excipients is useful in the production of enteric -coated capsules or tablets, e.g. a single capsule or tablet can contain at least about 1 mg usually at least about 10 mg of isolated subtilisin enzyme derived from Rothia species bacteria and may contain at least 100 mg subtilisin enzyme derived from Rothia species bacteria, at least about 200 mg, at least about 300 mg, at least about 400 mg, at least about 500 mg, up to about 1000 mg protein, including all the numbers between 1- lOOOmg.
- each of these enzymes ranges from at least about 1 mg usually at least about 10 mg in the composition or formulation. It is comtemplated that these additional enzymes can range from at least about 200 mg, at least about 300 mg, at least about 400 mg, at least about 500 mg, up to about 1000 mg protein, including all the numbers between 1- 1000 mg.
- enteric coatings can be applied, where a substantial fraction of the activity is retained, and is stable for at least about 1 month at 4°C.
- the method of lyophilizing bacteria is known to one skilled in the art, e. g. United States Patent 4205132, 4444760, RE40023, 5192743, 5529915, 6750330, and 7572893, all of which are incorporated by reference inn their entirety.
- the effective dose of the subtilisin enzyme derived from Rothia species bacteria ranges from 0.01 mg to 500 mg/kg body weight. In another embodiment, wherein the glutamine endopeptidase enzyme derived or isolated from a Rothia species bacterium is used, the effective dose of the enzyme is from 0.01 mg to 500 mg/kg body weight.
- the method is practiced when the subject is consuming any gluten- containing foodstuff. In another embodiment, the method is practiced prior to the consumption of gluten- containing foodstuff, wherein the subject is preparing to ingest gluten-containing food or the subject suspects that there might be gluten or wheat-derived ingredients in the food that the subject is about to consume. In another embodiment, the method is practiced whenever food is consumed or e.g., three times a day with the three major meals of a day: breakfast, lunch and dinner.
- the formulation or compositions comprising the isolated subtilisin enzyme derived from Rothia species bacteria is administered just before, during, or just after consumption of gluten-containing foodstuff.
- the formulation or compositions comprising the isolated subtilisin enzyme derived from Rothia species bacteria is administered prior to consumption of gluten-containing foodstuff. In one embodiment, the formulation or compositions comprising the isolated subtilisin enzyme derived from Rothia species bacteria is administered in a gluten-containing foodstuff.
- the pharmaceutical formulation as described herein is administered in an amount sufficient to attenuate gluten toxicity, as that term is used herein.
- Formulations are typically provided in a unit dosage form, where the term "unit dosage form,” refers to physically discrete units suitable as unitary dosages for the subjects, each unit containing a predetermined quantity of the the formulation or compositions comprising the isolated subtilisin enzyme derived from Rothia species bacteria described herein in an amount sufficient to produce the desired effect in association with a pharmaceutically acceptable diluent, carrier or vehicle.
- the specifications for the unit dosage forms of the present invention depend on the particular complex employed and the effect to be achieved, and the pharmacodynamics associated with each complex in the host.
- gluten toxicity refers to the action of an endopeptidase enzyme to reduce the amount, level or density of toxic gluten oligopeptides produced from gluten-containing foodstuff in the gut.
- Some toxic gluten oligopeptides are produced during digestion of gluten-containing foodstuff by endogenous trypsin, chymotrypsin, elastase and carboxypeptidase in the gastrointestinal tract.
- Attenuation of gluten toxicity is achieved by digesting toxic gluten oligopeptides to smaller peptide fragments that lack T cell epitopes in glutens recognized by the subject's immune system.
- the attenuation of gluten toxicity occurs in vitro prior to the ingestion of the gluten-containing foodstuff.
- the compositions or the formulation described herein is admixed to the gluten-containing foodstuff during the manufacture of the foodstuff.
- the assessment of attenuation of gluten toxicity can be determined using a cell-based or in vitro assay by measuring the ability of the the isolated subtilisin enzyme derived from Rothia species bacteria or isolated glutamine endopeptidase from Rothia species described herein to increase the concentration of free NH2 -termini in a reaction mixture containing e.g., 1 mg/ml of undigested or trypsin/
- Attenuation of gluten toxicity refers to an increase the concentration of free amino termini under such conditions by at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99% or even 100% (no gluten toxicity).
- a reduction in the residual molar concentration of oligopeptides greater than about e.g., 1000 Da can be measured using e.g., 1 mg/ml trypsin/ chymotrypsin/elastase/carboxypeptidase pre-digested gluten substrate after a 1 hour incubation with 10 ⁇ g/ml of the extract or enzyme, which detects an increase in degradation of gluten toxic intermediates.
- This reduction in molar concentration is at least 50%, at least 1-fold, at least 2-fold, at least 5 -fold, at least 10-fold, at least 100-fold, at least 1000-fold or more.
- oligopeptides can be estimated by methods known in the art, for example size exclusion chromatography and the like.
- an in vitro based assay measuring the degradation of highly immunogenic peptides can be used; such highly immunogenic peptides can include those derived from ot-gliadin
- gliadin peptides (10 mg/mL) are contacted with an enzyme sample (e.g., extract, isolated enzyme, whole saliva) to be tested and incubated at various time points (e.g., lOmin, 30min, lh, 2h, 6h, 12h, 24h, etc).
- enzyme sample e.g., extract, isolated enzyme, whole saliva
- time points e.g., lOmin, 30min, lh, 2h, 6h, 12h, 24h, etc.
- the assay is stopped by heat inactivation (e.g., boiling) and the peptide sample is subjected to RP-HPLC to determine the presence, absence or degree of degradation.
- "attenuates gluten toxicity” also refers to reducing the ability of a gluten oligopeptide to bind to HLA-DQ (e.g., a decreased number of epitopes for recognition by a subject's immune system).
- the ability of a substrate to bind to HLA-DQ is indicative of its toxicity; fragments smaller than about 8 amino acids are generally not stably bound to Class II MHC.
- the detoxification of whole gluten can be monitored by polyclonal T cell lines derived from intestinal biopsies of celiac or gluten allergic patients, by LC-MS-MS and by ELISA assays using monoclonal antibodies capable of recognizing sequences specific to gliadin.
- an extract of a Rothia species or an isolated glutamine endopeptidase from Rothia species described herein can reduce the potency by which a trypsin/ chymotrypsin/elastase/carboxypeptidase pre-digested gluten substrate can antagonize binding of PQPELPYPQPQLP (SEQ ID NO: 38) to HLA-DQ2.
- Treatment with an isolated enzyme or extract of Rothia species bacteria or Rothia bacteria described herein permits digestion of toxic oligopeptides, thereby preventing the toxic oligopeptides from competing with a test peptide for MHC binding.
- Such a competition assay can be performed by incubating 1 mg/ml trypsin/
- chymotrypsin/elastase/carboxypeptidase pre-digested gluten substrate with 10 ⁇ g/ml of the extract or enzyme, and the ability of the resulting solution to displace radioactive PQPELPYPQPQPLP (SEQ ID NO: 39) pre-bound to HLA-DQ2 molecules can then be quantified, with a reduction of displacement, relative to a non-treated control, indicative of utility in the methods of the present invention.
- "attenuates gluten toxicity” also refers to reducing the anti-tTG antibody and/or anti-gliadin antibodies response to a "gluten challenge diet" in a Celiac sprue or gluten allergic/gluten intolerance patient by at least 50%, at least 1-fold, at least 2-fold, at least 5 -fold, at least 10-fold, at least 100-fold or more.
- a "gluten challenge diet” is defined as the intake of 100 g bread per day for 3 days by an adult Celiac sprue or gluten allergic patient previously on a gluten-free diet.
- the anti-tTG antibody (ATA) and anti-gliadin antibodies (AGA) response can be measured in peripheral blood using standard clinical diagnostic procedures, as known in the art.
- a foodstuff comprising a formulation comprising a subtilisin enzyme derived from a
- subtilisin has the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins.
- subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC),
- ROTMU0001_0243 C6R5W1_9MICC
- ROTMU0001_240 C6R5V8_9MICC proteins described herein.
- subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
- subtilisin cleaves proline- containing proteins, cleaving the second peptide bond after proline in the XPXl motif, where X is any amino acid, P is proline and XI is a hydrophobic amino acid, i.e., cleaving at the peptide bond after XI, e.g. the XPQ motif, where Q is glutamine.
- subtilisin cleaves succinyl-Ala- Ala-Pro-Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after proline in the P2 position.
- subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes.
- subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis or as described in Figures 2A-2E; or have a predicted molecular weight of -125 kDa as described in the example section.
- subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 or 33 or 34..
- subtilisin comprises SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- subtilisin consists essentially of SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- the formulation further comprising at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ- pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
- a method for degrading gluten or an amylase-trypsin inhibitor in a gluten-containing foodstuff comprises contacting the gluten-containing foodstuff with an effective dose of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria.
- subtilisin has the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243
- subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC),
- ROTMU0001_0243 C6R5W1_9MICC
- ROTMU0001_240 C6R5V8_9MICC proteins, (SEQ. ID. NOS: 1-3) or SEQ. ID. NOS: 33-34.
- subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
- subtilisin cleaves proline- containing proteins, cleaving the second peptide bond after proline in the XPXl motif, where X is any amino acid, P is proline and XI is a hydrophobic amino acid, i.e., cleaving at the peptide bond after XI, e.g. the XPQ motif, where Q is glutamine.
- subtilisin cleaves succinyl-Ala- Ala-Pro-Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after proline in the P2 position.
- subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes, e.g. the 33mer peptide.
- subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis, or a predicted molecular weight of -125 kDa as described in the Example Section.
- subtilisin enzyme has a functional pH range of 6.0-10.0.
- subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
- subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 or 33 or 34..
- subtilisin comprises SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- subtilisin consists essentially of SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- subtilisin is SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- the formulation further comprising at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ- pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
- a composition comprising (a) an isolated subtilisin enzyme derived from a Rothia sp. bacteria, and (b) a prolyl endopeptidase (PEP).
- PEP prolyl endopeptidase
- composition of 57 or 58, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa, Rothia aeria and Rothia dentocariosa.
- ROTMU0001_0243 C6R5W1_9MICC
- ROTMU0001_240 C6R5V8_9MICC proteins, (SEQ. ID. NOS: 1-3) or SEQ. ID. NOS: 33-34.
- subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
- subtilisin cleaves proline- containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and XI is a hydrophobic amino acid, i.e., cleaving at the peptide bond after X 1; e.g. the XPQ motif, where Q is glutamine.
- subtilisin cleaves succinyl- Ala-Ala-Pro-Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after proline in the P2 position.
- subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes, e.g. the 33mer peptide.
- subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis, or a predicted molecular weight of -125 kDa as described in the Example Section.
- subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- subtilisin comprises SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- subtilisin consists essentially of SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- subtilisin SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- composition of any one of paragraphs 57-82. the formulation further comprising at least one isolated additional glutamine endopeptidase enzyme that cleaves a peptide bond after a -QPF- and a -PFP- motif in glutens.
- composition of any one of paragraphs 57-84 comprising a glutamine specific protease which is selected from the group consisting of Hordeum vulgare endoprotease, Aspergillus oryzae X-Pro dipeptidase, and Aspergillus saitoi carboxypeptidase. (as described in US Patent No. 7628985, incorporated by reference in its entirety).
- composition of any one of paragraphs 57-85 the composition further comprising a pharmaceutically acceptable carrier.
- a method for treating celiac disease or a related disorder such as gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis , the method comprising administering to a subject an effective dose of a composition comprising a subtilisin enzyme derived from a. Rothia sp. bacteria, or administering an effective dose of a composition of any one of paragraphs 57-86.
- Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, Rothia species ot 188 (strain WSA-8), Rothia aeria BAV86562.1 and Rothia dentocariosa KGJ00122.1.
- subtilisin has the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243
- subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins, (SEQ. ID. NOS: 1-3) or SEQ. ID. NOS: 33-34.
- subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
- subtilisin cleaves proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and Xi is a hydrophobic amino acid, i.e., cleaving at the peptide bond after Xi, e.g. the XPQ motif, where Q is glutamine.
- subtilisin cleaves succinyl-Ala-Ala-Pro-Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after proline in the P2 position.
- subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes, e.g. the 33mer peptide.
- subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis, or a predicted molecular weight of -125 kDa as described in the Example Section.
- subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- subtilisin comprises SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- subtilisin consists essentially of SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
- subtilisin enzyme derived from a Rothia sp. bacteria for the manufacture of medicament to treat non-celiac/non-allergy wheat sensitivity due to ATIs.
- a subtilisin enzyme derived from a Rothia sp. bacteria to degrade amylase-trypsin inhibitors (ATIs) in gluten-containing food stuff or for the treatment of non-celiac/non-allergy wheat sensitivity due to ATIs.
- ATIs amylase-trypsin inhibitors
- EXAMPLE 1 Gluten-degrading subtilisins from Rothia mucilaginosa and Bacillus sp.
- gluten are proline and glutamine-rich proteins present in wheat, barley and rye, which contain the immunogenic sequences that drive celiac disease (CD).
- Rothia mucilaginosa a harmless oral colonizer, contain enzymes that can cleave these gluten epitopes. The inventors have identified these enzymes and evaluate their potential as enzyme therapeutics.
- the membrane-associated R. mucilaginosa proteins were extracted and separated by DEAE chromatography. Enzyme activities were monitored with paranitroanilide derivatized- and FRET peptide substrates, and by gliadin zymography. Epitope elimination was determined by ELISA. Gliadin- degrading enzymes were identified by LC-ESI-MS/MS.
- the inventors have found natural gluten degrading microorganisms are associated with the oral cavity, i.e. the very proximal GI tract, and this discovery open new avenues to neutralize the deleterious effects of gluten in patients with celiac disease.
- Bacterial culturing ⁇ R. mucilaginosa ATCC 25296 was routinely grown on a Brucella-agar plates (Hardy Diagnostics, Santa Maria, CA) at 37°C for 24 h under aerobic conditions. Individual bacterial colonies were transferred to 100 ml of Todd-Hewitt broth (Beckton Dickinson, Sparks, MD) supplemented with 0.5% Tween-80 (THT), and subcultured into 4 L of THT. All incubations were carried out in Erlenmeyer flasks, while shaking at 200 rpm for 48 h at 37°C.
- n-Octyl- -D-glucopyranoside was added (Thermo Fisher, Waltham MA) as well as 0.3 mg/ml of L-cycteine.
- the cell suspension was frozen at - 20°C, defrosted, and then sonicated on ice using a sonifier with a macro tip (Branson sonifier 450, VWR Scientific, Bridgeport, NJ).
- the chemical pretreatment of the cells combined with the sonication reduced the OD 62 o of the suspension by 60%.
- the suspension was centrifuged for at 31,209 x g for 30 min at 4°C.
- the supernatant was harvested and centrifuged at 151,243 x g, for 1 h at 4°C.
- the pellet, containing most of the activity, was resuspended in 4 ml of 20 mM TrisHCl, pH 7.5.
- the protein concentration was determined using the bicinchoninic acid assay (Pierce Biotechnology, Rockford, IL, USA). Samples were stored at -80°C.
- DEAE anion exchange chromatography Frour ml of the resuspended pellet sample was thawed, and solubilized by the addition of 40 mg/ml n-Octyl- -D-glucopyranoside. A 6 ml volume of 50 mM Tris-HCl containing 0.3 M NaCl, pH 7.0, (DEAE buffer A) was added. The 10 ml sample was then loaded onto an anion-exchange DEAE sepharose fast flow column with a column size of 2.6 cm diameter x 27 cm length with a column volume (CV) of 143 ml.
- CV column volume
- the resin used was a cross-linked agarose with the diethylaminoethyl exchange group (-0-CH 2 CH 2 N+H(CH 2 CH 3 ) 2 ; GE Healthcare, Bjorkgatan, Sweden).
- the column was coupled to a FPLC system (AKTApurifier 10, GE Healthcare, Bjorkgatan, Sweden) and the flow rate applied was 1 ml/min.
- the buffers employed for protein elution were buffer A, containing 50 mM Tris-HCl, 0.3 M NaCl, pH 7.0, and buffer B, containing 50 mM Tris-HCl, 1 M NaCl, pH 7.0.
- Proteins were separated using a two-step gradient of 0% buffer B for 2.0 column volumes (286 ml) (isocratic conditions), followed by 100% elution buffer B for 1.5 column volume (215 ml). The absorbance was monitored at 219 nm and the eluate was collected in 10 ml fractions.
- Analytical SDS-PAGE The protein content of individual DEAE fractions (100 ⁇ ) and pooled DEAE fractions (400 ⁇ ) was determined using pre-casted discontinuous 4-12% SDS PAGE gels (NuPAGE, Thermofisher, Cambridge, MA) under reducing conditions. After electrophoresis gels were silver-stained as described (24).
- Gliadin zymography Pulooled DEAE fractions F1-F7 were desalted using 30 kDa cut-off membranes and aliquots of 200 ⁇ were analyzed for gluten-degrading enzyme activities on a 6% gliadin zymogram gel. The zymogram gel composition and renaturing and developing conditions were reported previously (22, 25).
- PAGE and Casein zymography The F2 fraction, containing the highest enzyme activity (hereafter called R. mucilaginosa enzyme preparation or Rmep) was applied in amounts ranging from 2- 32 ⁇ g on a 6% PAGE gel under non-reducing conditions.
- the composition of the gel was the same as the 6% gliadin zymogram gel, but without the incorporated gliadin. After electrophoresis the gel was divided in half. One half of the gel was silver-stained, the other half was developed as a zymogram gel using externally added casein as the enzyme substrate, as described (24).
- LC-ESI-MS/MS Proteins of interest were excised from the silver-stained gel half, and in-gel digested with sequencing-grade trypsin (Promega, Madison, WI), as described (24). The peptides were eluted from the gel, separated by in line CI 8 chromatography and sequenced using an LTQ Orbitrap mass spectrometer (ThermoFinnigan, San Jose, CA). The obtained b- and y-ion spectra were searched against a database of R. mucilaginosa ATCC 25296, containing 1737 Rothia protein entries, and 132 non-Rothia decoy proteins.
- Suc-AAPF-pNA SEQ ID NO: 4
- the peptides were dissolved in 75-100% DMSO at 10 mM, and were used at a final concentration of 200 ⁇ in 50 mM TrisHCl pH 8.0. Purified Rothia enzyme or subtilisin A from
- Bacillus licheniformis (Sigma) were tested at final concentrations of 1 ⁇ g/ml. Some experiments were conducted in the presence of inhibitors 4-(2-Aminoethyl) benzene sulfonyl fluoride (AEBSF), Aprotinin, E-64, EDTA, phenylmethanesulfonyl fluoride (PMSF) and Eglin C, which were tested at final concentrations of 10 mM, 0.08 mM, 0.1 mM, 1.5 mM, 1 mM, and 0.06- 1.2 ⁇ , respectively. Enzymes were preincubated with the inhibitors for 20 min before adding Suc-AAPF-pNA (SEQ ID NO: 4).
- AEBSF 4-(2-Aminoethyl) benzene sulfonyl fluoride
- PMSF phenylmethanesulfonyl fluoride
- Eglin C Eglin C
- Substrate hydrolysis was monitored for 10 h at 405 nm using a Genios microtiter plate reader (Tecan, Mannedorf, Switzerland) in the kinetic mode at 37°C.
- FRET substrate hydrolysis Three fluorescence resonance energy transfer (FRET) substrates comprising the hexapeptides QPQLPY (SEQ ID NO: 22), PQPQPQ (SEQ ID NO: 23) and QGSFQP (SEQ ID NO: 24) were synthesized with at the N-terminus the HiLyte FluorTM 488 label, and at the C- terminus with K(QXL520) (Anaspec, Fremont, CA). Rmep ( 1 ⁇ g/ml) and subtilisin A (0.5 ⁇ g/ml) were incubated with the substrates (100 ⁇ ) in 50 mM TrisHCl pH 8.0.
- R5 and G12 ELISA assays Gluten epitope elimination in the gliadin-Rmep and gliadin- subtilisin A digests was assessed using two sandwich ELISA assays employing the R5 monoclonal antibody (RIDASCREEN Gliadin, R-Biopharm, Darmstadt, Germany) or the G12 monoclonal antibody (AgraQuant® ELISA Gluten G12, Romer labs, Union, MO). To prevent high background values, the R5 plate wells were blocked with 1% skim milk in PBS prior to incubation with the samples. The assays were performed according to the manufacturers' instructions and as described (21, 24).
- Fractions 7 and 8 contained proteins migrating between 75 and 150 kDa. Based on protein patterns and enzyme activities the fractions were pooled into seven fractions as follows: Fl : fractions 1-5, F2: fractions 6-8, F3, fractions 9-12, F4, fractions 13-20, F5, fractions 21-52, F6, fractions 53-56 and F7: fractions 57-65.
- F1-F7 The protein composition in F1-F7 is shown in Figure 2A.
- F2 containing the enzyme activity and hereafter called R. mucilaginosa enzyme preparation (Rmep), displayed a major band between 100-150 kDa, and a double band between 75 and 100 kDa.
- Gliadin zymography of F1-F7 showed evidence for a double enzyme band in F2 of -75-80 kDa ( Figure 2B). As expected, the highest specific activity was associated with F2 (not shown).
- Rmep was subsequently analyzed at 4 different concentrations on a 6% SDS gel under non-reducing conditions.
- ROTMU0001_0241 WP 044143864.1; C6R5V9_9MICC
- ROTMU0001_0243 WP 044143865.1; C6R5W1_9MICC
- ROTMU0001_0240 WP_005509166.1; C6R5V8_9MICC
- the -80 kDa protein is a fragment of C6R5V9 9MICC, and the -75 kDa band is derived from C6R5W1_9MICC.
- three other bands were excised from the gel shown in Figure IB
- subtilisins ROTMU0001 0241, ROTMU0001 0243 and ROTMU0001_0240 are described in the Section on subtilisins and subtilisin-like enzymes. They are classified as WP_044143864.1 peptidase S8, WP_044143865.1 peptidase S8, and WP_005509166.1 peptidase S8 respectively.
- a blast search revealed that all are members of the S8 peptidase family, which share a conserved catalytic triad comprising Asp (D), His (H) and Ser (S) in the catalytic domain of the enzyme.
- the signal peptide cleavage sites as well as the catalytic triads are indicated.
- PQPQPQ (SEQ ID NO: 23), a theoretical substrate for Rothia enzymes, and QGSFQP (SEQ ID NO: 24), contained in two gliadin epitopes.
- QGSFQP not containing XPX, was not cleaved.
- Subtilin A showed the highest activity towards the PQPQPQ substrate ( Figure 4E).
- subtilisins The gluten-degrading enzymes of Rothia were identified as members of the subtilisin protease family, and the gluten-degrading activities of this class of enzymes were shown to extend beyond the Rothia genus.
- the cleavage specificity of subtilisins is XPX ⁇ with X in the PI position preferably being a hydrophobic amino acid.
- substrates with Q in the PI position were found to be highly susceptible to cleavage by Rmep and subtilisin A.
- XPQ is present in the majority of the antigenic gluten epitopes relevant in CD (31).
- a subset of such Q residues in gliadins are deamidated by the enzyme tissue transglutaminase 2 (TG2) in the patients' lamina intestinal, a key step in the pathogenesis of CD (32).
- TG2 tissue transglutaminase 2
- This deamidation of increases the peptides' affinity for HLA-DQ2 and HLA-DQ8 expressed on antigen- presenting cells and triggers the destructive mucosal T cell response.
- Glutamine residues in the XPQXP context are particularly prone to such deamidation (33, 34). Selective cleavage after Q in this context will prevent this T cell activation.
- the three major Rothia species are R. aeria, R. mucilaginosa and R. dentocariosa.
- Analysis of the gluten degrading Rothia enzymes showed that they belong to the D-H-S class of subtilisins (35, 36) and not to the family of kexins (an S8 protease sub -family). All contain a signal peptide for secretion, which is presumably cleaved off as most contain the consensus sequence AxA
- LPxTG C-terminal LPxTG-type peptidoglycan anchor
- R,K positively charged residues
- Rothia subtilisins did contain two to three C-terminal SLH (surface layer homology) domains, called
- subtilisins The mass spectrometric identification of subtilisins prompted the exploration of other subtilisins from other microbes, specifically Bacillus species, for activity, and they were here identified also to degrade gluten. Like Rmep, subtilisin A indeed degraded gluten with similar efficacy. Like Rothia, the Bacillus genomes encodes for several extracellular subtilisins. In general, bacteria that express multiple extracellular proteases reside in a protein-rich environment, and use proteases to degrade proteins into peptides that can subsequently be utilized for growth. This is the case for the natural habitat of Rothia species, the oral cavity, where XPQ-containing substrates are prevalent.
- the XPQ-rich proteins are not only represented by the ingested gluten proteins, but also by salivary proline-rich proteins that are produced constitutively by the salivary glands (38-41).
- salivary proline-rich proteins that are produced constitutively by the salivary glands (38-41).
- both B. subtilis and Rothia colonize the oral cavity ( 42) and that the salivary basic proline-rich proteins undergo extensive proteolytic fragmentation, with primary cleavage after XPQ ⁇ (43-45). Based on our data, these cleavages are carried out most likely by the identified oral bacterial subtilisins.
- subtilisin identification There were two observations in the subtilisin identification made in Rmep. First, Rmep was significantly less sensitive to the inhibitory effect of Eglin C than subtilisin A. This difference in sensitivity between both enzymes can best be explained by the significant structural differences between Rmep and subtilisin A in domains flanking their active sites. Secondly, the molecular weight of the subtilisins identified in the -75-80 kDa gel bands did not match their predicted molecular weight (-125 kDa).
- B. subtilis is food safe and has been consumed for decades, e.g. in a product called natto, a Japanese fermented soy bean dish.
- natto a product called natto
- the active enzyme is nattokinase, a 27.7 kDa subtilisin enzyme (subtilisin NAT or NattoK) (47). It is available in pure form as a dietary supplement.
- subtilisins are being used in detergents and household cleaning products.
- the food-grade status of B. subtilis and its already widely consumed products including nattokinase suggest readily available options for CD patients to achieve improved immunogenic gluten removal in vivo.
- the R. mucilaginosa subtilisins have superior epitope -detoxifying capacities compared to Bacillus subtilisins, and thus can be considered highly promising future food additives for this purpose.
- a potential shortcoming of subtilisins is their relatively low activity at acidic pH, which would reduce efficacy during gastric transit. This can be addressed by focusing future efforts on the R. aeria subtilisins, which are active at more acidic pH values as low as 3.0 (22). Furthermore, with molecular approaches further improvement of activity of subtilisins at low pH can be anticipated.
- A-gel After electrophoresis at a constant voltage of 120V at 4°C, the gel was divided in two halves ("A-gel” and "B-gel”). One-half (“A- gel”) was stained with 0.1% Coomassie Brilliant Blue in 40% (v/v) methanol/10% (v/v) acetic acid. The other half (“B-gel”) was developed as a zymogram gel 3 . (See Figure 12A and 12B). For this, the B-gel was washed twice for 30 min in buffer containing 2.5% Triton X-100 (renaturing buffer; Life
- LC-ESI-MS/MS The A-gel and B-gel halves were aligned, and the protein displaying enzyme activity in the B-gel was excised from the duplicate lanes, and the matching band in the A-gel was also excised in duplo.
- the proteins were digested in-gel with sequencing-grade trypsin, and the peptides were eluted and separated by in line C18 chromatography.
- the amino acid sequences of the peptide ions were obtained with an LTQ Orbitrap mass spectrometer (ThermoFinnigan, San Jose, CA). The b- and y-ion spectra were searched against a database of R.
- aeria F0474 supplemented with decoy proteins as well as the 46 Rothia subtilisin genes shown in Figure 10.
- the deltaCn and peptide probability settings were >0.1 and ⁇ 0.01, resp., as previously applied 3 .
- subtilisin protein from R. aeria protein was highly homologous to KGJ00122.1.
- a blast search of KGJ00122.1 revealed that it is 99% homologous to a R. aeria protein annotated as glycerol-3P-ABC transporter on NCBI (BAV86562.1).
- Sequence analysis of BAV86562.1 revealed that it is an enzyme, and that it belongs to the subtilisin family of proteases.
- the amino acid sequence is shown in this disclosure, and in the amino acid section in bold is the cd07474 domain, representing the Peptidase S8 family domain.
- the D, S and H amino acids of the catalytic triad are underlined. Alignment of
- HGTHVAGTAAGYGV (SEQ ID NO: 42) in the non-redundant (all emcompassing) limited to subtilisins identified Rothia-like peptidase S8 enzymes in Cellulomonas, Curtobacterium, Sanguibacter, Arthrobacter, Kitasatospora, Prauserella, Streptomyces, Pseudoglutamicibacter, Actinosynema, and Modestobacter genera, but not in Bacillus. It is predicted that these species produce enzymes that can cleave gluten, including the G12 epitope.
- EXAMPLE 3 Degradation of cereal amylase-trypsin inhibitors (ATIs) by gluten-degrahing subtilisin from Rothia sp.
- ATIs cereal amylase-trypsin inhibitors
- NCWS Non-celiac/non-allergy wheat sensitivity
- NCWS has an estimated prevalence of 5-10% in wheat (cereal) consuming populations 1 3 .
- NCWS is characterized by intestinal and extra-intestinal symptoms related to the consumption of gluten-containing foods that are also enriched in amylase-trypsin inhibitors (ATIs) 2 .
- ATIs amylase-trypsin inhibitors
- the diagnosis is made after CD and wheat allergy have been excluded and if the patients display typical symptoms and complaints within hours to days after consumption of ATI- containing cereals, mainly wheat, and remission of these symptoms within a few hours to days after stopping their consumption 1.
- the wheat components responsible for the initiation of an innate immune responses to wheat and related cereals in NCWS have been identified as ATIs4.
- ATIs are a family of disulfide-linked and protease resistant proteins that occur as monomers, dimers and tetramers with molecular weights ranging from 12-60 kDa. ATIs bind to and activate the TLR4-MD2-CD14 complex on mainly myeloid cells (dendritic cells, macrophages, monocytes), ultimately resulting in the release of proinflammatory innate cytokines 3 ' 4 .
- Rothia and Bacillus -derived subtilisins can cleave gluten proteins, with an apparent specificity after XPQ l 5 .
- XPX sequences and other sequences cleavable by subtilisins are also present in ATIs.
- ATIs are highly resistant to degradation by mammalian digestive enzymes 3 .
- a dietary enzyme that could eliminate immunotoxicity of both gluten and ATIs would clearly be beneficial for the treatment of the spectrum of wheat (cereal)-associated gastrointestinal disorders comprising CD and NCWS. Therefore, we investigated if the Bacillus and Rothia-derived subtilisins can degrade ATIs.
- ATIs were isolated from wheat cultivars as described 3 . They were incubated at a final concentration of 500 ⁇ g/ml with 10, 25 or 50 ⁇ g/ml Rmep (from R. mucilaginosa), or nattokinase (from B. subtilis). The controls incubations were carried out with heat-inactivated Rmep and nattokinase.
- ATIs Approximately 50% of the ATIs (500 ⁇ g/ml) were degraded after lh incubation with 50 ⁇ g/ml nattokinase, or after 4h incubation with 10 ⁇ g/ml nattokinase (Figure 15C). As expected, nattokinase also rapidly degraded gliadins ( Figure 15D). ATIs were stable when incubated with heat-inactivated Rmep or nattokinase ( Figures 15E and 15F). The results show that nattokinase is unique in being able to cleave ATIs and potentially to abolish their pro-inflammatory properties implicated in NCWS.
- Bacterial strains- Two gluten-degrading P. aeruginosa strains were isolated from human feces, which is described herein.
- the isolation and characterization of gluten-degrading Rothia mucilaginosa and R. aeria (WSA-8) from human saliva samples has been described herein.
- the R. mucilaginosa strain used in the present study was obtained from the American Type Culture Collection (ATCC strain 25296).
- Suspensions were incubated for 30 min at 37°C after which 5 ⁇ aliquots were plated in triplicate on Brucella agar to assess cell viability. The residual 995 ⁇ aliquots were lyophilized to dryness using a SpeedVac (Thermo Fisher). The lyophilized bacteria that had been incubated in 70% ethanol were reconstituted in 1 ml sterile SIB, and the bacteria that had been incubated in SIB (control) were reconstituted in deionized sterile water, yielding the same final ion composition in both samples. Enzyme activities in the reconstituted suspensions were assessed by gliadin zymography and by determining the hydrolysis of tripeptide substrates.
- Gliadin zymography-Gliadin zymogram gels (6%) were prepared with mixed gliadin from wheat (Sigma, St. Louis, MO) as the gel incorporated substrate, as previously described 6 .
- the peletted cells were resuspended in 40 ⁇ non-denaturing zymogram sample buffer and loaded onto the zymogram gel.
- Electrophoresis was carried out at 100 V at 4°C, and gels were renatured and developed in zymogram renaturing and developing buffers (InVitrogen, Carlsbad, CA, USA) according to the manufacturer's instructions. After 48 h of development at 37°C, gels were stained with 0.1% Coomassie Brilliant blue in a mixture of 40% methanol/10% acetic acid, and destained until the contrast between clear bands and background was optimal.
- Synthetic tripeptide substrates hydrolysis-Aliquots of 200 ⁇ reconstituted ethanol-treated and untreated P. aeruginosa cells in SIB (OD 1.2) were mixed with benzyloxycarbonyl-Leu-Pro-Tyr- paranitroanilide (Z-LPY-pNA) and aliquots 200 ⁇ aliquots of the Rothia strains were mixed with Z-Tyr- Pro-Gln-pNA (Z-YPQ-pNA) (21st Century Biochemicals, Marlborough, MA). The final concentration of the tripeptide substrates was 200 ⁇ . All experiments were performed in triplicate.
- Substrate hydrolysis was monitored spectrophotometrically at 405 nm, using a Genios microtiterplate reader (Tecan Group Ltd., Mannedorf, Switzerland) and Deltasoft software, with the equipment temperature set at 37°C. Readings were performed in the kinetic mode at the indicated time intervals.
- Results show that gliadin-degrading enzyme activities were unaffected by ethanol treatment, as evidenced from clear bands in the gliadin zymogram gels ( Figure 16B). From the rates of tripeptide hydrolysis depicted in Figures 16C and 61D it could be calculated that ⁇ 10% enzyme activity was lost after 70% ethanol treatment. The results show that the added ethanol could be fully eliminated by lyophilization after treatment, yielding an active enzyme preparation that was unadulterated with respect to the starting material, apart from being devoid of life cells.
- Stepniak D et al. Highly efficient gluten degradation with a newly identified prolyl endoprotease: implications for celiac disease. Am J Physiol Gastrointest Liver Physiol 2006;291 :G621-9.
- VSL#3 probiotic preparation has the capacity to hydrolyze gliadin polypeptides responsible for Celiac Sprue. Biochim Biophys Acta 2006; 1762:80-93.
- Fernandez-Feo M et al. The cultivable human oral gluten-degrading microbiome and its potential implications in coeliac disease and gluten sensitivity. Clin Microbiol Infect 2013;19:E386-94.
- Gallagher T et al.
- the prosegment-subtilisin BPN' complex crystal structure of a specific 'foldase'. Structure 1995;3:907-14.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Polymers & Plastics (AREA)
- Food Science & Technology (AREA)
- Nutrition Science (AREA)
- Mycology (AREA)
- Enzymes And Modification Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Coloring Foods And Improving Nutritive Qualities (AREA)
Abstract
There are gluten-degrading enzymes found in Rothia species bacteria that are subtilisins that belonging to the S8A family of serine protease family. The Rothia sp. derived subtilisin-like enzymes have the conserved catalytic triad composed of a Ser, His, and Asp residues that is characteristic of the serine protease family. The Rothia subtilisin enzymes are potent at cleaving proline-containing proteins, cleaving the second peptide bond after proline in the XPX1 motif, where X is any amino acid, P is proline and X1 is a hydrophobic amino acid, e.g. the XPQ motif, where Q is glutamine. Embodiments herein provide isolated enzyme compositions and formulations comprising subtilisins gluten-degrading enzyme from a Rothia species bacteria. Also provided herein are methods of treatment of celiac disease or a related disorder, treatment of gluten-containing foodstuff, degrading and/or detoxifying gluten comprising the subtilisins gluten-degrading enzyme and/or compositions.
Description
ROTHIA SUBTILISINS, S8A FAMILY PROTEASES, AS THERAPEUTIC ENZYMES FOR APPLICATION IN GLUTEN-INTOLERANCE DISORDERS
CROSS REFERENCE TO RELATED APPLICATION
[0001] This application claims benefit under 35 U.S.C. § 119(e) of the U.S. provisional application No. 62/293,960 filed February 11, 2016, the contents of which are incorporated herein by reference in their entirety.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. The ASCII copy, created on February 10, 2017, is named 701586-086341-PCT _SL.txt and is 549,085 bytes in size.
GOVERNMENT SUPPORT
[0003] This invention was made with Government support under contract No. AI087803 and AI101067 awarded by the National Institutes of Health. The Government has certain rights in the invention.
FIELD OF THE DISCLOSURE
[0004] The field of the invention relates to gluten-degrading enzymes and/or the treatment of celiac disease or a related disorder.
BACKGROUND OF THE DISCLOSURE
[0005] Celiac disease, also called celiac sprue or gluten-sensitive enteropathy, is a disease which develops in susceptible individuals in response to the intake of dietary gluten. The disease is caused by an immune reaction to gluten, most noticeably, to gliadin-derived peptides. These peptides elicit an immune response damaging the villi, which are tiny protrusions that line the small intestine. Their destruction causes malabsorbtion of nutrients leading to a variety of generalized gastro-intestinal disease symptoms such as diarrhea and abdominal pain. Additional and secondary symptoms include weight loss, fatigue, anemia, osteopenia and skin and tooth enamel defects.
[0006] A related disease/disorder is dermatitis herpetiformis, which is a chronic eruption of the skin characterized by clusters of intensely pruritic vesicles, papules, and urticaria-like lesions. IgA deposits occur in almost all normal-appearing and perilesional skin. Asymptomatic gluten-sensitive enteropathy is found in 75 to 90% of patients and in some of their relatives. Onset is usually gradual. Itching and burning are severe, and scratching often obscures the primary lesions with eczematization of nearby skin, leading to an erroneous diagnosis of eczema. Strict adherence to a gluten-free diet for prolonged periods may control the disease in some patients, obviating or reducing the requirement for drug therapy.
Dapsone, sulfapyridine and colchicines are sometimes prescribed for relief of itching.
[0007] Gluten allergy/gluten intolerance is a related ailment which results from overreaction of a subject's immune system to gluten and gliadin that are normally considered harmless. The symptoms are very similar to celiac sprue or gluten-sensitive enteropathy but without the enteropathy. Afflicted subjects have an abundance of IgG, IgA antibodies against α/β-gliadin. Typical symptoms are abdominal pain, gas, bloating and diarrhea; there is a general feeling of sickness and fatigue after grain-based products are consumed. Severe allergy can led to Gluten-sensitive idiopathic neuropathy where the typical symptoms
are ataxia and peripheral neuropathies because the primary tissue targeted are the central nervous system and peripheral nerves.
[0008] There is currently no good marketed treatment for celiac disease. In most cases, the symptoms are reversible and can be avoided if the patients refrain from the intake of gluten. However, complete elimination of gluten from the diet is not easy to achieve and maintain. Glutens are abundantly contained in dietary products made of wheat, barley and rye. Moreover, gluten is also widely used, for example in commercial soups, sauces, ice creams, hot dogs, and other foods, that patients need detailed lists of foodstuffs to avoid and expert advice from a dietitian familiar with celiac disease. Ingesting even small amounts of gluten may prevent remission or induce relapse. Supplementary vitamins, minerals, and hematinics may also be required, depending on deficiency. A few patients respond poorly or not at all to gluten withdrawal, either because the diagnosis is incorrect or because the disease is refractory. In the latter case, oral corticosteroids (e.g., prednisone 10 to 20 mg b.i.d) may induce response.
[0009] The gluten-free diet advice is to be followed for a lifetime, and intake of gluten, even in small amounts, can cause an immediate immunological response. In view of the serious and widespread nature of Celiac Sprue, the development of a non-dietary therapy would allow patients to lead a more normal life and find a broad application in the gluten-sensitive patient population.
[0010] Current approaches geared towards the development of treatment options for celiac disease and allergic gluten sensitivity focus on enzyme preparations that are able to digest the immunogenic gluten/gliadin oligopeptides into smaller fragments that do not elicit an immune response. Gluten proteins are remarkably resistant to human digestive enzymes operating in the gastro-intestinal tract due to the low content of lysine/arginine and the high proline content. Enzymes capable of gluten digestion are considered an attractive therapeutic option.
[0011] Moreover, gluten containing foods contain another class of non-gluten proteins with innate immune stimulatory and thus proinflammatory activity, namely the amylase .trypsin inhibitors (ATIs ). ATIs induce the condition of non-celiac wheat sensitivity (formerly "gluten sensitivity") which worsens both intestinal and extraintestinla chronic inflammatory diseases, including inflammatory bowel diseases, and autoimmune diseases like SLE, multiple sclerosis, the metabolic syndrome or allergic asthma - therefore affecting even more people that celiac disease. Notably, these diseases are not exacerbated by gluten. Here, a protease that would degrade and thus inactivate ATIs in gluten containing food stuffs would be highly desirable.
SUMMARY OF THE DISCLOSURE
[0012] The compositions, formulations, foodstuffs, and methods described herein are based, in part, on the discovery of subtilisins and subtilisin-like enzymes from Rothia species bacteria that are found in human plaque or saliva. These subtilisins and subtilisin-like enzymes from Rothia species bacteria have gluten-degrading activity. The subtilisins and subtilisin-like, gluten-degrading enzymes of Rothia were identified as members of the subtilisin protease family, and the gluten-degrading activities of this class of enzymes were shown to extend beyond the Rothia genus. In addition, these subtilisins and subtilisin-like enzymes were able to degrade amylase-trypsin inhibitors (ATIs) that are highly resistant to degradation
by mammalian digestive enzymes. A dietary enzyme that could eliminate immunotoxicity of both gluten and ATIs would clearly be beneficial for the treatment of the spectrum of wheat (cereal)-associated gastrointestinal disorders comprising CD and NCWS. These subtilisins and subtilisin-like, gluten- degrading enzymes can be formulated for the treatment of celiac disease, non-celiac/non-allergy wheat sensitivity due to ATIs, and/or a related disorder, and are especially useful for oral delivery as they retain their activity.
[0013] Embodiments of the present disclosure relate to use of subtilisins and subtilisin-like enzymes having gluten-degrading activities from the Rothia bacteria spp. for the production of formulations and compositions comprising the subtilisins and subtilisin-like enzymes therein, the methods of treatment of gluten-containing foodstuff, and for the methods of treating individuals with gluten allergy or celiac disease. Gluten degrading enzymes have been isolated from Rothia mucilaginosa ATCC 25296 and Rothia aeria (e.g., R. aeria Oral Taxon 188, also called Rothia species ot 188, Rothia sp. HOT-188, R. aeria strain F0474 (HMP ID 1324), R. aeria HM-818, and R. aeria strain WSA), and are identified, by sequence alignment, to be subtilisins that belonging to the S8A family of serine protease family. The Rothia sp. derived subtilisin-like enzymes have the conserved catalytic triad composed of a Ser (S), His (H), and Asp (D) residues that is characteristic of the serine protease family. The Rothia subtilisin enzymes are potent at cleaving proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and Xi is a hydrophobic amino acid; e.g. the XPQ motif, where Q is glutamine, and cleavage occurs after Q. Gluten-degrading activities are also shown for a well-known subtilisin A, derived from bacteria of the Bacillus sp. Therefore, subtilisins can useful for breaking down proline -glutamine rich proteins and peptides such as glutens, gliadins and peptides that are resistant to further digestion by other peptidases where these have been shown to elicit an immune response in celiac disease (CD). These enzymes can be used to pre-digest or pre-treatment of food containing such proteins or the enzyme can be taken together with the food containing such proteins.
[0014] Furthermore, the inventors have also developed a method that effectively kills bacteria, while fully preserving their enzymatic activities therein. Here, the inventors treated four gluten-degrading microbial strains with ethanol (e.g.,1%, 2%, 50%) for a period of time (e.g., 30 min-1 hr). Treatment with ethanol effectively kills the bacteria, so that the bacteria cannot replicate and are not viable.
However, the gluten-degrading enzymatic activities of the bacteria remain intact in the ethanol-treated bacteria. Compositions comprising of such ethanol-treated and lyophilized bacteria would be useful for the methods described herein, for example, for the production or treatment or both the production and treatment of gluten-containing foodstuff or amylase-trypsin inhibitor containing foodstuff, and for the methods of treating individuals with gluten allergy or CD, and other related disorders described herein.
[0015] Accordingly, it is the objective of this disclosure to provide uses of subtilisins for the methods of production or treatment or both production and treatment of gluten-containing foodstuff or amylase - trypsin inhibitor containing foodstuff, and for the methods of treating individuals with gluten allergy or CD, and other related disorders described herein.
[0016] It is also the objective of this disclosure to provide of subtilisins and subtilisin-like enzymes derived from Rothia bacteria sp. for methods of the production or treatment or both production and treatment of gluten-containing foodstuff or amylase-trypsin inhibitor containing foodstuff, and for the methods of treating individuals with gluten allergy or celiac disease, or other related disorders described herein.
[0017] Also contemplated is to provide compositions and formulations of compositions comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein for for methods of the production or treatment or both production and treatment of gluten-containing foodstuff or amylase-trypsin inhibitor containing foodstuff, and for the methods of treating individuals with gluten allergy or celiac disease, or other related disorders described herein.
[0018] In some embodiments, provided herein are gluten-free foodstuff compositions comprising a gluten-containing foodstuff in an admixture with a formulation or a composition comprising an isolated subtilisin or a subtilisin-like enzyme or both a subtilisin and a subtilisin-like enzyme derived a Rothia bacteria sp. as described herein, e.g., SEQ. ID. NO: 1-3, 33 and 34. More than one isolated subtilisin or a subtilisin-like enzyme is comtemplated. In other embodiments, the gluten-free foodstuff compositions comprise a gluten-containing foodstuff in an admixture with a formulation or a composition comprising an isolated subtilisin and/or subtilisin-like enzyme derived Rothia bacteria sp. and at least another isolated endopeptidase selected from a gluten-degrading enzyme from Rothia species bacteria, an isolated glutamine endopeptidase and a prolyl endopeptidase. Combinations of two or more isolated
endopeptidases are comtemplated, e.g., gluten-degrading enzyme and an isolated glutamine
endopeptidase, or an isolated glutamine endopeptidase and a prolyl endopeptidase, in addition the isolated subtilisin and/or subtilisin-like enzyme derived Rothia bacteria sp.
[0019] Accordingly, in one embodiment, provided herein is a foodstuff comprising a formulation or a composition comprising a subtilisin enzyme derived from a. Rothia sp. bacteria described herein.
[0020] In another embodiment, provided herein is a method for degrading gluten or attenuating gluten toxicity in a gluten-containing foodstuff, the method comprises contacting the gluten-containing foodstuff with an effective dose of a formulation or composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
[0021] In another embodiment, provided herein is a formulation or composition comprising (a) an isolated subtilisin and/or subtilisin-like enzyme derived from a Rothia sp. bacteria, and (b) a prolyl endopeptidase (PEP).
[0022] In another embodiment, provided herein is a formulation or composition comprising (a) an isolated subtilisin and/or subtilisin-like enzyme derived from a Rothia sp. bacteria, and (b) an additional glutamine endopeptidase that is a not a subtilisin and/or subtilisin-like enzyme.
[0023] In another embodiment, provided herein is a formulation or composition comprising (a) an isolated subtilisin and/or subtilisin-like enzyme derived from a Rothia sp. bacteria, and (b) an additional gluten-degrading enzyme derived from a Rothia sp. bacteria and the gluten-degrading enzyme is a not a subtilisin and/or subtilisin-like enzyme.
[0024] In another embodiment, provided herein is a method for treating celiac disease or a related disorder such as gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis, the method comprising administering to a subject an effective dose of a formulation or composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or administering an effective dose of any one composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
[0025] In another embodiment, provided herein is a use of a subtilisin enzyme derived from a Rothia sp. bacteria to attenuate gluten toxicity in gluten-containing food stuff or for the treatment of celiac disease or a related disorder.
[0026] In another embodiment, provided herein is a use of a subtilisin enzyme derived from a Rothia sp. bacteria for the manufacture of medicament to treat of celiac disease or a related disorder.
[0027] In another embodiment, provided herein is a use of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or any one composition described herein to attenuate gluten toxicity in gluten-containing food stuff or for the treatment of celiac disease or a related disorder.
[0028] In another embodiment, provided herein is a use of a formulation or composition comprising a subtilisin enzyme derived from a. Rothia sp. bacteria, or any one composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein for the manufacture of medicament for the treatment of celiac disease or a related disorder.
[0029] In one embodiment, provided herein is a foodstuff comprising a formulation or a composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria are cannot cell divide and are not alive or viable.
[0030] In one embodiment, provided herein is a method for degrading gluten or attenuating gluten toxicity in a gluten-containing foodstuff or degrading an amylase-trypsin inhibitor in a foodstuff, the method comprises contacting the gluten-containing foodstuff or the amylase-trypsin inhibitor containing foodstuff with an effective dose of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
[0031] In another embodiment, provided herein is a formulation or composition comprising ethanol- treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
[0032] In another embodiment, provided herein is a method for treating celiac disease or a related disorder such as gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis, the method comprising administering to a subject an effective dose of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
[0033] In another embodiment, provided herein is a use of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein
described herein to attenuate gluten toxicity in gluten-containing food stuff or to degrade an amylase- trypsin inhibitor in a foodstuff for the treatment of celiac disease or a related disorder, wherein the bacteria cannot cell divide and are not alive or viable.
[0034] In another embodiment, provided herein is a use of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein for the manufacture of medicament to treat of celiac disease or a related disorder, wherein the bacteria cannot cell divide and are not alive or viable.
[0035] In one embodiment of the degrading or attenuating method described, the contacting of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff is performed in vitro prior to consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
[0036] In one embodiment of the degrading or attenuating method described, the contacting of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff is performed in vivo concurrent with or after consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
[0037] In one embodiment of the treatment method described, the administering of the formulation or composition is performed in vitro prior to consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
[0038] In one embodiment of the treatment method described, the administering of the formulation or composition is performed in vivo concurrent with or after consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
[0039] In one embodiment of the treatment method described, the administering of the formulation or composition is performed in vitro prior to and also concurrent with or after consumption of the gluten- containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
[0040] In any aspect described herein, the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, Rothia species ot 188 (strain WSA-8), Rothia sp. HOT-188, Rothia aeria strain F0474 (HMP ID 1324), Rothia aeria HM-818, Rothia aeria strain WSA-8, Rothia aeria BAV86562.1 and Rothia dentocariosa KGJ00122.1.
[0041] In any aspect described herein, the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa, Rothia aeria and Rothia dentocariosa.
[0042] In any aspect described herein, the subtilisin comprises, or consists of, or consists essentially of the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243
(C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins. (See Section on subtilisins and subtilisin-like enzymes), (SEQ, ID. NOS: 1-3). The hypothetical ROTMU0001_0241 (C6R5V9_9MICC) is protein WP 044143864.1, ROTMU0001_0243 (C6R5W1_9MICC) ) is protein WP_044143865.1, and ROTMU0001_240 (C6R5V8_9MICC) is protein WP 005509166.1.
[0043] In any aspect described herein, the subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins.
[0044] In any aspect described herein, the subtilisin is a truncated protein of the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) protein. For example, at least 60% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins as described in SEQ, ID. NOS: 1-3.
[0045] In any aspect described herein, the subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
[0046] In any aspect described herein, the subtilisin cleaves proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and Xi is a hydrophobic amino acid, i.e., cleaving at the peptide bond after X1; e.g. the XPQ motif, where Q is glutamine and the cleavage occurs after Q.
[0047] In any aspect described herein, the subtilisin cleaves proline-containing proteins after the proline in the XPXi motif.
[0048] In any aspect described herein, the subtilisin cleaves succinyl-Ala-Ala-Pro-Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after proline in the P2 position. The numbering of the amino acid position (e.g., PI, P2, P3) is with respect to the peptide bond that is cleaved by the enzyme described. The amino acid residue immediately upstream of the cleavage peptide bond is designated the position PI, the amino acid residue immediately upstream of the PI amino acid residue is P2. Here, in the substrate for subtilisin, Phe = PI position, and Pro = P2 position, Ala = P3 and P4 positions.
[0049] In any aspect described herein, the subtilisin degrades the highly immunogenic gliadin-derived 33 -mer peptide. In any aspect described herein, the subtilisin degrades an amylase -trypsin inhibitor.
[0050] In any aspect described herein, the subtilisin does not cleave the second peptide bond after proline in the P2 position in a tripeptide having the -PiFP2- motif, wherein Pi and P2 are P = proline = Pro; F= Phenylalanine=Phe (in PI position); and Pi is in the P2 position.. The presense of P2 in this position is well known to interfere with protease activity. In any aspect described herein, the subtilisin does not cleave the peptide bond after Phe.
[0051] In any aspect described herein, the subtilisin does not cleave the second peptide bond after proline in the P2 position in a tripeptide having the -PPF- motif, wherein F= Phenylalanine=Phe (in the P0 position); P = proline = Pro (in the PI and P2 positions).
[0052] In any aspect described herein, the subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes.
[0053] In any aspect described herein, the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel
electrophoresis (SDS-PAGE) or as described in Figures 2A-2E in the Example section; or have a predicted molecular weight of -125 kDa as described in the Example section.
[0054] In any aspect described herein, the subtilisin undergoes activation to produce a shorter mature enzyme. For example, the subtilisin undergoes activation from a -125 kDa protein to a -75-80 kDa protein as determined by SDS-PAGE.
[0055] In any aspect described herein, the subtilisin enzyme has a functional pH range of 6.0-10.0. as determined by detectable Z-YPQ-pNA cleaving activity described herein. For example, a detectable Z- YPQ-pNA cleaving activity within a 72 hour digestion period or substantially complete Z-YPQ-pNA cleavage within a 1 hour digestion period.
[0056] In any aspect described herein, the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
[0057] In any aspect described herein, the subtilisin enzyme is a R. mucilaginosa-derrved subtilisin enzyme.
[0058] In any aspect described herein, the subtilisin is inhibited PMSF. In another embodiment, the subtilisin is 100% inhibited by ImM of PMSF.
[0059] In any aspect described herein, the subtilisin is not inhibited by E64 or EDTA.
[0060] In any aspect described herein, the subtilisin is not stable in acid conditions.
[0061] In any aspect described herein, the subtilisin is lyophilized.
[0062] In any aspect described herein, the lyophilized subtilisin is formulated into granules or is encapsulated.
[0063] In any aspect described herein, the subtilisin is a protein isolated from Rothia sp. bacteria. For example, by protein purification methods from cell extracts of Rothia sp., methods that are known in the art, for example, as described in the Example section.
[0064] In any aspect described herein, the subtilisin is an isolated recombinant protein. For example, the subtilisin nucleic acid coding sequence is expressed in another organism other than Rothia sp. For example, expression in yeast or Escherichia coli, or any mammalian cells such as COS cells.
[0065] In any aspect described herein, the subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 (See Section on subtilisins and subtilisin-like enzymes).
[0066] In any aspect described herein, the subtilisin comprises SEQ. ID. NO: 1, 2 or 3.
[0067] In any aspect described herein, the subtilisin consists of SEQ. ID. NO: 1, 2 or 3.
[0068] In any aspect described herein, the subtilisin consists essentially of SEQ. ID. NO: 1, 2 or 3.
[0069] In any aspect described herein, the subtilisin is SEQ. ID. NO: 1, 2 or 3.
[0070] In any aspect described herein, the formulation further comprising a prolyl endopeptidase (PEP).
[0071] In any aspect described herein, the formulation further comprising at least one additional gluten- degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten- degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ-pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
[0072] In any aspect described herein, the at least one additional gluten-degrading enzyme is not a subtilisin or a subtilisin-like protein isolated from a Rothia sp. bacteria.
[0073] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 is derived from the Rothia species Rothia species ot 188, also known as Rothia sp. HOT- 188 , Raeria strain F0474 (HMP ID 1324), R. aeria HM-818, and Rothia aeria strain WSA-8.
[0074] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an iso-electric point in a pH range of 2.0-4.0, inclusive.
[0075] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight between 120-150kDa, inclusive.
[0076] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight of 135-145kDa, inclusive.
[0077] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight between 50 and 90kDa, inclusive.
[0078] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 65 and 75 kDa, inclusive.
[0079] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 75 and 80 kDa, inclusive.
[0080] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 65 and 80 kDa, inclusive.
[0081] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 retains activity at the pH between 2.5 and 5.0, inclusive.
[0082] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 degrades a gliadin protein, a fragment thereof, or a gluten-containing foodstuff or ingredient thereof.
[0083] In any aspect described herein, the degradation is partial.
[0084] In any aspect described herein, the degradation is complete.
[0085] In any aspect described herein, the fragment thereof is a 33-mer peptide of ot2-gliadin or a 26- mer domain derived from γ-gliadin.
[0086] In any aspect described herein, the 33-mer peptide is
LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF (SEQ ID NO: 5).
[0087] In any aspect described herein, the 26-mer domain is FLQPQQPFPQQPQQPYPQQPQQPFPQ (SEQ ID NO: 6).
[0088] In any aspect described herein, the degradation by the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 occurs by cleaving the peptide bond after an amino acid sequence selected from the group consisting of -XPQ- -QQP-, -PPF-, - LPY-, -XPY- and - PFP-.
[0089] In any aspect described herein, the formulation or composition further comprising at least one isolated additional glutamine endopeptidase enzyme that cleaves a peptide bond after a QPF and a PFP motif in glutens.
[0090] In any aspect described herein, the at least one additional glutamine endopeptidase enzyme is not a subtilisin or a subtilisin-like protein isolated from a Rothia sp. bacteria.
[0091] In any aspect described herein, the degradation by the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 occurs by cleaving the peptide bond after an amino acid sequence selected from the group consisting of -XPQ-,-QQP-, -PPF-, - LPY- , -XPY- and - PFP-. In other embodiments, degradation or digestion occurs by cleaving the peptide bonds after amino acid sequences XPQ and QQP; XPQ and PPF; XPQ and PFP; XPQ and LPY; QQP and LPY; PPF and LPY; PFP and LPY; XPQ, QQP and PPF; XPQ, QQP and PFP; XPQ, QQP and LPY; QQP, PPF, and PFP; XPQ, PPF and PFP; QQP, PPF and LPY; XPQ, PPF and LPY; PY, PPF, and PFP; QQP, PFP and LPY; XPQ, PFP and LPY; XPQ, QQP, PPF and LPY; LPY, QQP, PPF and PFP; XPQ, LPY, PPF and PFP; XPQ, QQP, PFP and LPY; XPQ, QQP, PPF and PFP; or XPQ, QQP, PPF, LPY and PFP.
[0092] In any aspect described herein, the PEP is derived from the microorganism selected from the group consisting of Aspergillus niger, Flavobacterium meningosepticum, Sphingomonas capsulata, Penicillium citrinum, Hordeum vulgar e, and Myxococcus xanthus.
[0093] In any aspect described herein, the formulation or composition further comprising a glutamine specific protease which is selected from the group consisting of Hordeum vulgare endoprotease, Aspergillus oryzae X-Pro dipeptidase, and Aspergillus saitoi carboxypeptidase. For example, glutamine specific proteases as described in US Patent No. 7628985, the contents are incorporated by reference in their entirety.
[0094] In any aspect described herein, the formulation or composition further comprising a
pharmaceutically acceptable carrier. In any aspect described herein, the composition is a pharmaceutical composition comprising the subtilisin described herein and a pharmaceutically acceptable carrier.
[0095] In any aspect described herein, the related disorder is selected from the group consisting of refractory celiac disease, gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis.
Definitions
[0096] As used herein, the term "treating" or "treatment" with respect to a medical disease or disorder means to stabilize and/or improve the clinical symptoms of a subject afflicted with celiac disease or a related disorder. In one embodiment, "treating" or "treatment" means to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression or anticipated progression of such condition, or bringing about ameliorations of the symptoms of the pathology. Evidence of a therapeutic effect may be any diminution in the severity of disease, particularly as measured by the severity of one or more symptoms such as fatigue, chronic diarrhea, malabsorption of nutrients, weight loss, abdominal distension, anemia, and other symptoms of Celiac Sprue. Other disease indicia include the presence of antibodies specific for glutens, the presence of antibodies specific for tissue
transglutaminase, the presence of pro-inflammatory T cells and cytokines, damage to the villus structure of the small intestine as evidenced by histological or other examination, enhanced intestinal permeability, and the like. In some embodiment, effective treatment according to the methods described herein is determined by a reduction in at least one symptom of Celiac Sprue, gluten allergy, gluten intolerance and/or dermatitis herpetiformis by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99% or even 100% (e.g., remission or absence of symptoms). In one embodiment, treatment according to the methods and compositions described herein induces a state of remission in celiac disease, or a related disorder, or non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors.
[0097] As used herein, the term "treating" or "treatment" with respect to a gluten-containing foodstuff means degrading or digesting the foodstuff to reduce the production of toxic gluten oligopeptides when the foodstuff is subsequently ingested and further digestion by a subject. Preferably the subject is a human. In one embodiment, "treating" or "treatment" of a gluten-containing foodstuff results in complete elimination of toxic gluten oligopeptides when the foodstuff is subsequently ingested and further digestion by a subject. In another embodiment, the "treating" or "treatment" of a gluten-containing foodstuff results in at least 10% reduction of toxic gluten oligopeptides when the foodstuff is
subsequently ingested and further digestion by a subject. In other embodiments, the "treating" or
"treatment" of a gluten-containing foodstuff results in at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99% or even 100% reduction of toxic gluten oligopeptides when the foodstuff is subsequently ingested and further digestion by a subject.
[0098] As used herein, the term "effective dose" with respect to a medical disease or disorder refers to an amount of a biologically active molecule or conjugate thereof, enzyme, or bacterial formulation (e.g., probiotic formulation) sufficient to exhibit a detectable therapeutic effect, e.g. reduction in the symptoms associated with Celiac sprue, gluten allergy and/or dermatitis herpetiformis, e. g. fatigue, chronic diarrhea, malabsorption of nutrients, weight loss, abdominal distension, anemia, the presence of antibodies specific for tissue transglutaminase, the presence of pro-inflammatory T cells and cytokines, and damage to the villus structure of the small intestines. The specific amount that is therapeutically effective can be readily determined by an ordinary medical practitioner, and can vary depending on factors known in the art, such as, for example, the subject's history and age, the stage of pathological processes, and the administration of other agents or therapeutics that inhibit pathological processes in Celiac sprue, gluten allergy and/or dermatitis herpetiformis.
[0099] As used herein, the term "effective dose" or "effective amount" with respect to the treatment of a gluten-containing foodstuff refers to the amount of a biologically active molecule or conjugate thereof, enzyme, or bacterial formulation (e.g., probiotic formulation) sufficient to produce at least 10% reduction of toxic gluten oligopeptides when the foodstuff is subsequently ingested and further digestion by a subject.
[0100] As used herein, the term "an extract from a Rothia species" refers to a clarified aqueous solution that formerly comprised a Rothia species for example, a suspension of Rothia species in phosphate buffered saline (PBS) that was agitated for 1 hour at room temperature and then centrifuged at 1000 x G for 10 minutes to sediment the bacteria. The supernatant PBS fluid is "an extract from a Rothia species". Similarly, a clarified saliva sample is "an extract from a Rothia species" . "An extract from a Rothia species" can also mean a clarified periplasmic extraction of a Rothia species, for example, a suspension of Rothia species in phosphate buffered saline (PBS) with 20% or 500 mM sucrose and is then agitated for 1 hour at 4°C and then centrifuged at 1000 x G for 10 minutes to sediment the bacteria. In the presence of high sucrose concentration, the bacteria undergo osmotic shock. Such methods of making periplasm extracts are well known to those skilled in the art, e. g. as described in US Patent 5856142. "An extract from a Rothia species" can also mean a clarified cell lysate of a Rothia species, wherein the bacteria are lysed in a suitable buffer and the lysate is centrifuged at 20,000 x G for 30 minutes to sediment the cell debris. Ultracentrifugation clarified cell lysate of a Rothia species is also "an extract from a Rothia species". "An extract from a Rothia species" can also mean a chromatography fraction containing a a -70-80 kDa protein or a ~125-~140kDA with gluten-degrading activity (e.g., glutamine endopeptidase activity) as assayed by gliadin zymography and other methods described herein.
[0101] As used herein, in one embodiment, the term "a glutamine endopeptidase" refers to a proteolytic peptidase that breaks peptide bonds of non-terminal amino acids (i.e. within a protein or peptide molecule) at the -XPQ- or -Xaa-Pro-Gln- triplet sequence and the breakage occurs immediately after the glutamine residue. X or Xaa = any amino acids, P or Pro = proline, and Q or Gin = glutamine (e.g., - YPQ- where Y or Tyr = tyrosine). In another embodiment, a glutamine endopeptidase cleaves peptide bonds at either one of the following the -QQP-, and -PFP triplet sequences. In one embodiment, a glutamine endopeptidase can also cleave a -XPY- or-Xaa-Pro-Tyr triplet sequence. In other embodiments, a glutamine endopeptidase is capable of cleaving several of the -XPQ-, -QQP-, -PPF- and -PFP- triplet sequences. It is also noted that the term "glutamine endopeptidase" encompasses proteases that typically degrade salivary basic proline-rich proteins in saliva, and as such, have glutamine endopeptidase activity to degrade proline-rich glutens.
[0102] As used herein, in one embodiment, the term "digest" or "degrade" with respect to a gluten- containing foodstuff, gluten, gliadin or fragment thereof refers to breaking a peptide bond in the protein or peptide molecule in the gluten-containing foodstuff, gluten, gliadin or fragment thereof.
[0103] As used herein, the term "acidic pH" refers to pH values less than 7.0 (e.g., 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5). As used herein the term "basic pH" refers to pH values greater than 8.0 (e.g., 8.5, 9.0, 9.5, 10.0, 10.5, 11.0, 11.5, 12.0, 12.5, 13.0, 13.5, 14.0). As used herein the term "neutral pH" refers to pH values from 7.0 to 8.0, inclusive (e.g., 7.0, 7.2, 7.4, 7.6, 7.8, 8.0).
[0104] As used herein, the term "attenuates gluten toxicity" refers to a decrease in the level of gluten proteins or gluten toxic intermediates (e.g., as measured in a subject having celiac disease and administered a gluten challenge) of at least 20% following treatment with the enzyme compositions described herein compared to an untreated subject; preferably the level of gluten proteins or gluten toxic
intermediates are decreased by at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99%, or even 100% (i.e. no detectable glutens or gluten toxic intermediates).
[0105] As used herein, the term "toxic intermediates" refers to gluten protein fragments produced by the digestion of gluten with human digestive enzymes such as trypsin, chymotrypsin, and pepsin, that induce symptoms of celiac disease or a related disorder (see also "toxic gluten oligopeptides" definition herein).
[0106] As used herein, the term "related disorder" refers to diseases induced by gluten and include, but are not limited to, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, gluten allergy, refractory celiac disease, and dermatitis herpetiformis.
[0107] As used herein, the term "admix" in the context of gluten-containing foodstuff refers to mixing or blending with gluten-containing foodstuff. The product arising from the mixing or blending is an
"admixture."
[0108] As used herein, the term "glutens" refers to a mixture of proteins, including gliadins and glutelins, found in wheat grains, which are not soluble in water and which give wheat dough its elastic texture. "Glutens" also refer to the prolamine that are found in rye, barley, and oats.
[0109] As used herein, the term "glutelin" refers to prolamin-like proteins that are found in grass seeds, e. g. wheat, and are soluble in dilute acids or bases, detergents, chaotropic or reducing agents. "Glutelin" tend to be rich in prolines and glutamine.
[0110] As used herein, the term "prolamins" refers to a group of plant storage proteins having high proline content and is found in the seeds of cereal grains such as wheat (gliadin), barley (hordein), rye (secalin), corn (zein) and as a minor protein, avenin in oats. They are characterized by a high glutamine and proline content and are generally soluble only in strong alcohol solutions. Some prolamins, notably gliadin from wheat, and similar proteins found in the grass seed of the Triticeae species can induce celiac disease in genetically predisposed individuals.
[0111] As used herein, the term "gliadin" refers to the alcohol-soluble, glutamine and proline-rich prolamin glycoprotein that is found in wheat. This is one of the proteins that induce celiac disease in genetically predisposed individuals. Examples of gliadin sequences include but are not limited to wheat alpha gliadin sequences, for example as provided in GENBANK accession numbers AJ133612;
AJ133611; AJ133610; AJ133609; AJ133608; AJ133607; AJ133606; AJ133605; AJ133604; AJ133603; AJ133602; D84341.1; U51307; U51306; U51304; U51303; U50984; and U08287. A sequence of wheat omega gliadin is set forth in Genbank accession number AF280605.
[0112] As used herein, the term "gluten-containing foodstuff refers to food and/or ingredients of food that has gluten and other proteins found in wheat, barley, and rye. "Gluten-containing foodstuff also refers to food and/or ingredients of foods that are made of wheat, barley, and rye. It is also contemplated that "gluten-containing foodstuff can be foodstuff that is merely contaminated with gluten by way of the use of common manufacturing equipment. For example, oats do not contain gluten, however, because oats are a major agricultural product they are handled by the same mills, processing plants, and grain elevators that handle wheat, barley and rye. This results in enough contamination of the oats that they can
readily trigger a gluten allergy when ingested. Also included in the term "gluten-containing foodstuff are formulations of drugs, medications, vitamin supplements or mineral supplements that are contaminated by or prepared using gluten-containing foods such as wheat, barley, or rye.
[0113] As used herein, the term "consuming gluten-containing foodstuff refers to ingesting food made of wheat, rye, and barley, e. g. pizza, cake, bread, etc. as well as ingesting food made with ingredients that are made with wheat, rye, and barley, e. g. soy sauce.
[0114] As used herein, the term "diagnosed of Celiac sprue, gluten allergy/gluten intolerance and/or dermatitis herpetiformis" refers to having the symptoms associated with Celiac sprue, gluten allergy and/or dermatitis herpetiformis, e. g. fatigue, chronic diarrhea, malabsorption of nutrients, weight loss, abdominal distension, anemia, the presence of antibodies specific for tissue transglutaminase (ATA), antibodies specific for α/β,γ-gliadin (AGA), the presence of pro-inflammatory T cells and cytokines, and damage to the villus structure of the small intestines.
[0115] As used herein, the term "toxic gluten oligopeptides" refers to peptides derived during normal human digestion of gliadins and related storage proteins from dietary cereals, e.g. wheat, rye, barley, and the like. Such oligopeptides act as antigens for T cells in Celiac Sprue. For binding to Class II MHC proteins, immunogenic peptides are usually from about 8 to 20 amino acids in length, more usually from about 10 to 18 amino acids. Such peptides may include PXP motifs, such as the motif PQPQLP (SEQ. ID. NO: 7). Determination of whether an oligopeptide is immunogenic for a particular patient is readily determined by standard T cell activation and other assays known to those of skill in the art. Other examples of immunogenic gliadin oligopeptides are described in Wieser (1995) Baillieres Clin
Gastroenterol 9(2): 191-207, incorporated herein by reference. "Toxic gluten oligopeptides" also refers to peptides that comprise known T cell epitopes in gluten, e .g. QLQPFPQPQLPY (SEQ. ID. NO: 8) or PFPQPQLPY (SEQ. ID. NO: 9), PQPQLPYPQPQLPY (SEQ. ID. NO: 10) or PQPQLPYPQ (SEQ. ID. NO: 11), QPQQSFPQQQ (SEQ. ID. NO: 12) or PQQSFPQQQ (SEQ. ID. NO: 13), QLQPFPQPELPY (SEQ. ID. NO: 14), PQPELPYPQPELPY (SEQ. ID. NO: 15), QPQQSFPEQQ (SEQ. ID. NO: 16);
IQPQQPAQL (SEQ. ID. NO: 17); QQPQQPYPQ (SEQ. ID. NO: 18); SQPQQQFPQ (SEQ. ID. NO: 19); QQPFPQQPQ (SEQ. ID. NO: 20); or PFSQQQQPV (SEQ. ID. NO: 21), including 33-mer from alpha- gliadin, LQLQPF(PQPQLPY)3PQPQPF (SEQ. ID. NO: 5), and the 26-mer from gamma-gliadin, FLQPQQPFPQQPQQPYPQQPQQPFPQ (SEQ. ID. NO: 6).
[0116] The term "isolated" refers to an enzyme protein which is substantially or essentially free from bacterial components which normally accompany or interact with the enzyme as found in the bacteria. As used herein, the term "isolated" can also refer to mixtures of enzyme proteins comprising a plurality of different enzymes substantially free from bacterial components (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more different enzymes).
[0117] As used herein, the term "inhibited" or "inhibition" when used in the context with the glutamine endopeptidase activity means the reduction of the cleavage of-XPQ-, -XPY-, -QQP-, -PPF- and/or - PFP-containing peptides by at least about 50%, about 60%, about 70%, about 80%, about 90%, about 100% (i.e., level of XPQ -containing peptides is undetectable by standard methods) by any assay
described herein or known in the art, wherein X is any amino acid, P is proline, Q is glutamine, Y is tyrosine, and F is phenylalanine.
[0118] As used herein, the term "gluten degrading activity" with respect to the compositions comprising an isolated enzyme, a plurality of isolated enzymes, an extract from Rothia species, a plurality of extracts from more than one Rothia species, a Rothia species bacteria itself, or a plurality of Rothia species bacteria refers to the capability of the composition to cleave -XPQ-, -XPY-, -QQP-, -PPF- and/or -PFP- containing peptides by at least about 50%, about 60%, about 70%, about 80%, about 90%, about 100% (i.e., level of XPQ-containing peptides is undetectable by standard methods) by any assay described herein or known in the art, wherein X is any amino acid, P is proline and Q is glutamine. In one embodiment, the cleavage is preferably at peptide bonds of non-terminal amino acids (i.e. within a protein or peptide molecule) and the breakage occurs immediately after the glutamine residue for -XPQ- sequence, immediately after the proline residue for - QQP- or -PFP- sequence, and immediately after the phenylalanine residue for -PPF- sequence.
[0119] As used herein, the phrase "retain activity in acidic pH environment" or "retain protease activity" refers to an isolated enzyme from Rothia species described herein that is still has gluten degrading activity when the enzyme is in an environment with pH less than 7.0.
[0120] As used herein, the term "inclusive" when used with pH or molecular weight of a molecule means that all possible gradation of the pH or molecular weight in contemplated within the specified range. For example, if pH is 3.0 to 4.0 inclusive, then pHs of 3.02, 3.1, 3.14, 3.2, 3.75, 3.99 etc are also contemplated.
[0121] As used herein, the terms "subtilisin" and "subtilisin-like enzyme" means a protease that comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family. Subtilisin and subtilisin-like enzyme are used interchangeably when referring to the enzyme derived from the Rothia sp. bacteria.
[0122] An enzyme that is "derived from Rothia sp." means the enzyme is isolated directly from the bacteria or the enzyme is a recombinant expressed protein from a coding nucleic acid sequence deduced from the Rothia sp."
[0123] The phrase "pharmaceutically acceptable" is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
[0124] The phrase "pharmaceutically acceptable carrier" as used herein means a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in e.g., absorption, carrying or transporting the subject agents from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be "acceptable" in the sense of being compatible with the other ingredients of the formulation, for example the carrier does not decrease the impact of the agent on the treatment.
[0125] As used herein the term "comprising" or "comprises" is used in reference to compositions, methods, and respective component(s) thereof, that are essential to the invention, yet open to the inclusion of unspecified elements, whether essential or not.
[0126] As used herein the term "consisting essentially of refers to those elements required for a given embodiment. The term permits the presence of elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment of the invention.
[0127] The term "consisting of refers to compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.
[0128] As used in this specification and the appended claims, the singular forms "a," "an," and "the" include plural references unless the context clearly dictates otherwise. Thus for example, references to "the method" includes one or more methods, and/or steps of the type described herein and/or which will become apparent to those persons skilled in the art upon reading this disclosure and so forth.
BRIEF DESCRIPTION OF THE FIGURES
[0129] Figures 1A-1C show the isolation of R. mucilaginosa gluten-degrading enzymes by DEAE chromatography. R. mucilaginosa cells were lysed, sonicated, the supernatant ultracentrifuged, and the pellet dissolved in n-Octyl- -D-glucopyranoside.
[0130] Figure 1A shows the separation of proteins by DEAE chromatography applying an isocratic gradient containing 0.3M NaCl and 50 mM TrisHCl pH 7.0.
[0131] Figure IB shows a representative SDS-PAGE gel of the DEAE chromatography fractions. Protein content in 100 μΐ fraction aliquots investigated by 4-12% SDS PAGE.
[0132] Figure 1C is a histogram showing the enzyme activity in 50 μΐ fraction aliquots investigated with Z-YPQ-pNA as the substrate. The data shown are representative of two independent experiments.
[0133] Figures 2A-2E demonstrate the identification of the gluten-degrading enzymes of R.
mucilaginosa. DEAE fractions 1-65 were pooled into 7 fractions designated F1-F7 (see Example section for details).
[0134] Figure 2A shows a representative SDS-PAGE gel of the DEAE chromatography pooled fractions. Protein content in 400 μΐ aliquots of F1-F7 were analyzed on a 4-12% SDS-PAGE gel.
[0135] Figure 2B shows a representative gliadin zymogram gel of the DEAE chromatography pooled fractions. Gliadin-degrading enzyme activity in 200 μΐ desalted aliquots of F1-F7 were analyzed on a 6% gliadin zymogram gel.
[0136] Figure 2C shows a representative non-reducing PAGE gel of the DEAE chromatography fraction F2. The PAGE gel under non-reducing conditions of R. mucilaginosa enzyme preparation (Rmep) (F2) was loaded amounts 4, 8, 16, 32 μg protein in lanes 1-4, respectively.
[0137] Figure 2D shows a representative casein zymogram of the DEAE chromatography fraction F2. The casein zymogram of F2 was loaded amounts 2, 4, 8, and 16 μg in lanes 1-4, respectively.
[0138] Figure 2E is a table showing the proteins identified in excised gel bands labeled a-e in Figures 2C and 2D. The data shown are representative of at least four independent experiments.
[0139] Figures 3A-3D are representative histograms showing the effects of pH and inhibitors on R. mucilaginosa enzyme preparation (Rmep) activity.
[0140] Figure 3A shows the enzymatic activity of R. mucilaginosa enzyme preparation (Rmep) at various pH. Activity of Rmep in 0.1M Citric acid/0.2M phosphate buffer mixtures, pH 2-12, was measured with Suc-AAPF-pNA (SEQ. ID. NO: 4) (200 μΜ) as the substrate.
[0141] Figure 3B shows the inhibitor profile of R. mucilaginosa enzyme preparation (Rmep). Inhibitors AEBSF, Aprotinin, E-64, EDTA, PMSF and Eglin C were tested at final concentrations of 10 mM, 0.08 mM, 0.1 mM, 1.5 mM, 1 mM, and 0.06 μΜ, respectively. Rmep was added at a final concentration of 5.7 μg/ml. The percent inhibition was determined from the ratio of the initial velocities of hydrolysis of Suc-AAPF-pNA (SEQ. ID. NO: 4) in the absence and presence of inhibitor.
[0142] Figure 3C shows the inhibition of Bacillus subtilis sp. subtilisin A with a higher concentration Eglin C (1.2 μΜ).
[0143] Figure 3D show the inhibition of R. mucilaginosa enzyme preparation (Rmep) with a higher concentration Eglin C (1.2 μΜ).
[0144] Figures 4A-4E demonstrate the cleavage specificities of R. mucilaginosa enzyme preparation (Rmep) and B. subtilis subtilisin A.
[0145] Figure 4A and Figure 4B are representative graphs of the hydrolysis of the substrates: Suc- AAPF-pNA (SEQ. ID. NO: 4), Z-YPQ-pNA, and Z- LPY -pNA, each at 200 μΜ, by Rmep and subtilisin A, respectively, each at 1 μg/ml.
[0146] Figure 4C show a representative graph of the hydrolysis of the substrate, LPY, by Rmep and subtilisin A at 5 μg/ml and extended incubation times.
[0147] Figure 4D and Figure 4E are representative graphs of the hydrolysis of gliadin-derived FRET substrates. FRET substrates containing QPQLPY (SEQ. ID. NO: 22), PQPQPQ (SEQ. ID. NO: 23) and QGSFQP (SEQ. ID. NO: 24), each at 100 μΜ, were incubated with Rmep (Figure 4E) and subtilisin A (Figure 4E), at 1 μg/ml and 0.5 μg/ml, respectively. Controls were boiled Rmep and subtilisin A incubated with PQPQLPY (+)(SEQ. ID. NO: 25), PQPQPQ (0)(SEQ. ID. NO: 23) and QGSFQP (*) (SEQ. ID. NO: 24) (no activity, baseline).
[0148] Figures 5A-5D demonstrate the degradation of mixed gliadins by R. mucilaginosa enzyme preparation (Rmep) and the abolishment of immunogenic epitopes by Rmep.
[0149] Figure 5A is a representative SDS-PAGE gel of non-digested gliadins (control) and Rmep- treated gliadins. Gliadins (250 μg/ml) in 50 mM Tris/HCl pH 8.0 were incubated with Rmep at 57 μg/ml. After 0, 15 min, 30 min and 2 h incubation 100 μΐ aliquots were removed, boiled and analyzed by SDS- PAGE and stained with Coomassie Brilliant Blue. The bold arrow (left) points to the position of the major band in the gliadin preparation; the thin arrow (right) to the 125kDa band in the Rmep preparation, and the dotted arrows (right) to the gliadin degradation fragments.
[0150] Figure 5B is a representative chromatogram of the RP-HPLC of the degradation of the immunogenic 33-mer peptide from a-gliadin. Arrow (top) points to the intact 33-mer.
[0151] Figure 5C and Figure 5D show the assessment of the survival of epitopes in the gliadin-Rmep degradation mixture employing the R5 ELISA (Figure 5C) or G12 ELISA (Figure 5D) assays.
[0152] Figures 6A-6D demonstrate the degradation of mixed gliadins by B. subtilisis subtilisin A and abolishment of immunogenic epitopes by B. subtilisis subtilisin A.
[0153] Figure 6A is a representative SDS-PAGE gel of non-digested gliadins (control) and subtilisin A- treated gliadins. Gliadins (250 μg/ml) in 50 mM Tris/HCl pH 8.0 were incubated with subtilisin A at 57 μg/ml. Experiments were conducted as described in the legend of Figure 5 with subtilisin A instead of Rmep.
[0154] Figure 6B is a representative chromatogram of the RP-HPLC of the degradation of the immunogenic 33-mer peptide from a-gliadin with subtilisin A. Arrow (top) points to the intact 33-mer.
[0155] Figure 6C and Figure 6D show the assessment of the survival of epitopes in the gliadin- subtilisin A degradation mixture employing the R5 ELISA (Figure 6C) or G12 ELISA (Figure 6D) assays.
[0156] Figure 7. Domain composition of C6R5V9 9MICC. The protein of 1328 amino acids contains a peptidase S8 propeptide domain (also called proteinase inhibitor 19), a peptidase S8/S53 family domain, an immunoglobulin-like fold domain, and 3 surface layer homology domains. This figure is based on InterPro analysis.
[0157] Figures 8A-8F demonstrate the gliadin degradation and epitope abolishment by a nattokinase enzyme (NattoK) derived from B. subtilis.
[0158] Figure 8A is a representative SDS-PAGE gel of non-digested gliadins (control) and NattoK - treated gliadins. Mixed gliadins (G, 250 μg/ml) were incubated with NattoK (57 μg/ml) for 0, 15, 30 and 120 min. Left four lanes: controls without enzyme or gliadins, respectively, each at t=0 and 120 min. Arrow points to the major components in the gliadin mixture represented by a and γ-gliadins containing most of the immunogenic epitopes.
[0159] Figure 8B is a representative SDS-PAGE gel of non-digested gliadins (control) and diluted NattoK-treated gliadins. Dilution series of NattoK (3.5-0.06 μg/ml) incubated for 30 min with mixed gliadins. Right lanes, gliadin (G) and NattoK (NK) control.
[0160] Figure 8C show a representative graph of the hydrolysis of the substrate, Suc-AAPF-pNA (SEQ. ID. NO: 4), with a dilution series of NattoK. Suc-AAPF-pNA (SEQ. ID. NO: 4) was incubated Suc- AAPF-pNA (SEQ. ID. NO: 4). Hydrolysis was measured at 405 nm.
[0161] Figure 8D is a representative chromatogram of the RP-HPLC analysis of the degradation of the gliadin-derived 33-mer (250 μg/ml) incubated for 0, 15, 30 and 120 min with NattoK 57 μg/ml).
[0162] Figure 8E and Figure 8F show the assessment of the survival of epitopes in the gliadin- NattoK degradation mixture employing the R5 ELISA (Figure 8E) or G12 ELISA (Figure 8F) assays. Epitope abolishment in Mixed gliadins (250 μg/ml) were incubated with NattoK (57 μg/ml) for 0, 15, 30 and 120 min and then assayed by the R5 ELISA or G12 ELISA.
[0163] Figure 9 is a representative SDS-PAGE gel showing the gliadin degradation by a dilution series of Rmep from R. mucilaginosa. Mixed gliadins (250 μg/ml) in 50 mM Tris, pH 8.0 were incubated with
Rmep ranging from 57 to 0.88 μg/ml for 30 min. Aliquots of 100 μΐ are loaded on the gel. Right lanes, gliadin and Rmep controls.
[0164] Figure 10. Multiple sequence alignment of subtilisins derived Rothia using CLUSTAL O (1.2.1) (SEQ ID NOS 43-58, 3, 59-63, 2, 64-66, 33, 67-81, 1, and 82-84, respectively, in order of appearance). Underlined enzymes, C6R5V8 9MICC, C6R5W1 9MICC, and C6R5V9 9MICC are those identified in this disclosure.
[0165] Figure 11 shows the phylogenetic tree (Clustal Omega) of Rothia subtilisins revealing 8-9 distinct groups. Boxed are the enzymes identified in this disclosure.
[0166] Figures 12A-12B show the identification of the gluten-degrading enzyme, subtilisin proteins from Rothia aeria.
[0167] Figure 12A shows a representative SDS-PAGE gel part stained with Coomassie Brilliant Blue.
[0168] Figure 12B shows a representative zymogram gel corresponding to the SDS-PAGE gel part, the zymogram was developed as a using externally added casein as the enzyme substrate to visualize bands with enzyme activity (indicated with an arrow). Bands 1-4 were excised and subjected to mass spectrometric analysis of the amino acid sequences and identification of the protein. The protein was identified as BAV86562.1 from Rothia aeria.
[0169] Figure 13 show the CLUSTAL 2.0.12 alignment of protein KGJ00122.1 (SEQ ID NO: 33) from Rothia dentocariosa, and protein BAV86562.1 (SEQ ID NO: 34) from Rothia aeria. Both enzymes belong to the peptidase S8 family of subtilisin enzymes. The * symbol underneath the sequence indicates an identical amino acid at that position in both protein sequences. The proteins are >99% homologous.
[0170] Figure 14 shows the alignment of the amino acid sequences of subtilisins from R. mucilaginosa (WP 044143865.1, (SEQ ID NO: 64); WP_044143864.1, (SEQ ID NO: 82)), R. aeria (BAV86562.1, (SEQ ID NO: 34)), B. licheniformis (P00780.1, (SEQ ID NO: 35)) and B. subtilis NAT (P35835.1, (SEQ ID NO: 35)). Underlined conserved amino acids are the D, H and S residues that participates in the catalytic triad of subtilisins.
[0171] Figures 15A-15F show effective ATI degradation by subtilisins from B. subtilis (nattokinase). This demonstrates that nattokinase (and other subtilisin-related enzymes) can also be used to inactivated ATIs in gluten and thus be of benefit for patients with non-celiac wheat sensitivity. ATI (500 μg/ml) incubated with Rmep from R. mucilaginosa (Figure 15A) or nattokinase from B. subtilis (Figure 15C) at 50, 25, or 10 μg/ml; Figures 15B and 15D, Gliadins (500 μg/ml) incubated with Rmep (Figure 15B) or nattokinase (Figure 15D) at 25 μg/ml. Figures 15E and 15F, ATIs incubated with control heat inactivated enzymes, Rmep (Figure 15E) or nattokinase (Figure 15F).
[0172] Figures 16A-16D demonstrate that ethanol treated gluten-degrading enzyme contain bacteria are not viable but their intrinsic gluten-degrading enzymatic activities are intact after ethanol treatment.
DETAILED DESCRIPTION OF THE DISCLOSURE
[0173] The Rothia-derived proteins with gluten-degrading enzymatic activity were identified as hypothetical proteins ROTMU0001_0241 (C6R5V9_9MICC, WP_044143864.1 peptidase S8), ROTMU0001_0243 (C6R5W1_9MICC, WP_044143865.1 peptidase S8) and ROTMU0001_240
(C6R5V8_9MICC, WP_005509166.1 peptidase S8) SEQ ID NO: 1-3 respectively. A blast search revealed that these are subtilisin-like serine proteases belonging to the peptidase S8 family. Alignment of the major Rothia subtilisins indicated that all contain the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8 protease family. They cleaved succinyl-Ala-Ala-Pro- Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin with proline (Pro) in the P2 position, as in Tyr-Pro-Gln j and Leu-Pro-Tyr j cleavage specificities that were reported earlier for the Rothia gluten- degrading enzymes. The downward pointed arrow indicates the cleavage position or the location of the peptide bond that is cleaved. The numbering of the amino acid position (e.g., PI, P2, P3) is with respect to the peptide bond that is cleaved by the enzyme described. The amino acid residue immediately upstream of the cleavage peptide bond is designated the position PI, the amino acid residue immediately upstream of the PI amino acid residue is P2. Here, in the substrate for subtilisin, Phe = PI position, and Pro = P2 position, Ala = P3 and P4 positions. Moreover, FRET substrates of gliadin immunogenic epitopes comprising Xaa-Pro-Xaa motives were rapidly hydrolyzed. The Rothia subtilisins as well as other subtilisins from Bacillus sp. , subtilisin A and nattokinase, could degrade the highly immunogenic gliadin-derived 33-mer peptide. Furthermore, major gluten antigenic epitopes were efficiently eliminated by both subtilisins, as demonstrated with R5 and G12 gliadin ELISA assays. Therefore, this study identified Rothia and food-grade Bacillus subtilisins as promising new candidates for enzyme
therapeutics in celiac disease (CD).
[0174] Accordingly, described herein are gluten-degrading enzyme formulations and compositions comprising subtilisin derived from Rothia species bacteria, as well as uses thereof in the treatment of CD or a related disorder, and the treatment of gluten-containing foodstuff.
[0175] The methods, formulations, and compositions described herein are advantageous over other Rothia species enzyme compositions in that they retain gluten-degrading activity over a wide range of pH and thus, are active throughout the digestive tract of a subject diagnosed with celiac disease or a related disorder or non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors.
[0176] Sensitivity to gluten-containing foods is widespread, and manifests predominantly in the form of celiac disease (CD). The increased awareness for CD in the medical community and the general public has led to improved diagnosis and earlier initiation of preventive strategies. The prevalence of CD ranges between ~1 : 100-1 :200 in most populations (1). The development of CD is dependent on exogenous and host-associated factors, whereby ingested gluten is the direct trigger of the disease, and the presence of HLA-DQ2 or HLA-DQ8 alleles, and tissue transglutaminase (TG2) activity are the major contributing host-associated factors (2). The disease is characterized by inflammation and flattening of the duodenal and jejunal villi, with a broad spectrum of symptoms, ranging from a clinically silent disease to severe malabsorption and a high risk for secondary autoimmune diseases (3).
[0177] To date, a strict gluten-free diet is the only treatment option for CD, which is difficult to maintain, and this poses a significant social and psychological burden to the patient. Traces of gluten are present in nearly all refined foods, and the felt quality of life of many patients equals that of hemodialysis
patients(4). Therefore, novel therapies that would relieve patients from the need to adhere to the highly restrictive gluten-free diet are highly desired (5, 6).
[0178] The major therapies currently being pursued target the immunogenic gluten peptides and the immune system, e.g. using a vaccine-based strategy, gluten-degrading enzymes, luminal gluten binders, and inhibitors of the body's enzyme tissue transglutaminase which potentiates gluten antigenicity by deamidation (7). Enzyme therapies cleave gluten and thereby abolish immunogenic epitopes before they reach the lamina propria of the small intestine where T cell activation occurs (8, 9). Enzyme therapeutics have advantages. First, enzyme therapeutics are targeting the most upstream trigger, i.e. antigenic gluten peptides, rather than endogenous molecules or cells downstream in the cascade of intestinal
inflammation; second, they are amenable to optimization of substrate specificity and pH activity (10).
[0179] Bacterial and barley-derived gluten-degrading enzymes have been isolated (1 1, 12) and are being explored for clinical application (9, 13, 14). Furthermore, gluten-degrading bacteria, mostly lactobacilli and bifidobacteria, which are already used in the food industry have been found potentially useful for CD treatment (15-17), with a few reports indicating actual gluten digestion( 18, 19). The inventors have found that exceptionaly high gluten-degrading enzyme activities are naturally associated with bacteria that colonize the oral cavity (20). Thus Rothia bacteria from human saliva can hydrolyze gluten domains that are highly immunogenic and resistant to mammalian digestive enzymes (21, 22). This recent discovery has identified these natural microbes as novel sources of gluten-degrading enzymes, with the added advantage that they exhibit an expected low toxicity profile (23). Here the inventors isolated the gluten- degrading enzymes from Rothia mucilaginosa and Rothia aeria, of which the complete genome sequence is available, and identified the proteinases as subtilisin family members. The discoveries highlight this group of enzymes, with cleavage specificities after Xaa-Pro-Xaaj, and some with proven safety in the food industry, as hitherto unrecognized candidates for dietary enzyme therapeutics for CD.
[0180] Accordingly, in one embodiment, provided herein is a foodstuff comprising a formulation or composition comprising a subtilisin enzyme derived from a. Rothia sp. bacteria.
[0181] In another embodiment, provided herein is a method for degrading gluten or attenuating the gluten in a gluten-containing foodstuff the method comprises contacting the gluten-containing foodstuff or an amylase-trypsin inhibitor containing foodstuff with an effective dose of a formulation or composition comprising a subtilisin enzyme derived from a. Rothia sp. bacteria.
[0182] In another embodiment, provided herein is a composition comprising (a) an isolated subtilisin and/or subtilisin-like enzyme derived from a Rothia sp. bacteria, and (b) a prolyl endopeptidase (PEP).
[0183] In another embodiment, provided herein is a method for treating celiac disease or a related disorder such as gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis the method comprising administering to a subject an effective dose of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or administering an effective dose of any one composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
[0184] In another embodiment, provided herein is a use of a subtilisin enzyme derived from a Rothia sp. bacteria to attenuate gluten toxicity in gluten-containing food stuff or for the treatment of celiac disease or a related disorder.
[0185] In another embodiment, provided herein is a use of a subtilisin enzyme derived from a Rothia sp. bacteria for the manufacture of medicament to treat of celiac disease or a related disorder.
[0186] In another embodiment, provided herein is a use of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or any one composition described herein to attenuate gluten toxicity in gluten-containing food stuff or for the treatment of celiac disease or a related disorder.
[0187] In another embodiment, provided herein is a use of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or any one composition described herein for the manufacture of medicament for the treatment of celiac disease or a related disorder.
[0188] In one embodiment, provided herein is a method for detoxifying gluten, the method comprising contacting gluten-containing foodstuff with an effective amount of with an effective dose of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria or a composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
[0189] In one embodiment, provided herein is a method for detoxifying an amylase-trypsin inhibitor, the method comprising contacting an amylase-trypsin inhibitor-containing foodstuff with an effective amount of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria or a composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
[0190] In another embodiment, provided herein is a method for detoxifying gluten, the method comprising contacting a gluten-containing foodstuff with an effective amount of the isolated enzyme composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
[0191] In one embodiment, provided herein is a method for detoxifying an amylase-trypsin inhibitor, the method comprising contacting the amylase-trypsin inhibitor-containing foodstuff with an effective amount an isolated enzyme composition comprising a subtilisin enzyme derived from a Rothia sp.
bacteria described herein.
[0192] In one embodiment, provided herein is a gluten-free foodstuff composition comprising a gluten- containing foodstuff in an admixture with a subtilisin enzyme derived from a Rothia sp. bacteria described herein. In one embodiment, the subtilisin enzyme is isolated from a Rothia sp. bacteria. In another embodiment, the subtilisin enzyme is a recombinant protein expressed from any protein expression system known in the art and the protein expression system is not Rothia sp. bacteria. For example, the recombinant subtilisin enzyme is expressed in expression bacteria Escherichia coli.
[0193] In one embodiment, provided herein is a gluten-free foodstuff composition comprising a gluten- containing foodstuff in an admixture with the isolated enzyme formulation or composition comprising subtilisin enzyme derived from a Rothia sp. bacteria described herein and/or the probiotic composition comprising a Rothia sp. bacteria that expresses subtilisin enzyme described herein.
[0194] In one embodiment, provided herein is a method of killing gluten-degrading bacteria without affecting their enzyme activities therein, the method comprises incubation the bacteria with ethanol for a period of time sufficient for the bacteria to not be able to cell divide.
[0195] In one embodiment, provided herein is a method for detoxifying gluten, the method comprising contacting gluten-containing foodstuff with an effective amount of with an effective dose of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten- degrading enzymatic activities therein described herein, wherein the bacteria are cannot cell divide and are not alive or viable.
[0196] In one embodiment, provided herein is a method for detoxifying an amylase-trypsin inhibitor, the method comprising contacting amylase-trypsin inhibitor-containing foodstuff with an effective amount of with an effective dose of a formulation formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria are cannot cell divide and are not alive or viable.
[0197] In another embodiment, provided herein is a method for detoxifying gluten, the method comprising contacting gluten-containing foodstuff with an effective amount of the isolated enzyme composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria described herein.
[0198] In one embodiment, provided herein is a method for detoxifying an amylase-trypsin inhibitor, the method comprising contacting the amylase-trypsin inhibitor-containing foodstuff with an effective amount of ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria are cannot cell divide and are not alive or viable.
[0199] In one embodiment, provided herein is a foodstuff comprising a formulation or a
composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria are cannot cell divide and are not alive or viable.
[0200] In one embodiment, provided herein is a gluten-free foodstuff composition comprising a gluten- containing foodstuff in an admixture with formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein, or with an effective amount of ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein, wherein the bacteria are cannot cell divide and are not alive or viable.
[0201] In one embodiment, provided herein is a method for degrading gluten or attenuating gluten toxicity in a gluten-containing foodstuff or degrading an amylase-trypsin inhibitor in a foodstuff, the method comprises contacting the gluten-containing foodstuff or the amylase-trypsin inhibitor containing foodstuff with an effective dose of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
[0202] In another embodiment, provided herein is a formulation or composition comprising ethanol- treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
[0203] In another embodiment, provided herein is a method for treating celiac disease or a related disorder such as gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis, the method comprising administering to a subject an effective dose of a formulation or composition comprising ethanol-treated, and
lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein, wherein the bacteria cannot cell divide and are not alive or viable.
[0204] In another embodiment, provided herein is a use of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein to attenuate gluten toxicity in gluten-containing food stuff or to degrade an amylase-trypsin inhibitor in foodstuff for the treatment of celiac disease or a related disorder, wherein the bacteria cannot cell divide and are not alive or viable.
[0205] In another embodiment, provided herein is a use of a formulation or composition comprising ethanol-treated, and lyophilized bacteria that have gluten-degrading enzymatic activities therein described herein for the manufacture of medicament to treat of celiac disease or a related disorder, wherein the bacteria cannot cell divide and are not alive or viable.
[0206] In one embodiment of the degrading method described, the contacting of the gluten-containing food stuff is performed in vitro prior to consumption of the gluten-containing food stuff or the amylase- trypsin inhibitor containing foodstuff respectively.
[0207] In one embodiment of the degrading method described, the contacting of the gluten-containing food stuff is performed in vivo concurrent with or after consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
[0208] In one embodiment of the treatment method described, the administering of the formulation or composition is performed in vitro prior to consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
[0209] In one embodiment of the treatment method described, the administering of the formulation or composition is performed in vivo concurrent with or after consumption of the gluten-containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
[0210] In one embodiment of the treatment method described, the administering of the formulation or composition is performed in vitro prior to and also concurrent with or after consumption of the gluten- containing food stuff or the amylase-trypsin inhibitor containing foodstuff respectively.
[0211] In any aspect described herein, the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, , Rothia species ot 188, Rothia sp. HOT-188, Rothia aeria strain F0474 (HMP ID 1324), Rothia aeria HM-818, Rothia aeria strain WSA-8, Rothia aeria BAV86562.1 and Rothia dentocariosa KGI00122.1.
[0212] In any aspect described herein, the Rothia sp. bacteria is selected from the group consisting of R. mucilaginosa, R. aeria and R. dentocariosa.
[0213] In any aspect described herein, the subtilisin has the sequence ROTMU0001 0241 (also identified as C6R5V9_9MICC and WP_044143864.1 peptidase S8), ROTMU0001_0243 (also identified as C6R5W1_9MICC and WP_044143865.1 peptidase S8) and ROTMU0001_240 (also identified as C6R5V8_9MICC and WP_005509166.1 peptidase S8), KGJ00122.1 peptidase S8, and BAV86562.1 glycerol-3 -phosphate ABC transporter. These subtilisins are identified as SEQ ID NO: 1-3, 33, and 34 respectively.
[0214] In any aspect described herein, the subtilisin is at least 90% identical to the sequences of ROTMU0001_0241 (C6R5V9_9MICC;WP_044143864.1 peptidase S8), ROTMU0001_0243
(C6R5W1_9MICC; WP_044143865.1 peptidase S8) and ROTMU0001_240 (C6R5V8_9MICC;
WP_005509166.1 peptidase S8), KGJ00122.1 peptidase S8, and BAV86562.1 glycerol-3 -phosphate ABC transporter proteins described herein (See Section on subtilisins and subtilisin-like enzymes), (SEQ, ID. NOS: 1-3, 33, and 34).
[0215] In any aspect described herein, the subtilisin is derived from a Rothia spp. and degrades gluten G12 epitope at least 50% faster than Bacillus spp. -derived subtilisin. The gluten G12 epitope degradation assay are known in the art and can be performed using any assay known. For example, as described in the Example section of this disclosure. In other embodiments, the Rothia spp. subtilisin is at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, or at least 85%, at least 90% faster than Bacillus spp. derived subtilisin.
[0216] In any aspect described herein, the subtilisin comprises the conserved catalytic triad that is characteristic of the S8A family of serine protease family, the conserved catalytic triad being Asp (D), His (H) and Ser (S) in the D-H-S order in the polypeptide.
[0217] Conserved regions of the catalytic triad in subtilisins. comprises the D, H and S residues. These regions are predicted to define cleavage specificity towards the gluten R5 epitope. Regions 1-3 are concerved in both Rothia and Bacillus subtilisins and flank the D, H and S residues, respectively.
Regions 4 to 7 flank the regions 1 to 3 are found in the Rothia subtilisins only.
VK(I/V)AViI/V7L)D(S/T)G(I/V)(D/Q) (region 1) (SEQ ID NO: 26)
(G/S)HGTHVAGT (region 2) (SEQ ID NO: 27)
GTSM(A/S) (region 3) (SEQ ID NO: 28)
Variable domains flanking the conserved regions 1 to 3 described above. These are predicted to confer enzyme cleavage specificity towards the gluten G12 epitope:
K(G/D)( region 1) (region 5) (SEQ ID NO: 29)
(region 1)YTH (region 6) (SEQ ID NO: 30)
(region 2)AAGYGV (region 7) (SEQ ID NO: 31 )
(S ); region 3) (region 8) (SEQ ID NO: 32)
[0218] In any aspect described herein, the subtilisin cleaves proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and Xi is a
hydrophobic amino acid, i.e., cleaving at the peptide bond after X1; e.g. the XPQ motif, where Q is glutamine, and subtilisin cleaves the peptide bond after Q.
[0219] A hydrophobic amino acid is one that has a hydrophobic side chain. The nine amino acids that have hydrophobic side chains are glycine (Gly), alanine (Ala), valine (Val), leucine (Leu), isoleucine (He), proline (Pro), phenylalanine (Phe), methionine (Met), and tryptophan (Trp).
[0220] In any aspect described herein, the subtilisin cleaves succinyl-Ala-Ala-Pro-Phe- jparanitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after the proline located at the P2 position in the substrate. The downward arrow incidates the site of cleavage by subtilisin. The numbering of the amino acid position is with respect to the peptide bond that is cleaved by the enzyme described. The amino acid residue immediately upstream of the cleavage peptide bond has designate the position PI, the amino acid residue immediately upstream of the PI amino acid residue is P2. Hence, the peptide bond that is cleaved is that after Phe, and Phe is the amino acid residue at the P 1 position, and Pro is the amino acid residue at the P2 position.
[0221] In any aspect described herein, the subtilisin degrades the highly immunogenic gliadin-derived 33 -mer peptide.
[0222] In any aspect described herein, the subtilisin does not cleave the second peptide bond after proline in the P2 position in a tripeptide having the -PxFPy-motif, wherein F= phenylalanine=Phe;
P=proline=Pro. In this tripeptide, F is the amino acid residue at the PI position, Px is the amino acid residue at the P2 position, and Py is the amino acid in the P Γ position (downstream from the sessile bond).
[0223] In any aspect described herein, the subtilisin does not cleave the second peptide bond after proline in the P2 position in a tripeptide having the -PxPyF- motif, wherein F= phenylalanine; P=proline. In this tripeptide, Py is the amino acid residue at the PI position, and Px is the amino acid residue at the P2 position.
[0224] In any aspect described herein, the subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes.
[0225] In any aspect described herein, the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel
electrophoresis or as described in Figures 2A-2E; or have a predicted molecular weight of -125 kDa as described in the Example section.
[0226] In any aspect described herein, the subtilisin undergoes autocatalytic activation to produce a shorter mature enzyme. Autocatalytic activation refers to the self-cleavage exhibited by subtilisin on its own polypeptide to form a shorter polypeptide that has further enzymatic cleavage on other proteins. The self-cleaving brings forth the enzymatic cleavage activity using other proteins as substrate. In any aspect described herein, the shorter mature enzyme subtilisin is about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis as described herein.
[0227] In any aspect described herein, the subtilisin enzyme has a functional pH range of 6.0-10.0. as determined by detectable Z-YPQ-pNA cleaving activity. For example, a detectable Z-YPQ-pNA cleaving
activity within a 72 hour digestion period or substantially complete Z-YPQ-pNA cleavage within a 1 hour digestion period.
[0228] In any aspect described herein, the subtilisin enzyme from R. mucilaginosa has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
[0229] In any aspect described herein, the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
[0230] In any aspect described herein, the subtilisin is inhibited by phenylmethane sulfonyl fluoride (PMSF), a serine protease inhibitor. In another embodiment, the subtilisin is 100% inhibited by ImM of PMSF.
[0231] In any aspect described herein, the subtilisin is not inhibited by E64 or
(ethylenediaminetetraacetic acid) EDTA.
[0232] In any aspect described herein, the subtilisin is not stable in acid conditions.
[0233] In any aspect described herein, the subtilisin is lyophilized.
[0234] In any aspect described herein, the subtilisin is a protein isolated from Rothia sp. bacteria. For example, by protein purification methods from cell extracts of Rothia sp.
[0235] In any aspect described herein, the subtilisin is an isolated recombinant protein. For example, the subtilisin nucleic acid coding sequence is expressed in another organism other than Rothia sp. For example, expression in yeast or Escherichia coli. Method of recombinantly expressing proteins in other eukaryote or prokaryotic protein expression systems are known in the art.
[0236] In any aspect described herein, the subtilisin nucleic acid coding sequence is codon optimized for efficient protein expression for the selected eukaryote protein expression systems in order to produce large quantities of recombinant Rothia sp. subtilisin.
[0237] In any aspect described herein, the subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1-3, 33, and 34. (See Section on subtilisins and subtilisin-like enzymes).
[0238] In any aspect described herein, the subtilisin comprises SEQ. ID. NO: 1-3, 33, and 34.
[0239] In any aspect described herein, the subtilisin consists essentially of SEQ. ID. NO: 1-3, 33, and 34.
[0240] In any aspect described herein, the subtilisin is SEQ. ID. NO: 1-3, 33, and 34.
[0241] In any aspect described herein, the formulation or composition further comprising a prolyl endopeptidase (PEP). PEP are also known as prolyl oligopeptidase (POP) or post-proline cleaving enzyme. For example, PEP degrade the nonapeptide bradykinin at the Pro-Phe bond.
[0242] In any aspect described herein, the PEP is derived from a microorganism selected from the group consisting of Aspergillus niger, Flavobacterium meningosepticum, Sphingomonas capsulata, Penicillium citrinum, Hordeum vulgar e, and Myxococcus xanthus .
[0243] In any aspect described herein, the formulation or composition further comprising at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria that is not a subtilisin or subtilisin-like enzyme and does not contain the conserved catalytic triad, amino acids D, H, and S in the catalytic domain of S8 protease family.
[0244] In any aspect described herein, the formulation or composition described, the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ-pNA.
[0245] In any aspect described herein, the formulation or composition described, the at least one additional gluten-degrading enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
[0246] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 is derived from the Rothia species are the enzymes disclosed in the PCT Patent Application No: PCT/USl 1/43118, PCT Patent publication No: WO2012006384, and the US Patent Application No. 20130171109, the contents of each are incorporated by reference in their entity.
[0247] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 is derived from the Rothia species Rothia species ot 188, also known as Rothia sp. HOT-188 , Rothia aeria strain F0474 (HMP ID 1324), Rothia aeria HM-818, and Rothia aeria strain WSA-8.
[0248] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an iso-electric point in a pH range of 2.0-4.0, inclusive.
[0249] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight between 120-150kDa, inclusive.
[0250] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight of 135-145kDa, inclusive.
[0251] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight of 125-145kDa, inclusive.
[0252] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has an estimated molecular weight between 50 and 90kDa, inclusive.
[0253] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 65 and 75 kDa, inclusive.
[0254] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 65 and 80 kDa, inclusive.
[0255] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 has molecular weight between 75 and 80 kDa, inclusive.
[0256] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 retains activity at the pH between 2.5 and 5.0, inclusive.
[0257] In any aspect described herein, the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 degrades a gliadin protein, a fragment thereof, or a gluten-containing foodstuff or ingredient thereof.
[0258] In any aspect described herein, the fragment thereof is a 33-mer peptide of ot2-gliadin or a 26- mer domain derived from γ-gliadin.
[0259] In any aspect described herein, the 33-mer peptide is
LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF (SEQ. ID. NO: 5).
[0260] In any aspect described herein, the 26-mer domain is FLQPQQPFPQQPQQPYPQQPQQPFPQ (SEQ. ID. NO: 6).
[0261] In any aspect described herein, the degradation by the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 occurs by cleaving the peptide bond after an amino acid sequence selected from the group consisting of -XPQ- -QQP-, -PPF-, -LPY- and -PFP-.
[0262] In any aspect described herein, the formulation or composition further comprising at least one isolated additional glutamine endopeptidase enzyme that cleaves a peptide bond after a QPF and a PFP motif in glutens.
[0263] In any aspect described herein, the additional glutamine endopeptidase enzyme are those enzymes disclosed in the US Patent No. 8685392, the contents are incorporated by reference in its entity.
[0264] In any aspect described herein, the degradation by the subtilisin, or by the at least one enzyme that retains protease activity at acidic pH of 3.0 or the glutamine endopeptidase described herein is partial. For example, the degradation is about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95%. Various percentages of degradation between 20% to 99% are encompassed herein.
[0265] In any aspect described herein, the degradation by the subtilisin, or by the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 or the glutamine endopeptidase described herein is complete.
[0266] In any aspect described herein, the degradation by the at least one additional gluten-degrading enzyme that retains protease activity at acidic pH of 3.0 occurs by cleaving the peptide bond after an amino acid sequence selected from the group consisting of -XPQ-,-QQP-, -PPF-, -LPY- and -PFP-. In other embodiments, degradation or digestion occurs by cleaving the peptide bonds after amino acid sequences XPQ and QQP; XPQ and PPF; XPQ and PFP; XPQ and LPY; QQP and LPY; PPF and LPY; PFP and LPY; XPQ, QQP and PPF; XPQ, QQP and PFP; XPQ, QQP and LPY; QQP, PPF, and PFP; XPQ, PPF and PFP; QQP, PPF and LPY; XPQ, PPF and LPY; LPY, PPF, and PFP; QQP, PFP and LPY; XPQ, PFP and LPY; XPQ, QQP, PPF and LPY; LPY, QQP, PPF and PFP; XPQ, LPY, PPF and PFP; XPQ, QQP, PFP and LPY; XPQ, QQP, PPF and PFP; or XPQ, QQP, PPF, LPY and PFP.
[0267] In any aspect described herein, the formulation or composition further comprising a glutamine specific protease which is selected from the group consisting of Hordeum vulgare endoprotease,
Aspergillus oryzae X-Pro dipeptidase, and Aspergillus saitoi carboxypeptidase. For example, glutamine specific proteases as described in US Patent No. 7628985, and US Patent Application Publication No. 20130171 109, the contents of each are incorporated by reference in their entirety).
[0268] In any aspect described herein, the formulation or composition further comprising a
pharmaceutically acceptable carrier.
[0269] In any aspect described herein, the related disorder is selected from the group consisting of refractory celiac disease, gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis.
[0270] In any aspect described herein, the composition is formulated into granules. For example, lyophilized enzyme protein granular preparation.
[0271] In any aspect described herein, the composition comprises lyophilized enzyme protein preparation.
[0272] In any aspect described herein, the composition is an oral formulation, such as in the form of a capsule, liquid, tablet, suspension, or enteric coated capsule or tablet.
[0273] In any aspect described herein, the composition is formulated for treatment of celiac disease or a related disorder in a subject
[0274] In any aspect described herein, the composition is formulated for treatment of a gluten- containing foodstuff prior to ingestion by a subject having celiac disease or a related disorder, wherein the gluten-containing foodstuff is degraded in vitro.
[0275] In any aspect described herein, the subtilisin that is derived from Rothia sp., the at least one gluten-degrading enzyme, the isolated enzyme composition and/or the probiotic composition is administered in an admixture with a gluten-containing foodstuff for the purpose of degrading the gluten in the food. In one embodiment, the enzyme is admixed with the ingredients during the manufacture of the food. In one embodiment, the enzyme is admixed with the ingredients during the preparation and/or cooking of the food.
[0276] In any aspect described herein, the isolated subtilisin enzyme retains activity in the admixture.
[0277] In any aspect described herein, the gluten-containing foodstuff is degraded partially prior to ingestion by the subject. For example, the gluten-containing foodstuff is partially degraded to about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% prior to ingestion by the subject. Various percentages of degradation between 20% to 99% are encompassed herein.
[0278] In any aspect described herein, the gluten-containing foodstuff is degraded completely prior to ingestion by the subject.
[0279] In any aspect described herein, the subtilisin that is derived from Rothia sp., the at least one additional gluten-degrading enzyme, the isolated enzyme composition or formulation described herein is administered to the subject as an oral formulation.
[0280] In any aspect described herein, the subtilisin that is derived from Rothia sp., the at least one additional gluten-degrading enzyme, the isolated enzyme composition or formulation described herein is administered just prior to, during or just after consumption of a gluten-containing foodstuff.
Celiac Disease and Related Disorders
[0281] The gastrointestinal (GI) tract consists of distinct but connected anatomical regions, comprising the oral cavity, the oesophagus, the stomach, the small and the large intestine (DeSesso JM, and Jacobson CF. Food Chem Toxicol 2001; 39:209-28). The oral microbiome is described in Dewhirst et al., J Bacteriol. 2010, 192:5002-17. The entire GI tract is colonized with microorganisms with colonization levels showing a gradient being lowest in the stomach and increasing in density toward the proximal and distal ends. The proximal region, the oral cavity, provides a rich environment for bacterial colonization as
it contains a variety of different habitats and ecological niches. It harbors over 600 different types of bacteria belonging to 141 different taxa representing 6 different bacterial phyla, including the Firmicutes, Actinobacteria, Proteobacteria, Bacteroidetes, Fusobacteria and the TM7 phylum (Aas JA, et al. J Clin Microbiol 2005; 43:5721-32; Paster BJ, et al. J Bacterid 2001; 183:3770-83). The distal GI microbiome is likewise phylogenetically diverse with members representing at least 9 different phyla (Eckburg PB, et al. Science 2005; 308: 1635-8; Frank DN, et al. Proc Natl Acad Sci U S A 2007; 104: 13780-5).
[0282] The GI tract is considered a "super organ" with functions contributed by human as well as bacterial genes (Camp JG, et al. Gastroenterology 2009; 136: 1989-2002; Turnbaugh PJ, et al. Nature 2006; 444: 1027- 31). Most Gl-colonizing microorganisms live in symbiosis with the host. The mutually beneficial relationship between the host and its colonizers is most evident in aspects related to digestion. Complex carbohydrates that cannot be degraded by the arsenal of human digestive enzymes can in most cases be hydrolyzed by bacterial glycosidases. For instance, bacteria belonging to the Bacteroides genus, turn the non-digestable polysaccharides into small chain fatty acids that are subsequently metabolized by the host (Turnbaugh PJ, et al. Nature 2006; 444: 1027- 31). Ingested proteins are in part degraded by host proteolytic enzymes such as pepsin, elastase, carboxypeptidase, trypsin, and chymotrypsin converting them into oligopeptides and single amino acids which can then enter the enterocyte via selective transporters and be further metabolized or transported (Daniel H. Annu Rev Physiol 2004; 66:361-84). Evidently, this mechanism is contingent upon the susceptibility of the substrate proteins to digestion by host enzymes.
[0283] Examples of dietary proteins that are difficult to digest by host proteolytic enzymes are glutens. Gluten proteins, comprising gliadins and glutenins, are abundantly contained in dietary products made of wheat, barley and rye (Wieser H. Food Microbiol 2007;24: 115-9). They are unusual with respect to their high content of the amino acids proline and glutamine, which are largely resistant to cleavage by the major human GI digestive enzymes (e.g., pepsin, trypsin, chymotrypsin). Thus pepsin or trypsin are unable to cleave the peptide bonds C-terminal to these residues (Siegel M, et al. Chem Biol 2006;
13:649-58). The proteolytic resistance of some highly T cell stimulatory gluten-derived peptides that reach the duodenum, e.g. a 33-mer peptide from ot2-gliadin and a 26-mer peptide from γ-gliadin, is paradigmatic for the inability of the human body to thoroughly digest gluten, resulting in the destructive immunological responses in the proximal intestine of patients with celiac disease (Koning F, et al. Best Pract Res Clin Gastroenterol 2005; 19:373-87; Jabri B, and Sollid LM. Nat Clin Pract Gastroenterol Hepatol 2006; 3:516-25; Schuppan D, et al., Gastroenterology 2009; 137: 1912-33).
[0284] Celiac sprue, also known as celiac disease, gluten-sensitive enteropathy, and gluten-induced enteropathy, is a chronic disease of the digestive tract that interferes with the digestion and absorption of nutrients from food. People with celiac sprue cannot tolerate gluten. Celiac disease is an inherited, autoimmune disease in which the lining of the small intestine is damaged from eating gluten and other proteins found in wheat, barley, rye, and gluten-contaminated oats. There is a propensity of Celiac disease in individuals who possess the HLA-DQ8 class II antigen receptor gene. The exact cause of celiac disease is unknown although it is believed that intestinal damage is caused by interactions between
specific gliadin oligopeptides and the HLA-DQ2, DQ2.5, DQ2.2/DQ7 or DQ8 antigen, which in turn induce proliferation of T lymphocytes in the sub-epithelial layers. T helper 1 cells and cytokines can play a major role in a local inflammatory process leading to villus atrophy of the small intestine. The intestines contain projections, called villi that absorb nutrients. The lining villi become damaged due to the body's immune reaction. In undiagnosed or untreated celiac disease, these villi become flattened. Because the lining of the intestine contains essential enzymes for digestion and absorption, its destruction leads to malabsorption, a difficulty in absorption of food and essential nutrients. As a result, Celiac sprue is often considered a malabsorption disorder. This affects the ability to absorb nutrients properly. The disease can develop at any point in life, from infancy to late adulthood. Those with a family member with celiac disease are at greater risk for developing the disease. The disorder is most common in Caucasians and those of European ancestry and women are affected more commonly than men.
[0285] The symptoms of celiac disease can vary significantly from person to person. This is part of the reason the diagnosis is frequently delayed. For example, one person may have constipation, a second may have diarrhea, and a third may have no irregularity in stools. A non-limiting list of gastrointestinal symptoms include abdominal pain, abdominal distention, bloating, gas, indigestion, constipation, decreased appetite that may also be increased or unchanged, diarrhea, chronic or occasional lactose intolerance which is common upon diagnosis, but usually goes away following treatment, nausea and vomiting, stools that float, are foul smelling, bloody, or "fatty", and unexplained weight loss although people can be overweight or of normal weight upon diagnosis.
[0286] A non-limiting list of non-intestinal symptoms include anemia (low red blood cell count), bone and joint pain, bone disease such as osteoporosis, kyphoscoliosis, and fracture, breathlessness due to anemia, bruising easily, dental enamel defects and discoloration, depression, fatigue, growth delay in children, hair loss, hypoglycemia, irritability and behavioral changes, malnutrition, mouth ulcers, muscle cramps, nosebleeds, seizures, short stature, unexplained skin disorders (dermatitis herpetiformis), swelling which can be general or abdominal, and vitamin or mineral deficiency which can include single or multiple nutrient (for example, iron, folate, vitamin K).
[0287] There is currently no treatment for celiac disease except the advice to follow a lifelong gluten- free diet, which allows the intestinal villi to heal. Patients are advised to eliminate foods, beverages, and medications that contain wheat, barley, rye, and in some cases oats. The health care provider may prescribe vitamin and mineral supplements to correct nutritional deficiencies. Occasionally,
corticosteroids (such as prednisone) may also be prescribed for short-term use or in patients suffering from refractory sprue. Following a well-balanced, gluten-free diet is generally the only treatment needed to stay well.
[0288] The current diagnosis method includes a complete blood count (CBC) to detect signs of anemia, testing for an increase in alkaline phosphatase level which may indicate bone loss, testing for low cholesterol and albumin levels which may be signs of malabsorption and malnutrition, testing for an increase in liver enzymes and abnormal blood clotting, and detection of specific antibodies to tissue transglutaminase and gliadin. The health care provider will order these antibody tests if Celiac sprue is
suspected. If the tests are positive, upper endoscopy is usually performed to sample a piece of tissue (biopsy) from the first part of the small intestine (duodenum). An endoscopy with enteroscopy, particularly of the lower sections of the intestine most commonly affected, will show a flattening of the villi. A follow-up biopsy or blood work may be ordered several months after the diagnosis and treatment to confirm the disease. Normal results mean that the patient has responded to treatment, thereby confirming the diagnosis.
[0289] In one embodiment, the subject treated according to the methods and compositions described herein has been diagnosed with Celiac Sprue, gluten allergy/gluten intolerance and/or dermatitis herpetiformis. In another embodiment, the subject is a mammal, preferably a human. Current diagnosis methods for Celiac sprue include but are not limited to one or more of serological tests, e.g. anti-gliadin antibodies, anti-transglutaminase antibodies, anti-endomysial antibodies; endoscopic evaluation, e.g. to identify celiac lesions; histological assessment of small intestinal mucosa, e.g. to detect villous atrophy, crypt hyperplasia, infiltration of intra-epithelial lymphocytes; and any GI symptoms dependent on inclusion of gluten in the diet.
[0290] Non-celiac/non-allergy wheat sensitivity (NCWS) due to amylase-trypsin inhibitors (ATIs) has an estimated prevalence of 5-10% in wheat (cereal) consuming populations. NCWS is characterized by intestinal and extra-intestinal symptoms related to the consumption of gluten-containing foods that are also enriched in ATIs. The diagnosis is made after CD and wheat allergy have been excluded and if the patients display typical symptoms and complaints within hours to days after consumption of ATI- containing cereals, mainly wheat, and remission of these symptoms within a few hours to days after stopping their consumption 1. The wheat components responsible for the initiation of an innate immune responses to wheat and related cereals in NCWS have been identified as ATIs. Wheat ATIs are a family of disulfide-linked and protease resistant proteins that occur as monomers, dimers and tetramers with molecular weights ranging from 12-60 kDa. ATIs bind to and activate the TLR4-MD2-CD14 complex on mainly myeloid cells (dendritic cells, macrophages, monocytes), ultimately resulting in the release of proinflammatory innate cytokines.
Rothia bacteria spp. subtilisins and subtilisin-like enzymes
[0291] There were three sequences of R. mucilaginosa proteins identified in excised protein bands in the "Rmep" fraction in the Example section. These three R. mucilaginosa proteins have been identified and are shown here. Start codons were determined using Artemis (correcting the start codons listed for C6R5V9 and C6R5W1 at NCBI). Bold and underlined residues are the predicted signal peptide cleavage sites AHA, and conserved enzyme catalytic triad D-H-S that is characteristic of the S8 protease family. SEQ ID NOS: 1-3 in order of appearance.
[0292] C6R5V9|C6R5V9_9MICC Uncharacterized protein OS=Rothia mucilaginosa ATCC 25296 GN=ROTMU0001_0241 PE=3 SV=1, also known as WP_044143864.1 peptidase S8. The section indicated by the amino acid residues in bold is the cd07474 domain.
MTTPHAPRRRMKAVGATGLSAALALTLGVPAT FSAAHAQSPQQVEGSTASASGDAASRI SPGLQKAEGQIT VY VQ FKGKGAYEQTQSAAVLARKEAPANRQAQVQAIAAQVQSQAQSVA TGD AAQIPALAERPDVERI SPI IAKEPJXINSGSE IDTKT^
TVDSYLKAKi^TELPS- DSGLIDRNKFIGGIDLVGDDYNASVAEKSTPQPDlSnsrPLDCRPDGFGSGGHGTHV
AGTAAGYGVTANGTTYRGDYKNLTEEQLKGMSIGPGTAPDAQIIAIRVFGCT
GDFSDRADIVNLSLGGEFAPADDPESYMIN IXLARQGVFTVAAAG^
ANAYGSTQPIDRARVTTKTGLE LQGDYSVNFDYSKASADQLRGEWAAPKRNRYACEAFTAEEAKALKGK WVYFDWDQDDLTFPCGSKVRFDNVQAAGGVGVVlXtAGKAERYTIGIGGNATIPGLRLTASSTKDL^
PVTVE^LDYKASGRGPHSHAFDL SSSARGQHGSDGFIKPDLAAPGTEIVSAAVGTGNKGVSFTGTS.^ PHVAGVAALV QAHQDY PQMI KAAIiMNGASTPIK EQGAQYAVDRVGTGMVNARAAVDAKVIAYDAKTPE RVSTAFGVLEYTPDSGIQTVQREIVLDNTDSQAHTYTLSYEASTTIPGVEYSYPQQVSVGAGERK VTVTV RIDPSKLEKTMDPAMSADQVAQDWTTGKTLAAGKRQYIASASGRLIFSENGREAIRQSIHVAPKPVSKMRV DASRIDYKGISDKESTVTLRGTTLNQGGYRSLLGAFELGAVSDRIPSGQLKLPSNQSVDLQYVGAASDAPA LKAAGK PNDGSLFFGISTWGTWDSMHWGRQVQVQIDTNNDSTADYVLEVTREKGLDYPLVKVWSISGNAS TVVARYPLNSAWGDTDTNIMDTNTMILGVPLKDLGLTAEKAQSIKYTVQTDTWHNEGNSYVDTTSTIEYSP FNPGVWFTGEESGVPGLFVDRDGGQLTVHRK NNKERQALFLHMHNATGDLSGRKTA GVAAGDRAQVVKV AR IHDARFTDVPADNQFYREI WIAARQIDRGYQDG FRPLNNMDRATMAAYFYRMSGSPQYTAPS PSF SDVPLNHPYYKEIEWMKAQGITTGWPDGTYRPEGSVNRDAMAAFFYRYAGSPEYTAPAQARFTDVPTDKQF YREISWLAEQGV GWPDGSFRPVEPVHRDAMAAFVYRYS GVLKESPEI
(SEQ. ID. NO: 1)
C6R5W1 I C6R5W1_9MICC Uncharacterized protein OS=Rothia mucilaginosa ATCC 25296 GN=ROTMU0001_02 3 PE=3 SV=1
Also known as WP_044143865.1 peptidase S8
MQHTASPNPRGRSHRRRIGSGLLTLSMALSPLAALGTTAHAAEDPDAVKQVLSESMKNASGTVTAFVRFKG KGAFEQTQPAGVRAGVQAPVN SSQVQAIASQVQSQAQQVSSQSGAQVLYTTHNAVRGVAVRGDAESIKAL ANRPDVEKISPILPKYRQNAGAAIDAGSLATWTGTTNPAGAGGYTGKGVKIAVIDSGIDYTH DFGGSGKL EDYEKASKLTELPSADSGLINRTKVAGGYDLVGDAYDGSNTATPDGNPLDCTTGGHGTHVAGTAAGYGVNA DGSTFTGDYSKLTAEQLKTMKIGPGVAPDAEIYAFRVFGCSGSTNVVIEALDRALDPNGDGDFSDRVNVVN MSLGGEFSPQDDPEAYAVDALTRAGVLSVISAGNANDYSLRGDTYSNSGHPATAASAITVANAYGSTRAVD AAELTDPATGTTRKVRGDYSVSYPWAQAGTKEFTGELTAISENNRYACNALSADEAAAVKGKWVLIDWAKD DGELACGSKVRFDNLEAAGAKGVLLAGNDEEPGLGIAGNDTLPGFRLAASAAKDLRAQITAAEAAGKPLTV RLGNELKSSLRVDTDKLDQLNPMSARGFHGSYGYTKPDIAAPGSYITSAAVATGNNSVTFSGTSMAAPYVT GSAALVMQSHPTYTPAQVKSALMNTATHDVRTESGATYAVDRVGAGRVDTLAAVQSKSLVYNADKSGTVSL SFGVLEYAPDAGVQTLTREVTVENTDSVAHTYALSYAESTNIPGVEYSFPSAVTLAPGETKKFEVTVRIDP SKLEKTRDAAMDTTQNATDYYTGNETVPEQYRQYIASASGRLVLTEDGTKALRLPVHVAPKPVSTMHAAED TV FTQKPSSDEAQKADTGWTKSQISLRGTEVNQGGYRSLLGAFEYGASVDRVAP SLSLNSNVKANLQYV GAFSDAPALKAAGGNADDGTLRFGISTWANWDVVSYENTFTVEIDTDGNNRADYKLVTDRAKGLDYPLVRL YGYKNGNLVELGYYPLNGAWGDVDTNMMDTNTLIMSAPLKDLGLTSANNPDIQYRVSATTQYEWGNVSETG WIKYRPFSPKLWFSGDSSAVAGLHPDASTTTLTAHRSADAIPALGESGTPAKALLLHLHNGTGDLSGTNGA KGNRAEVLNIKEQQTEYITPSRFTDVKNTDQFYTEISWLAQRGITTGYPDGTYRPLESVERGAMAAFFYRM QGSPQFTAPSTPSFKDVPTTHPFYKEIEWMKAQGITTGYSDGTFRPSAPVNRDAMAAFFYRAAGSPHVDLP ATSHFSDVSTDNQFYREITWLASKGISTGWPDGTYRPVTPIARDAMAAFIYRYTEKVANQAGR
(SEQ. ID. NO: 2)
C6R5V8 I C6R5V8_9MICC Uncharacterized protein OS=Rothia mucilaginosa ATCC 25296 GN=ROTMU0001_0240 PE=3 SV=1
Also known as WP_005509166.1 peptidase S8
MATFPEATPARAARHTQPGRLKQLARSCGALTLGLTLGLTALPFGTAAYAAPGVVRGADRDAPHQNTGTGE
NNNEVLSPSLDGATGERAVFVRFKGQGAYAQTQPDAVRSRAQAPVNAQAQVQAIRASVQQQGASAAKESGA
QVLYTTHNTMRGVALYGNVEQIRALANRDDVERISI IEDMAPQNSGTLIDTDTLSVWAKSPANPASTGYTG
KGVKIVVLDTGIDYTHADLGGPGTQEAFDKAKASDTIPEGTYDPKKFLGGYDLVGDDYNSGKKETSTPHPD
NNPLDCGGHGSHVAGTAAGYGVNADGSTFHGDYSKLTEEQLKDMKIGPGSAPDAQLIGLRIFGCKGTTAFV
PKGLDRVLDPNDDGDFSDRADIANLSLGNEFGVFDETVNYAVGSLYREGILSVVAAGNANNYNAVGDTYSN
SGGPGTSAYGLTVANSIGSTQLVDRVKILAPANEADTYGDYSVSFDYSKATEDQLRGTVVRAASRNRYACE
AFTEEEAAALKGKWALIDWADADGTAPCGSKVRFDNLQAAGATGVVLTSNTEVGDTAIGGNSSIPGVRLAK
SQVERLSVQIDSGELTLQLGENLRDSIRVPNGKLDQANTSTARGLHGSHGITKPDVAAPGTNISSIEVGSG
TGSSVKTGTSMSTPFVAGVAALIMQAHPEYGPRMLKTVIMNTADHHMQDAWGNPYAVDRVGTGRINTRAAV
ADRVMLFNAARPEQVSDTFGVLEYTPNAGVQTLQHRVSVENTDSVAHTYALNYEGSTSIPGVEFSYPQSVS
VGAGQKATFTVTVRIDPSKLEKTRDPSMYPNQDSVNYSTGTVTISGARQYIASASGRLILTDADSSAAVKT
LRMPLHVAPKPVSAMRVAGSDIAFDAEGSGATEQTLTLQGTAVDQGGYRSLLGAFELGASSPRIPTAKLGV
GSDSRMDLQYVGAASNVAALKAAGADTSEARLSFGISTWGNWQEVTPRGTYYVFVDTNKDGTSDYRLQTVR
EKGLDYPLVKVSKRSNGKWQAIENALYPLNGTWGDTDTNIMDSNTLVMTVPLNVLGLDPDAESTEISYSVT
TSSAFSATTVVDTTDSVVFNYAAPKLWFSGDSAGVPNLFVDAPETQLVAHRNGDAKNVSALFLHMHNATGD
LSGVNGAAGERAQVLRVSSNSEATAASAHFTDVPADYPFVNDINWLAQRRITTGYPDGTFRPNGSVERGAM
AAFFYRMAGSPQFTAPSTPSFKDVPRDHPFYKEIEWMRARGITTGWSDGTFRPNAAVNRDAMAAFFYRFAG
SPAYSAPAASPFSDVAAGSQFYREISWLAEQRITTGWADGSFRPVQPIERGAMAAFLHRYNVRVLNNR
(SEQ. ID. NO: 3)
[0293] One protein was identified from Rothia dentocariosa KGJ00122.1 from the excised bands 1-4 in Figure 12. The protein had gluten-degrading properties in the casein degradation assay shown in Figure 12. The amino acid sequence of R. dentocariosa KGJ00122.1 is shown below. Peptides derived from this sequence were identified in the bands 1-4.
>KGJ00122.1 peptidase S8, Rothia dentocariosa
MPK TPIRGLSRACLSATLGVTMAITAGLPATAAPAGDPDTPVAQDIARNSREHAVLSDSMKKAEGNIPV
FVQFKGKGAYEQTQSPAVLANKQAPINKQAEVQAIKTQVQSQAQAAAQSTGAKTLYTTHNIMRGVALQGD
AAQIRALANNPEVERITPIVPKKKQNAGSVVDTGAAENWARENSGYTGKDVKIAVVDSGIDYTHSDFGGP
GTVEAFNKATKLTEMPAADSGLYDAKKYIGGYDLVGDSYDGTNQTTPDNNPIDCSAGGHGTHVAGTAAGY
GVNQDGTTFRGDYSKLTAEQLNQMKIGPGAAPEAQLYSFRVFGCTGTTAVVVQALDRTLDPNGDGDFSDR
A IVNLSIGGEFSPPDDADAYAVESLNRQGVLAVVSAGNATDYYGRGDTYSDSGQPA AVSALTVA SIG
SSYAVDSMEIQAPANVAGKVPGDYTVSYTYTGAKPEALTGTVVTPSESNKFGCEAFSAEDAAKIKDKWVF
IEWANADGSLPCGSKVRFDNVEKAGGKGVVLSSEEEKPALPIGGNESIPGFRVAKSASAKVREAAATGEL
KVRLGADLKESLRVPSNKKDQLTASSARGYHGTYGYTKPDVAAPGNNISSARVGTGTGGISYTGTSMSAP
FAAGVAAQVLQANQSYGPTQLKAAIMNSA HDVRTADGNVYAVDRVGSGRIDAKAAAETKVLLYNADRPA
QVSQTFGVLEYAVNEGKQTLTREMTVENFDSHTHTYNISYAGSTDMPGVEFSLPSNITVNPGEKK FTVT
I IDPAAMEKTMDPAMEKTHNSVDPYGDG ELVPEQYRQFIASESGRILLTEGAATLRAPIHAAPKPASA
MKVEGSSVEIPAGEHQA LKLTGTELNQRGYKSLLGAFEHGASIERTSPVKLDVSSNAKANMQHVGAAST
APALKASGGNPNDGLLAFGIS WANWDVVSTEN F V IDTDGNNRADYMLVTDRAKGIDFPIVRLYGYK
NGNLEQIAYYPLNNAWGDTDTNMMDSNALVMAVPLKDLGLSAEKTKDIKYSVSATTQYAWTNVSETGWIN
YRPFDPKLWFSGTAATVPGFFADAPSSELVAHRAEGATDVKALFLHMHNTTGDLSGLNGAAGNRAQVLEV
TEQQQLDPAPSRFTDVPAENQFYAEINWLAQRRITTGYPDGTFRPGENVERGAMAAYFYRLAGTPQFTAP
DNP FSDVPKSHPFYKEIEWMAARGI TGYGDG FRPSDSVNRDAMAAFFYRYANSPQFAAPAASPFKDV
PANSQFYKEIAWLAEQGITKGWDDGTYRPGEPIHRDAMAAFLYRYSDKVLK
(SEQ. ID. NO: 33)
[0294] The amino acid sequence of a protein in Rothia aeria BAV86562.1 that belong to the peptidase S8 family is shown below. The section with amino acid residues in bold is the cd07474 domain that is typically representative of the peptidase S8 family domain. Underlined amino acids are the : D, S and H residues comprising the catalytic triad.
>BAV86562.1 glycerol-3-phosphate ABC transporter, Rothia aeria
MAITAGLPATAAPAGDPDTPVAQDIARNSREHAVLSDSMKKAEGNIPVFVQFKGKGAYEQTQSPAVLANK QAPTNKQAEVQAIKTQVQSQAQAAAQSTGAKTLYTTHNIMRGVALQGDAAQIRALANNPEVERITPIVPK KKQNAGSVVDTGAAENWARENSGYTGKDVKIAVVDSGIDYTHADFGGPGTVEAFNKATKLTEMPAADSGL YDAKKYIGGYDLVGDSYDGTNQTAPD NPIDCSAGGHGTHVAGTAAGYGVNQDGTTFRGDYSKLTAEQLN
Q^IGPGAAPEAQLYSFRWGCTGTTGVWQALDRTLDPNGDGDFSDRANIVNLSIGGEFSPPDDADAYA VESLNRQGVLAWSAGNATDYYGRGDTYSDSGQPANAVSALTVANSIGSSYAVDSMEIQAPANVAGKVPG DYTVSYTYTGAKPEALTGTVVTPSESNKFGCEAFSAEDAAKIKDKWVFLEWANADGSLPCGSKVRFDNVE KAGGKGWLSSEEEKPALPIGGNESIPGFRVAKSASAKVREAAANGELKVRLGTDLKESLRVPSNKKDQL TASSARGYHGTYGYTKPDVAAPGNNISSARVGTGTDGISYTGTSMSAPFAAGVAAQVLQANQSYGPTQLK AAIMNSANHDVRTADGNVYAVDRVGSGRIDAKAAAE KVLLY ADRPAQVSQ FGVLEYAV EGKQ L R EMTVENFDSHTHTYNISYAGSTDMPGVEFSLPSNITVNPGEKKNFTV I IDPAAMEKTMDPAMEK HNS VDPYGDG ELVPEQYRQFIASESGRILLTEGAATLRAPIHAAPKPASAMKVEGSSVEIPAGEHQANLKLT GTELNQRGYKSLLGAFEHGASIERTSPVKLDVSSNAKANMQHVGAASTAPALKASGGNPNDGLLAFGIST WANWDVVSTEN F V IDTDGNNRADYMLVTDRAKGIDFPIVRLYGYKNGNLEQIAYYPLNNAWGD DTN MMDSNALVMAVPLKDLGLSAEKTKDIKYSVSATTQYAWTNVSETGWINYRPFDPKLWFSGTAATVPGFFA DAPSSELVAHRAEGATDVKALFLHMHNTTGDLSGLNGAAGNRAQVLEVTEQQQLDPAPSRFTDVPAENQF YAEINWLAQRRITTGYPDGTFRPGENVERGAMAAYFYRLAGTPQF APDNPTFSDVPKSHPFYKEIEWMA ARGITTGYGDGTFRPSASVNRDAMAAFFYRYANSPQFAAPAASPFKDVPANSQFYKEIAWLAEQGITKGW DDGTYRPGEPIHRDAMAAFLYRYSDKVLK
(SEQ. ID. NO: 34)
Bacillus subtilis bacteria spp. subtilisins
[0295] The amino acid sequences of Bacillus licheniformis subtilisin A (subtilisin Carlsberg) and B. subtilis subtilisin NAT (nattokinase ) are shown below.
P00780.1; Subtilisin Carlsberg
MMRKKSFWLGMLTAFMLVFTMAFSDSASAAQPAKNVEKDYIVGFKSGVK ASVKKDIIKESGGKVDKQFR IINAAKAKLDKEALKEVKNDPDVAYVEEDHVAHALAQTVPYGIPLIKADKVQAQGFKGA VKVAVLDTGI QASHPDLNVVGGASFVAGEAYNTDGNGHG HVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGTYSG IVSGIEWA NGMDVI MSLGGPSGS AMKQAVDNAYARGVVVVAAAG SGSSGNTNTIGYPAKYDSVIA VGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTSTYATLNGTSMASPHVAGAAALILSKHPNLSASQV RNRLSSTATYLGSSFYYGKGLINVEAAAQ
(SEQ. ID. NO: 35)
P35835.1; Subtilisin NAT or Nattokinase
MRSKKLWISLLFALTLIFTMAFSNMSAQAAGKSSTEKKYIVGFKQTMSAMSSAKKKDVISEKGGKVQKQF KYVNAAAATLDEKAVKELKKDPSVAYVEEDHIAHEYAQSVPYGISQIKAPALHSQGYTGSNVKVAVIDSG IDSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAGTIAALNNSIGVLGVAPSASLYAVKVLDSTGSGQY SWIINGIEWAISNNMDVINMSLGGPTGSTALKTVVDKAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPST IAVGAVNSSNQRASFSSVGSELDVMAPGVSIQSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNA QVRDRLESTATYLGNSFYYGKGLINVQAAAQ
(SEQ. ID. NO: 36)
Additional Gluten-degrading enzymes that are not subtilisin or subtilisin-like
[0296] The additional gluten-degrading enzymes or glutamine endoproteases useful for the methods, formulations, and compositions of this disclosure include those that have been previously disclosed in the PCT Patent Application No: PCT/US11/43118, PCT Patent publication No: WO2012006384, the US Patent Application No. 20130171109, US Patent No. 7628985, and US Patent No. 8685392the contents of each are incorporated by reference in their entity.
[0297] In some embodiments, the additional gluten-degrading enzymes or glutamine endoproteases useful for the methods, formulations, and compositions of this disclosure are derived from Rothia species bacteria and they retain gluten-degrading activity throughout a wide range of pH (e.g., pH 3.0-10), unlike the Rothia subtilisin or subtilisin-like enzymes that have gluten-degrading activity at a pH range of about 6.0-10.0 and have low or negligible gluten-degrading activity at pH values below 5.0 and pH higher than 10.0. In some embodiments, these additional gluten-degrading enzymes are glutamine endopeptidases.
[0298] Accordingly, in some embodiments, the glutamine endopeptidase enzymes of a Rothia species described herein is capable of cleaving of any of the following peptides, including known T cell epitopes in gluten, under optimal conditions: QLQPFPQPQLPY (SEQ ID NO: 8) or PFPQPQLPY (SEQ ID NO: 9), PQPQLPYPQPQLPY (SEQ ID NO: 10) or PQPQLPYPQ (SEQ ID NO: 11), QPQQSFPQQQ (SEQ ID NO: 12) or PQQSFPQQQ (SEQ ID NO: 13), QLQPFPQPELPY (SEQ ID NO: 14),
PQPELPYPQPELPY (SEQ ID NO: 15), QPQQSFPEQQ (SEQ ID NO: 16); IQPQQPAQL (SEQ ID NO: 17); QQPQQPYPQ (SEQ ID NO: 18); SQPQQQFPQ (SEQ ID NO: 19); QQPFPQQPQ (SEQ ID NO: 20); or PFSQQQQPV (SEQ ID NO: 8), including 33-mer from alpha-gliadin,
LQLQPF(PQPQLPY)3PQPQPF (SEQ ID NO: 5), and the 26-mer from gamma-gliadin,
FLQPQQPFPQQPQQPYPQQPQQPFPQ (SEQ ID NO: 6). In some embodiments, the glutamine
endopeptidase of a Rothia species described herein have a kcat/Km of at least about 2.5 s"1 M"1, usually at least about 250 s"1 M"1 and preferably at least about 25000 s"1 for cleaving of any of the peptides described herein. A glutamine endopeptidase of a Rothia species described herein have a specificity kcat/Km>2 mM'V1 for the quenched fluorogenic substrate Abz-QPQQP-Tyr(N02)-D (SEQ ID NO: 37). Methods of assaying such enzymatic activities are known to those skilled in the art, e. g. by HPLC or fluorescence spectroscopy and as described, for example, in US Patent No. 7534426. For fluorescence spectroscopy-based assays, suitable fluorophores can be attached to the amino- and carboxy-termini of the peptides.
[0299] in some embodiments, the additional gluten-degrading enzymes described herein are isolated enzymes, extracts, or enriched extracts derived from Rothia species bacteria (e.g., Rothia spp. ot 188, also known as Rothia sp. HOT-188 and Rothia aeria). Such gluten-degrading enzymes can be, in one embodiment, a glutamine endopeptidase enzyme (e.g., a metal-ion dependent serine protease). In one embodiment, the glutamine endopeptidase enzyme present in the extract, derived or isolated from a Rothia species bacterium is inhibited by 1 mM 1-10 Phenanthroline. Addition of the serine protease inhibitor, phenylmethanesulphonylfluoride or phenylmethylsulphonyl fluoride (PMSF) can also inhibit YPQ, QQP, PPF and/or PFP cleavage activity, indicating that the enzyme is a serine protease. In one embodiment, the glutamine endopeptidase enzyme present in the extract, derived or isolated from a Rothia species bacterium is inhibited by 0.1 - 1 mM PMSF. In one embodiment, the glutamine endopeptidase enzyme present in the extract, derived or isolated from a Rothia species bacterium is inhibited by 0.1 - 1 mM 4-(2-Aminoethyl) benzenesulfonyl fluoride hydrochloride (AEBSF).
[0300] In one embodiment, the glutamine endopeptidase enzyme is isolated from a Rothia species bacterium by conventional protein purification methods known to those skilled in the art, e. g. as described in the Current Protocols in Molecular Biology and the Current Protocols in Protein Sciences. The protein fraction of an extract from a Rothia species bacterium can be concentrated by ammonium sulphate precipitation, and then purified by ion exchange chromatography on DEAE SEPHAROSE® CL- 6B and gel filtration on SEPHADEX® G-100. Sample fractions are taken at each step and assayed for - XPQ-, -QQP-, -PPF- and/or -PFP- cleavage activity in order to follow the location of the enzyme. For example, the enzyme can be at least 20% pure, at least 35% pure, at least 45% pure, at least 55% pure, at least 65% pure, at least 75% pure, at least 85% pure, at least 95% pure, at least 95% pure, at least 99% pure, wherein all the percentages between 20 and 99 are explicitly included.
[0301] The enzyme or enzymes can be further purified, for example, from the 70 kDa, or 75-80 kDa, or -125 kDa fractions using standard purification schemes known in the art, e. g. size exclusion
chromatography to isolate the 70 kDa fraction from a clarified crude extract of a Rothia species bacteria cell lysate. The bacteria can be lysed by standard methods known in the art, e. g. with lysozymes and treatment in a par bomb. The lysate can then be clarified by ultracentrifugation at 100,000 x G force for 1 hour at 4°C. The clarified lysate can then be concentrated and then fractioned with commercially available gel filtration matrix such as SEPHACRYL® (S-100 /200/300/400/500) from GE Healthcare Life Sciences. Fractions with glutamine endopeptidase activity can be determined by methods known in
the art and those described herein. One skilled in the art will be able to make minor modification for the enzyme being studied.
[0302] In other embodiments, the enzymes can be further purified according to the methods described in the Example Section.
[0303] In one embodiment, the glutamine endopeptidase enzyme attenuates gluten toxicity by cleaving the peptide bond after glutamine at -XPQ- and after tyrosine in XPY motifs in gluten-containing foodstuff, wherein X = any amino acids, P = proline, Q = glutamine, and Y is tyrosine. In one embodiment, the cleavage is at peptide bonds of non-terminal amino acids (i.e. within a protein or peptide molecule) immediately after the proline residue for - QQP- or -PFP- sequence, and immediately after the phenylalanine residue for -PPF- sequence.
Acidic Gluten-degrading enzymes from Rothia species bacteria
[0304] The enzymes with gluten-degrading activity at acidic pH described in the US Patent Application No. 20130171109 have a significant advantage over other microbial enzymes that degrade gluten due to their acidic character and ability to retain protease activity at varying pH (e.g., pH 3 to 10) including acidic pHs, such as those found in the stomach. The enzymes described herein have an isoelectric focusing point pH fractions of pH 2.5, 3 and 4. In the most acidic fraction (tested as described herein in the Examples section) a high molecular weight protease of approximately -125 kD to ~140kD can be isolated for use with the methods as described herein.
[0305] Another advantage of the enzymes with activity at acidic pH described in the US Patent
Application No. 20130171109 is that the R. aeria enzyme retains gluten-degrading activity throughout a wide range of pH (e.g., 3-10). As used herein, the term "retains gluten-degrading activity" or "retains activity" means that an enzyme as described herein retains at least 20% of the gluten-degrading activity (as measured by e.g., an in vitro gliadin or gliadin peptide cleavage assay as described in e.g., the Examples section) measured at a range of test pHs (e.g., in pHs of 2-12) compared to the activity measured at the environmental pH for the enzyme (e.g., pH 7-8 or the native pH environment in which the enzyme is found); preferably the enzyme retains at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99%, or even 100% of the activity compared to the activity measured when the assay is conducted at the enzyme's environmental pH (e.g., pH 7-8). It is contemplated herein that the isolated subtilisin enzyme together with the addition gluten- degrading enzyme described in this disclosure be taken prior to ingestion (e.g., 20 min to lhr before), concomitant with ingestion (e.g., at the same time), or shortly after ingestion (e.g., 20 min to lhr after) of a gluten-containing foodstuff. The enzymes described herein can transit the gastrointestinal tract with the gluten-containing foodstuff and can de-toxify gluten or fragments thereof that are formed during digestion. Since the enzymes are active in vitro at pHs observed in essentially every region of the gastrointestinal tract (e.g., oral cavity, stomach, small intestine etc), the enzymes with activity at acidic pH described in the US Patent Application No. 20130171109 will have a higher predicted efficiency for degrading gluten than a comparable enzyme that is inactivated by low pH (e.g., stomach pH). As used herein, the term "higher efficiency for degrading gluten" means that at least 20% more gluten will be
degraded during passage through the gastrointestinal tract by the enzymes described herein (as measured by appearance of gluten degradation products or by a more favorable response of a subject to a gluten challenge) compared to an enzyme having similar activity but that does not operate at a wide range of pH (e.g., only works within a narrow pH range of 7-8); preferably at least 30% more, at least 40% more, at least 50% more, at least 60% more, at least 70% more, at least 80% more, at least 90% more, at least 95% more, at least 99% more, at least 1-fold more, at least 2-fold more, at least 5-fold more, at least 10- fold more, at least 20-fold more, at least 100-fold more, at least 200-fold more, at least 500-fold more, at least 1000-fold more gluten is degraded during passage through the gastrointestinal tract by the enzymes described herein that retain activity at a wide range of pH.
[0306] The combination of isolated subtilisin enzyme together with the addition gluten-degrading enzyme described herein are advantageous over previous gluten-degrading enzymes described.
[0307] In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity at pH 2.5. In one embodiment, the enzyme described herein retains protease activity at pH 3.0. In another embodiment, the addition gluten- degrading enzyme described herein retains protease activity up to pH 7.0. In one embodiment, the addition gluten-degrading enzyme described herein retains protease activity between pH 2.5 to 7.0. In some embodiments, the addition gluten-degrading enzyme described herein retains protease activity between pH 2.5 to 3.0, between pH 2.5 to 4.0, between pH 3.0 to 4.0, between pH 3.0 to 6.0, between pH 2.5 to 5.0, between pH 2.5 to 6.0, between pH 5.0 to 7.0, between pH 5.0 to 6.0, and between pH 6.0 to 7.0.
[0308] In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 exhibits protease activity at pH 3.0 after 3-4 hours of digestion, e.g., in an in vitro gliadin degradation assay using a synthetic substrate Z-YPQ-pNA described herein. In one embodiment, the addition gluten-degrading enzyme described herein exhibited at least 5% protease activity at pH 3.0 after 3-4 hours of digestion in comparison the activity observed when assayed at pH 8.0 for 3-4 hours.
[0309] In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity at pH 2.5 and has an approximate molecular size of 140 kDa as determined by a gliadin zymogram or characterized as in Fig. 6. In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171 109 retains protease activity at pH 2.5 and has an approximate molecular size of 125 kDa as determined by a gliadin zymogram. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity at pH 2.5 and has an approximate molecular size range of 120-150 kDa as determined by gliadin zymography. In another embodiment, the addition gluten- degrading enzyme described herein retains protease activity at pH 2.5 and has an approximate molecular size range of 135- 145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity at pH 2.5 and has an approximate molecular size range of 125-145 kDa as determined by gliadin zymography.
[0310] In one embodiment, the gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size of 140 kDa as determined by a gliadin zymogram or characterized as in Fig. 6. In another embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size of 125 kDa as determined by a gliadin zymogram. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 120-150 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 135-145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten- degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 125-145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 50-90 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 65-75 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 65-80 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 3.0-4.0 and has an approximate molecular size range of 75-80 kDa as determined by gliadin zymography.
[0311] In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size of 140 kDa as determined by a gliadin zymogram or characterized as in Fig. 6. In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size of 125 kDa as determined by a gliadin zymogram. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size range of 120-150 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size range of 135-145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0- 7.0 and has an approximate molecular size range of 125-145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size range of 50-90 kDa as
determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size range of 65-75 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0- 7.0 and has an approximate molecular size range of 65-80 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 5.0-7.0 and has an approximate molecular size range of 75-80 kDa as determined by gliadin zymography.
[0312] In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size of 140 kDa as determined by a gliadin zymogram or characterized as in Fig. 6. In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size of 125 kDa as determined by a gliadin zymogram. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size range of 120-150 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size range of 135-145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5- 5.0 and has an approximate molecular size range of 125-145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size range of 50-90 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size range of 65-75 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5- 5.0 and has an approximate molecular size range of 65-80 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-5.0 and has an approximate molecular size range of 75-80 kDa as determined by gliadin zymography.
[0313] In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size of 140 kDa as determined by a gliadin zymogram. In one embodiment, the addition gluten-degrading enzyme with activity at acidic pH described in the US Patent Application No. 20130171109 retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size of 125 kDa as determined by a gliadin zymogram. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH
2.5-7.0 and has an approximate molecular size range of 120-150 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 135- 145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 125-145 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 50-90 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 65-75 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 65-80 kDa as determined by gliadin zymography. In another embodiment, the addition gluten-degrading enzyme described herein retains protease activity in the range between pH 2.5-7.0 and has an approximate molecular size range of 75-80 kDa as determined by gliadin zymography.
Formulations and compositions
[0314] A formulation as described herein comprises an isolated subtilisin enzyme derived from Rothia species bacteria. The formulation comprises an effective amount or effective does of the enzyme. In one embodiment, the effective dose of the isolated subtilisin enzyme from the Rothia species bacterium is administered orally. In one embodiment, pharmaceutical formulation and compositions are provide herein.
[0315] In one embodiment, the isolated subtilisin enzyme derived from Rothia species bacteria is admixed to the gluten-containing foodstuff. For example, the subtilisin enzyme derived from Rothia species bacteria is mixed with the gluten-containing foodstuff prior to ingesting.
[0316] In one embodiment, the isolated subtilisin enzyme derived from Rothia species bacteria is formulated with a pharmaceutically acceptable excipient or carrier. In one embodiment, the
pharmaceutical formulation and compositions comprise an isolated subtilisin enzyme derived from Rothia species bacteria and a pharmaceutically acceptable excipient or carrier. The pharmaceutical formulation and compositions further comprise at least one addition gluten-degrading enzyme or a glutamine endoprotease. In another embodiment, the pharmaceutical formulation and compositions further comprise a PEP.
[0317] In one embodiment, the isolated subtilisin enzyme derived from Rothia species bacteria is contained in a formulation that comprises an enteric coating.
[0318] In one embodiment, the isolated subtilisin enzyme derived from Rothia species bacteria is a lyophilized preparation. Lyophilization or freeze-drying is a means of drying achieved by freezing a wet substance and causing the ice to sublime directly to vapor by exposing it to a low partial pressure of water vapor. In practice, the substance may not be completely frozen, especially if non-aqueous solutions
are present, and most lyophilization processes are completed by a period of desorption drying. The purpose of freeze-drying is to increase the shelf life, or preserve a specimen, be it food, microbial organisms, or, in some circumstances to decrease the size of the product. For various purposes, such as stable storage, the isolated enzyme can be lyophilized. Lyophilization is preferably performed on an initially concentrated preparation, e.g. of at least about 1 mg/ml for isolated enzyme preparation and 1000 bacteria/ml. Additives can be added to improve enzyme stability in the lyophilization process if so desired. Such additives are known in the art, for example, PEG, albumin, dissacharides such as maltitol, mannitol, corn syrup solids, sorbitol and branched polymers of sucrose. These are described in U.S.
Patent No: 6294365, the contents are incorporated here by reference. In some embodiments,
lyophilization of an isolated enzyme can be performed without loss of specific activity (e.g., gluten- degrading activity). Lyophilized extracts are useful in the production of enteric -coated capsules, enteric- coated tablets, capsules, granules or tablets.
[0319] In one embodiment of the methods described herein further comprises administering an effective dose of subtilisin enzyme ranging from 0.01 mg to 500 mg/kg body weight. In some embodiments, the formulations or compositions administered to the subject is a combination of subtilisin and at least one addition gluten-degrading enzyme or a glutamine endopeptidase described in this disclosure. This combination can further comprise a PEP. The prolyl endopeptidase can be provided in a separate formulation or can be formulated with the active species (e.g., extract, isolated enzyme etc) described herein. Prolyl endopeptidase (PREP or PEP) or prolyl oligopeptidase (EC 3.4.21.26), (sometimes also known as post-proline cleaving enzyme) is a large cytosolic enzyme that belongs to a distinct class of serine peptidases. The enzyme cleaves peptide bonds at the C-terminal side of proline residues. Its activity is confined to action on oligopeptides of less than 10 kDa and it has an absolute requirement for the trans-configuration of the peptide bond preceding proline. Some types of prolyl endopeptidase from A. Niger have been used in studies to decrease the propensity of gluten-containing wheat products to aggravate celiac disease (Stepniak D, et al., 2006, Am J Physiol Gastrointest Liver Physiol 291 (4):
G621-9), e. g. PEP derived or isolated from Aspergillus niger, Flavobacterium meningosepticum, Sphingomonas capsulate, Penicillium citrinum, Lactobacillus helveticus and Myxococcus Xanthus in US Patent Application 20060002917 and 20080193436, and in US Patent Nos. 7563864, 7303871, and 7320788, the contents are incorporated here by reference.
[0320] In some embodiments of the pharmaceutical formulations described herein, the glutamine endopeptidase enzyme useful in the compositions or formulations is about 70 - 80 kDa, is active in a saliva sample, serine protease, and detoxifies gluten by cleaving the peptide bond after glutamine at - XPQ- motifs in gluten-containing foodstuff, wherein X = any amino acids, P = proline, and Q = glutamine. In one embodiment, glutamine endopeptidase enzyme is active in a buffer that mimics the ion composition of saliva, e. g. saliva ion buffer described herein.
[0321] In one embodiment of the pharmaceutical formulations described herein, the Rothia species bacteria is Rothia species ot 188 (also known as as Rothia sp. HOT-188, Rothia aeria strain F0474 (HMP ID 1324), Rothia aeria HM-818, and Rothia aeria strain WSA-8) and Rothia aeria.
[0322] In some embodiments of the pharmaceutical formulations described herein, the effective dose of the subtilisin enzyme derived from Rothia species bacteria ranges from 0.01 mg to 500 mg/kg body weight when the formulation comprises the isolated subtilisin enzyme.
[0323] In some embodiments of the pharmaceutical formulations described herein, the formulation is suitable for oral administration, e. g. a tablet or a capsule.
[0324] In some embodiments of the pharmaceutical formulations described herein, the formulation comprises an enteric coating.
[0325] In one embodiment, the isolated subtilisin enzyme derived from Rothia species bacteria described herein are formulated into pharmaceutical compositions by combination with appropriate, pharmaceutically acceptable carriers or diluents, and are formulated into preparations in solid, semi-solid, or liquid forms, such as tablets, capsules, powders, granules, solutions, gels, and microspheres. As such, administration of the extract, Rothia species bacteria, or the enzyme described herein can be achieved by oral administration.
[0326] In pharmaceutical dosage forms, the subtilisin enzyme derived from Rothia species bacteria described herein can be administered alone or in appropriate association, as well as in combination, with other pharmaceutically active compounds. For example, the methods and compositions provided herein can be combined with pharmaceutically active compounds used in the treatment and alleviation of symptoms of Celiac Sprue including, but not limited to, the following: an inhibitor of tissue
transglutaminase (see US Patent No. 7579313), an anti-inflammatory agent, an anti-ulcer agent, a mast cell-stabilizing agent, and/or and anti-allergy agent. Examples of such agents include HMG-CoA reductase inhibitors with anti-inflammatory properties such as compactin, lovastatin, simvastatin, pravastatin and atorvastatin; anti-allergic histamine HI receptor antagonists such as acrivastine, cetirizine, desloratadine, ebastine, fexofenadine, levocetirizine, loratadine and mizolastine; leukotriene receptor antagonists such as montelukast and zafirlukast; COX2 inhibitors such as celecoxib and rofecoxib; p38 MAP kinase inhibitors such as BIRB-796; and mast cell stabilizing agents such as sodium chromoglycate (chromolyn), pemirolast, proxicromil, repirinast, doxantrazole, amlexanox nedocromil and probicromil.
[0327] In one embodiment, the formulation or administration protocol combines an extract, Rothia species bacteria, subtilisin enzyme derived from Rothia species bacteria, and/or glutamine endopeptidase enzyme described herein with an inhibitor of transglutaminase 2 (TG2) (see US Patent No. 7579313). Such formulations can provide additional protection from gluten mediated enteropathy, as TG2 has been shown to have a significant pro-inflammatory effect on gluten peptides in the celiac gut. In particular, TG2 inhibitors containing halo-dihydroisoxazole, diazomethylketone or dioxoindole moieties are useful for this purpose.
[0328] In one embodiment, the formulation or administration protocol combines an extract, Rothia species bacteria, subtilisin enzyme derived from Rothia species bacteria, and/or glutamine endopeptidase enzyme described herein with an anti -inflammatory agent, e.g. a statin; p38 MAP kinase inhibitor; anti- TNFalpha agent; etc.
[0329] In one embodiment, the formulation comprises the subtilisin enzyme derived from Rothia species bacteria, and/or an additional gluten-degrading enzyme, and/or the glutamine endopeptidase enzyme, and/or a PEP described herein or a PEGylated form thereof. PEGylation is the process of covalent attachment of poly (ethylene glycol) polymer chains to another molecule, normally a drug or therapeutic protein. PEGylation is routinely achieved by incubation of a reactive derivative of PEG with the target macromolecule. The covalent attachment of PEG to a drug or therapeutic protein can "mask" the agent from the host's immune system (reduced immunogenicity and antigenicity), increase the hydrodynamic size (size in solution) of the agent which prolongs its circulatory time by reducing renal clearance.
PEGylation can also provide water solubility to hydrophobic drugs and proteins.
[0330] Methods of PEGylating proteins are known to one of ordinary skill in the art, e. g. US Patent 7585837 and also described herein. The first step of the PEGylation is the suitable functionalization of the PEG polymer at one or both terminals. PEGs that are activated at each terminus with the same reactive moiety are known as "homobifunctional", whereas if the functional groups present are different, then the PEG derivative is referred as "heterobifunctional" or "heterofunctional." The chemically active or activated derivatives of the PEG polymer are prepared to attach the PEG to the desired molecule.
[0331] The choice of the suitable functional group for the PEG derivative is based on the type of available reactive group on the molecule that will be coupled to the PEG. For proteins, typical reactive amino acids include lysine, cysteine, histidine, arginine, aspartic acid, glutamic acid, serine, threonine, and tyrosine. The N-terminal amino group and the C-terminal carboxylic acid can also be used.
[0332] The techniques used to form first generation PEG derivatives are generally reacting the PEG polymer with a group that is reactive with hydroxyl groups, typically anhydrides, acid chlorides, chloroformates and carbonates. In the second generation PEGylation chemistry more efficient functional groups such as aldehyde, esters, amides etc made available for conjugation. Preferred end groups for heterobifunctional PEGs are maleimide, vinyl sulfones, pyridyl disulfide, amine, carboxylic acids and NHS esters.
[0333] Pharmaceutical formulations can be formulated for administration by any known route. By way of example, the composition can be administered by a mucosal, pulmonary, topical, or other localized or systemic route (e.g., enteral and parenteral). The phrases "parenteral administration" and "administered parenterally" as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intraventricular, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, sub capsular, subarachnoid, intraspinal, intracerebrospinal, and intrasternal injection, infusion and other injection or infusion techniques, without limitation. It is preferred herein that the formulations described herein are administered orally (or mixed with gluten- containing foodstuff) to a subject afflicted with celiac disease or a related disorder.
[0334] For oral preparations, the subtilisin enzyme derived from Rothia species bacteria described herein can be used alone or in combination with appropriate additives to make tablets, powders, granules or capsules, for example, with conventional additives, such as lactose, mannitol, corn starch or potato
starch; with binders, such as microcrystalline cellulose, cellulose derivatives, acacia, corn starch or gelatins; with disintegrants, such as corn starch, potato starch or croscarmellose sodium; with lubricants, such as talc or magnesium stearate; and if desired, with diluents, buffering agents, moistening agents, preservatives, colorants, and flavoring agents.
[0335] For enteral administration, a composition can be incorporated into an inert carrier in discrete units such as capsules, cachets, tablets or lozenges, each containing a predetermined amount of the active compound; as a powder or granules; or a suspension or solution in an aqueous liquid or non-aqueous liquid, e.g., a syrup, an elixir, an emulsion or a draught. Suitable carriers may be starches or sugars and include lubricants, flavorings, binders, and other materials of the same nature.
[0336] A tablet can be made by compression or molding, optionally with one or more accessory ingredients. Compressed tablets can be prepared by compressing in a suitable machine the active compound in a free-flowing form, e.g., a powder or granules, optionally mixed with accessory ingredients, e.g., binders, lubricants, inert diluents, surface active or dispersing agents. Molded tablets can be made by molding in a suitable machine, a mixture of the powdered active compound with any suitable carrier.
[0337] A syrup or suspension can be made by adding the extract, Rothia species bacteria, or isolated enzyme described herein to a concentrated, aqueous solution of a sugar, e.g., sucrose, to which can also be added any accessory ingredients. Such accessory ingredients may include flavoring, an agent to retard crystallization of the sugar or an agent to increase the solubility of any other ingredient, e.g., as a polyhydric alcohol, for example, glycerol or sorbitol.
[0338] Formulations for oral administration can be presented with an enhancer. Orally-acceptable absorption enhancers include surfactants such as sodium lauryl sulfate, palmitoyl carnitine, Laureth-9, phosphatidylcholine, cyclodextrin and derivatives thereof; bile salts such as sodium deoxycholate, sodium taurocholate, sodium glycochlate, and sodium fusidate; chelating agents including citric acid and salicylates; and fatty acids (e.g., oleic acid, lauric acid, acylcarnitines, mono- and diglycerides). Other oral absorption enhancers include benzalkonium chloride, benzethonium chloride, CHAPS (3-(3- cholamidopropyl)-dimethylammonio-l-propanesulfonate), Big-CHAPS (N, N-bis(3-D- gluconamidopropyl)-cholamide), chlorobutanol, octoxynol-9, benzyl alcohol, phenols, cresols, and alkyl alcohols. An especially preferred oral absorption enhancer for the present invention is sodium lauryl sulfate.
[0339] While not required, in one embodiment, the formulations comprising theesubtilisin enzyme derived from Rothia species bacteria described herein and the oral formulations comprise enteric coatings, so that the subtilisin enzyme derived from Rothia species bacteria described herein is delivered to the intestinal tract. Enteric formulations are often used to protect an active ingredient from the strongly acid contents of the stomach. Such formulations are created by coating a solid dosage form with a film of a polymer that is insoluble in acid environments, and soluble in basic environments. Exemplary films are cellulose acetate phthalate, polyvinyl acetate phthalate, hydroxypropyl methylcellulose phthalate and
hydroxypropyl methylcellulose acetate succinate, methacrylate copolymers, and cellulose acetate phthalate.
[0340] A subtilisin enzyme derived from Rothia species bacteria described herein, can be prepared as a tablet formulation comprising the extract, the Rothia species bacteria, or the enzyme described herein with an enteric polymer casing. An example of such a preparation can be found in WO2005/021002. The active material in the core can be present in a micronized or solubilized form. In addition to active materials the core can contain additives conventional to the art of compressed tablets. Appropriate additives in such a tablet can comprise diluents such as anhydrous lactose, lactose monohydrate, calcium carbonate, magnesium carbonate, dicalcium phosphate or mixtures thereof; binders such as
microcrystalline cellulose, hydroxypropylmethylcellulose, hydroxypropyl-cellulose,
polyvinylpyrrolidone, pre-gelatinised starch or gum acacia or mixtures thereof; disintegrants such as microcrystalline cellulose (fulfilling both binder and disintegrant functions) cross-linked
polyvinylpyrrolidone, sodium starch glycollate, croscarmellose sodium or mixtures thereof; lubricants, such as magnesium stearate or stearic acid, glidants or flow aids, such as colloidal silica, talc or starch, and stabilisers such as desiccating amorphous silica, coloring agents, flavors etc. Preferably the tablet comprises lactose as diluent. When a binder is present, it is preferably hydroxypropylmethyl cellulose. Preferably, the tablet comprises magnesium stearate as lubricant. Preferably the tablet comprises croscarmellose sodium as disintegrant. Preferably, the tablet comprises microcrystalline cellulose.
[0341] The diluent can be present in a range of 10 - 80% by weight of the core. The lubricant can be present in a range of 0.25 - 2% by weight of the core. The disintegrant can be present in a range of 1 - 10% by weight of the core. Microcrystalline cellulose, if present, can be present in a range of 10 - 80% by weight of the core.
[0342] The extract, the Rothia species bacteria, or the enzyme described herein preferably comprises between 10 and 50% of the weight of the core, more preferably between 15 and 35% of the weight of the core (calculated as free base equivalent). The core can contain any therapeutically suitable dosage level of the active ingredient, but preferably contains up to 150 mg as free base of the active ingredient. The core can contain 20, 30, 40, 50, 60, 80 or lOOmg as free base of the active ingredient. The active ingredient can be present as the free base, or as any pharmaceutically acceptable salt. If the active ingredient is present as a salt, the weight is adjusted such that the tablet contains the desired amount of active ingredient, calculated as free base of the salt. Preferably, the active ingredient is present as a hydrochloride salt.
[0343] The core can be made from a compacted mixture of its components. The components can be directly compressed, or can be granulated before compression. Such granules can be formed by a conventional granulating process as known in the art. In an alternative embodiment, the granules can be individually coated with an enteric casing, and then enclosed in a standard capsule casing.
[0344] The core is surrounded by a casing which comprises an enteric polymer. Examples of enteric polymers are cellulose acetate phthalate, cellulose acetate succinate, methylcellulose phthalate, ethylhydroxycellulose phthalate, polyvinylacetate pthalate, polyvinylbutyrate acetate, vinyl acetate-
maleic anhydride copolymer, styrene-maleic mono-ester copolymer, methyl aery late -methacrylic acid copolymer or methacry late -methacrylic acid-octyl acrylate copolymer. These can be used either alone or in combination, or together with other polymers than those mentioned above. The casing can also include insoluble substances which are neither decomposed nor solubilised in living bodies, such as alkyl cellulose derivatives such as ethyl cellulose, crosslinked polymers such as styrene-divinylbenzene copolymer, polysaccharides having hydroxyl groups such as dextran, cellulose derivatives which are treated with bifunctional crosslinking agents such as epichlorohydrin, dichlorohydrin or 1, 2-, 3, 4- diepoxybutane. The casing can also include starch and/or dextrin.
[0345] Exemplary enteric coating materials are the commercially available EUDRAGIT® enteric polymers such as EUDRAGIT® L, EUDRAGIT® S and EUDRAGIT® NE used alone or with a plasticiser. Such coatings are normally applied using a liquid medium, and the nature of the plasticiser depends upon whether the medium is aqueous or non-aqueous. Plasticizers for use with aqueous medium include propylene glycol, triethyl citrate, acetyl triethyl citrate or CITROFLEX® or CITROFLEX® A2. Non-aqueous plasticizers include these, and also diethyl and dibutyl phthalate and dibutyl sebacate. A preferred plasticiser is triethyl citrate. The quantity of plasticiser included will be apparent to those skilled in the art.
[0346] The casing can also include an anti-tack agent such as talc, silica or glyceryl monostearate.
Preferably the anti-tack agent is glyceryl monostearate. Typically, the casing can include around 5 - 25 wt% Plasticiser and up to around 50 wt % of anti-tack agent, preferably 1-10 wt % of anti-tack agent.
[0347] If desired, a surfactant can be included to aid with forming an aqueous suspension of the polymer. Many examples of possible surfactants are known to the person skilled in the art. Preferred examples of surfactants are polysorbate 80, polysorbate 20, or sodium lauryl sulphate. If present, a surfactant can form 0.1 - 10% of the casing, preferably 0.2 - 5% and particularly preferably 0.5 - 2%
[0348] In one embodiment, there is a seal coat included between the core and the enteric coating. A seal coat is a coating material which can be used to protect the enteric casing from possible chemical attack by any alkaline ingredients in the core. The seal coat can also provide a smoother surface, thereby allowing easier attachment of the enteric casing. A person skilled in the art would be aware of suitable coatings. Preferably the seal coat is made of an Opadry coating, and particularly preferably it is Opadry White OY-S-28876.
[0349] In an example, lactose monohydrate, microcrystalline cellulose, the active ingredient- e. g. the extract form Rothia species, the hydroxypropyl methyl cellulose and half of the croscarmellose sodium are screened into a 10 Litre Fielder high-shear blender (any suitable high shear blender could be used) and blended for 5 minutes at 300 rpm with the chopper off. The mixture is then granulated by the addition of about 750 ml water whilst continuing to blend. The granules are dried in a Glatt 3/5 fluid bed drier, screened by Comil into a Pharmatec 5 Litre bin blender and then blended with any lactose anhydrous given in the formula plus the remainder of the croscarmellose sodium over 5 minutes at 20 rpm. Magnesium stearate is screened into the blender and the mixing process continued for a further 1 minute at 10 rpm. The lubricated mix is compressed using a Riva Piccolla rotary tablet press fitted with
9.5mm round normal convex punches (any suitable tablet press could be used). The sealcoat, and subsequently the enteric coat, are applied by spraying of an aqueous suspension of the coat ingredients in a Manesty 10 coater using parameters for the coating process as recommended by the manufacturers of the coating polymers (again, any suitable coater could be used).
[0350] Other enteric formulations comprise engineered polymer microspheres made of biologically erodable polymers, which display strong adhesive interactions with gastrointestinal mucus and cellular linings and can traverse both the mucosal absorptive epithelium and the follicle-associated epithelium covering the lymphoid tissue of Peyer's patches. The polymers maintain contact with intestinal epithelium for extended periods of time and actually penetrate it, through and between cells. See, for example, Mathiowitz et al. (1997) Nature 386 (6623): 410-414. Drug delivery systems can also utilize a core of superporous hydrogels (SPH) and SPH composite (SPHC), as described by Dorkoosh et al.
(2001) J Control Release 71(3):307-18. Other enteric-coated preparations of this sort can be prepared by one skilled in the art, using these materials or their equivalents.
[0351] The compositions can be formulated as a sustained release composition. For example, sustained- release means or delivery devices are known in the art and include, but are not limited to, sustained- release matrices such as biodegradable matrices or semi-permeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules that comprise the extract, Rothia species bacteria, or enzyme described herein
[0352] A sustained-release matrix, as used herein, is a matrix made of materials, usually polymers, which are degradable by enzymatic or acid/base hydrolysis or by dissolution. Once inserted into the body, the matrix is acted upon by enzymes and body fluids. The sustained-release matrix desirably is chosen from biocompatible materials such as liposomes, polylactides (polylactic acid), polyglycolide (polymer of glycolic acid), polylactide co-glycolide (co-polymers of lactic acid and glycolic acid) polyanhydrides, poly(ortho)esters, polyproteins, hyaluronic acid, collagen, chondroitin sulfate, carboxylic acids, fatty acids, phospholipids, polysaccharides, nucleic acids, polyamino acids, amino acids such as phenylalanine, tyrosine, isoleucine, polynucleotides, polyvinyl propylene, polyvinylpyrrolidone and silicone. A preferred biodegradable matrix is a matrix of one of polylactide, polyglycolide, or polylactide co- glycolide (co-polymers of lactic acid and glycolic acid).
[0353] Sustained-release matrices include polylactides (U.S. Pat. No. 3,773,919, EP 58,481), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (U. Sidman el al., Biopolymers 22:547- 556 (1983)), poly (2-hydroxyethyl methacrylate) (R. Langer et al., J. Biomed Mater. Res. 15: 167-277 (1981), and R. Langer, Chem. Tech. 12:98-105 (1982)), ethylene vinyl acetate (R. Langer et al, Id.) or poly-D- (-)-3-hydroxybutyric acid (EP 133,988). Sustained-release compositions also include
liposomally entrapped extract, Rothia species bacteria, or enzyme described herein. Such liposomes can be prepared by methods known per se: DE 3,218,121; Epstein, et al., Proc. Natl. Acad. Sci. USA
82:3688-3692 (1985); Hwang et al., Proc. Natl. Acad. Sci. USA 77:4030-4034 (1980); EP 52,322; EP 36,676; EP 88,046; EP 143,949; EP 142,641; Japanese Pat. Appl. 83-118008; U.S. Pat. Nos. 4,485,045 and 4,544,545; and EP 102,324. Ordinarily, the liposomes are of the small (about 200-800 Angstroms)
unilamellar type in which the lipid content is greater than about 30 mol. percent cholesterol, the selected proportion being adjusted for the optimal therapy. Other biodegradable polymers and their use are described, for example, in detail in Brem et al. (1991, J. Neurosurg. 74:441-446). For examples of sustained release compositions, see U.S. Pat. No. 3,773,919, EP 58,481A, U.S. Pat. No. 3,887,699, EP 158,277A, Canadian Patent No. 1176565, U. Sidman et al., Biopolymers 22:547 (1983) and R. Langer et al., Chem. Tech. 12:98 (1982).
[0354] Methods for preparing liposomes and microspheres for administration to a patient are known to those of skill in the art. U.S. Pat. No. 4,789,734, the contents of which are hereby incorporated by reference, describes methods for encapsulating biological materials in liposomes. A review of known methods is provided by G. Gregoriadis, Chapter 14, "Liposomes," Drug Carriers in Biology and
Medicine, pp. 287-341 (Academic Press, 1979).
[0355] Microspheres formed of polymers or proteins are well known to those skilled in the art, and can be tailored for passage through the gastrointestinal tract directly into the blood stream. Alternatively, the compound can be incorporated and the microspheres or composite of microspheres, implanted for slow release over a period of time ranging from days to months. See, for example, U.S. Pat. Nos. 4,906,474, 4,925,673 and 3,625,214, and Jein, TIPS 19: 155-157 (1998), the contents of which are hereby incorporated by reference.
[0356] Preferred micro particles are those prepared from biodegradable polymers, such as polyglycolide, polylactide and copolymers thereof. Those of skill in the art can readily determine an appropriate carrier system depending on various factors, including the desired rate of drug release and the desired dosage.
[0357] The pharmaceutically acceptable excipients, such as vehicles, adjuvants, carriers or diluents that are inherently nontoxic and nontherapeutic, are commercially available. Moreover, pharmaceutically acceptable auxiliary substances, such as pH adjusting and buffering agents, tonicity adjusting agents, stabilizers, wetting agents and the like, are commercially available. Any compound useful in the methods and compositions of the invention can be provided as a pharmaceutically acceptable base addition salt. "Pharmaceutically acceptable base addition salt" refers to those salts which retain the biological effectiveness and properties of the free acids, which are not biologically or otherwise undesirable. These salts are prepared from addition of an inorganic base or an organic base to the free acid. Salts derived from inorganic bases include, but are not limited to, the sodium, potassium, lithium, ammonium, calcium, magnesium, iron, zinc, copper, manganese, aluminum salts and the like. Preferred inorganic salts are the ammonium, sodium, potassium, calcium, and magnesium salts. Salts derived from organic bases include, but are not limited to, salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, such as
isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, ethanolamine, 2 dimethylaminoethanol, 2 diethylaminoethanol, dicyclohexylamine, lysine, arginine, histidine, caffeine, procaine, hydrabamine, choline, betaine, ethylenediamine, glucosamine, methylglucamine, theobromine, purines, piperazine, piperidine, N ethylpiperidine, polyamine resins and the like. Particularly preferred
organic bases are isopropylamine, diethylamine, ethanolamine, trimethylamine, dicyclohexylamine, choline and caffeine.
[0358] Examples of such carriers include ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts, or electrolytes such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, and polyethylene glycol.
[0359] In one embodiment, other ingredients may be added to pharmaceutical formulations, including antioxidants, e.g., ascorbic acid; low molecular weight (less than about ten residues) polypeptides, e.g., polyarginine or tripeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids, such as glycine, glutamic acid, aspartic acid, or arginine; monosaccharides, disaccharides, and other carbohydrates including cellulose or its derivatives, glucose, mannose, or dextrins; chelating agents such as EDTA, and sugar alcohols such as mannitol or sorbitol.
[0360] In one embodiment, the pharmaceutical formulation to be used for therapeutic administration must be sterile. Sterility is readily accomplished by filtration through sterile filtration membranes (e.g., 0.2 micron membranes).
Dosage and Administration
[0361] Depending on the subject, severity of disease and condition being treated and on the
administration route, the subtilisin enzyme derived from Rothia species bacteria described herein can be administered in dosages of 0.01 mg to 500 mg/kg body weight per day, e.g. about 20, 100, 250, 500 or more mg/day or about 0.5, 1, 1.5, or more g/day for an average person for the enzyme. A typical dose of the enzyme described herein in subjects will be at least about 1 mg/adult subject, at least about 10 mg/adult subject; or at least about 50, 150, 250, 500 or more mg/adult subject. In some embodiments, the dosage is no more than about 5 g, no more than about 1 g, or no more than about 500 mg/adult subject. Efficient proteolysis of gluten in vivo for an adult can, depending on diet and other factors, require at least about 500 units of a therapeutically efficacious the subtilisin enzyme derived from Rothia species bacteria or glutamine endopeptidase from Rothia species bacteria described herein. In some embodiments, low dose of subtilisin enzyme glutamine endopeptidase, such as 1000 units, can be used. In other embodiments, such as for the rapid detoxification of 5-10 g ingested gluten, as much as 20,000-50,000 units can be provided in unit dose form. One unit is defined as the amount of enzyme required to hydrolyze 1 μπιοΐ of Z-KPQ-pNA or Z-YPQ-pNA per min under specified conditions. For example, most PEPs have specific activities in the range of 5-50 units/mg protein. For barley EP-B2 (whose specific activity is in the 1000 Units/mg range, as measured with Cbz-Phe-Arg-pNA), low dose glutenase may consist of 10,000-100,000 Units, whereas high-dose PEPs contains as much as 1,000,000 Units. It will be understood by those of skill in the art that the dose can be raised, but that additional benefits may not be obtained by exceeding the useful dosage. Dosages will be appropriately adjusted for pediatric
formulation. In children the effective dose may be lower, for example at least about 0.1, 0.5, 1, 10, 20, 100, 150, 250 or more mg.
[0362] In one embodiment, the compositions or formulations are admixed with gluten-containing foodstuff in vitro for the purpose of detoxifying the gluten-containing foodstuff, i.e., reducing the production of toxic gluten oligopeptides when ingested and further digested by a subject. The effective dosage for in vitro detoxification will depend on many factors, e.g., the degree of detoxification desired (partial or complete), the state of the gluten-containing foodstuff, the time and pH of digestion and the ratio of composition or formulation to the amount of gluten-containing foodstuff to be digested. A typical dose for the enzyme can be 10 units per 1 g for a 24 hour complete digestion. One skilled in the art will be able to vary the units in proportion to the amount of gluten-containing foodstuff and the time allowed for digestion to attained the desired level of digestion.
[0363] The skilled artisan will appreciate that certain factors may influence the dosage and timing required to effectively treat a subject, including but not limited to the severity of the disease or disorder, previous treatments, the general health and/or age of the subject, and other diseases present. The dose levels can also depend on whether the extract, Rothia species bacteria, or enzyme is used, the severity of the symptoms and the susceptibility of the subject to side effects. The isolated enzyme can be more potent than the extract or the bacteria. Moreover, treatment of a subject with a therapeutically effective dose can include a single treatment or a series of treatments. Estimates of effective dosages and in vivo half-lives for the extract, Rothia species bacteria, or enzyme encompassed by the invention can be made using conventional methodologies or on the basis of in vivo testing using an appropriate animal model, as known in the art, or as described herein. Preferred dosages for a given enzyme are readily determinable by those of skill in the art by a variety of means.
[0364] The therapeutic effect can be measured in terms of clinical outcome or can be determined by immunological or biochemical tests. For example, in the treatment of Celiac sprue, suppression of the deleterious T-cell activity can be measured by enumeration of reactive Thl cells, by quantitating the release of cytokines at the sites of lesions, or using other assays for the presence of autoimmune T cells known in the art. Alternatively, one can look for a reduction in symptoms of celiac disease as described herein or, e.g. as set forth in Pyle et al, Clin. Gastroenterol. Hepatol. 3 :679-686, 2005.
[0365] Various methods for administration may be employed, it being appreciated that the formulations of the extract, Rothia species bacteria, or enzyme described herein provided by the present invention provide improved formulations for oral administration. For example, in the treatment of Celiac Sprue with a subtilisin enzyme derived from Rothia species bacteria described herein, the present invention provides unit dose forms of the extract, Rothia species bacteria, or enzyme described herein suitable for administration with meals. The dosage of the therapeutic formulation will vary widely, depending upon the nature of the disease, the frequency of administration, the manner of administration, the clearance of the agent from the host, and the like. The initial dose can be larger, followed by smaller maintenance doses. The dose can be administered as infrequently as weekly or biweekly, or more often fractionated
into smaller doses and administered daily, with meals, semi-weekly, or otherwise as needed to maintain an effective dosage level.
[0366] Lyophilized formulations of subtilisin enzyme derived from Rothia species bacteria and excipients is useful in the production of enteric -coated capsules or tablets, e.g. a single capsule or tablet can contain at least about 1 mg usually at least about 10 mg of isolated subtilisin enzyme derived from Rothia species bacteria and may contain at least 100 mg subtilisin enzyme derived from Rothia species bacteria, at least about 200 mg, at least about 300 mg, at least about 400 mg, at least about 500 mg, up to about 1000 mg protein, including all the numbers between 1- lOOOmg. Where there additional enzymes in the formulation or compositions, e.g., isolated additional gluten-degrading enzyme or isolated glutamine endopeptidase enzyme or isolated PEP, each of these enzymes ranges from at least about 1 mg usually at least about 10 mg in the composition or formulation. It is comtemplated that these additional enzymes can range from at least about 200 mg, at least about 300 mg, at least about 400 mg, at least about 500 mg, up to about 1000 mg protein, including all the numbers between 1- 1000 mg. As described in detail here, enteric coatings can be applied, where a substantial fraction of the activity is retained, and is stable for at least about 1 month at 4°C. The method of lyophilizing bacteria is known to one skilled in the art, e. g. United States Patent 4205132, 4444760, RE40023, 5192743, 5529915, 6750330, and 7572893, all of which are incorporated by reference inn their entirety.
[0367] In one embodiment, the effective dose of the subtilisin enzyme derived from Rothia species bacteria ranges from 0.01 mg to 500 mg/kg body weight. In another embodiment, wherein the glutamine endopeptidase enzyme derived or isolated from a Rothia species bacterium is used, the effective dose of the enzyme is from 0.01 mg to 500 mg/kg body weight.
[0368] In one embodiment, the method is practiced when the subject is consuming any gluten- containing foodstuff. In another embodiment, the method is practiced prior to the consumption of gluten- containing foodstuff, wherein the subject is preparing to ingest gluten-containing food or the subject suspects that there might be gluten or wheat-derived ingredients in the food that the subject is about to consume. In another embodiment, the method is practiced whenever food is consumed or e.g., three times a day with the three major meals of a day: breakfast, lunch and dinner.
[0369] Accordingly, in some embodiments, the formulation or compositions comprising the isolated subtilisin enzyme derived from Rothia species bacteria is administered just before, during, or just after consumption of gluten-containing foodstuff.
[0370] In one embodiment, the formulation or compositions comprising the isolated subtilisin enzyme derived from Rothia species bacteria is administered prior to consumption of gluten-containing foodstuff. In one embodiment, the the formulation or compositions comprising the isolated subtilisin enzyme derived from Rothia species bacteria is administered in a gluten-containing foodstuff.
[0371] In one embodiment, the pharmaceutical formulation as described herein is administered in an amount sufficient to attenuate gluten toxicity, as that term is used herein.
[0372] Formulations are typically provided in a unit dosage form, where the term "unit dosage form," refers to physically discrete units suitable as unitary dosages for the subjects, each unit containing a
predetermined quantity of the the formulation or compositions comprising the isolated subtilisin enzyme derived from Rothia species bacteria described herein in an amount sufficient to produce the desired effect in association with a pharmaceutically acceptable diluent, carrier or vehicle. The specifications for the unit dosage forms of the present invention depend on the particular complex employed and the effect to be achieved, and the pharmacodynamics associated with each complex in the host.
Attenuates gluten toxicity
[0373] In the context of an enzyme or enzyme preparation, "attenuates gluten toxicity" refers to the action of an endopeptidase enzyme to reduce the amount, level or density of toxic gluten oligopeptides produced from gluten-containing foodstuff in the gut. Some toxic gluten oligopeptides are produced during digestion of gluten-containing foodstuff by endogenous trypsin, chymotrypsin, elastase and carboxypeptidase in the gastrointestinal tract. Attenuation of gluten toxicity is achieved by digesting toxic gluten oligopeptides to smaller peptide fragments that lack T cell epitopes in glutens recognized by the subject's immune system. The activity of a glutamine endopeptidase from Rothia species described herein, before and/or after the digestion of gluten oligopeptides produced by endogenous trypsin, chymotrypsin, elastase and carboxypeptidase would result in less than 10% of the post-digestion products being longer than PQPQLPYPQ (SEQ ID NO: 11) which has nine amino acid residues. This can be assessed by the longer retention times on a C18 reverse phase HPLC column monitored at A215 and such methods are well known to one skilled in the art.
[0374] In one embodiment, the attenuation of gluten toxicity occurs in vitro prior to the ingestion of the gluten-containing foodstuff. For example, the compositions or the formulation described herein is admixed to the gluten-containing foodstuff during the manufacture of the foodstuff.
[0375] The assessment of attenuation of gluten toxicity can be determined using a cell-based or in vitro assay by measuring the ability of the the isolated subtilisin enzyme derived from Rothia species bacteria or isolated glutamine endopeptidase from Rothia species described herein to increase the concentration of free NH2 -termini in a reaction mixture containing e.g., 1 mg/ml of undigested or trypsin/
chymotrypsin/elastase/carboxypeptidase pre-digested gluten substrate, and 10 μg/ml of the extract or isolated glutamine endopeptidase from a Rothia species, which can be incubated at 37°C for 1 hour. Thus, attenuation of gluten toxicity in this context refers to an increase the concentration of free amino termini under such conditions by at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99% or even 100% (no gluten toxicity). Additionally, a reduction in the residual molar concentration of oligopeptides greater than about e.g., 1000 Da can be measured using e.g., 1 mg/ml trypsin/ chymotrypsin/elastase/carboxypeptidase pre-digested gluten substrate after a 1 hour incubation with 10 μg/ml of the extract or enzyme, which detects an increase in degradation of gluten toxic intermediates. This reduction in molar concentration is at least 50%, at least 1-fold, at least 2-fold, at least 5 -fold, at least 10-fold, at least 100-fold, at least 1000-fold or more. The concentration of such oligopeptides can be estimated by methods known in the art, for example size exclusion chromatography and the like.
[0376] Alternatively, an in vitro based assay measuring the degradation of highly immunogenic peptides can be used; such highly immunogenic peptides can include those derived from ot-gliadin
(LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF; a 33-mer; SEQ. ID. NO: 5) or γ-gliadin
(FLQPQQPFPQQPQQPYPQQPQQPFPQ,; 26-mer; SEQ. ID. NO: 6). For example, gliadin peptides (10 mg/mL) are contacted with an enzyme sample (e.g., extract, isolated enzyme, whole saliva) to be tested and incubated at various time points (e.g., lOmin, 30min, lh, 2h, 6h, 12h, 24h, etc). The assay is stopped by heat inactivation (e.g., boiling) and the peptide sample is subjected to RP-HPLC to determine the presence, absence or degree of degradation.
[0377] In one embodiment, "attenuates gluten toxicity" also refers to reducing the ability of a gluten oligopeptide to bind to HLA-DQ (e.g., a decreased number of epitopes for recognition by a subject's immune system). The ability of a substrate to bind to HLA-DQ is indicative of its toxicity; fragments smaller than about 8 amino acids are generally not stably bound to Class II MHC. The detoxification of whole gluten can be monitored by polyclonal T cell lines derived from intestinal biopsies of celiac or gluten allergic patients, by LC-MS-MS and by ELISA assays using monoclonal antibodies capable of recognizing sequences specific to gliadin. For example, an extract of a Rothia species or an isolated glutamine endopeptidase from Rothia species described herein can reduce the potency by which a trypsin/ chymotrypsin/elastase/carboxypeptidase pre-digested gluten substrate can antagonize binding of PQPELPYPQPQLP (SEQ ID NO: 38) to HLA-DQ2. Treatment with an isolated enzyme or extract of Rothia species bacteria or Rothia bacteria described herein permits digestion of toxic oligopeptides, thereby preventing the toxic oligopeptides from competing with a test peptide for MHC binding. Such a competition assay can be performed by incubating 1 mg/ml trypsin/
chymotrypsin/elastase/carboxypeptidase pre-digested gluten substrate with 10 μg/ml of the extract or enzyme, and the ability of the resulting solution to displace radioactive PQPELPYPQPQPLP (SEQ ID NO: 39) pre-bound to HLA-DQ2 molecules can then be quantified, with a reduction of displacement, relative to a non-treated control, indicative of utility in the methods of the present invention.
[0378] In one embodiment, "attenuates gluten toxicity" also refers to reducing the anti-tTG antibody and/or anti-gliadin antibodies response to a "gluten challenge diet" in a Celiac sprue or gluten allergic/gluten intolerance patient by at least 50%, at least 1-fold, at least 2-fold, at least 5 -fold, at least 10-fold, at least 100-fold or more. A "gluten challenge diet" is defined as the intake of 100 g bread per day for 3 days by an adult Celiac sprue or gluten allergic patient previously on a gluten-free diet. The anti-tTG antibody (ATA) and anti-gliadin antibodies (AGA) response can be measured in peripheral blood using standard clinical diagnostic procedures, as known in the art.
[0379] The present invention can be defined in any of the following numbered paragraphs:
[1] A foodstuff comprising a formulation comprising a subtilisin enzyme derived from a
Rothia sp. bacteria.
[2] The foodstuff of paragraph 1, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296,
Rothia species ot 188 (strain WSA-8), Rothia aeria BAV86562.1 and Rothia dentocariosa KGJ00122.1.
[3] The foodstuff of paragraph 1, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa, Rothia aeria and Rothia dentocariosa.
[4] The foodstuff of paragraph 1 or 2 or 3, wherein the subtilisin has the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins.
[5] The foodstuff of any one of paragraphs 1-4, wherein the subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC),
ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins described herein.
[6] The foodstuff of any one of paragraphs 1-5, wherein the subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
[7] The foodstuff of any one of paragraphs 1-6, wherein the subtilisin cleaves proline- containing proteins, cleaving the second peptide bond after proline in the XPXl motif, where X is any amino acid, P is proline and XI is a hydrophobic amino acid, i.e., cleaving at the peptide bond after XI, e.g. the XPQ motif, where Q is glutamine.
[8] The foodstuff of any one of paragraphs 1-7, wherein the subtilisin cleaves succinyl-Ala- Ala-Pro-Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after proline in the P2 position.
[9] The foodstuff of any one of paragraphs 1-8, wherein the subtilisin degrades the highly immunogenic gliadin-derived 33 -mer peptide.
[10] The foodstuff of any one of paragraphs 1-9, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PFP- motif, wherein F= Phenylalanine=Phe; P=proline=Pro.
[11] The foodstuff of any one of paragraphs 1-10, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PPF- motif, wherein F= Phenylalanine; P=proline.
[12] The foodstuff of any one of paragraphs 1-11, wherein the subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes.
[13] The foodstuff of any one of paragraphs 1-12, wherein the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis or as described in Figures 2A-2E; or have a predicted molecular weight of -125 kDa as described in the example section.
[14] The foodstuff of any one of paragraphs 1-13, wherein the subtilisin enzyme has a functional pH range of 6.0-10.0.
[15] The foodstuff of any one of paragraphs 1-14, wherein the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
[16] The foodstuff of any one of paragraphs 1-15, wherein the subtilisin is 100% inhibited by ImM of PMSF.
[17] The foodstuff of any one of paragraphs 1-16, wherein the subtilisin is not inhibited by E64 or EDTA.
[18] The foodstuff of any one of paragraphs 1-17, wherein the subtilisin is not stable in acid conditions.
[19] The foodstuff of any one of paragraphs 1-18, wherein the subtilisin is lyophilized.
[20] The foodstuff of any one of paragraphs 1-19, wherein the subtilisin is a recombinant protein.
[21] The foodstuff of any one of paragraphs 1-20, wherein the subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 or 33 or 34..
[22] The foodstuff of any one of paragraphs 1-21, wherein the subtilisin comprises SEQ. ID. NO: 1, 2 or 3 or 33 or 34..
[23] The foodstuff of any one of paragraphs 1-22, wherein the subtilisin consists essentially of SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
[24] The foodstuff of any one of paragraphs 1-23, wherein the subtilisin is SEQ. ID. NO: 1, 2 or 3 or 33 or 34..
[25] The foodstuff of any one of paragraphs 1-24, the formulation further comprising a prolyl endopeptidase.
[26] The foodstuff of any one of paragraphs 1-25, the formulation further comprising at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ- pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
[27] The foodstuff of any one of paragraphs 1-26, the formulation further comprising at least one isolated additional glutamine endopeptidase enzyme that cleaves a peptide bond after a QPF and a PFP motif in glutens.
[28] A method for degrading gluten or an amylase-trypsin inhibitor in a gluten-containing foodstuff the method comprises contacting the gluten-containing foodstuff with an effective dose of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria.
[29] The method of paragraph 28, wherein the contacting is performed in vitro prior to consumption of the gluten-containing food stuff.
[30] The method of paragraph 28, wherein the contacting is performed in vivo concurrent with or after consumption of the gluten-containing food stuff.
[31] The method of paragraph 28, 29, or 30, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, Rothia species ot 188 (strain WSA-8), Rothia aeria BAV86562.1 and Rothia dentocariosa KGJ00122.1.
[32] The method of any one of paragraphs 28-31, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa, Rothia aeria and Rothia dentocariosa.
[33] The method of any one of paragraphs 28-32, wherein the subtilisin has the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243
(C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins.
[34] The method of any one of paragraphs 28-33, wherein the subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC),
ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins, (SEQ. ID. NOS: 1-3) or SEQ. ID. NOS: 33-34.
[35] The method of any one of paragraphs 28-34, wherein the subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
[36] The method of any one of paragraphs 28-35, wherein the subtilisin cleaves proline- containing proteins, cleaving the second peptide bond after proline in the XPXl motif, where X is any amino acid, P is proline and XI is a hydrophobic amino acid, i.e., cleaving at the peptide bond after XI, e.g. the XPQ motif, where Q is glutamine.
[37] The method of any one of paragraphs 28-36, wherein the subtilisin cleaves succinyl-Ala- Ala-Pro-Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after proline in the P2 position.
[38] The method of any one of paragraphs 28-37, wherein the subtilisin degrades the highly immunogenic gliadin-derived 33 -mer peptide.
[39] The method of any one of paragraphs 28-38, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PFP- motif, wherein F= Phenylalanine=Phe; P=proline=Pro.
[40] The method of any one of paragraphs 28-39, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PPF- motif, wherein F= Phenylalanine; P=proline.
[41] The method of any one of paragraphs 28-40, wherein the subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes, e.g. the 33mer peptide.
[42] The method of any one of paragraphs 28-41, wherein the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis, or a predicted molecular weight of -125 kDa as described in the Example Section.
[43] The method of any one of paragraphs 28-42, wherein the subtilisin enzyme has a functional pH range of 6.0-10.0.
[44] The method of any one of paragraphs 28-43, wherein the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
[45] The method of any one of paragraphs 28-44, wherein the subtilisin is 100% inhibited by ImM of PMSF. (or just inhibited PMSF)
[46] The method of any one of paragraphs 28-45, wherein the subtilisin is not inhibited by E64 or EDTA.
[47] The method of any one of paragraphs 28-46, wherein the subtilisin is not stable in acid conditions.
[48] The method of any one of paragraphs 28-47, wherein the subtilisin is lyophilized.
[49] The method of any one of paragraphs 28-48, wherein the subtilisin is a recombinant protein.
[50] The method of any one of paragraphs 28-49, wherein the subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 or 33 or 34..
[51] The method of any one of paragraphs 28-50, wherein the subtilisin comprises SEQ. ID. NO: 1, 2 or 3 or 33 or 34..
[52] The method of any one of paragraphs 28-51, wherein the subtilisin consists essentially of SEQ. ID. NO: 1, 2 or 3 or 33 or 34..
[53] The method of any one of paragraphs 28-52, wherein the subtilisin is SEQ. ID. NO: 1, 2 or 3 or 33 or 34..
[54] The method of any one of paragraphs 28-53, the formulation further comprising a prolyl endopeptidase.
[55] The method of any one of paragraphs 28-54, the formulation further comprising at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ- pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
[56] The method of any one of paragraphs 28-55, the formulation further comprising at least one isolated additional glutamine endopeptidase enzyme that cleaves a peptide bond after a QPF and a PFP motif in glutens.
[57] A composition comprising (a) an isolated subtilisin enzyme derived from a Rothia sp. bacteria, and (b) a prolyl endopeptidase (PEP).
[58] The composition of paragraph 57, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, Rothia species ot 188 (strain WSA-8), Rothia aeria BAV86562.1 and Rothia
dentocariosa KGJ00122.1.
[59] The composition of 57 or 58, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa, Rothia aeria and Rothia dentocariosa.
[60] The composition of any one of claims 28-32, wherein the subtilisin has the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243
(C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins.
[61] The composition of any one of paragraphs 57-60, wherein the subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC),
ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins, (SEQ. ID. NOS: 1-3) or SEQ. ID. NOS: 33-34.
[62] The composition of any one of paragraphs 57-61, wherein the subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
[63] The composition of any one of paragraphs 57-62, wherein the subtilisin cleaves proline- containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and XI is a hydrophobic amino acid, i.e., cleaving at the peptide bond after X1; e.g. the XPQ motif, where Q is glutamine.
[64] The composition of any one of paragraphs 57-63, wherein the subtilisin cleaves succinyl- Ala-Ala-Pro-Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after proline in the P2 position.
[65] The composition of any one of paragraphs 57-64, wherein the subtilisin degrades the highly immunogenic gliadin-derived 33 -mer peptide.
[66] The composition of any one of paragraphs 57-65, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PFP- motif, wherein F= Phenylalanine=Phe; P=proline=Pro.
[67] The composition of any one of paragraphs 57-66, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PPF- motif, wherein F= Phenylalanine; P=proline.
[68] The composition of any one of paragraphs 57-67, wherein the subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes, e.g. the 33mer peptide.
[69] The composition of any one of paragraphs 57-68, wherein the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis, or a predicted molecular weight of -125 kDa as described in the Example Section.
[70] The composition of any one of paragraphs 57-69, wherein the subtilisin undergo autocatalytic activation to produce a shorter mature enzyme.
[71] The composition of any one of paragraphs 57-70, wherein the subtilisin enzyme has a functional pH range of 6.0-10.0.
[72] The composition of any one of paragraphs 57-71. wherein the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
[73] The composition of any one of paragraphs 57-72. wherein the subtilisin is 100% inhibited by ImM of PMSF. (or just inhibited PMSF)
[74] The composition of any one of paragraphs 57-73, wherein the subtilisin is not inhibited by E64 or EDTA.
[75] The composition of any one of paragraphs 57-74, wherein the subtilisin is not stable in acid conditions.
[76] The composition of any one of paragraphs 57-75. wherein the subtilisin is lyophilized.
[77] The composition of any one of paragraphs 57-76. wherein the subtilisin is a recombinant protein.
[78] The composition of any one of paragraphs 57-77, wherein the subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
[79] The composition of any one of paragraphs 57-78, wherein the subtilisin comprises SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
[80] The composition of any one of paragraphs 57-79, wherein the subtilisin consists essentially of SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
[81] The composition of any one of paragraphs 57-80. wherein the subtilisin is SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
[82] The composition of any one of paragraphs 57-81, the formulation further comprising at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z- YPQ-pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
[83] The composition of any one of paragraphs 57-82. the formulation further comprising at least one isolated additional glutamine endopeptidase enzyme that cleaves a peptide bond after a -QPF- and a -PFP- motif in glutens.
[84] The composition of any one of paragraphs 57-83, wherein the PEP is derived from the microorganism selected from the group consisting of Aspergillus niger, Flavobacterium meningosepticum, Sphingomonas capsulata, Penicillium citrinum, Hordeum vulgare, and Myxococcus xanthus.
[85] The composition of any one of paragraphs 57-84. the composition further comprising a glutamine specific protease which is selected from the group consisting of Hordeum vulgare endoprotease, Aspergillus oryzae X-Pro dipeptidase, and Aspergillus saitoi carboxypeptidase. (as described in US Patent No. 7628985, incorporated by reference in its entirety).
[86] The composition of any one of paragraphs 57-85, the composition further comprising a pharmaceutically acceptable carrier.
[87] A method for treating celiac disease or a related disorder such as gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis , the method comprising administering to a subject an effective dose of a composition comprising a subtilisin enzyme derived from a. Rothia sp. bacteria, or administering an effective dose of a composition of any one of paragraphs 57-86.
[88] The treatment method of paragraph 87, wherein the administering is performed in vitro prior to consumption of the gluten-containing food stuff.
[89] The treatment method of paragraph 87, wherein the administering is performed in vivo concurrent with or after consumption of the gluten-containing food stuff.
[90] The treatment method of paragraph 87, wherein the administering is performed in vitro prior to and also concurrent with or after consumption of the gluten-containing food stuff.
[91] The treatment method of any one of paragraphs 87-90, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, Rothia species ot 188 (strain WSA-8), Rothia aeria BAV86562.1 and Rothia dentocariosa KGJ00122.1.
[92] The treatment method of any one of paragraphs 87-91, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa, Rothia aeria and Rothia dentocariosa.
[93] The method of any one of paragraphs 28-32, wherein the subtilisin has the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243
(C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins.
[94] The treatment method of any one of paragraphs 87-93, wherein the subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins, (SEQ. ID. NOS: 1-3) or SEQ. ID. NOS: 33-34.
[95] The treatment method of any one of paragraphs 87-94, wherein the subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
[96] The treatment method of any one of paragraphs 87-95, wherein the subtilisin cleaves proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and Xi is a hydrophobic amino acid, i.e., cleaving at the peptide bond after Xi, e.g. the XPQ motif, where Q is glutamine.
[97] The treatment method of any one of claims 87-96, wherein the subtilisin cleaves succinyl-Ala-Ala-Pro-Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the second peptide bond after proline in the P2 position.
[98] The treatment method of any one of paragraphs 87-97, wherein the subtilisin degrades the highly immunogenic gliadin-derived 33 -mer peptide.
[99] The treatment method of any one of paragraphs 87-98, wherein the subtilisin does not cleave the second peptide bond after Proline in the P2 position in a tripeptide having the -PFP- motif, wherein F= Phenylalanine=Phe; P=proline=Pro.
[100] The treatment method of any one of paragraphs 87-99, wherein the subtilisin does not cleave the second peptide bond after Proline in the P2 position in a tripeptide having the -PPF- motif, wherein F= Phenylalanine; P=proline.
[101] The treatment method of any one of paragraphs 87-100, wherein the subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes, e.g. the 33mer peptide.
[102] The treatment method of any one of paragraphs 87-101, wherein the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis, or a predicted molecular weight of -125 kDa as described in the Example Section.
[103] The treatment method of any one of paragraphs 87-102, wherein the subtilisin undergoes autocatalytic activation to produce a shorter mature enzyme.
[104] The treatment method of any one of paragraphs 87-103, wherein the subtilisin enzyme has a functional pH range of 6.0-10.0.
[105] The treatment method of any one of paragraphs 87-104, wherein the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
[106] The method of any one of paragraphs 87-105, wherein the subtilisin is 100% inhibited by ImM of PMSF. (or just inhibited PMSF)
[107] The treatment method of any one of paragraphs 87-106, wherein the subtilisin is not inhibited by E64 or EDTA.
[108] The treatment method of any one of paragraphs 87-107, wherein the subtilisin is not stable in acid conditions.
[109] The treatment method of any one of paragraphs 87-108, wherein the subtilisin is lyophilized.
[110] The treatment method of any one of paragraphs 87-109, wherein the subtilisin is a recombinant protein.
[Ill] The treatment method of any one of paragraphs 87-110, wherein the subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
[112] The treatment method of any one of paragraphs 87-111, wherein the subtilisin comprises SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
[113] The treatment method of any one of paragraphs 87-112, wherein the subtilisin consists essentially of SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
[114] The treatment method of any one of paragraphs 87-113, wherein the subtilisin is SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
[115] The treatment method of any one of paragraphs 87-114, the formulation further comprising a prolyl endopeptidase.
[116] The treatment method of any one of paragraphs 87-115, the formulation further comprising an effective amount of at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ-pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
[117] The treatment method of any one of paragraphs 87-116, the formulation further comprising an isolated second additional glutamine endopeptidase enzyme that cleaves a peptide bond after a -QPF- and a -PFP- motif in glutens.
[118] The treatment method of any one of paragraphs 87-117, wherein the related disorder is selected from the group consisting of refractory celiac disease, gluten allergy, gluten intolerance, non-celiac/non-allergy wheat sensitivity due to amylase-trypsin inhibitors, and dermatitis herpetiformis.
[119] Use of a subtilisin enzyme derived from a Rothia sp. bacteria to attenuate gluten toxicity in gluten-containing food stuff or for the treatment of celiac disease or a related disorder.
[120] Use of a subtilisin enzyme derived from a Rothia sp. bacteria for the manufacture of medicament to treat of celiac disease or a related disorder.
[121] Use of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or a composition of any one of paragraphs 57-86 to attenuate gluten toxicity in gluten-containing food stuff or for the treatment of celiac disease or a related disorder.
[122] Use of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or a composition of any one of paragraphs 57-86 for the manufacture of medicament for the treatment of celiac disease or a related disorder.
[123] Use of any one of paragraphs 119-122, wherein the related disorder is selected from the group consisting of refractory celiac disease, gluten allergy, gluten intolerance, non-celiac/non- allergy wheat sensitivity due to in amylase-trypsin inhibitors, and dermatitis herpetiformis.
[124] Use of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or a composition of any one of paragraphs 57-86 to degrade amylase-trypsin inhibitors (ATIs) in gluten-containing food stuff or for the treatment of non-celiac/non-allergy wheat sensitivity due to ATIs.
[125] Use of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or a composition of any one of paragraphs 57-86 for the manufacture of medicament for the treatment of non-celiac/non-allergy wheat sensitivity due to ATIs.
[126] Use of a subtilisin enzyme derived from a Rothia sp. bacteria for the manufacture of medicament to treat non-celiac/non-allergy wheat sensitivity due to ATIs.
[127] Use of a subtilisin enzyme derived from a Rothia sp. bacteria to degrade amylase-trypsin inhibitors (ATIs) in gluten-containing food stuff or for the treatment of non-celiac/non-allergy wheat sensitivity due to ATIs.
[0380] This invention is further illustrated by the following example which should not be construed as limiting. The contents of all references cited throughout this application, as well as the figures and table are incorporated herein by reference.
[0381] Those skilled in the art will recognize, or be able to ascertain using not more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.
EXAMPLES
EXAMPLE 1 - Gluten-degrading subtilisins from Rothia mucilaginosa and Bacillus sp.
[0382] Gluten are proline and glutamine-rich proteins present in wheat, barley and rye, which contain the immunogenic sequences that drive celiac disease (CD). Rothia mucilaginosa, a harmless oral colonizer, contain enzymes that can cleave these gluten epitopes. The inventors have identified these enzymes and evaluate their potential as enzyme therapeutics.
[0383] The membrane-associated R. mucilaginosa proteins were extracted and separated by DEAE chromatography. Enzyme activities were monitored with paranitroanilide derivatized- and FRET peptide substrates, and by gliadin zymography. Epitope elimination was determined by ELISA. Gliadin- degrading enzymes were identified by LC-ESI-MS/MS.
[0384] Proteolytic degradation of protease-resistant domains in gluten require enzymatic cleavage specificities that are not readily available in the repertoire of mammalian digestive enzymes. Recent studies have revealed that the oral cavity contains microorganisms producing endoprotease(s) with cleavage specificity after a glutamine residue (Helmerhorst EJ, et al. J Biol Chem 2008;283: 19957-66). The activity was found by analyzing the sequences of salivary peptides that are naturally present in human whole saliva. The salivary peptidome contains multiple peptides derived from human salivary basic proline-rich proteins that were cleaved after the Xaa-Pro-Gln (-XPQ-) tripeptide sequence
(Helmerhorst EJ, et al., J Biol Chem 2008; 283: 19957-66; Vitorino R, et al. Prot Clin Appl 2009; 3: 528- 540; Messana I, et al. Mol Cell Proteomics 2008; 7:911-26). The structural similarity between gliadins and basic proline-rich proteins was studied to investigate if gliadins are substrates for oral microbial proteases and can be degraded into non-immunogenic peptides.
[0385] The inventors have found natural gluten degrading microorganisms are associated with the oral cavity, i.e. the very proximal GI tract, and this discovery open new avenues to neutralize the deleterious effects of gluten in patients with celiac disease.
METHODS
[0386] Bacterial culturing ~ R. mucilaginosa ATCC 25296 was routinely grown on a Brucella-agar plates (Hardy Diagnostics, Santa Maria, CA) at 37°C for 24 h under aerobic conditions. Individual bacterial colonies were transferred to 100 ml of Todd-Hewitt broth (Beckton Dickinson, Sparks, MD)
supplemented with 0.5% Tween-80 (THT), and subcultured into 4 L of THT. All incubations were carried out in Erlenmeyer flasks, while shaking at 200 rpm for 48 h at 37°C.
[0387] Preparation of a R. mucilaginosa cell extract—Cells were harvested from the 4 L THT culture by centrifugation at 16,000 x g at 4°C for 30 min, washed two times with 20 mM TrisHCl buffer, pH 7.5, and then re-suspended in 150 ml of 20 mM TrisHCl buffer containing 596 kU/ml lysozyme (Sigma, St. Louis, MO, USA). After incubation at 37°C for 1 h, 25 mg/ml n-Octyl- -D-glucopyranoside was added (Thermo Fisher, Waltham MA) as well as 0.3 mg/ml of L-cycteine. The cell suspension was frozen at - 20°C, defrosted, and then sonicated on ice using a sonifier with a macro tip (Branson sonifier 450, VWR Scientific, Bridgeport, NJ). The chemical pretreatment of the cells combined with the sonication reduced the OD62o of the suspension by 60%. The suspension was centrifuged for at 31,209 x g for 30 min at 4°C. The supernatant was harvested and centrifuged at 151,243 x g, for 1 h at 4°C. The pellet, containing most of the activity, was resuspended in 4 ml of 20 mM TrisHCl, pH 7.5. The protein concentration was determined using the bicinchoninic acid assay (Pierce Biotechnology, Rockford, IL, USA). Samples were stored at -80°C.
[0388] DEAE anion exchange chromatography—Four ml of the resuspended pellet sample was thawed, and solubilized by the addition of 40 mg/ml n-Octyl- -D-glucopyranoside. A 6 ml volume of 50 mM Tris-HCl containing 0.3 M NaCl, pH 7.0, (DEAE buffer A) was added. The 10 ml sample was then loaded onto an anion-exchange DEAE sepharose fast flow column with a column size of 2.6 cm diameter x 27 cm length with a column volume (CV) of 143 ml. The resin used was a cross-linked agarose with the diethylaminoethyl exchange group (-0-CH2CH2N+H(CH2CH3)2; GE Healthcare, Bjorkgatan, Sweden). The column was coupled to a FPLC system (AKTApurifier 10, GE Healthcare, Bjorkgatan, Sweden) and the flow rate applied was 1 ml/min. The buffers employed for protein elution were buffer A, containing 50 mM Tris-HCl, 0.3 M NaCl, pH 7.0, and buffer B, containing 50 mM Tris-HCl, 1 M NaCl, pH 7.0. Proteins were separated using a two-step gradient of 0% buffer B for 2.0 column volumes (286 ml) (isocratic conditions), followed by 100% elution buffer B for 1.5 column volume (215 ml). The absorbance was monitored at 219 nm and the eluate was collected in 10 ml fractions.
[0389] Analytical SDS-PAGE—The protein content of individual DEAE fractions (100 μΐ) and pooled DEAE fractions (400 μΐ) was determined using pre-casted discontinuous 4-12% SDS PAGE gels (NuPAGE, Thermofisher, Cambridge, MA) under reducing conditions. After electrophoresis gels were silver-stained as described (24).
[0390] Gliadin zymography—Pooled DEAE fractions F1-F7 were desalted using 30 kDa cut-off membranes and aliquots of 200 μΐ were analyzed for gluten-degrading enzyme activities on a 6% gliadin zymogram gel. The zymogram gel composition and renaturing and developing conditions were reported previously (22, 25).
[0391] PAGE and Casein zymography— The F2 fraction, containing the highest enzyme activity (hereafter called R. mucilaginosa enzyme preparation or Rmep) was applied in amounts ranging from 2- 32 μg on a 6% PAGE gel under non-reducing conditions. The composition of the gel was the same as the 6% gliadin zymogram gel, but without the incorporated gliadin. After electrophoresis the gel was divided
in half. One half of the gel was silver-stained, the other half was developed as a zymogram gel using externally added casein as the enzyme substrate, as described (24).
[0392] LC-ESI-MS/MS—Proteins of interest were excised from the silver-stained gel half, and in-gel digested with sequencing-grade trypsin (Promega, Madison, WI), as described (24). The peptides were eluted from the gel, separated by in line CI 8 chromatography and sequenced using an LTQ Orbitrap mass spectrometer (ThermoFinnigan, San Jose, CA). The obtained b- and y-ion spectra were searched against a database of R. mucilaginosa ATCC 25296, containing 1737 Rothia protein entries, and 132 non-Rothia decoy proteins.
[0393] Hydrolysis of paranitroanilide-derivatized substrates— Paranitroanilide (pNA)-derivatized tripeptide substrates were chemically synthesized at >90% purity (21st Century Biochemicals,
Marlborough, MA). The substrates obtained were Z-YPQ-pNA, Z-QQP-pNA, Z-LPY-pNA, Z-PFP-pNA, Z-PPF-pNA, where Z=benzyloxycarbonyl, Y=tyrosine, P=proline, Q=glutamine, L=leucine, and F=phenylalanine. Suc-AAPF-pNA (SEQ ID NO: 4) was obtained from Sigma, where Suc=N-succinyl and A=alanine. The peptides were dissolved in 75-100% DMSO at 10 mM, and were used at a final concentration of 200 μΜ in 50 mM TrisHCl pH 8.0. Purified Rothia enzyme or subtilisin A from
Bacillus licheniformis (Sigma) were tested at final concentrations of 1 μg/ml. Some experiments were conducted in the presence of inhibitors 4-(2-Aminoethyl) benzene sulfonyl fluoride (AEBSF), Aprotinin, E-64, EDTA, phenylmethanesulfonyl fluoride (PMSF) and Eglin C, which were tested at final concentrations of 10 mM, 0.08 mM, 0.1 mM, 1.5 mM, 1 mM, and 0.06- 1.2 μΜ, respectively. Enzymes were preincubated with the inhibitors for 20 min before adding Suc-AAPF-pNA (SEQ ID NO: 4).
Substrate hydrolysis was monitored for 10 h at 405 nm using a Genios microtiter plate reader (Tecan, Mannedorf, Switzerland) in the kinetic mode at 37°C.
[0394] FRET substrate hydrolysis—Three fluorescence resonance energy transfer (FRET) substrates comprising the hexapeptides QPQLPY (SEQ ID NO: 22), PQPQPQ (SEQ ID NO: 23) and QGSFQP (SEQ ID NO: 24) were synthesized with at the N-terminus the HiLyte FluorTM 488 label, and at the C- terminus with K(QXL520) (Anaspec, Fremont, CA). Rmep ( 1 μg/ml) and subtilisin A (0.5 μg/ml) were incubated with the substrates (100 μΜ) in 50 mM TrisHCl pH 8.0. Samples were incubated at 37°C and fluorescence increase, indicating hydrolysis, was measured every 5 min for 30 min, and every 10 min for the next 30 min, at λεχ 485 nm and e 520 nm, using a Genios microtiter plate reader in the kinetic mode.
[0395] Degradation of mixed gliadins and the 33-mer peptide—Mixed gliadins were obtained from Sigma. A synthetic highly immunogenic a-gliadin derived 33-mer peptide (26) was synthesized at a purity of >90% (21st Century Biochemicals). Mixed gliadins or the 33-mer peptide (each at final concentration 250 μg/ml) were incubated with Rmep or subtilisin A (each at 57 μg/ml) in 50 mM
TrisHCl, pH 8.0. After t=0, 15 min, 30 min, and 2 h, 100 μΐ sample aliquots were removed and boiled. Gliadin degradation was assessed by 4-12% SDS-PAGE followed by Coomassie staining, and 33-mer degradation was determined by RP-HPLC.
[0396] Reversed-phase high performance liquid chromatography (RP-HPLC)—Separation of the 33-mer peptide and its fragments was achieved by RP-HPLC, using buffer A (0.1% trifluoroacetic acid) and buffer B (0.1% trifluoroacetic acid in 80% acetonitrile) at a gradient of 0-55% buffer B over 75 min time interval. The equipment used was an HPLC Model 715 (Gilson, Middleton, WI) and a C-18 column (TSK-GEL 5 mm, ODS-120T, TOSOHaas, Montgomeryville, PA) (22, 25).
[0397] R5 and G12 ELISA assays—Gluten epitope elimination in the gliadin-Rmep and gliadin- subtilisin A digests was assessed using two sandwich ELISA assays employing the R5 monoclonal antibody (RIDASCREEN Gliadin, R-Biopharm, Darmstadt, Germany) or the G12 monoclonal antibody (AgraQuant® ELISA Gluten G12, Romer labs, Union, MO). To prevent high background values, the R5 plate wells were blocked with 1% skim milk in PBS prior to incubation with the samples. The assays were performed according to the manufacturers' instructions and as described (21, 24).
RESULTS
[0398] Purification of the enzyme from Rothia mucilaginosa— The inventors observed that the gluten-degrading enzyme activity of R. mucilaginosa was primarily cell associated. Therefore, to isolate the enzyme(s), cells were treated with lysozyme, an N-acetylmuramidase to break down the
peptidoglycan layer, and then sonicated and centrifuged. The supernatant, which was turbid and contained microscopic vesicles, was ultracentrifuged. Enzyme activities, monitored with the substrate Z- YPQ-pNA, were primarily localized in the (vesicular) pellet. It was dissolved to clarity with the mild detergent n-Octyl- -D-glucopyranoside and then subjected to DEAE chromatography applying an isocratic gradient. Figure 1A shows the DEAE chromatogram, Figure IB the protein content in fraction aliquots analyzed by SDS-PAGE, and Figure 1C the enzyme activity, determined with Z-YPQ-pNA. Most activity was contained in fractions 7 and 8 with some activity trailing in fractions 9-14. Fractions 7 and 8 contained proteins migrating between 75 and 150 kDa. Based on protein patterns and enzyme activities the fractions were pooled into seven fractions as follows: Fl : fractions 1-5, F2: fractions 6-8, F3, fractions 9-12, F4, fractions 13-20, F5, fractions 21-52, F6, fractions 53-56 and F7: fractions 57-65.
[0399] The protein composition in F1-F7 is shown in Figure 2A. F2, containing the enzyme activity and hereafter called R. mucilaginosa enzyme preparation (Rmep), displayed a major band between 100-150 kDa, and a double band between 75 and 100 kDa. Gliadin zymography of F1-F7 showed evidence for a double enzyme band in F2 of -75-80 kDa (Figure 2B). As expected, the highest specific activity was associated with F2 (not shown). Rmep was subsequently analyzed at 4 different concentrations on a 6% SDS gel under non-reducing conditions. After electrophoresis half of the gel was silver stained (Figure 2C) and the other half was developed as a zymogram with externally added casein as the substrate (Figure 2D). This permitted a true comparison in electrophoretic mobilities of proteins in both gel halves. Enzyme activities were again associated with the -75-80 kDa double band, and not with the also prominent -125 kDa band. Several bands were excised from the SDS- and the zymogram gel for protein identification by LC-ESI-MS/MS. The inactive 125 kDa band was labeled as band a, the active -80 kDa band as b/d and the active -75 kDa band as c/e. The major proteins identified in bands a-e were
ROTMU0001_0241 (WP 044143864.1; C6R5V9_9MICC), ROTMU0001_0243 (WP 044143865.1;
C6R5W1_9MICC) and ROTMU0001_0240 (WP_005509166.1; C6R5V8_9MICC) (Figure 2E). Their relative abundances in the respective bands, determined at the MS I level, are indicated. It shows that the -125 kDa band contains a mixture of primarily C6R5V9_9MICC and C6R5W1_9MICC, in a 32%/67% ratio. The -80 kDa protein is a fragment of C6R5V9 9MICC, and the -75 kDa band is derived from C6R5W1_9MICC. As a control, three other bands were excised from the gel shown in Figure IB
(fraction 13, lowest band, and fraction 14 two middle bands), yielding identifications other than subtilisin enzymes (data not shown).
[0400] The amino acid sequences of the identified subtilisins ROTMU0001 0241, ROTMU0001 0243 and ROTMU0001_0240 are described in the Section on subtilisins and subtilisin-like enzymes. They are classified as WP_044143864.1 peptidase S8, WP_044143865.1 peptidase S8, and WP_005509166.1 peptidase S8 respectively. A blast search revealed that all are members of the S8 peptidase family, which share a conserved catalytic triad comprising Asp (D), His (H) and Ser (S) in the catalytic domain of the enzyme. The signal peptide cleavage sites as well as the catalytic triads are indicated. The protein sequences of all subtilisin genes in the three known members of the Rothia genus, Rothia aeria, Rothia mucilaginosa and Rothia dentocariosa were aligned using Clustal Omega (Figure 10). The three variants identified by LC-ESI-MS/MS are highlighted. A phylogenetic tree was drawn using Clustal Omega, showing evidence for 8-9 different Rothia subtilisin sequence types based on sequence conservation around the catalytic residues D, H and S (Figure 11). It shows that the three identified subtilisis belong to different sub groups.
[0401] Enzymatic characteristics of Rmep—Rmep was further tested for enzyme activities and specificities relevant for CD. The enzyme was active over a pH range of 6.0-10.0, with low or negligible activities at pH values lower than 5.0 or higher than 11.0 (Figure 3A). Activity was inhibited effectively by PMSF and AEBSF (serine protease inhibitors), with partial inhibition by aprotinin, but not by E64 (cysteine protease inhibitor) or EDTA (metalloprotease inhibitor) (Figure 3B). These findings are consistent with the characteristics of subtilisins, which are of the serine proteases type. Rmep was only partly inhibited by high concentrations of Eglin C, an effective inhibitor of B. licheniformis subtilisin A (Figure 3C, Figure 3D).
[0402] In order to compare the gliadin-relevant substrate specificities of Rmep and subtilisin A in more detail, hydrolysis of Z-YPQ-pNA, Z-QQP-pNA, Z-LPY-pNA, Z-PFP-pNA, Z-PPF-pNA and Suc-AAPF- pNA (SEQ ID NO: 4) was monitored. The tripeptides are all contained with high frequency in the immunogenic gliadin domains, and Suc-AAPF-pNA (SEQ ID NO: 4) is a typical substrate for subtilisins. Z-QQP-pNA and Z-PFP-pNA were not hydrolyzed (data not shown), while substrates with a P residue in the P2 position were cleaved, albeit at quite different rates; Suc-AAPF-pNA (SEQ ID NO: 4) was cleaved most rapidly (Figure 4A, Figure 4B), followed by Z-YPQ-pNA. The rapid hydrolysis of Suc- AAPF-pNA (SEQ ID NO: 4) by Rmep further points to subtilisin-like enzyme activity in this preparation. LPY hydrolysis could be demonstrated at five -fold increased enzyme concentrations and longer incubation times (Figure 4C). PPF was hydrolyzed by subtilisin A at fifty-fold increased enzyme concentrations, but not by Rmep (data not shown).
[0403] Activities were also determined towards three gliadin-derived FRET substrates (Figure 4D, 4E). The substrates were QPQLPY (SEQ ID NO: 22), contained in three immunogenic gliadin epitopes;
PQPQPQ (SEQ ID NO: 23), a theoretical substrate for Rothia enzymes, and QGSFQP (SEQ ID NO: 24), contained in two gliadin epitopes. The first two peptides, containing XPX motifs, were rapidly hydrolyzed by Rmep (Figure 4D). In contrast, QGSFQP, not containing XPX, was not cleaved. Subtilin A showed the highest activity towards the PQPQPQ substrate (Figure 4E).
[0404] Elimination of immunogenic epitopes by Rmep—Hydrolysis of the FRET substrates would suggest CD-relevant epitope degradation. To further investigate this, the time courses of degradation of mixed gliadins and the highly immunogenic 33-mer a-gliadin peptide were determined. Furthermore, epitope elimination was monitored by two ELISA assays employing the R5 antibody recognizing QQPFP (SEQ ID NO: 40) and related pentapeptides (27, 28) and the G12 antibody recognizing QPQLPY (SEQ ID NO: 22) contained in the 33-mer peptide (29, 30). Data obtained with Rmep are shown in Figure 5, and with subtilisin A in Figure 6.
[0405] Rmep rapidly degraded mixed gliadins within 15 min incubation and completed 33-mer peptide degradation within 30 min of incubation (Figure 5A and 5B, respectively). R5 epitope abolishment in the Rmep digest of gliadins could already be observed in the t=0 sample (46% reduction in antibody binding compared to the control, corrected for enzyme only values). After 15 min virtually all R5 epitopes were eliminated (Figure 5C). After 30 min the G12 antibody binding had decreased by 65% and showed a time-dependent decline to 85% reduction after 2 h of incubation (Figure 5D). Subtilisin A degraded gliadins even faster, with near complete degradation in the t=0 sample (Figure 6A). However, the 33-mer peptide was not as efficiently cleaved, and after 2 h of incubation residual 33-mer still remained (74% degradation; Figure 6B). The R5 epitopes in the gliadin-subtilisin A digest were rapidly eliminated, by 90% at t=0, and by 100% within 15 min of incubation (Figure 6C). In contrast, the G12 epitopes were quite resistant to subtilisin A, and were degraded by 22% at t=0 and 45% at 2 h (Figure 6D). This agrees with the modest activity towards the 33-mer.
[0406] The gluten-degrading enzymes of Rothia were identified as members of the subtilisin protease family, and the gluten-degrading activities of this class of enzymes were shown to extend beyond the Rothia genus. The cleavage specificity of subtilisins is XPX^ with X in the PI position preferably being a hydrophobic amino acid. In accordance, substrates with Q in the PI position were found to be highly susceptible to cleavage by Rmep and subtilisin A. XPQ is present in the majority of the antigenic gluten epitopes relevant in CD (31). A subset of such Q residues in gliadins are deamidated by the enzyme tissue transglutaminase 2 (TG2) in the patients' lamina propria, a key step in the pathogenesis of CD (32). This deamidation of increases the peptides' affinity for HLA-DQ2 and HLA-DQ8 expressed on antigen- presenting cells and triggers the destructive mucosal T cell response. Glutamine residues in the XPQXP context are particularly prone to such deamidation (33, 34). Selective cleavage after Q in this context will prevent this T cell activation. Based on the here reported cleavage preferences of Rothia and Bacillus subtilisins, they can both be considered efficient enzymes for degradation of these major gluten epitopes
before they reach the lamina propria. This is further supported by the elimination of major gluten epitopes in the two independent ELISA assays.
[0407] The three major Rothia species are R. aeria, R. mucilaginosa and R. dentocariosa. Analysis of the gluten degrading Rothia enzymes showed that they belong to the D-H-S class of subtilisins (35, 36) and not to the family of kexins (an S8 protease sub -family). All contain a signal peptide for secretion, which is presumably cleaved off as most contain the consensus sequence AxA|A which is recognized by a signal peptidase. Using NCBI BlastP (or InterPro) analysis it was found that none of the sequences contain a C-terminal LPxTG-type peptidoglycan anchor ("LPxTG" disclosed as SEQ ID NO: 41), a motif that is typically preceded by a transmembrane sequence of hydrophobic residues, followed by several positively charged residues (R,K) at the very end of the protein sequence. However, most Rothia subtilisins did contain two to three C-terminal SLH (surface layer homology) domains, called
Pfam00395(37). Such bacterial SLH domain proteins are non-covalently anchored to the cell surface via a conserved mechanism involving cell wall polysaccharide pyruvylation. The theoretical cell-envelope association agrees with our finding that Rothia subtilisins could be isolated from cell-derived vesicles that could be harvested by ultracentrifugation.
[0408] The mass spectrometric identification of subtilisins prompted the exploration of other subtilisins from other microbes, specifically Bacillus species, for activity, and they were here identified also to degrade gluten. Like Rmep, subtilisin A indeed degraded gluten with similar efficacy. Like Rothia, the Bacillus genomes encodes for several extracellular subtilisins. In general, bacteria that express multiple extracellular proteases reside in a protein-rich environment, and use proteases to degrade proteins into peptides that can subsequently be utilized for growth. This is the case for the natural habitat of Rothia species, the oral cavity, where XPQ-containing substrates are prevalent. The XPQ-rich proteins are not only represented by the ingested gluten proteins, but also by salivary proline-rich proteins that are produced constitutively by the salivary glands (38-41). In this context it is of interest to note that both B. subtilis and Rothia colonize the oral cavity ( 42) and that the salivary basic proline-rich proteins undergo extensive proteolytic fragmentation, with primary cleavage after XPQ^ (43-45). Based on our data, these cleavages are carried out most likely by the identified oral bacterial subtilisins.
[0409] Some interesting observations were made when the substrate specificities of subtilisin A and Rmep were compared. First, both enzymes cleaved AAPF (SEQ ID NO: 4) rapidly, but not PPF. This indicates that a Pro in the P3 position interferes with substrate recognition by both enzymes. In most gluten immunogenic domains containing the XPF sequence, X is represented by a Q, and not a P.
Accordingly, the FRET results indicate that QPF is efficiently cleaved. Also abundant in gliadin immunogenic domains is LPY, which is cleaved, albeit at lower efficiency. The relative inefficiency of subtilisin A towards the 33-mer peptide, rich in XPQ and LPY, is not easily explained, other than e.g. by allosteric inhibitory effects of certain degradation fragments on the enzyme itself. However, Rmep cleaved this epitope very efficiently.
[0410] There were two observations in the subtilisin identification made in Rmep. First, Rmep was significantly less sensitive to the inhibitory effect of Eglin C than subtilisin A. This difference in
sensitivity between both enzymes can best be explained by the significant structural differences between Rmep and subtilisin A in domains flanking their active sites. Secondly, the molecular weight of the subtilisins identified in the -75-80 kDa gel bands did not match their predicted molecular weight (-125 kDa). Given that the catalytic triad is located at the N-terminal portion of the protein, we postulate that the parent inactive precursor proteins C6R5V9_9MICC and C6R5W1_9MICC are processed at the N- termini to remove the inhibitory propeptide, and at the C-terminus between the Ig-like segment and SLH domains, generating the -75 and -80 kDa mature enzymes, as outlined in Figure 7. It is well known that subtilisins from Bacillus species undergo autocatalytic activation to produce a shorter mature enzyme (46). Further structural analysis should reveal the exact primary, secondary and tertiary structures of active Rothia subtilisins.
[0411] B. subtilis is food safe and has been consumed for decades, e.g. in a product called natto, a Japanese fermented soy bean dish. In natto the active enzyme is nattokinase, a 27.7 kDa subtilisin enzyme (subtilisin NAT or NattoK) (47). It is available in pure form as a dietary supplement. Like Rmep (Figure 8A) NattoK degraded gliadins effectively (Figure 8A, Figure 8B), hydrolyzed Z-AAPF-pNA (SEQ ID NO: 4) (Figure 8C), and degraded the 33-mer peptide (Figure 8D), although a large fragment eluting just prior to the 33-mer in the RP-HPLC chromatogram remained. It abolished the R5 epitopes (Figure 8E), but not the G12 epitopes (Figure 8F). Despite a long history of consumption of B. subtilis and its products, there are very few reports of adverse events. The natto dish is believed to promote a healthy gut flora and to facilitate the uptake of vitamin K2. Apart from uses as dietary food and feed additives/supplements, subtilisins are being used in detergents and household cleaning products. Overall, the food-grade status of B. subtilis and its already widely consumed products including nattokinase suggest readily available options for CD patients to achieve improved immunogenic gluten removal in vivo. Importantly, the R. mucilaginosa subtilisins have superior epitope -detoxifying capacities compared to Bacillus subtilisins, and thus can be considered highly promising future food additives for this purpose. A potential shortcoming of subtilisins is their relatively low activity at acidic pH, which would reduce efficacy during gastric transit. This can be addressed by focusing future efforts on the R. aeria subtilisins, which are active at more acidic pH values as low as 3.0 (22). Furthermore, with molecular approaches further improvement of activity of subtilisins at low pH can be anticipated.
EXAMPLE 2 - Gluten-degrahing subtilisin from Rothia aeria
[0412] With the genomic sequence information of R. aeria becoming available, the inventors were able to identify additional gluten-degrading, subtilisin and subtilisin-like enzymes from R.aeria based on the results obtained from Rothia mucilaginosa and Bacillus species in Example 1. The enzyme was found to be a member of the subtilisin family and is encoded by BAV86562.1. The R aeria enzyme is
substantially different from the previously isolated R. mucilaginosa enzymes (WP_044143864.1 and WP_044143865.1). However, much larger differences were observed when the Rothia-encoded subtilisins were aligned with two Bacillus-encoded subtilisins (P00780.1 and P35835.1) (Figure 14). Analysis of the catalytic region of these enzymes show conserved amino acid sequences (named regions 1-3) and regions that were present only in the Rothia subtilisins (regions 4-7). A blast search with
sequence of region 6, HGTHVAGTAAGYGV, (SEQ ID NO: 42) identified Rothia-like subtilisins in a number of other microbial species. Given that Rothia, but not Bacilllus subtilisins can cleave the immunogenic gliadin-derived G12 epitope (QPQLPY, (SEQ ID NO: 22)), it is speculated that one or more of the regions 4-7 is necessary to confer specificity towards the G12 epitope.
METHODS
[0413] Cultivation of Rothia aeria— Rothia aeria strain WSA-8 1 has been deposited as strain HM-818 to the BEI resources (beiresources.org) and has been sequenced. It is equivalent to R. aeria Oral Taxon 188, strain F0474 (HMP ID 1324). To identify the gluten-degrading enzyme(s) produced by R. aeria, the bacteria were cultured on Brucella agar plates (Hardy Diagnostics, Santa Maria, CA) at 37°C for 48 h under aerobic conditions. The cells were harvested from plate with a cotton swab and suspended in sterile PBS to an OD62o 5.0. Four aliquots of 1.5 ml of the suspension were centrifuged and the supernatants were removed.
[0414] SDS-PAGE and casein zymography~The four cell pellets were resuspended each in 200 μΐ zymogram sample buffer 1. To separate the proteins, the samples were applied to a non-reducing (no DTT or β-mercaptoethanol-containing) 6% SDS-PAGE gel of 16 cm x 20 cm x 0.15 cm, using a protean II xi cell system (Bio-Rad, Hercules, CA). The composition of this gel was the same as that of previously published 6% gliadin zymogram gels but without incorporation of gliadin 1. After electrophoresis at a constant voltage of 120V at 4°C, the gel was divided in two halves ("A-gel" and "B-gel"). One-half ("A- gel") was stained with 0.1% Coomassie Brilliant Blue in 40% (v/v) methanol/10% (v/v) acetic acid. The other half ("B-gel") was developed as a zymogram gel 3. (See Figure 12A and 12B). For this, the B-gel was washed twice for 30 min in buffer containing 2.5% Triton X-100 (renaturing buffer; Life
Technologies, Carlsbad, CA), followed by washing twice for 1 h in buffer containing 20 mM Tris-HCl, pH 7.5 (developing buffer; Life Technologies, Carlsbad, CA). The B-gel was then incubated in developing buffer supplemented with 1% casein (Sigma, St. Louis, MO) at 37°C for 1.5 h. After washing with water for 2 min, the B-gel was stained with 0.1% (w/v) Coomassie Brilliant Blue in 40% (v/v) methanol/10% (v/v) acetic acid for 24 h. Both the A-gel and B-gel were destained in 40% (v/v) methanol/10% (v/v) acetic acid until optimal contrast was achieved.
[0415] LC-ESI-MS/MS—The A-gel and B-gel halves were aligned, and the protein displaying enzyme activity in the B-gel was excised from the duplicate lanes, and the matching band in the A-gel was also excised in duplo. The proteins were digested in-gel with sequencing-grade trypsin, and the peptides were eluted and separated by in line C18 chromatography. The amino acid sequences of the peptide ions were obtained with an LTQ Orbitrap mass spectrometer (ThermoFinnigan, San Jose, CA). The b- and y-ion spectra were searched against a database of R. aeria F0474, supplemented with decoy proteins as well as the 46 Rothia subtilisin genes shown in Figure 10. The filter settings selected were X-corr values > 2.2 and 3.5 for Z = 2, and 3, respectively. The deltaCn and peptide probability settings were >0.1 and <0.01, resp., as previously applied 3.
[0416] Database searches— The amino acid sequences of subtilisins WP 044143865.1 (R.
mucilaginosa), WP_044143864.1 (R. mucilaginosa), BAV&6562. \ (R. aeria), P00780.1 (subtilisin A; B.
licheniformis) and P35835.1 (nattokinase; B. subtilis NAT) were aligned using the aligner tool at the website justbio. Region 6 (HGTHVAGTAAGYGV, (SEQ ID NO: 42)) was blast-searched using the "blastp" suite at the website of the National Center for Biotechnology Information (NCBI) at world wide web site. The default settings were used, except for an increased threshold value of 1,000. Searches were conducted against the non-redundant protein sequences database with "subtilisin" in the entrez query. RESULTS
[0417] The sequences of Bacillus licheniformis subtilisin A (P00780.1) and B. subtilis NAT nattokinase (P35835.1) are shown in Figure 13.
[0418] The strategy for identifying the gluten-degrading enzyme from R. aeria was to use a large SDS gel (16 x 20 cm) instead of a mini SDS gel (8 x 8 cm) to achieve better protein separation. A low percentage gel (6%) facilitated separation of proteins with molecular weights >50 kDa.
[0419] The gel results are shown in Figure 12A and 12B. The zymogram gel part (Figure 12B) gave evidence for a single enzyme band with an apparent molecular weight of around -78 kDa, and the matching gel in Figure 12A showed a major band migrating at the same position. Four bands in total were excised and subjected to mass spectrometric analysis. The most prominent protein, identified with high confidence in all four gel bands, was peptidase S8, KGJ00122.1. The sequence is also shown in Figure 10, line 27. It is a subtilisin from R. dentocariosa, represented by 33, 41, 32 and 30 unique peptides respectively. Since the loaded bacteria was R. aeria and not R. dentocariosa, this indicated that the subtilisin protein from R. aeria protein was highly homologous to KGJ00122.1. A blast search of KGJ00122.1 revealed that it is 99% homologous to a R. aeria protein annotated as glycerol-3P-ABC transporter on NCBI (BAV86562.1). Sequence analysis of BAV86562.1 revealed that it is an enzyme, and that it belongs to the subtilisin family of proteases. The amino acid sequence is shown in this disclosure, and in the amino acid section in bold is the cd07474 domain, representing the Peptidase S8 family domain. The D, S and H amino acids of the catalytic triad are underlined. Alignment of
KGJ00122.1 (from R. dentocariosa) and BAV86562.1 (from R. aeria) showed very few differences, as expected (Figure 13). The natural expression level of BAV86562.1 in R. aeria is high (Figure 12A). Furthermore, the enzyme retains activity at pH values as low as 3.01, indicating that it may be active under gastric pH conditions.
[0420] To probe for structural similarities among the subtilisins identified in Rothia and Bacillus species, the amino acid sequences of WP_044143865.1 (R. mucilaginosa), WP_044143864.1 (R. mucilaginosa), BAV86562.1 (R. aeria), P00780.1 (subtilisin A; B. licheniformis) and P35835.1 (nattokinase; B. subtilis NAT) were aligned (Figure 14). Major differences in the enzyme lengths and overall sequences were observed, consistent with earlier subtilisin comparisons 4' 5. Domains comprising the catalytic triad residues D, H and S (underlined) however were conserved. Both Bacillus and Rothia subtilisins hydrolyze the immunogenic R5 gluten epitope 3' 6' 7. Since Rothia subtilisins but not the Bacillus subtilisins efficiently cleave the immunogenic G12 gluten epitope 3'8, the inventors looked for subtle differences in the substrate binding regions that could explain such difference in substrate specificity. Several differences were observed just before or after the conserved regions 1-3 that distinguished
Rothia subtilisins from the Bacillus subtilisins. These were designated regions 4-7. It is proposed that regions 1-3 are necessary for R5 epitope elimination, and that one or more of the regions 4-7 are necessary to confer specificity towards the G12 epitope. Subsequent searches with region 6
(HGTHVAGTAAGYGV, (SEQ ID NO: 42)) in the non-redundant (all emcompassing) limited to subtilisins identified Rothia-like peptidase S8 enzymes in Cellulomonas, Curtobacterium, Sanguibacter, Arthrobacter, Kitasatospora, Prauserella, Streptomyces, Pseudoglutamicibacter, Actinosynema, and Modestobacter genera, but not in Bacillus. It is predicted that these species produce enzymes that can cleave gluten, including the G12 epitope.
EXAMPLE 3 - Degradation of cereal amylase-trypsin inhibitors (ATIs) by gluten-degrahing subtilisin from Rothia sp.
[0421] Non-celiac/non-allergy wheat sensitivity (NCWS) has an estimated prevalence of 5-10% in wheat (cereal) consuming populations 1 3. NCWS is characterized by intestinal and extra-intestinal symptoms related to the consumption of gluten-containing foods that are also enriched in amylase-trypsin inhibitors (ATIs)2. The diagnosis is made after CD and wheat allergy have been excluded and if the patients display typical symptoms and complaints within hours to days after consumption of ATI- containing cereals, mainly wheat, and remission of these symptoms within a few hours to days after stopping their consumption 1. The wheat components responsible for the initiation of an innate immune responses to wheat and related cereals in NCWS have been identified as ATIs4. Wheat ATIs are a family of disulfide-linked and protease resistant proteins that occur as monomers, dimers and tetramers with molecular weights ranging from 12-60 kDa. ATIs bind to and activate the TLR4-MD2-CD14 complex on mainly myeloid cells (dendritic cells, macrophages, monocytes), ultimately resulting in the release of proinflammatory innate cytokines 3' 4.
[0422] Rothia and Bacillus -derived subtilisins can cleave gluten proteins, with an apparent specificity after XPQ l 5. XPX sequences and other sequences cleavable by subtilisins are also present in ATIs. Like gluten, ATIs are highly resistant to degradation by mammalian digestive enzymes 3. A dietary enzyme that could eliminate immunotoxicity of both gluten and ATIs would clearly be beneficial for the treatment of the spectrum of wheat (cereal)-associated gastrointestinal disorders comprising CD and NCWS. Therefore, we investigated if the Bacillus and Rothia-derived subtilisins can degrade ATIs.
METHODS
[0423] ATIs were isolated from wheat cultivars as described3. They were incubated at a final concentration of 500 μg/ml with 10, 25 or 50 μg/ml Rmep (from R. mucilaginosa), or nattokinase (from B. subtilis). The controls incubations were carried out with heat-inactivated Rmep and nattokinase.
Experiments were conducted in 50 mM Tris-HCl, pH 8.0. After 0, 15 min, 30 min, lh, and 4h incubation, 20 μΐ aliquots were removed, mixed with SDS-sample buffer, heated at 85°C for 5 min and analyzed by 4-12% SDS PAGE. Proteins were visualized with Coomassie Blue staining.
RESULTS
[0424] The wheat ATI proteins, migrating at -15 kDa, were resistant to degradation by Rmep (Figure 15A). Protease activity in the Rmep preparation was confirmed with gliadin as the substrate (Figure 15B).
While the gliadins were degraded, the ATI contaminant in the gliadin preparation was not, consistent with the observations made with the purified ATIs (indicated with an arrow). On the other hand, ATIs were susceptible to proteolysis by nattokinase. Approximately 50% of the ATIs (500 μg/ml) were degraded after lh incubation with 50 μg/ml nattokinase, or after 4h incubation with 10 μg/ml nattokinase (Figure 15C). As expected, nattokinase also rapidly degraded gliadins (Figure 15D). ATIs were stable when incubated with heat-inactivated Rmep or nattokinase (Figures 15E and 15F). The results show that nattokinase is unique in being able to cleave ATIs and potentially to abolish their pro-inflammatory properties implicated in NCWS.
EXAMPLE 4 - Preparation of non-viable bacteria composition having gluten degrading activity METHODS
[0425] Bacterial strains- Two gluten-degrading P. aeruginosa strains (FA- 10 and FA- 13) were isolated from human feces, which is described herein. The isolation and characterization of gluten-degrading Rothia mucilaginosa and R. aeria (WSA-8) from human saliva samples has been described herein. The R. mucilaginosa strain used in the present study was obtained from the American Type Culture Collection (ATCC strain 25296).
[0426] Bacteria cell inactivation- The two P. aeruginosa isolates, R. mucilaginosa and R. aeria strains were cultured aerobically on Brucella agar plates (Hardy Diagnostics, Santa Monica, CA) at 37°C. After 48 h incubation, cells were harvested with a sterile cotton swab and diluted to an OD62o of 1.2 in either 1 ml of 70% ethanol (EtOH) or in 1 ml of saliva ion buffer (SIB, control) containing 50 mM KC1, 1.5 mM potassium phosphate, 1 mM CaC^ and 0.1 mM MgC^, pH 7.0. Suspensions were incubated for 30 min at 37°C after which 5 μΐ aliquots were plated in triplicate on Brucella agar to assess cell viability. The residual 995 μΐ aliquots were lyophilized to dryness using a SpeedVac (Thermo Fisher). The lyophilized bacteria that had been incubated in 70% ethanol were reconstituted in 1 ml sterile SIB, and the bacteria that had been incubated in SIB (control) were reconstituted in deionized sterile water, yielding the same final ion composition in both samples. Enzyme activities in the reconstituted suspensions were assessed by gliadin zymography and by determining the hydrolysis of tripeptide substrates.
[0427] Gliadin zymography-Gliadin zymogram gels (6%) were prepared with mixed gliadin from wheat (Sigma, St. Louis, MO) as the gel incorporated substrate, as previously described6. The reconstituted EtOH-treated and control cells, each suspended in SIB OD62o 1.2, were harvested by centrifugation. The aliquots centrifuged were 625 μΐ for each of the Rothia strains, and 208 μΐ for the P. aeruginosa strains. The peletted cells were resuspended in 40 μΐ non-denaturing zymogram sample buffer and loaded onto the zymogram gel. Electrophoresis was carried out at 100 V at 4°C, and gels were renatured and developed in zymogram renaturing and developing buffers (InVitrogen, Carlsbad, CA, USA) according to the manufacturer's instructions. After 48 h of development at 37°C, gels were stained with 0.1% Coomassie Brilliant blue in a mixture of 40% methanol/10% acetic acid, and destained until the contrast between clear bands and background was optimal.
[0428] Synthetic tripeptide substrates hydrolysis-Aliquots of 200 μΐ reconstituted ethanol-treated and untreated P. aeruginosa cells in SIB (OD 1.2) were mixed with benzyloxycarbonyl-Leu-Pro-Tyr-
paranitroanilide (Z-LPY-pNA) and aliquots 200 μΐ aliquots of the Rothia strains were mixed with Z-Tyr- Pro-Gln-pNA (Z-YPQ-pNA) (21st Century Biochemicals, Marlborough, MA). The final concentration of the tripeptide substrates was 200 μΜ. All experiments were performed in triplicate. Substrate hydrolysis was monitored spectrophotometrically at 405 nm, using a Genios microtiterplate reader (Tecan Group Ltd., Mannedorf, Switzerland) and Deltasoft software, with the equipment temperature set at 37°C. Readings were performed in the kinetic mode at the indicated time intervals.
RESULTS
[0429] Effect of cell killing on enzymatic activity ~ The bactericidal treatment of choice was 70% ethanol since it can be removed by lyophilization after treatment. Aliquots plated in triplicate of the treated cells showed complete loss of cell viability as expected whereas the untreated cells were viable (Figure 16A). Enzyme activities in the treated and untreated cell suspensions were evaluated qualitatively by zymography (Figure 16B), and quantitatively with the tripeptide substrate Z-LPY-pNA or Z-YPQ- pNA (Figure 16C). The maximum rates of Z-LPY-pNA and Z-YPQ-pNA hydrolysis are depicted in Figure 16D. Results show that gliadin-degrading enzyme activities were unaffected by ethanol treatment, as evidenced from clear bands in the gliadin zymogram gels (Figure 16B). From the rates of tripeptide hydrolysis depicted in Figures 16C and 61D it could be calculated that <10% enzyme activity was lost after 70% ethanol treatment. The results show that the added ethanol could be fully eliminated by lyophilization after treatment, yielding an active enzyme preparation that was unadulterated with respect to the starting material, apart from being devoid of life cells.
REFERENCES for Example 1
1. Abadie V, et al. Integration of genetic and immunological insights into a model of celiac disease pathogenesis. Annu Rev Immunol 2011; 29:493-525.
2. Schuppan D, et al. Celiac disease: from pathogenesis to novel therapies. Gastroenterology
2009;137: 1912-33.
3. Abadie V, et al. Intraepithelial lymphocytes in celiac disease immunopathology. Semin
Immunopathol 2012;34:551-66.
4. Shah S, et al. Patient perception of treatment burden is high in celiac disease compared with other common conditions. Am J Gastroenterol 2014; 109: 1304-11.
5. Norsa L, et al. Gluten-free diet or alternative therapy: a survey on what parents of celiac children want. Int J Food Sci Nutr 2015;66:590-4.
6. Rubio-Tapia et al. ACG clinical guidelines: diagnosis and management of celiac disease. Am J Gastroenterol 2013; 108:656-76; quiz 677.
7. Sollid LM, and Khosla C. Novel therapies for coeliac disease. J Intern Med 2011;269:604-13.
8. Kaukinen K, and Lindfors K. Novel treatments for celiac disease: glutenases and beyond. Dig Dis 2015;33:277-81.
9. Lahdeaho ML, et al. The Glutenase ALV003 Attenuates Gluten-Induced Mucosal Injury in Patients with Celiac Disease. Gastroenterology 2014.
10. Bethune MT, and Khosla C. Oral enzyme therapy for celiac sprue. Methods Enzymol 2012;502:241-71.
11. Siegel M, et al. Rational design of combination enzyme therapy for celiac sprue. Chem Biol 2006;13:649-58.
12. Stepniak D, et al. Highly efficient gluten degradation with a newly identified prolyl endoprotease: implications for celiac disease. Am J Physiol Gastrointest Liver Physiol 2006;291 :G621-9.
13. Tack GJ, et al. Consumption of gluten with gluten-degrading enzyme by celiac patients: a pilot- study. World J Gastroenterol 2013; 19:5837-47.
14. Siegel M, et al. Safety, tolerability, and activity of ALV003: results from two phase 1 single, escalating-dose clinical trials. Dig Dis Sci 2012;57:440-50.
15. Freitag TL, et al. Testing safety of germinated rye sourdough in a celiac disease model based on the adoptive transfer of prolamin-primed memory T cells into lymphopenic mice. Am J Physiol Gastrointest Liver Physiol 2014;306:G526-34.
16. Lindfors K, et al. Live probiotic Bifidobacterium lactis bacteria inhibit the toxic effects induced by wheat gliadin in epithelial cell culture. Clin Exp Immunol 2008; 152:552-8.
17. Pvollan G, et al. Proteolytic activity and reduction of gliadin-like fractions by sourdough lactobacilli. J Appl Microbiol 2005;99: 1495-502.
18. Caminero A, et al. Diversity of the cultivable human gut microbiome involved in gluten metabolism: isolation of microorganisms with potential interest for coeliac disease. FEMS Microbiol Ecol 2014;88:309-19.
19. De Angelis M, et al. VSL#3 probiotic preparation has the capacity to hydrolyze gliadin polypeptides responsible for Celiac Sprue. Biochim Biophys Acta 2006; 1762:80-93.
20. Helmerhorst EJ, et al. Discovery of a novel and rich source of gluten-degrading microbial enzymes in the oral cavity. PLoS One 2010;5:el3264.
21. Tian N, Wei G, et al. Effect of Rothia mucilaginosa enzymes on gliadin (gluten) structure, deamidation, and immunogenic epitopes relevant to celiac disease. Am J Physiol Gastrointest Liver Physiol 2014;307:G769-76.
22. Zamakhchari M, et al. Identification of Rothia bacteria as gluten-degrading natural colonizers of the upper gastro-intestinal tract. PLoS One 2011;6:e24455.
23. Fernandez-Feo M, et al. The cultivable human oral gluten-degrading microbiome and its potential implications in coeliac disease and gluten sensitivity. Clin Microbiol Infect 2013;19:E386-94.
24. Wei G, et al. Identification of Pseudolysin (lasB) as an Aciduric Gluten-Degrading Enzyme with High Therapeutic Potential for Celiac Disease. Am J Gastroenterol 2015; 110:899-908.
25. Helmerhorst EJ, and Wei G. Experimental strategy to discover microbes with gluten-degrading enzyme activities. Proc. SPIE 2014;9112:91120D 1-11.
26. Shan L, et al. Structural basis for gluten intolerance in celiac sprue. Science 2002;297:2275-9.
27. Osman AA, Uhlig HH, Valdes I, et al. A monoclonal antibody that recognizes a potential coeliac- toxic repetitive pentapeptide epitope in gliadins. Eur J Gastroenterol Hepatol 2001; 13: 1189-93.
28. Valdes I, et al. Innovative approach to low -level gluten determination in foods using a novel sandwich enzyme-linked immunosorbent assay protocol. Eur J Gastroenterol Hepatol 2003; 15:465-74.
29. Moron B, et al. Toward the assessment of food toxicity for celiac patients: characterization of monoclonal antibodies to a main immunogenic gluten peptide. PLoS One 2008;3:e2294.
30. Moron B, et al. Sensitive detection of cereal fractions that are toxic to celiac disease patients by using monoclonal antibodies to a main immunogenic wheat peptide. Am J Clin Nutr 2008;87:405-14.
31. Sollid LM, et al. Nomenclature and listing of celiac disease relevant gluten T-cell epitopes restricted by HLA-DQ molecules. Immunogenetics 2012;64:455-60.
32. van de Wal Y, et al. Selective deamidation by tissue transglutaminase strongly enhances gliadin- specific T cell reactivity. J Immunol 1998; 161: 1585-8.
33. Sollid LM. Coeliac disease: dissecting a complex inflammatory disorder. Nat Rev Immunol 2002;2:647-55.
34. Vader LW, et al. Specificity of tissue transglutaminase explains cereal toxicity in celiac disease. J Exp Med 2002;195:643-9.
35. Siezen RJ, and Leunissen JA. Subtilases: the superfamily of subtilisin-like serine proteases. Protein Sci 1997;6:501-23.
36. Siezen RJ, et al. Evolution of prokaryotic subtilases: genome-wide analysis reveals novel subfamilies with different catalytic residues. Proteins 2007;67:681-94.
37. Mesnage S, et al. Bacterial SLH domain proteins are non-covalently anchored to the cell surface via a conserved mechanism involving wall polysaccharide pyruvylation. EMBO J 2000; 19:4473-84.
38. Azen EA, et al. PRB1, PRB2, and PRB4 coded polymorphisms among human salivary
concanavalin-A binding, II- 1, and Po proline-rich proteins. Am J Hum Genet 1996;58: 143-53.
39. Helmerhorst EJ, and Oppenheim FG. Saliva: a dynamic proteome. J Dent Res 2007;86:680-93.
40. Inzitari R, et al. Detection in human saliva of different statherin and P-B fragments and derivatives. Proteomics 2006;6:6370-9.
41. Tian N, et al. Salivary proline-rich proteins and gluten: Do structural similarities suggest a role in celiac disease? Proteomics Clin Appl 2015;9:953-64.
42. Dewhirst FE, et al. The human oral microbiome. J Bacteriol 2010; 192:5002-17.
43. Helmerhorst EJ, et al. Identification of Lys-Pro-Gln as a novel cleavage site specificity of saliva- associated proteases. J Biol Chem 2008;283: 19957-66.
44. Messana I, et al. Trafficking and postsecretory events responsible for the formation of secreted human salivary peptides: a proteomics approach. Mol Cell Proteomics 2008;7:911-26.
45. Vitorino R, et al. Towards defining the whole salivary peptidome. Proteomics Clin Appl
2009;3:528-540.
46. Gallagher T, et al. The prosegment-subtilisin BPN' complex: crystal structure of a specific 'foldase'. Structure 1995;3:907-14.
47. Dabbagh F, Negahdaripour M, Berenjian A, et al. Nattokinase: production and application. Appl Microbiol Biotechnol 2014;98:9199-206.
REFERENCES for Example 2
1. Zamakhchari M, et al. Identification of Rothia bacteria as gluten-degrading natural colonizers of the upper gastro-intestinal tract. PLoS One 2011;6:e24455.
2. Helmerhorst EJ, and Wei G. Experimental Strategy to Discover Microbes with Gluten-degrading Enzyme Activities. Proc SPIE Int Soc Opt Eng 2014;9112.
3. Wei G, et al. Identification of food-grade subtilisins as gluten-degrading enzymes to treat celiac disease. Am J Physiol Gastrointest Liver Physiol 2016;311 :G571-G580.
4. Siezen RJ, and Leunissen JA. Subtilases: the superfamily of subtilisin-like serine proteases. Protein Sci 1997;6:501-23.
5. Siezen RJ, et al. Evolution of prokaryotic subtilases: genome-wide analysis reveals novel subfamilies with different catalytic residues. Proteins 2007;67:681-94.
6. Osman AA, et al. A monoclonal antibody that recognizes a potential coeliac -toxic repetitive pentapeptide epitope in gliadins. Eur J Gastroenterol Hepatol 2001;13: 1189-93.
7. Valdes I, et al. Innovative approach to low-level gluten determination in foods using a novel sandwich enzyme-linked immunosorbent assay protocol. Eur J Gastroenterol Hepatol 2003; 15:465-74.
8. Moron B, et al. Toward the assessment of food toxicity for celiac patients: characterization of monoclonal antibodies to a main immunogenic gluten peptide. PLoS One 2008;3:e2294.
9. Schuppan D, et al. Non-celiac wheat sensitivity: differential diagnosis, triggers and implications. Best Pract Res Clin Gastroenterol 2015;29:469-76.
10. Schuppan D, and Zevallos V. Wheat amylase trypsin inhibitors as nutritional activators of innate immunity. Dig Dis 2015;33:260-3.
11. Zevallos VF, et al. Nutritional Wheat Amylase-Trypsin Inhibitors Promote Intestinal Inflammation via Activation of Myeloid Cells. Gastroenterology 2016.
12. Junker Y, et al. Wheat amylase trypsin inhibitors drive intestinal inflammation via activation of tolllike receptor 4. J Exp Med 2012;209:2395-408.
REFERENCES for Example 3
1. Schuppan D, et al. Non-celiac wheat sensitivity: differential diagnosis, triggers and implications. Best Pract Res Clin Gastroenterol 2015;29:469-76.
2. Schuppan D, and Zevallos V. Wheat amylase trypsin inhibitors as nutritional activators of innate immunity. Dig Dis 2015;33:260-3.
3. Zevallos VF, et al. Nutritional Wheat Amylase-Trypsin Inhibitors Promote Intestinal Inflammation via Activation of Myeloid Cells. Gastroenterology 2016.
4. Junker Y, et al. Wheat amylase trypsin inhibitors drive intestinal inflammation via activation of tolllike receptor 4. J Exp Med 2012;209:2395-408.
5. Wei G, et al. Identification of food-grade subtilisins as gluten-degrading enzymes to treat celiac disease. Am J Physiol Gastrointest Liver Physiol 2016;311 :G571-G580.
Claims
1. A foodstuff comprising a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria.
2. The foodstuff of claim 1, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, Rothia species ot 188 (strain WSA-8), Rothia aeria BAV86562.1 and Rothia dentocariosa KGJ00122.1.
3. The foodstuff of claim 1, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa, Rothia aeria and Rothia dentocariosa.
4. The foodstuff of claim 1 or 2 or 3, wherein the subtilisin has the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins.
5. The foodstuff of any one of claims 1-4, wherein the subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins described herein.
6. The foodstuff of any one of claims 1-5, wherein the subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
7. The foodstuff of any one of claims 1-6, wherein the subtilisin cleaves proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and Xi is a hydrophobic amino acid, i.e., cleaving at the peptide bond after X1; e.g. the XPQ motif, where Q is glutamine.
8. The foodstuff of any one of claims 1-7, wherein the subtilisin cleaves succinyl-Ala-Ala-Pro-Phe- paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the 2nd peptide bond after proline in the P2 position.
9. The foodstuff of any one of claims 1-8, wherein the subtilisin degrades the highly immunogenic gliadin-derived 33-mer peptide.
10. The foodstuff of any one of claims 1-9, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PFP- motif, wherein F= Phenylalanine=Phe; P=proline=Pro.
11. The foodstuff of any one of claims 1-10, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PPF- motif, wherein F= Phenylalanine; P=proline.
12. The foodstuff of any one of claims 1-11, wherein the subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes.
13. The foodstuff of any one of claims 1-12, wherein the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis or as described in Figures 2A-2E; or have a predicted molecular weight of -125 kDa as described in the example section.
14. The foodstuff of any one of claims 1-13, wherein the subtilisin enzyme has a functional pH range of 6.0-10.0.
15. The foodstuff of any one of claims 1-14, wherein the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
16. The foodstuff of any one of claims 1-15, wherein the subtilisin is 100% inhibited by ImM of PMSF.
The foodstuff of any one of claims 1-16, wherein the subtilisin is not inhibited by E64 or EDTA.
17. The foodstuff of any one of claims 1-17, wherein the subtilisin is not stable in acid conditions.
18. The foodstuff of any one of claims 1-18, wherein the subtilisin is lyophilized.
19. The foodstuff of any one of claims 1-19, wherein the subtilisin is a recombinant protein.
20. The foodstuff of any one of claims 1-20, wherein the subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3.
21. The foodstuff of any one of claims 1-21, wherein the subtilisin comprises SEQ. ID. NO: 1, 2 or 3.
22. The foodstuff of any one of claims 1-22, wherein the subtilisin consists essentially of SEQ. ID. NO:
1, 2 or 3.
23. The foodstuff of any one of claims 1-23, wherein the subtilisin is SEQ. ID. NO: 1, 2 or 3.
24. The foodstuff of any one of claims 1-24, the formulation further comprising a prolyl endopeptidase.
25. The foodstuff of any one of claims 1-25, the formulation further comprising at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ-pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
26. The foodstuff of any one of claims 1-26, the formulation further comprising at least one isolated additional glutamine endopeptidase enzyme that cleaves a peptide bond after a QPF and a PFP motif in glutens.
27. A method for degrading gluten in a gluten-containing foodstuff the method comprises contacting the gluten-containing foodstuff with an effective dose of a formulation comprising a subtilisin enzyme derived from a. Rothia sp. bacteria.
28. The method of claim 28, wherein the contacting is performed in vitro prior to consumption of the gluten-containing food stuff.
29. The method of claim 28, wherein the contacting is performed in vivo concurrent with or after consumption of the gluten-containing food stuff.
30. The method of claim 28, 29, or 30, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, Rothia species ot 188 (strain WSA-8), Rothia aeria BAV86562.1 and Rothia dentocariosa KGJ00122.1.
31. The method of any one of claims 28-31, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa, Rothia aeria and Rothia dentocariosa.
32. The method of any one of claims 28-32, wherein the subtilisin has the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins.
33. The method of any one of claims 28-33, wherein the subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins, (SEQ. ID. NOS: 1-3) or SEQ. ID. NOS: 33-34..
34. The method of any one of claims 28-34, wherein the subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
35. The method of any one of claims 28-35, wherein the subtilisin cleaves proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and Xi is a hydrophobic amino acid, i.e., cleaving at the peptide bond after X1; e.g. the XPQ motif, where Q is glutamine.
36. The method of any one of claims 28-36, wherein the subtilisin cleaves succinyl-Ala-Ala-Pro-Phe- paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the 2nd peptide bond after proline in the P2 position.
37. The method of any one of claims 28-37, wherein the subtilisin degrades the highly immunogenic gliadin-derived 33-mer peptide.
38. The method of any one of claims 28-38, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PFP- motif, wherein F= Phenylalanine=Phe; P=proline=Pro.
39. The method of any one of claims 28-39, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PPF- motif, wherein F= Phenylalanine; P=proline.
40. The method of any one of claims 28-40, wherein the subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes, e.g. the 33mer peptide.
41. The method of any one of claims 28-41, wherein the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis, or a predicted molecular weight of -125 kDa as described in the Example Section.
42. The method of any one of claims 28-42, wherein the subtilisin enzyme has a functional pH range of 6.0- 10.0.
43. The method of any one of claims 28-43, wherein the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 1 1.0.
44. The method of any one of claims 28-44, wherein the subtilisin is 100% inhibited by ImM of PMSF.
(or just inhibited PMSF)
45. The method of any one of claims 28-45, wherein the subtilisin is not inhibited by E64 or EDTA.
46. The method of any one of claims 28-46, wherein the subtilisin is not stable in acid conditions.
47. The method of any one of claims 28-47, wherein the subtilisin is lyophilized.
48. The method of any one of claims 28-48, wherein the subtilisin is a recombinant protein.
49. The method of any one of claims 28-49, wherein the subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3.
50. The method of any one of claims 28-50, wherein the subtilisin comprises SEQ. ID. NO: 1, 2 or 3.
51. The method of any one of claims 28-51, wherein the subtilisin consists essentially of SEQ. ID. NO:
1, 2 or 3.
52. The method of any one of claims 28-52, wherein the subtilisin is SEQ. ID. NO: 1, 2 or 3.
53. The method of any one of claims 28-53, the formulation further comprising a prolyl endopeptidase.
54. The method of any one of claims 28-54, the formulation further comprising at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ-pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
55. The method of any one of claims 28-55, the formulation further comprising at least one isolated additional glutamine endopeptidase enzyme that cleaves a peptide bond after a QPF and a PFP motif in glutens.
56. A composition comprising (a) an isolated subtilisin enzyme derived from a Rothia sp. bacteria, and (b) a prolyl endopeptidase (PEP).
57. The composition of claim 57, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, Rothia species ot 188 (strain WSA-8), Rothia aeria BAV86562.1 and Rothia dentocariosa KGJ00122.1.
58. The composition of 57 or 58, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa, Rothia aeria and Rothia dentocariosa.
59. The composition of any one of claims 28-32, wherein the subtilisin has the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins.
60. The composition of any one of claims 57-60, wherein the subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins, (SEQ. ID. NOS: 1-3) or SEQ. ID. NOS: 33-34..
61. The composition of any one of claims 57-61, wherein the subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
62. The composition of any one of claims 57-62, wherein the subtilisin cleaves proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino
acid, P is proline and Xi is a hydrophobic amino acid, i.e., cleaving at the peptide bond after X1; e.g. the XPQ motif, where Q is glutamine.
63. The composition of any one of claims 57-63, wherein the subtilisin cleaves succinyl-Ala-Ala-Pro- Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the 2nd peptide bond after proline in the P2 position.
64. The composition of any one of claims 57-64, wherein the subtilisin degrades the highly immunogenic gliadin-derived 33-mer peptide.
65. The composition of any one of claims 57-65, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PFP- motif, wherein F= Phenylalanine=Phe; P=proline=Pro.
66. The composition of any one of claims 57-66, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PPF- motif, wherein F= Phenylalanine; P=proline.
67. The composition of any one of claims 57-67, wherein the subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes, e.g. the 33mer peptide.
68. The composition of any one of claims 57-68, wherein the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis, or a predicted molecular weight of -125 kDa as described in the Example Section.
69. The composition of any one of claims 57-69, wherein the subtilisin undergo autocatalytic activation to produce a shorter mature enzyme.
70. The composition of any one of claims 57-70, wherein the subtilisin enzyme has a functional pH range of 6.0-10.0.
71. The composition of any one of claims 57-71, wherein the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 11.0.
72. The composition of any one of claims 57-72, wherein the subtilisin is 100% inhibited by ImM of PMSF. (or just inhibited PMSF)
73. The composition of any one of claims 57-73, wherein the subtilisin is not inhibited by E64 or EDTA.
74. The composition of any one of claims 57-74, wherein the subtilisin is not stable in acid conditions.
75. The composition of any one of claims 57-75, wherein the subtilisin is lyophilized.
76. The composition of any one of claims 57-76, wherein the subtilisin is a recombinant protein.
77. The composition of any one of claims 57-77, wherein the subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 or x or y.
78. The composition of any one of claims 57-78, wherein the subtilisin comprises SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
79. The composition of any one of claims 57-79, wherein the subtilisin consists essentially of SEQ. ID.
NO: 1, 2 or 3 or 33 or 34.
80. The composition of any one of claims 57-80, wherein the subtilisin is SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
81. The composition of any one of claims 57-81, the formulation further comprising at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z-YPQ-pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0-7.0, inclusive.
82. The composition of any one of claims 57-82, the formulation further comprising at least one isolated additional glutamine endopeptidase enzyme that cleaves a peptide bond after a -QPF- and a -PFP- motif in glutens.
83. The composition of any one of claims 57-83, wherein the PEP is derived from the microorganism selected from the group consisting of Aspergillus niger, Flavobacterium meningosepticum, Sphingomonas capsulata, Penicillium citrinum, Hordeum vulgare, and Myxococcus xanthus.
84. The composition of any one of claims 57-84, the composition further comprising a glutamine specific protease which is selected from the group consisting of Hordeum vulgare endoprotease, Aspergillus oryzae X-Pro dipeptidase, a d Aspergillus saitoi carboxypeptidase. (as described in US Patent No. 7628985, incorporated by reference in its entirety).
85. The composition of any one of claims 57-85, the composition further comprising a pharmaceutically acceptable carrier.
86. A method for treating celiac disease or a related disorder such as gluten allergy, gluten intolerance and dermatitis herpetiformis , the method comprising administering to a subject an effective dose of a composition comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or administering an effective dose of a composition of any one of claims 57-86.
87. The treatment method of claim 87, wherein the administering is performed in vitro prior to consumption of the gluten-containing food stuff.
88. The treatment method of claim 87, wherein the administering is performed in vivo concurrent with or after consumption of the gluten-containing food stuff.
89. The treatment method of claim 87, wherein the administering is performed in vitro prior to and also concurrent with or after consumption of the gluten-containing food stuff.
90. The treatment method of any one of claims 87-90, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa ot 681 (strain WSA-2B), Rothia mucilaginosa ATCC 25296, Rothia species ot 188 (strain WSA-8), Rothia aeria BAV86562.1 and Rothia dentocariosa KGJ00122.1.
91. The treatment method of any one of claims 87-91, wherein the Rothia sp. bacteria is selected from the group consisting of Rothia mucilaginosa, Rothia aeria and Rothia dentocariosa.
92. The method of any one of claims 28-32, wherein the subtilisin has the sequence of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins.
93. The treatment method of any one of claims 87-93, wherein the subtilisin is at least 90% identical to the sequences of the hypothetical ROTMU0001_0241 (C6R5V9_9MICC), ROTMU0001_0243 (C6R5W1_9MICC) or ROTMU0001_240 (C6R5V8_9MICC) proteins, (SEQ. ID. NOS: 1-3) or SEQ. ID. NOS: 33-34.
94. The treatment method of any one of claims 87-94, wherein the subtilisin comprises the catalytic triad with Asp (D), His (H) and Ser (S) in the D-H-S order that is characteristic of the S8A family of serine protease family.
95. The treatment method of any one of claims 87-95, wherein the subtilisin cleaves proline-containing proteins, cleaving the second peptide bond after proline in the XPXi motif, where X is any amino acid, P is proline and Xi is a hydrophobic amino acid, i.e., cleaving at the peptide bond after X1; e.g. the XPQ motif, where Q is glutamine.
96. The treatment method of any one of claims 87-96, wherein the subtilisin cleaves succinyl-Ala-Ala- Pro-Phe-paranitroanilide (SEQ ID NO: 4), a substrate for subtilisin, cleaving at the 2nd peptide bond after proline in the P2 position.
97. The treatment method of any one of claims 87-97, wherein the subtilisin degrades the highly immunogenic gliadin-derived 33-mer peptide.
98. The treatment method of any one of claims 87-98, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PFP- motif, wherein F= Phenylalanine=Phe; P=proline=Pro.
99. The treatment method of any one of claims 87-99, wherein the subtilisin does not cleave the 2nd peptide bond after Proline in the P2 position in a tripeptide having the -PPF- motif, wherein F= Phenylalanine; P=proline.
100. The treatment method of any one of claims 87- 100, wherein the subtilisin is more effective glutenase compared with Bacillus sp. subtilisin A with respect to certain immunogenic epitopes, e.g. the 33mer peptide.
101. The treatment method of any one of claims 87-101, wherein the subtilisin has an apparent molecular weight of about 75-80 kDa as determined by gliadin zymograms or by sodium dodecyl sulfate polyacrylamide gel electrophoresis, or a predicted molecular weight of -125 kDa as described in the Example Section.
102. The treatment method of any one of claims 87-102, wherein the subtilisin undergoes autocatalytic activation to produce a shorter mature enzyme.
103. The treatment method of any one of claims 87-103, wherein the subtilisin enzyme has a functional pH range of 6.0-10.0.
104. The treatment method of any one of claims 87-104, wherein the subtilisin enzyme has low or negligible enzyme activity at pH values below 5.0 or pH values higher than 1 1.0.
105. The method of any one of claims 87-105, wherein the subtilisin is 100% inhibited by ImM of PMSF.
(or just inhibited PMSF)
106. The treatment method of any one of claims 87-106, wherein the subtilisin is not inhibited by E64 or EDTA.
107. The treatment method of any one of claims 87-107, wherein the subtilisin is not stable in acid conditions.
108. The treatment method of any one of claims 87-108, wherein the subtilisin is lyophilized.
109. The treatment method of any one of claims 87-109, wherein the subtilisin is a recombinant protein.
110. The treatment method of any one of claims 87-110, wherein the subtilisin has an amino acid sequence that show at least 60% similarity to SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
111. The treatment method of any one of claims 87-111, wherein the subtilisin comprises SEQ. ID. NO:
1, 2 or 3 or 33 or 34.
112. The treatment method of any one of claims 87-112, wherein the subtilisin consists essentially of SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
113. The treatment method of any one of claims 87-113, wherein the subtilisin is SEQ. ID. NO: 1, 2 or 3 or 33 or 34.
114. The treatment method of any one of claims 87-114, the formulation further comprising a prolyl endopeptidase.
115. The treatment method of any one of claims 87-115, the formulation further comprising an effective amount of at least one additional gluten-degrading enzyme isolated from a Rothia species bacteria, wherein the at least one additional gluten-degrading enzyme retains protease activity at an acidic pH of 3.0 as measured in an in vitro gliadin degradation assay for 3 hours using a synthetic substrate Z- YPQ-pNA, and wherein the at least one enzyme comprises an isoelectric point in a pH range of 2.0- 7.0, inclusive.
116. The treatment method of any one of claims 87-116, the formulation further comprising an isolated second additional glutamine endopeptidase enzyme that cleaves a peptide bond after a -QPF- and a -PFP- motif in glutens.
117. The treatment method of any one of claims 87-117, wherein the related disorder is selected from the group consisting of refractory celiac disease, gluten allergy, gluten intolerance and dermatitis herpetiformis.
118. Use of a subtilisin enzyme derived from a Rothia sp. bacteria to attenuate gluten toxicity in gluten- containing food stuff or for the treatment of celiac disease or a related disorder.
119. Use of a subtilisin enzyme derived from a Rothia sp. bacteria for the manufacture of medicament to treat of celiac disease or a related disorder.
120. Use of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or a composition of any one of claims 57-86 to attenuate gluten toxicity in gluten-containing food stuff or for the treatment of celiac disease or a related disorder.
121. Use of a formulation comprising a subtilisin enzyme derived from a Rothia sp. bacteria, or a composition of any one of claims 57-86 for the manufacture of medicament for the treatment of celiac disease or a related disorder.
122. Use of any one of claims 119-122, wherein the related disorder is selected from the group consisting of refractory celiac disease, gluten allergy, gluten intolerance and dermatitis herpetiformis.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/076,852 US11124785B2 (en) | 2016-02-11 | 2017-02-10 | Rothia subtilisins, S8A family proteases, as therapeutic enzymes for application in gluten intolerance disorders |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662293960P | 2016-02-11 | 2016-02-11 | |
| US62/293,960 | 2016-02-11 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017139659A1 true WO2017139659A1 (en) | 2017-08-17 |
Family
ID=59563535
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/017491 Ceased WO2017139659A1 (en) | 2016-02-11 | 2017-02-10 | Rothia subtilisins, s8a family proteases, as therapeutic enzymes for application in gluten-intolerance disorders |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US11124785B2 (en) |
| WO (1) | WO2017139659A1 (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110468175A (en) * | 2019-08-22 | 2019-11-19 | 赵秋萍 | A kind of composite plant Gly-His-Lys and its preparation method and application |
| CN111148830A (en) * | 2017-10-04 | 2020-05-12 | 诺维信公司 | Polypeptides with protease activity and polynucleotides encoding the same |
| WO2021129998A1 (en) | 2019-12-23 | 2021-07-01 | Evonik Operations Gmbh | Bacterial consortium comprising at least one bacillus and lactobacillus strain for gluten degradation |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022186290A1 (en) * | 2021-03-02 | 2022-09-09 | 森永乳業株式会社 | Dipeptidyl peptidase-iv inhibitor |
| CN119285699B (en) * | 2024-11-13 | 2025-03-28 | 盐城工学院 | Walnut meal-derived antibacterial polypeptide and its application |
| CN121714009A (en) * | 2026-02-12 | 2026-03-24 | 长兴趣酶生物科技有限公司 | Method for preparing enzymolysis cereal powder |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130171109A1 (en) * | 2010-07-07 | 2013-07-04 | Trustees Of Boston University | Rothia species gluten-degrading enzymes and uses thereof |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1673457B1 (en) | 2003-08-25 | 2011-05-18 | Funzyme Biotechnologies SA | Novel fungal proteins and nucleic acids encoding same |
| US7628985B2 (en) | 2004-04-26 | 2009-12-08 | The Board Of Regents Of The Leland Stanford Junior University | Therapeutic enzyme formulations and uses thereof in celiac sprue and/or dermatitis herpetoformis |
| WO2008115411A1 (en) | 2007-03-16 | 2008-09-25 | The Board Of Trustees Of The Leland Stanford Junior University | Combination enzyme therapy for digestion of dietary gluten |
| FI121851B (en) | 2009-07-08 | 2011-05-13 | Ab Enzymes Oy | A fungal-derived protease and its use |
| US8685392B2 (en) | 2009-10-07 | 2014-04-01 | Trustees Of Boston University | Rothia species glutamine endopeptidases and use thereof |
| EP2531521B1 (en) | 2010-02-02 | 2017-09-06 | Amano Enzyme USA., Ltd. | Use of proteases for gluten intolerance |
| ES2595500T3 (en) | 2011-12-06 | 2016-12-30 | Fondazione Istituto Insubrico Di Ricerca Per La Vita | New proteases that can hydrolyze gluten peptides and proteins at an acidic pH, from Actinomycete Actinoallomurus |
-
2017
- 2017-02-10 WO PCT/US2017/017491 patent/WO2017139659A1/en not_active Ceased
- 2017-02-10 US US16/076,852 patent/US11124785B2/en active Active
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130171109A1 (en) * | 2010-07-07 | 2013-07-04 | Trustees Of Boston University | Rothia species gluten-degrading enzymes and uses thereof |
Non-Patent Citations (1)
| Title |
|---|
| DATABASE UniProtKB/TrEMBL [o] 10 January 2014 (2014-01-10), Database accession no. C6R5V9_9MICC * |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111148830A (en) * | 2017-10-04 | 2020-05-12 | 诺维信公司 | Polypeptides with protease activity and polynucleotides encoding the same |
| CN110468175A (en) * | 2019-08-22 | 2019-11-19 | 赵秋萍 | A kind of composite plant Gly-His-Lys and its preparation method and application |
| WO2021129998A1 (en) | 2019-12-23 | 2021-07-01 | Evonik Operations Gmbh | Bacterial consortium comprising at least one bacillus and lactobacillus strain for gluten degradation |
Also Published As
| Publication number | Publication date |
|---|---|
| US11124785B2 (en) | 2021-09-21 |
| US20190040375A1 (en) | 2019-02-07 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9598684B2 (en) | Rothia species gluten-degrading enzymes and uses thereof | |
| US11124785B2 (en) | Rothia subtilisins, S8A family proteases, as therapeutic enzymes for application in gluten intolerance disorders | |
| AU2005239985B2 (en) | Therapeutic enzyme formulations and uses thereof | |
| US8685392B2 (en) | Rothia species glutamine endopeptidases and use thereof | |
| US7628985B2 (en) | Therapeutic enzyme formulations and uses thereof in celiac sprue and/or dermatitis herpetoformis | |
| US8796201B2 (en) | Enzyme treatment of foodstuffs for celiac sprue | |
| CN102858795A (en) | Use of proteases for gluten intolerance | |
| US20140205587A1 (en) | Proteases for Degrading Gluten | |
| US20130045195A1 (en) | Proteases for Degrading Gluten | |
| US10457929B2 (en) | Compositions for the treatment of gluten intolerance and uses thereof | |
| AU2008100719B4 (en) | Papaya resin for gluten digestion and uses thereof | |
| US20150197738A1 (en) | Acid Stable Prolyl Endopeptidases for Degrading Gluten | |
| Awosika | Structure-function properties of pea-protein derived peptides with inhibitory activities against gastrointestinal enzymes | |
| IL178660A (en) | Formulations comprising prolyl endopeptidase and cysteine endoprotease b for decreasing gluten oligopeptide levels in food |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17750883 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 17750883 Country of ref document: EP Kind code of ref document: A1 |