WO2017106264A1 - Method for producing a clean lactase - Google Patents

Method for producing a clean lactase Download PDF

Info

Publication number
WO2017106264A1
WO2017106264A1 PCT/US2016/066519 US2016066519W WO2017106264A1 WO 2017106264 A1 WO2017106264 A1 WO 2017106264A1 US 2016066519 W US2016066519 W US 2016066519W WO 2017106264 A1 WO2017106264 A1 WO 2017106264A1
Authority
WO
WIPO (PCT)
Prior art keywords
lactase
preparation
isoelectric point
milk
food
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/066519
Other languages
French (fr)
Inventor
Morten Krog Larsen
Masoud Rajabi Zargahi
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
International N&H Denmark ApS
Original Assignee
DuPont Nutrition Biosciences ApS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by DuPont Nutrition Biosciences ApS filed Critical DuPont Nutrition Biosciences ApS
Publication of WO2017106264A1 publication Critical patent/WO2017106264A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23CDAIRY PRODUCTS, e.g. MILK, BUTTER OR CHEESE; MILK OR CHEESE SUBSTITUTES; PREPARATION THEREOF
    • A23C9/00Milk preparations; Milk powder or milk powder preparations
    • A23C9/12Fermented milk preparations; Treatment using microorganisms or enzymes
    • A23C9/1203Addition of, or treatment with, enzymes or microorganisms other than lactobacteriaceae
    • A23C9/1206Lactose hydrolysing enzymes, e.g. lactase, beta-galactosidase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/24Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2468Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1) acting on beta-galactose-glycoside bonds, e.g. carrageenases (3.2.1.83; 3.2.1.157); beta-agarase (3.2.1.81)
    • C12N9/2471Beta-galactosidase (3.2.1.23), i.e. exo-(1-->4)-beta-D-galactanase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/01023Beta-galactosidase (3.2.1.23), i.e. exo-(1-->4)-beta-D-galactanase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/01108Lactase (3.2.1.108)

Definitions

  • the present invention relates to a method for preparing a lactase preparation involving incubating a preparation containing a lactase enzyme at a pH close to the isoelectric point of said lactase.
  • the invention also relates to a lactase enzyme produced by the method of the invention.
  • enzymes to improve food grade products are well known, and such enzymes are routinely produced by fermentation of microorganisms that express them.
  • lactase also known as lactase-phlorizin hydrolase, or LPH
  • LPH lactase-phlorizin hydrolase
  • Lactase is an enzyme produced by many organisms and is located in the brush border of the small intestine of humans and other mammals. Lactase is essential to the complete digestion of whole milk; it breaks down lactose, a sugar which gives milk its sweetness. An individual consuming dairy products comprising lactose in the absence of lactase may experience the symptoms of lactose intolerance. Lactose is present in dairy products and more specifically in milk, skimmed milk, cream and other milk products. The breakdown of
  • lactase occurs in the intestinal wall of the human body (and other mammals) by the natural presence of lactase.
  • lactose in most populations that lack lactase are well known and described. Members of such populations cannot hydrolyse the lactose, which in such cases passes into the large intestine, where it produces dehydration, poor calcium absorption, diarrhoea, flatulence, belching and cramps, and, in severe cases, even watery explosive diarrhoea.
  • lactase an important industrial application of lactase is in the production of lactose-hydrolysed milk products for lactose intolerant individuals.
  • Such hydrolysed milk products include pasteurized milk, UHT-milk and milk reconstituted from all or part of its original constituents with or without intermediate processing steps such as protein hydrolysis.
  • Treatment with lactase may be done prior to and after the heat-treatment of the milk.
  • the lactase treatment may be done by adding the enzyme to the milk.
  • the solubility properties of lactose are such that it may lead to its crystallization, leading to a sandy or gritty texture.
  • Such undesired texture may be found in some dairy products such as condensed milk, evaporated milk, dry milk, frozen milk, ice cream, and in confectionary products with a high content of milk.
  • Full or partial hydrolysis of lactose by lactase eliminates this problem, providing products with a homogeneous texture and as a result a higher consumer acceptance.
  • lactase in food processing is to increase the sweet taste in lactose- containing products such as milk or yoghurt.
  • the hydrolysis of lactose in such products results in an increased sweet taste due to glucose production.
  • lactase may be employed in the hydrolysis of lactose products containing dairy components, for example bread. Lactose can be added to such products to enhance flavour, retain moisture, provide browning and improve toasting properties. Lactose hydrolysis by lactase in fermented milk products such as yoghurt will increase sweet taste.
  • the lactase is added prior to the beginning of the fermentative process, it may increase the rate of acid development and thus reduce processing times.
  • lactase treatment of milk or milk-derived products such as whey makes such products suitable for application in animal feed and pet food for lactose intolerant animals such as cats.
  • the lactose hydrolysis allows the manufacture of higher concentrated whey and at the same time prevents gut problems, similar to those described earlier for lactose-deficient patients.
  • Lactose hydrolysed whey is concentrated to produce a syrup containing 70-75% solids and is used as a food ingredient in ice cream, bakery and confectionary products.
  • the present invention encompasses both neutral and acidic lactases.
  • the lactase is a neutral lactase.
  • the lactase is an acidic lactase.
  • the choice for a neutral or acidic lactase depends on the pH profile in the application. In applications with neutral pH, neutral lactases are usually preferred; such applications include milk, ice cream, whey, cheese, yoghurt, milk powder etc. Acid lactases are more suited for applications in the acidic range.
  • an enzyme treatment can have unexpected and undesirable side effects.
  • An example of an undesirable side effect is the development of off-flavour as a result of the enzyme treatment, due to unwanted enzymatic activities in the enzyme preparation.
  • the present invention addresses this need.
  • a lactase enzyme can be produced from a preparation comprising said lactase using a simple and cost-effective method involving precipitation of the lactase at a pH close to its isoelectric point.
  • a relatively simple method could produce a lactase preparation, wherein the lactase activity is retained following incubation at a pH close to its isoelectric point.
  • the present invention provides an alternative, improved method for lactase precipitation in which a simple step of incubation at a pH close to the isoelectric point of said lactase is employed.
  • the present invention provides a method for producing a lactase comprising incubating a preparation comprising said lactase at a pH close to the isoelectric point of said lactase.
  • the method of the invention allows for production of a lactase which retains its activity following incubation at a pH close to the isoelectric point.
  • the invention also encompasses a lactase or lactase preparation produced by the method of the invention.
  • FIGURES Figure 1 shows the chromatographic fingerprint of lactase protein obtained from a Mono P column.
  • Figure 2 shows the results of SDD-PAGE analysis of lactase activity.
  • Lane 1. Crude F3031 G; Lane 2. Crude after pH decrease to 4.0 and increase to 7.30; Lane 3.
  • Supernatant pH 4.0; and Lane 8. Pellet pH 4.0.
  • the present inventors have surprisingly found that it is possible to produce a lactase using a quick and cost-effective method, involving incubating a preparation comprising a lactase at a pH close to the isoelectric point of the lactase.
  • the present invention provides a method for producing a lactase comprising incubating a preparation comprising said lactase at a pH close to the isoelectric point of said lactase.
  • the isoelectric point (pi, pH(l), IEP), is the pH at which a particular molecule carries no net electrical charge.
  • the isoelectric point of a lactase may be determined by methods known in the art, for example as described in present Example 1.
  • the term "close to its isoelectric point" is intended to mean a pH value near to the isoelectric point of the lactase.
  • the pH at which the lactase preparation is incubated may be within 2.0 units of the isoelectric point.
  • the pH at which the lactase preparation is incubated may be within 0.1-2.0 units, e.g. 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1 , 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9 or 2.0 units of the isoelectric point.
  • incubated at a pH close to the isoelectric point is intended to mean keeping the preparation at a pH close to the isoelectric point, for example for an amount of time sufficient to allow precipitation of the lactase.
  • lactase may be precipitated from the preparation comprising said lactase.
  • 50-100% of lactase is precipitated.
  • about 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100% of lactase protein or activity is precipitated.
  • the lactase may be an intracellular or an extracellular produced lactase. In a preferred embodiment the lactase is extracellular.
  • the reference to a lactase as used herein is intended to mean any enzyme with lactase activity.
  • the lactase may be from a Lactobacillus, for example a species of Lactobacillus such as Lactobacillus delbrueckii, e.g. Lactobacillus delbrueckii bulgaricus. Lactobacillus delbrueckii subsp. bulgaricus was until 2014 known as Lactobacillus bulgaricus.
  • Lactobacillus bulgaricus is used herein, but this is intended to be equivalent to Lactobacillus delbrueckii bulgaricus.
  • the lactase is from Lactobacillus bulgaricus.
  • the amino acid sequence of L. bulgaricus is publically available, for example as UniProtKB - P0C1Y0 (BGAL_LACDE) (www.uniprot.org/uniprot/P0C1Y0).
  • the lactase may be a lactase having an amino acid sequence which is at least 80, 85 or 90%, preferably at least 95% identical with the amino acid sequence of L. bulgaricus lactase as set out in SEQ ID NO:1 :.
  • the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence).
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
  • % identity number of identical positions/total number of positions (i.e. overlapping positions) x 100).
  • the two sequences are the same length.
  • the lactase is not from a Kluyveromyces species, for example K. lactis.
  • the method of the invention may be performed on any lactase preparation which contains a lactase, and, in a preferred embodiment , at least one further enzyme.
  • the method is particularly useful when the preparation is a culture or fermentation broth.
  • the method of the invention may be applied to an untreated culture broth (whole culture broth) , to a homogenized culture broth, or to a whole or homogenized culture broth.
  • the temperature should be held in the range of from 2-75°C, in particular in the range of from 10-70°C, preferably in the range of from 5-25°C.
  • the incubation time may be anything from 1 second to a couple of weeks, typically the holding time will be in the range of from 1 second to 24 hours, , preferably in the range of from 1 second to 4 hours.
  • no further or additional purification steps are performed.
  • no column purification of the lactase is performed, for example, no ion exchange, affinity or size exclusion column purification is performed, nor column purification based on hydrophobic interaction.
  • the invention also encompasses a lactase enzyme produced by any aspect of the method of the invention.
  • a lactase according to the invention may be used in the production of a food or beverage product, preferably a dairy product.
  • the dairy product may be selected from milk, ice cream, whey, cheese, yoghurt, and milk powder etc.
  • the product is in the form of a milk drink.
  • lactase according to the present invention or produced by a method according to the invention may be substantially free of unwanted enzymatic activities, and hence the method of the invention can also be used to purify lactase from a preparation comprising said lactase and other enzymes.
  • a lactase "substantially free” from unwanted enzymatic activities may encompass any lactase, in which the unwanted enzymatic activity or activities is not present or present at a sufficiently low level that, upon effective dosage of the lactase in the relevant production process, no observable activity of the unwanted enzyme activities is observed.
  • Unwanted enzymatic activities can be any enzymatic activities that are not the desired lactase activity.
  • the unwanted enzyme activity may be an enzyme selected from the group consisting of lipases, amylases, cellulases, oxidoreductases, xylanases, isomerases, peptidases and proteases.
  • the unwanted enzymatic activity is aryl sulfatase.
  • the invention provides a lactase which comprises less than e.g. 20-1000 units of arylsulfatase activity per NLU, for example, less than 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900 or 1000 units activity per NLU.
  • the lactase according to the invention may advantageously be used in food and feed products to hydrolyse lactose without the formation of off-flavour compounds.
  • the preparation of intracellular lactases requires the disruption of the cells to release the lactase enzyme. At the same time, other cytoplasmic enzymes are released.
  • the quality of an industrial preparation of the lactase may be determined by the ratio of unwanted enzyme activities to lactase activity.
  • Proteases are critical unwanted enzymes since they are known to lead to unwanted side effects in application, such as milk clotting or off-flavour formation in milk.
  • Off-flavour compounds include p-cresol (produced by aryl sulfatase), and bitter peptides.
  • AKTA explorer system was used for protein purification and according to the method described by the manufacturer, GE, USA - Cat. No. 18-1 112-41.
  • the MonoP column was obtained from GE Life sciences, USA - Cat. No. 17-0611-01.
  • PD-10 column was obtained from GE Life sciences, USA - Cat. No. 17-0851-01.
  • Na- dihydrogen phosphate was obtained from Merck, Germany - Cat. No. 1.06346.
  • Tris (hydroxymethyl) aminomethane was obtained from Sigma-Aldrich, Germany - Cat. No. 154563.
  • Polybuffer 74 was obtained from GE Life sciences, USA - Cat. No. 17-0713-01. Nu-PAGE gel was obtained from Invitrogen, USA - Cat. No. NP0321.
  • SeeBlue standard marker was obtained from Invitrogen, USA - Cat. No. LC5925.
  • the PD-10 column was prepared as described by the manufacturer and equilibrated with 20 mM Tris/HCI, pH 8.5 (buffer A). The Sample was diluted 2x with desalting buffer and desalted on the column.
  • the column was prepared as described by the manufacturer and equilibrated with 20 mM Tris/HCI, pH 8.5 (buffer A). The sample (2 ml desalted sample) was applied to the column at a flow rate of 1.5 ml/min and the column was washed with buffer A. The bound proteins were eluted according to differences in their isoelectric point with a linier pH gradient of 8.5-4.0 using 10% Polybuffer 74, pH 4.0/HCI (buffer B). During the entire run, fractions of approx. 1.0 ml were collected and subjected to pH-measurement and lactase enzyme assay.
  • Lactase (Neutral) Beta-Galactosidase activity - FCC IV was determined using the following parameters:
  • Substrate ONPG, pH 6.50;
  • the isoelectric point of the L. bulgaricus lactase protein was determined to be 4.1 as described in Example 1.
  • the pH was stepwise adjusted down to 5.0, 4.5 and 4.0 by the addition of ice cold H 2 S0 4 solution (2 M). Samples were taken (2 mL) at each pH point and pellets were separated from supernatants by 5 min centrifugation at 10000g. Pellets were re-solubilized by the addition of 2.0 mL of PEM buffer. The Supernatants were added 200 ⁇ of a 1.0 M Na-P buffer (pH 8.0). Both supernatants and pellets were subjected to lactase assay and SDS-PAGE analysis.
  • Lactase activity was assayed using the following parameters: Lactase assay Substrate: FCC IV NLU, 10 ⁇ of 100x diluted sample/blank (diluted in PEM buffer), 190 ⁇ substrate, 5 min/32°C/420nm.
  • the recovered lactase solution had a decrease in odour.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Health & Medical Sciences (AREA)
  • Wood Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Molecular Biology (AREA)
  • Food Science & Technology (AREA)
  • Polymers & Plastics (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Dairy Products (AREA)

Abstract

A method for producing a clean lactase is described. The method comprises incubating a preparation comprising said lactase at a pH close to the isoelectric point of said lactase.

Description

TITLE
METHOD FOR PRODUCING A CLEAN LACTASE
The present invention relates to a method for preparing a lactase preparation involving incubating a preparation containing a lactase enzyme at a pH close to the isoelectric point of said lactase. The invention also relates to a lactase enzyme produced by the method of the invention.
INCORPORATION BY REFERENCE OF THE SEQUENCE LISTING
The sequence listing provided in the file named "NB41025USPSP_seq_listing _ST25.txt" with a size of 8,908 bytes which was created on December 7, 2015 and which is filed herewith, is incorporated by reference herein in its entirety.
BACKGROUND OF THE INVENTION
The use of enzymes to improve food grade products is well known, and such enzymes are routinely produced by fermentation of microorganisms that express them. However, it is also well known in the art that when fermenting a microorganism in order to obtain a desirable enzyme, one or more undesirable enzymes are often also expressed by said microorganism. If these undesirable enzymes are not effectively inactivated they may cause stability problems during recovery of the desirable enzyme and/or during storage of the desirable enzyme. Even if these other enzymes do not cause stability problems they may indeed be unwanted as industry for many purposes requires a "pure" enzyme without side-activities.
Examples of industrial uses of enzymes are incubations with lactase, for example to render milk and milk-based products acceptable for lactose intolerant individuals. Lactase (also known as lactase-phlorizin hydrolase, or LPH), is a member of the β-galactosidase family of enzymes, and is a glycoside hydrolase involved in the hydrolysis of the disaccharide lactose into constituent galactose and glucose monomers. In humans, lactase is encoded by the LCT gene.
Lactase is an enzyme produced by many organisms and is located in the brush border of the small intestine of humans and other mammals. Lactase is essential to the complete digestion of whole milk; it breaks down lactose, a sugar which gives milk its sweetness. An individual consuming dairy products comprising lactose in the absence of lactase may experience the symptoms of lactose intolerance. Lactose is present in dairy products and more specifically in milk, skimmed milk, cream and other milk products. The breakdown of
l lactose occurs in the intestinal wall of the human body (and other mammals) by the natural presence of lactase.
The nutritional and functional problems caused by lactose in most populations that lack lactase are well known and described. Members of such populations cannot hydrolyse the lactose, which in such cases passes into the large intestine, where it produces dehydration, poor calcium absorption, diarrhoea, flatulence, belching and cramps, and, in severe cases, even watery explosive diarrhoea.
Thus, an important industrial application of lactase is in the production of lactose-hydrolysed milk products for lactose intolerant individuals. Such hydrolysed milk products include pasteurized milk, UHT-milk and milk reconstituted from all or part of its original constituents with or without intermediate processing steps such as protein hydrolysis. Treatment with lactase may be done prior to and after the heat-treatment of the milk. The lactase treatment may be done by adding the enzyme to the milk. The solubility properties of lactose are such that it may lead to its crystallization, leading to a sandy or gritty texture. Such undesired texture may be found in some dairy products such as condensed milk, evaporated milk, dry milk, frozen milk, ice cream, and in confectionary products with a high content of milk. Full or partial hydrolysis of lactose by lactase eliminates this problem, providing products with a homogeneous texture and as a result a higher consumer acceptance.
A further application of lactase in food processing is to increase the sweet taste in lactose- containing products such as milk or yoghurt. The hydrolysis of lactose in such products results in an increased sweet taste due to glucose production. Furthermore, lactase may be employed in the hydrolysis of lactose products containing dairy components, for example bread. Lactose can be added to such products to enhance flavour, retain moisture, provide browning and improve toasting properties. Lactose hydrolysis by lactase in fermented milk products such as yoghurt will increase sweet taste. However, when the lactase is added prior to the beginning of the fermentative process, it may increase the rate of acid development and thus reduce processing times. The lactase treatment of milk or milk-derived products such as whey makes such products suitable for application in animal feed and pet food for lactose intolerant animals such as cats. The lactose hydrolysis allows the manufacture of higher concentrated whey and at the same time prevents gut problems, similar to those described earlier for lactose-deficient patients. Lactose hydrolysed whey is concentrated to produce a syrup containing 70-75% solids and is used as a food ingredient in ice cream, bakery and confectionary products. Lactases have been described for and isolated from a large variety or organisms, including micro-organisms. Some lactases are so-called neutral lactases as they have a pH optimum between pH = 6 and pH = 8. Other lactases are classified as acidic lactases, as they have a pH optimum of between pH=3.5 and pH=5.0. The present invention encompasses both neutral and acidic lactases. In one aspect the lactase is a neutral lactase. In an alternative aspect the lactase is an acidic lactase.
The enzymatic properties of lactases like pH- and temperature optimum vary between species. In general, however, lactases that are excreted show a lower pH-optimum of pH = 3.5 to pH = 5.0; intracellular lactases usually show a higher pH optimum in the region of pH = 6.0 to pH = 7.5, but exceptions on these general rules occur. The choice for a neutral or acidic lactase depends on the pH profile in the application. In applications with neutral pH, neutral lactases are usually preferred; such applications include milk, ice cream, whey, cheese, yoghurt, milk powder etc. Acid lactases are more suited for applications in the acidic range. Although aimed at improving the functionality and/or taste profiles of the food product, occasionally an enzyme treatment can have unexpected and undesirable side effects. An example of an undesirable side effect is the development of off-flavour as a result of the enzyme treatment, due to unwanted enzymatic activities in the enzyme preparation.
As such, it is desirable to remove unwanted enzymatic activities from enzyme preparations which are added to food-grade products. In view of its utility in this area, there is thus a need to produce isolated lactases, for example from which unwanted enzymatic activities have been removed.
Current methods used in the art to isolate and purify lactase enzymes involve column purification, which can be costly. Thus, there is a need for new and alternative methods of producing and isolating lactases which are cost effective and relatively quick and simple to carry out.
The present invention addresses this need.
SUMMARY OF THE INVENTION
The present inventors have surprisingly found that a lactase enzyme can be produced from a preparation comprising said lactase using a simple and cost-effective method involving precipitation of the lactase at a pH close to its isoelectric point. Prior to the present invention, it had not previously been appreciated that such a relatively simple method could produce a lactase preparation, wherein the lactase activity is retained following incubation at a pH close to its isoelectric point.
For example, acetone has been used previously in some cases to precipitate lactase enzymes, but such precipitation processes require large volumes of acetone to produce acidic lactase powders. The present invention provides an alternative, improved method for lactase precipitation in which a simple step of incubation at a pH close to the isoelectric point of said lactase is employed.
As such, the present invention provides a method for producing a lactase comprising incubating a preparation comprising said lactase at a pH close to the isoelectric point of said lactase. The method of the invention allows for production of a lactase which retains its activity following incubation at a pH close to the isoelectric point.
The invention also encompasses a lactase or lactase preparation produced by the method of the invention.
DESCRIPTION OF THE FIGURES Figure 1 shows the chromatographic fingerprint of lactase protein obtained from a Mono P column.
Figure 2 shows the results of SDD-PAGE analysis of lactase activity. Lane 1. Crude F3031 G; Lane 2. Crude after pH decrease to 4.0 and increase to 7.30; Lane 3. Supernatant pH 5.0: Lane 4. Pellet pH 5.0; Lane 5. Supernatant pH 4.5; Lane 6. Pellet pH 4.5; Lane 7. Supernatant pH 4.0; and Lane 8. Pellet pH 4.0.
BRIEF DESCRIPTION OF THE BIOLOGICAL SEQUENCES
The following sequences comply with 37 C.F.R. §§ 1.821-1.825 ("Requirements for Patent Applications Containing Nucleotide Sequences and/or Amino Acid Sequence Disclosures - the Sequence Rules") and are consistent with World Intellectual Property Organization (WIPO) Standard ST.25 (2009) and the sequence listing requirements of the European Patent Convention (EPC) and the Patent Cooperation Treaty (PCT) Rules 5.2 and 49.5(a- bis), and Section 208 and Annex C of the Administrative Instructions. The symbols and format used for nucleotide and amino acid sequence data comply with the rules set forth in 37 C.F.R. § 1.822. SEQ ID NO: 1 is the amino acid sequence of a lactase from Lactobacillus delbrueckii subsp. bulgaricus. DETAILED DESCRIPTION OF THE INVENTION
The present inventors have surprisingly found that it is possible to produce a lactase using a quick and cost-effective method, involving incubating a preparation comprising a lactase at a pH close to the isoelectric point of the lactase. As such, the present invention provides a method for producing a lactase comprising incubating a preparation comprising said lactase at a pH close to the isoelectric point of said lactase.
As demonstrated in Example 2 and Figure 2, when a preparation (crude extract) comprising a lactase was incubated at a pH close to the isoelectric point of the lactase, it was possible to recover the majority of the lactase activity and protein in a precipitated and resuspended pellet. This was surprising because lactases generally function as oligomeric enzymes. It was not obvious that a functioning lactase could be obtained following precipitation. The present invention represents a simplification of methods used previously in the art, and thus provides a valuable contribution to the art. The isoelectric point (pi, pH(l), IEP), is the pH at which a particular molecule carries no net electrical charge. The isoelectric point of a lactase may be determined by methods known in the art, for example as described in present Example 1.
As used herein, the term "close to its isoelectric point" is intended to mean a pH value near to the isoelectric point of the lactase. For example, the pH at which the lactase preparation is incubated may be within 2.0 units of the isoelectric point. For example, the pH at which the lactase preparation is incubated may be within 0.1-2.0 units, e.g. 0.1 , 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1 , 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9 or 2.0 units of the isoelectric point.
By "incubated at a pH close to the isoelectric point" is intended to mean keeping the preparation at a pH close to the isoelectric point, for example for an amount of time sufficient to allow precipitation of the lactase.
By "precipitation" is meant deposition in solid form from a solution. In the present invention the lactase may be precipitated from the preparation comprising said lactase. In one aspect 50-100% of lactase is precipitated. For example, about 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100% of lactase protein or activity is precipitated.
The lactase may be an intracellular or an extracellular produced lactase. In a preferred embodiment the lactase is extracellular. The reference to a lactase as used herein is intended to mean any enzyme with lactase activity.
The lactase may be from a Lactobacillus, for example a species of Lactobacillus such as Lactobacillus delbrueckii, e.g. Lactobacillus delbrueckii bulgaricus. Lactobacillus delbrueckii subsp. bulgaricus was until 2014 known as Lactobacillus bulgaricus. The term "Lactobacillus bulgaricus" is used herein, but this is intended to be equivalent to Lactobacillus delbrueckii bulgaricus.
In a preferred embodiment the lactase is from Lactobacillus bulgaricus. The amino acid sequence of L. bulgaricus is publically available, for example as UniProtKB - P0C1Y0 (BGAL_LACDE) (www.uniprot.org/uniprot/P0C1Y0). Alternatively the lactase may be a lactase having an amino acid sequence which is at least 80, 85 or 90%, preferably at least 95% identical with the amino acid sequence of L. bulgaricus lactase as set out in SEQ ID NO:1 :.
SEQ ID NO: 1
MSNKLVKEKRVDQADLAWLTDPEVYE TIPPHSDHESFQSQEELEEGKS SLVQSLDGDWLIDYAENGQGP FYAEDFDDSNFKSVKVPGNLELQGFGQ PQY VQYPWDGSEEIFPPQIPSKNPLASYVRYFDLDEAFWDKEVSLKFD GAATAIYVWLNGHFVGYGEDSFTPSEFMVTKFLKKENNRLAVALYKYSSA SWLEDQDFWRMSGLFRSVTLQAKPRLHLEDLKLTASLTDNYQKGKLEVEA NIAYRLPNASFKLEVRDSEGDLVAEKLGPIRSEQLEFTLADLPVAAWSAE KPNLYQVRLYLYQAGSLLEVSRQEVGFRNFELKDGIMYLNGQRIVFKGAN RHEFDSKLGRAITEEDMIWDIKTMKRSNINAVRCSHYPNQSLFYRLCDKY GLYVIDEANLESHGTWEKVGGHEDPSFNVPGDDQHWLGASLSRVKNMMAR DKNHASILIWSLGNESYAGTVFAQMADYVRKADPTRVQHYEGVTHNRKFD DATQIESRMYVPAKVIEEYLTNKPAKPFISVEYAHAMGNSVGDLAAYTAL EKYPHYQGGFIWDWIDQGLEKDGHLLYGGDFDDRPTDYEFCGNGLVFADR TESPKLANVKALYANLKLEVKDGQLFLKNDNLFTNSSSYYFLTSLLVDGK LTYQSRPLTFGLEPGESGTFALPWPEVADEKGEWYRVTAHLKEDLPWAD EGFTVAEAEEVAQKLPEFKPEGRPDLVDSDYNLGLKGNNFQILFSKVKGW PVSLKYAGREYLKRLPEFTFWRALTDNDRGAGYGYDLARWENAGKYARLK DISCEVKEDSVLVKTAFTLPVALKGDLTVTYEVDGRGKIAVTADFPGAEE AGLLPAFGLNLALPKELTDYRYYGLGPNESYPDRLEGNYLGIYQGAVKKN FSPYLRPQETGNRSKVRWYQLFDEKGGLEFTANGADLNLSALPYSAAQIE AADHAFELTNNYTWVRALSAQMGVGGDDSWGQKVHPEFCLDAQKARQLRL VIQPLLLK
It is defined here that in order to determine the percent identity of two amino acid sequences or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity = number of identical positions/total number of positions (i.e. overlapping positions) x 100). Preferably, the two sequences are the same length.
The skilled person will be aware of the fact that several different computer programs are available to determine the homology between two sequences. For instance, a comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. In one embodiment the lactase is not from a Kluyveromyces species, for example K. lactis.
The method of the invention may be performed on any lactase preparation which contains a lactase, and, in a preferred embodiment , at least one further enzyme. The method is particularly useful when the preparation is a culture or fermentation broth. The method of the invention may be applied to an untreated culture broth (whole culture broth) , to a homogenized culture broth, or to a whole or homogenized culture broth.
According to the method of the invention, during the incubation the temperature should be held in the range of from 2-75°C, in particular in the range of from 10-70°C, preferably in the range of from 5-25°C.
The incubation time may be anything from 1 second to a couple of weeks, typically the holding time will be in the range of from 1 second to 24 hours, , preferably in the range of from 1 second to 4 hours.
In one aspect of the invention no further or additional purification steps are performed. In a preferred embodiment no column purification of the lactase is performed, for example, no ion exchange, affinity or size exclusion column purification is performed, nor column purification based on hydrophobic interaction.
The invention also encompasses a lactase enzyme produced by any aspect of the method of the invention.
Also encompassed are food and beverage products comprising the lactase according to the invention. A lactase according to the invention may be used in the production of a food or beverage product, preferably a dairy product. The dairy product may be selected from milk, ice cream, whey, cheese, yoghurt, and milk powder etc. In one embodiment the product is in the form of a milk drink.
The lactase according to the present invention or produced by a method according to the invention may be substantially free of unwanted enzymatic activities, and hence the method of the invention can also be used to purify lactase from a preparation comprising said lactase and other enzymes.
As used herein, a lactase "substantially free" from unwanted enzymatic activities may encompass any lactase, in which the unwanted enzymatic activity or activities is not present or present at a sufficiently low level that, upon effective dosage of the lactase in the relevant production process, no observable activity of the unwanted enzyme activities is observed.
Unwanted enzymatic activities can be any enzymatic activities that are not the desired lactase activity. For example, the unwanted enzyme activity may be an enzyme selected from the group consisting of lipases, amylases, cellulases, oxidoreductases, xylanases, isomerases, peptidases and proteases. In one aspect the unwanted enzymatic activity is aryl sulfatase.
In a further aspect of the invention, the invention provides a lactase which comprises less than e.g. 20-1000 units of arylsulfatase activity per NLU, for example, less than 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900 or 1000 units activity per NLU. The lactase according to the invention may advantageously be used in food and feed products to hydrolyse lactose without the formation of off-flavour compounds.
By way of example, the preparation of intracellular lactases requires the disruption of the cells to release the lactase enzyme. At the same time, other cytoplasmic enzymes are released. The quality of an industrial preparation of the lactase may be determined by the ratio of unwanted enzyme activities to lactase activity. Proteases are critical unwanted enzymes since they are known to lead to unwanted side effects in application, such as milk clotting or off-flavour formation in milk.
"Off-flavour" compounds include p-cresol (produced by aryl sulfatase), and bitter peptides.
The invention will now be further described by way of Examples, which are meant to serve to assist one of ordinary skill in the art in carrying out the invention and are not intended in any way to limit the scope of the invention. EXAMPLES EXAMPLE 1
DETERMINATION OF THE ISOELECTRIC POINT OF L. BULGARICUS LACTASE Background Chromatofocusing is a chromatography technique that separates proteins according to differences in their isoelectric point (pi). The pi of each protein is the pH at which the protein has zero surface charge. Proteins with different pi can be separated by being passed through a chromatofocusing column while a pH gradient is generated on the column by specifically designed and matched amphoteric buffers. Proteins elute in order of their isoelectric points.
Materials
AKTA explorer system was used for protein purification and according to the method described by the manufacturer, GE, USA - Cat. No. 18-1 112-41.
The MonoP column was obtained from GE Life sciences, USA - Cat. No. 17-0611-01. PD-10 column was obtained from GE Life sciences, USA - Cat. No. 17-0851-01.
Na- dihydrogen phosphate was obtained from Merck, Germany - Cat. No. 1.06346.
Tris (hydroxymethyl) aminomethane was obtained from Sigma-Aldrich, Germany - Cat. No. 154563.
Polybuffer 74 was obtained from GE Life sciences, USA - Cat. No. 17-0713-01. Nu-PAGE gel was obtained from Invitrogen, USA - Cat. No. NP0321.
Mes running buffer was obtained from Invitrogen, USA - Cat. No. NP0002.
SeeBlue standard marker was obtained from Invitrogen, USA - Cat. No. LC5925.
SDS-PAGE analyses was carried out using Xcell Mini-cell and according to the method described by the manufacturer, Invitrogen, USA - Cat. No. EI0001. Sample:
Lactobacillus bulgaricus lactase (fermentation number F3031 G) Methods
Desalting, PD-10 desalting column
The PD-10 column was prepared as described by the manufacturer and equilibrated with 20 mM Tris/HCI, pH 8.5 (buffer A). The Sample was diluted 2x with desalting buffer and desalted on the column.
Chromatofocusing, Mono P HR10/8
The column was prepared as described by the manufacturer and equilibrated with 20 mM Tris/HCI, pH 8.5 (buffer A). The sample (2 ml desalted sample) was applied to the column at a flow rate of 1.5 ml/min and the column was washed with buffer A. The bound proteins were eluted according to differences in their isoelectric point with a linier pH gradient of 8.5-4.0 using 10% Polybuffer 74, pH 4.0/HCI (buffer B). During the entire run, fractions of approx. 1.0 ml were collected and subjected to pH-measurement and lactase enzyme assay.
Lactase assay
Lactase (Neutral) Beta-Galactosidase activity - FCC IV was determined using the following parameters:
Substrate: ONPG, pH 6.50;
10 μΙ_ sample/blank;
90 μΙ_ substrate;
Incubation for 5 m in at 32°C; Read at 420 nm using a ELISA reader.
Results and discussion
The chromatographic fingerprint of lactase protein obtained from the Mono P column is shown in Figure 1. As shown, the lactase protein elutes at the end of pH gradient having the pi of approx. 4.1 (see Table 1). Table 1
Figure imgf000012_0001
EXAMPLE 2
EVALUATION OF THE EFFICIENCY OF ISOELECTRIC POINT PRECIPITATION AND RECOVERY OF L. BULGARICUS LACTASE PROTEIN.
The isoelectric point of the L. bulgaricus lactase protein was determined to be 4.1 as described in Example 1.
Sample: Crude F3031 G - 496 NLU/ml - pH 7.31 (30 mL)
Method
The pH was stepwise adjusted down to 5.0, 4.5 and 4.0 by the addition of ice cold H2S04 solution (2 M). Samples were taken (2 mL) at each pH point and pellets were separated from supernatants by 5 min centrifugation at 10000g. Pellets were re-solubilized by the addition of 2.0 mL of PEM buffer. The Supernatants were added 200 μί of a 1.0 M Na-P buffer (pH 8.0). Both supernatants and pellets were subjected to lactase assay and SDS-PAGE analysis.
The remaining sample was added NaOH (1.0 M) to bring the pH to its original value (7.3) - without removal of pellet, precipitation was completely reversible.
SDD-PAGE analysis was carried out using the following parameters: 10 sample, 30 100mM Na-P, pH 6.5, 17 μί 5x sample buffer +DTT, 5 min heat, and 10 μ\- load. The results are shown in Figure 2.
Lane 1. Crude F3031G Lane 2. Crude after pH down to 4.0 and up to 7.30
Lane 3. Supernatant pH 5.0
Lane 4. Pellet pH 5.0
Lane 5. Supernatant pH 4.5
Lane 6. Pellet pH 4.5 Lane 7. Supernatant pH 4.0
Lane 8. Pellet pH 4.0
Lactase activity was assayed using the following parameters: Lactase assay Substrate: FCC IV NLU, 10 μΙ of 100x diluted sample/blank (diluted in PEM buffer), 190 μΙ substrate, 5 min/32°C/420nm.
Results
The results are shown in Table 2 below:
Figure imgf000014_0001
The addition of H2S04 caused rapid and smooth precipitation of lactase protein started at pH 5.0 and completed at pH 4.0. The resolubilization of the lactase protein pellet was fast and 100%, and the resulting solution was crystal clear. The highest lactase recovery (activity) was achieved at pH 4.5. However, pH 4.0 generated the highest lactase protein pellet as judged by SDS-PAGE analysis (the decrease in enzyme activity at this pH was most likely due to protein instability/aggregation).
This condition of lactase protein precipitation/recovery might be improved by the pH fine- tuning (depending on the nature of the crude).
The recovered lactase solution had a decrease in odour.
All documents referred to herein are hereby incorporated by reference in their entirety, with special attention to the subject matter for which they are referred Various modifications and variations of the described methods and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in molecular biology, cellular immunology or related fields are intended to be within the scope of the following claims.

Claims

1. A method for producing a lactase comprising incubating a preparation comprising said lactase at a pH close to the isoelectric point of said lactase.
2. A method for reducing unwanted enzymatic activities in a preparation comprising lactase, comprising incubating said preparation at a pH close to the isoelectric point of said lactase.
3. The method of claim 1 or claim 2 wherein the lactase is precipitated from said preparation.
4. The method of claim 3 wherein about, or at least about, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100% of lactase protein or activity is precipitated from said preparation.
5. The method of any one of claims 1 to 4 wherein said pH is within 0.8 units of the isoelectric point of said lactase.
6. The method of any one of claims 1 to 5, wherein said lactase is from a Lactobacillus.
7. The method of any one of claims 1 to 6 wherein said lactase is from Lactobacillus bulgaricus.
8. The method of any one of claims 1 to 7 wherein said lactase is from Lactobacillus bulgaricus, and said isoelectric point is 4.1.
9. The method of any one of claims 1 to 8 wherein the lactase is not from a Kluyveromyces species, preferably not from K. lactis.
10. The method of any one of claims 1 to 9 comprising the step of forming a pellet of said lactase, and subsequently dissolving said pellet in a medium.
11. The method of any one of claims 1 to 10 wherein a further purification step is not performed.
12. The method of any one of claims 1 to 1 1 wherein a column purification step is not performed.
13. The method of any one of claims 1 to 12 wherein said preparation comprising a lactase is a fermentation broth.
14. The method of claim 2, wherein said unwanted enzymatic activities are selected from lipases, amylases, cellulases, oxidoreductases, xylanases, isomerases, peptidases and proteases.
15. The method of claim 2 wherein the unwanted enzymatic activity is aryl sulfatase.
16. A lactase produced by the method of any one of claims 1 to 15.
17. A lactase produced by the method of any one of claims 1 to 15, which is substantially free of unwanted enzymatic activities.
18. A food or beverage product comprising the lactase of claim 16 or claim 17.
19. The food or beverage product of claim 18 which is a dairy product, preferably selected from milk, ice cream, whey, cheese, yoghurt, and milk powder.
20. Use of a lactase produced by the method of any one of claims 1 to 15 for use in the production of a food or beverage product according to claim 18 or claim 19.
21. A method, or food, or use substantially as described herein.
PCT/US2016/066519 2015-12-14 2016-12-14 Method for producing a clean lactase Ceased WO2017106264A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562266812P 2015-12-14 2015-12-14
US62/266,812 2015-12-14

Publications (1)

Publication Number Publication Date
WO2017106264A1 true WO2017106264A1 (en) 2017-06-22

Family

ID=57737985

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/066519 Ceased WO2017106264A1 (en) 2015-12-14 2016-12-14 Method for producing a clean lactase

Country Status (1)

Country Link
WO (1) WO2017106264A1 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20200205431A1 (en) * 2017-06-15 2020-07-02 Dsm Ip Assets B.V. Frozen enzyme pellets
AU2018251957B2 (en) * 2017-04-11 2022-04-07 Kerry Group Services International Ltd Lactase enzymes with improved properties
US12435326B2 (en) 2017-04-11 2025-10-07 Kerry Group Services International Ltd Lactase enzymes with improved properties

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1306751A (en) * 1971-01-26 1973-02-14 Baxter Laboratories Inc Lactase enzyme production
WO2007060247A2 (en) * 2005-11-28 2007-05-31 Dsm Ip Assets B.V. Enzyme preparations yielding a clean taste

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1306751A (en) * 1971-01-26 1973-02-14 Baxter Laboratories Inc Lactase enzyme production
WO2007060247A2 (en) * 2005-11-28 2007-05-31 Dsm Ip Assets B.V. Enzyme preparations yielding a clean taste

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
C BRAMAUD ET AL: "Whey protein fractionation: isoelectric precipitation of alpha-lactalbumin under gentle heat treatment", BIOTECHNOLOGY AND BIOENGINEERING, 20 November 1997 (1997-11-20), United States, pages 391 - 397, XP055347142, Retrieved from the Internet <URL:http://onlinelibrary.wiley.com/doi/10.1002/%28SICI%291097-0290%2819971120%2956:4%3C391::AID-BIT5%3E3.0.CO;2-J/pdf> [retrieved on 20170216], DOI: 10.1002/(SICI)1097-0290(19971120)56:4<391::AID-BIT5>3.0.CO;2-J *
JIAN CHEN ET AL: "Large-scale purification of human granulocyte-macrophage colony-stimulating factor expressed in Bombyx mori pupae", APPLIED BIOCHEMISTRY AND BIOTECHNOLOGY ; PART A: ENZYME ENGINEERING AND BIOTECHNOLOGY, vol. 141, no. 1, 1 April 2007 (2007-04-01), New York, pages 149 - 159, XP055347141, ISSN: 0273-2289, DOI: 10.1007/s12010-007-9217-1 *
STANDARD ST.25, 2009

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2018251957B2 (en) * 2017-04-11 2022-04-07 Kerry Group Services International Ltd Lactase enzymes with improved properties
AU2018251957C1 (en) * 2017-04-11 2023-09-28 Kerry Group Services International Ltd Lactase enzymes with improved properties
AU2018251957C9 (en) * 2017-04-11 2025-03-20 Kerry Group Services International Ltd Lactase enzymes with improved properties
US12435326B2 (en) 2017-04-11 2025-10-07 Kerry Group Services International Ltd Lactase enzymes with improved properties
US20200205431A1 (en) * 2017-06-15 2020-07-02 Dsm Ip Assets B.V. Frozen enzyme pellets

Similar Documents

Publication Publication Date Title
AU2024202679A1 (en) Food products comprising milk proteins and non-animal proteins, and methods of producing the same
DK2439266T3 (en) Enzyme preparations to obtain a pure taste
Irazoqui et al. Enzymes for production of whey protein hydrolysates and other value-added products
Karav Selective deglycosylation of lactoferrin to understand glycans' contribution to antimicrobial activity of lactoferrin
Gagnaire et al. Survey of bacterial proteins released in cheese: a proteomic approach
Princely et al. Biochemical characterization, partial purification, and production of an intracellular beta-galactosidase from Streptococcus thermophilus grown in whey
JP7122114B2 (en) Novel β-galactosidase
Prasad et al. Extraction and characterisation of β-galactosidase produced by Bifidobacterium animalis spp. lactis Bb12 and Lactobacillus delbrueckii spp. bulgaricus ATCC 11842 grown in whey
WO2017106264A1 (en) Method for producing a clean lactase
US20240032553A1 (en) Frozen enzyme pellets
Robitaille et al. Growth-promoting effects of pepsin-and trypsin-treated caseinomacropeptide from bovine milk on probiotics
JP7535620B2 (en) Method for producing galactooligosaccharides
Mozumder et al. Study on isolation and partial purification of lactase (β-galactosidase) enzyme from Lactobacillus bacteria isolated from yogurt
JP5681341B2 (en) Fermented milk production method and fermented milk food and drink
Kandari et al. Purification and characterization of hydrolytic and transgalactosyl α-galactosidase from Lactobacillus helveticus ATCC 10797
Agyei et al. Bioanalytical evaluation of Lactobacillus delbrueckii subsp. lactis 313 cell-envelope proteinase extraction
Dushkova et al. Physicochemical, microbiological, and sensory characteristics of probiotic Bulgarian yoghurts obtained by ultrafiltration of goat’s milk
WO2024043297A1 (en) Composition production method, oligosaccharide-containing composition obtained thereby, and utilization of said method and composition
EP3435772A1 (en) Enzyme composition and preparation of a dairy product with improved properties
EP3435771A1 (en) Enzyme composition and preparation of a dairy product with improved properties
C Perotti et al. Dairy products modified in their lactose content
US20170367357A1 (en) Lactase solution and dairy product using same
WO2009150888A1 (en) Milk protein degradation product, manufacturing method for milk protein degradation product and bifidobacterial growth-promoting agent
CN114514317A (en) Production of lactase using a strain with altered regulation
Abd et al. Lactulose Production in Skim Milk by β-Galactosidase from Lactobacillus acidophilus

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16822576

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 16822576

Country of ref document: EP

Kind code of ref document: A1