WO2017089529A1 - Immunostimulatory compositions - Google Patents

Immunostimulatory compositions Download PDF

Info

Publication number
WO2017089529A1
WO2017089529A1 PCT/EP2016/078794 EP2016078794W WO2017089529A1 WO 2017089529 A1 WO2017089529 A1 WO 2017089529A1 EP 2016078794 W EP2016078794 W EP 2016078794W WO 2017089529 A1 WO2017089529 A1 WO 2017089529A1
Authority
WO
WIPO (PCT)
Prior art keywords
melanin
antigen
dopa
composition
immunostimulatory composition
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2016/078794
Other languages
French (fr)
Inventor
Antoine Carpentier
Claire Banissi
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Assistance Publique Hopitaux de Paris APHP
Universite Sorbonne Paris Nord
Original Assignee
Assistance Publique Hopitaux de Paris APHP
Universite Sorbonne Paris Nord
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to HRP20211085TT priority Critical patent/HRP20211085T1/en
Priority to DK16801468.6T priority patent/DK3380120T3/en
Priority to KR1020187018135A priority patent/KR102448132B1/en
Priority to US15/778,929 priority patent/US10857227B2/en
Priority to BR112018010692A priority patent/BR112018010692A8/en
Priority to EP16801468.6A priority patent/EP3380120B1/en
Priority to RU2018123170A priority patent/RU2732118C2/en
Priority to SI201631266T priority patent/SI3380120T1/en
Priority to PL16801468T priority patent/PL3380120T3/en
Priority to JP2018546753A priority patent/JP7033539B2/en
Priority to LTEP16801468.6T priority patent/LT3380120T/en
Priority to CA3005930A priority patent/CA3005930C/en
Application filed by Assistance Publique Hopitaux de Paris APHP, Universite Sorbonne Paris Nord filed Critical Assistance Publique Hopitaux de Paris APHP
Priority to CN201680074969.0A priority patent/CN108601826B/en
Priority to AU2016360902A priority patent/AU2016360902B2/en
Priority to ES16801468T priority patent/ES2877552T3/en
Publication of WO2017089529A1 publication Critical patent/WO2017089529A1/en
Priority to IL259575A priority patent/IL259575B/en
Anticipated expiration legal-status Critical
Priority to US17/089,172 priority patent/US11904014B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/385Haptens or antigens, bound to carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55516Proteins; Peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/572Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/575Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6093Synthetic polymers, e.g. polyethyleneglycol [PEG], Polymers or copolymers of (D) glutamate and (D) lysine

Definitions

  • the invention is in the field of immunology, in particular in the field of adjuvants, i.e. elements that potentiate the immunogenic property of antigens, and is useful in particular in the field of vaccines, whether prophylactic or therapeutic.
  • PRRs pattern recognition receptors
  • PRRs pattern recognition receptors
  • TLRs Toll-like receptors
  • NOD nucleotide-binding and oligomerization domain
  • RLRs Retinoic-acid inducible gene (RIG)-like receptors
  • DNA receptors DNA receptors
  • scavenger receptors scavenger receptors
  • CLRs C-type lectin receptors
  • PRRs antigen-presenting cells
  • DCs dendritic cells
  • macrophages to trigger an adaptive immune response
  • Some adjuvants activate either the antibody secretion by B-lymphocytes (humoral response), or the cytotoxic T lymphocytes (CTLs; also called CD8 T cells) response (cellular response), or both.
  • B-lymphocytes recognize longer peptides starting at around 15 amino acids, presented on the surface of an antigen presenting cell (APC) by major histocompatibility complex (MHC) class II molecules.
  • MHC major histocompatibility complex
  • Cytotoxic T lymphocytes recognize short peptides of eight to ten amino acid residues, presented on the surface of an APC, or a target cell, by MHC class I molecules.
  • the main processing pathway for MHC class I presentation involves degradation of cytosolic proteins.
  • extracellular soluble antigens or peptides are presented by the MHC class I, a process called cross-presentation (Foged et al., Eur J Pharm Sci. 2012 Mar 12;45(4):482-91 ).
  • Licensing of cross-presentation by DCs can be initiated by CD4+ T-cell (CD40:CD40L ligation) or, in a CD4+ T-cell independent way, through ligation of innate PPRs such as the TLRs (mainly TLR3, TLR7/8 or TLR9) (Foged et al., op.cit).
  • vaccine components usually contain at least two antigenic epitopes: the target antigen that elicits an antigen-specific B cell or CTL response, and a TH epitope.
  • the target antigen that elicits an antigen-specific B cell or CTL response
  • a TH epitope a large number of polymorphisms in MHC class II genes in the population, some 'universal' TH epitopes binding a large number of MHC class II have been designed to be included in vaccines (P25, ptt- 30, PADRE, ).
  • TH-cells are further subdivided into lineages (Th1 , Th2, Th17, ...) according to their cytokine profiles and their ability to modulate B and cytotoxic CD8 response.
  • Adjuvants can bias the immune responses towards Th1 or Th2 responses and can also modulate T regulatory Lymphocytes (Treg).
  • T regulatory Lymphocytes For example, aluminium salts (Alum), widely used in human vaccination, induce predominantly a Th2 immune response.
  • CFA complete Freund's adjuvant
  • cationic peptides such as IC31 or polyarginine
  • Catechols also known as pyrocatechol or o-hydroxyphenols or 1 ,2- dihydroxybenzen
  • Catechols play a major role in life and are involved in various biological processes such as neurotransmission, melanogenesis, marine biology, melanization in insects (Eleftherianos et al, J Innate Immun 201 1 ;3:28-33; Viljakainen, Brief Funct Genomics. 2015;14(6):407-12), or sclerotization of arthropod cuticle (Andersen, Insect Biochem Mol Biol. 2010;40(3):166-78).
  • Catecholamines are neurotransmettors that are synthesized from L-tyrosine by a series of enzymatic pathways.
  • tyrosine hydroxylase removes a hydroxyl group to produce L-DOPA (3,4-dihydroxyphenylalanine).
  • L-DOPA is decarboxylated to form dopamine by L-aromatic amino-acid decarboxylase (LADCC); which is then catabolized to noradrenaline and adrenaline by hydroxylases
  • LADCC L-aromatic amino-acid decarboxylase
  • DB Dopamine beta-hydroxylase
  • PNMT Phenylethanolamine-N-methyl- transferase
  • catechols Besides their role as precursors of catecholamines, catechols have the ability to undergo oxidation, generating chemical compounds with strong adhesive properties on substrate/other molecules, either by covalent or non-covalent bounds. Such oxidative process plays a major role in various biological processes such as melanogenesis, marine biology, melanization in insects, or sclerotization of arthropod cuticle.
  • melanin synthesis plays a major role in animals to protect them against the harmful and mutagenic ultraviolet light rays.
  • activation of phenoloxidase (PO) also leads to the formation of melanin around intruding microorganisms, a process named melanization, that allows encapsulation of foreign particles (Eleftherianos, 201 1 , op.c/ ' i.; Viljakainen 2015, op. cit).
  • melanins are macromolecules formed by oxidative polymerization of phenolic or indolic compounds via a series of enzymatic and non-enzymatic reactions (Slominski et al, Physiol Rev. 2004;84(4):1 155-228).
  • L-Dopa is a well-known precursor of melanin ( Figure 1 ).
  • melanins are heterogeneous compounds, and 4 types of melanin have been described: (1 ) Eumelanins produced by serial oxidations of L- Dopa and leading mainly to copolymers of Dihydroxyindole carboxylic acid (DHICA) and 5, 6-dihydroxyindole (DHI); (2) Pheomelanins in which L-Dopa undergoes cysteinylation, by conjugation with glutathione or cysteine, leading to polymers containing benzothiazine and benzothiazole; (3) Neuromelanin (NM) which is produced in specific populations of catecholaminergic neurons in the brain; (4) and, mainly found in many fungi and plants, allomelanins or catechol melanins resulting from oxidation or polymerization of various compounds such as di-or tetra-hydroxynaphthalene, homogentisic acid, v-glutarminyl-4-
  • Melanin is thus a broad and generic term for designating a group of natural pigments found in most organisms (arachnids are one of the few groups in which it has not been detected), usually produced by the oxidation of the amino acid tyrosine, followed by polymerization.
  • melanin as natural pigments (i.e. a colored material), produced by the oxidation of the amino acid tyrosine, followed by polymerization. This oxidation, which is a critical step, is generally mediated by the enzyme tyrosinase, which will convert tyrosine to DOPA.
  • melanin as a complex polymer derived from the amino acid tyrosine, by various steps including catalysis of the L-3,4-dihydroxyphenylalanine by tyrosinase.
  • Melanin is also defined and claimed in EP 313380 as "a major class of broad- spectrum ultraviolet-absorbing organic polymers found naturally in various vegetables (mushrooms), animal species (squid, octopus, etc.) and, very importantly, in the human epidermis. They are formed in the epidermis by the enzymatic conversion of L-tyrosine into L-3,4-dihydro y phenylalanine, commonly referred to as L-dopa. The L-dopa is further converted to a melanin by a biologic pathway which is well described in the literature.”
  • melanin is obtained through a complex process (as reminded in Figure 1 ) that combines both the oxidation of melanin precursors and their subsequent polymerization. This combined process is thus different from the mere polymerization of melanin precursors such as a polytyrosine for instance.
  • Melanin can be synthetically produced and is sold as such, for instance by Sigma Aldrich, as prepared oxidation of tyrosine with hydrogen peroxide.
  • melanin represents a polymeric pigment known and recognized in the art which cannot be confused with a mere polypeptide of amino-acids that are melanin precursors.
  • a polytyrosyl obtained without oxidative polymerization would not be considered as a melanin molecule by a person skilled in the art.
  • Melanin synthesis involves several intermediary compounds, several enzymes and can be modified by pH, presence of cationic metals, temperature.
  • Pawelek (1993, 1995) described a method to produce soluble synthetic melanin by combining dopachrome and an appropriate enzyme, or by incubating 5,6-dihydroxyindole-2-carboxylic acid alone or with 5,6- dihydroxyindole, or with 3-amino-tyrosine (US Patent 5225435; US Patent 53841 16).
  • MAPs Mussel Adhesive Proteins
  • L-Dopa L-Dopa
  • oxidative polymerization thus leading to melanin-like compounds
  • Several primary catecholamines, such as Norepinephrine, Dopamine, or Dopa-containing polymers can undergo similar oxidative polymerization that can build up adhesive films on the surfaces of solid materials (Lee, op.
  • cuticular sclerotization is a process closely related to melanization, by which cuticles are stabilized by incorporation of phenolic compounds.
  • Sclerotization mainly involves 3 catechols (N-acetyldopamine (NADA), dehydro-NADA and N-b-alanyldopamine (NBAD)) that are first oxidized to ortho-quinones by tyrosinase or laccase.
  • NADA N-acetyldopamine
  • NBAD N-b-alanyldopamine
  • the corresponding ortho-quinones can be rearranged to para-quinone methides and further oxidized to unsaturated quinoid derivatives and dehydro-benzodioxine derivatives.
  • the ortho-quinones and para- quinone methides are highly reactive compounds and can form adducts by reaction with nucleophilic compounds (such as cysteine, histidine, methionine, lysine, alanine, tyrosine) to give acyldopamines substituted in the 6-position of the aromatic ring (mainly for ortho-quinone) or substituted in the beta-position of the side chain (for para-quinone methides) ( Andersen 2010, op. cit).
  • nucleophilic compounds such as cysteine, histidine, methionine, lysine, alanine, tyrosine
  • RPE retinal pigment epithelium
  • the melanin appears as a companion during the purification process, as the antigen remains pathogenic even after antigen solubilisation by V8 protease (table 5, Bora 1995), making the role of melanin in the physiopathology of the disease unlikely.
  • Other examples of such association have not been described in the literature.
  • Direct modulation of the immune system by the neurotransmitter dopamine through autocrine/paracrine manner has been suggested.
  • Dopamine shows conflicting effects on the immune system. Dopamine can potentiate the production of Th2 cytokines by human naive CD4 T-cells, of Th1 cytokines by activated CD4 T-cells; or of Th17 cytokines (IL-23) by DCs.
  • Dopamine can inhibit the suppressive activity of regulatory T-cells (T-reg) , favor T-cell migration, but can also inhibit human T-cell proliferation (Sarkar et al, Brain Behav Immun. 2010; 24(4): 525-528; Pacheco et al, Front Immunol. 2014;5:1 17). Altogether, the effects of Dopamine on the immune system are complex and not straightforward. These effects do not directly trigger an antigen- specific immune response, are mediated by DARs and do not require a close vicinity between the antigen and dopamine.
  • T-reg regulatory T-cells
  • DHICA 5,6-dihydroxyindole-2-carboxylic acid
  • Arnon et al (1960 - Biochem. J., 75: 103-109) disclose among others, antigen protein, i.e. gelatin, egg albumin or edestin, bound to polytyrosyl, which is not a melanin I.
  • Fujita et al (Chemistry Central Journal, Biomed Central Ltd, vol. 5, no. 1 , 23 August 201 1 (201 1 -08-23), page 48) reviews the status of multiple antigen- presenting peptide vaccine systems, using nanoparticles. This document does not mention nor suggest to prepare complexes of melanin and antigens for increasing immunogenicity of the antigen.
  • Cui et al (NANO, vol. 10, no. 05, 1 July 2015 (2015-07-01 ), pages 1530003-1 to 1530003-23) further disclose poly-dopamine capsules. The particles are not used to obtain an immunogenic composition.
  • US 2012/237605 discloses nanoparticules with a polydopamine-based surface, but does not suggest or disclose the use thereof as immunogenic compositions.
  • Liu et al (Small. 2016 Apr 6;12(13):1744-57) disclose pathogen-mimicking polymeric nanoparticles based on dopamine polymerization as vaccines adjuvants induce robust humoral and cellular immune responses. Antigen is added after formation of the melanin.
  • the invention is based on the fact that melanin can be used as a potent adjuvant for inducing immunity against an antigen, when administered conjointly with this antigen. It is preferred when the melanin and the antigen are complexed, in particular when the antigen is trapped within the melanin.
  • a “melanin” is a pigment being a macromolecule obtained from the oxidative polymerization of precursors related to indole or cathecol.
  • Figure 1 describes the synthesis of one type of melanin (eumelanin).
  • a melanin according to the present invention may be a "natural" melanin that could be found in nature, such as the eumelanin obtained from the polymerization of the precursors as depicted in Figure 1 , a MAPs-like polymer (containing a high proportion of a melanin precursor), or a melanin-like molecule obtained from the polymerization of precursor derivatives such as the ones described below.
  • melanins which are produced by the oxidation of the amino acid tyrosine, followed by polymerization: eumelanin, pheomelanin, and neuromelanin and plant melanins.
  • a preferred melanin in the context of the present application, is eumelanin.
  • the composition described below and used in the composition of the invention may also use other types of melanins such as pheomelanins, neuromelanins, plant melanins, MAPs-like polymers (obtained from oxidation of polymers containing a high proportion of a melanin precursor such as L-Dopa) which can be considered as melanin-like molecules, as well as non-natural melanins obtained through polymerization of derivatives of melanin precursors.
  • the first step of the biosynthetic pathway for both eumelanins and pheomelanins is catalysed by tyrosinase that promotes the oxidation of its substrates ( Figure 1 ):
  • Dopaquinone can combine with cysteine by two pathways to benzothiazines and pheomelanins
  • dopaquinone can be converted to leucodopachrome and follow two more pathways to the eumelanins
  • a “melanin precursor” is a molecule that is used or synthetized during the synthesis of a melanin.
  • L-tyrosine is a preferred precursor, and would require oxidative polymerization.
  • L-dopa is a preferred precursor.
  • D-dopa is a preferred precursor.
  • 6-hydroxy-Dopa is a preferred precursor.
  • DHICA is a preferred precursor.
  • DHI is a preferred precursor.
  • Dopamine is a preferred precursor.
  • melt precursor further includes derivatives of such precursors and/or polymers containing a high proportion of such precursors (such as in Mussel Adhesives Proteins).
  • L-Dopa L-Dopa, D-Dopa, Dopamine, norepinephrine (noradrenaline), epinephrine (adrenaline) , 6-hydroxydopa, catechin, dihydrocaffeic acid, caffeic acid, (3,4-dihydroxyphenylacetic acid) DOPAC; 3,4-Dihydroxymandelic acid, acyldopamines, N-acetyldopamine, dehydro- N-acetyldopamine and N-b- alanyldopamine, dopaquinone, dopamine-o-quinone, norepinephrine-o-quinone, epinephrine-o-quinone.
  • a particulary prefered material is L-DOPA (L-3,4-dihydroxyphenylalanine), D- DOPA (D-3,4-dihydroxyphenylalanine), 6-hydroxydopa, or substituted derivatives thereof
  • R1 , R2 and R3 are independently hydrogen -OH, or C1 to C6 alkyl groups.
  • a precursor of cathecol moiety such as: phenylalanine, Tyrosine, tryptamine
  • lndoline-5,6-diol moiety such as: Dopachrome, Dopaminochrome, noradrenochrome, adrenochrome, DHICA, Indol 5,6 quinone, LeukoDopachrome (cycloDopa), Leucodopaminechrome; leuconoradrenochrome, 5,6-dihydroxyindole-2- carboxylique (DHICA), 5,6-dihydroxyindole (DHI)
  • a particulary preffered material is DHICA.
  • R1 , R2 and R3 may be the same or different and are independently hydrogen, -OH or C1 to C6 alkyl groups.
  • DHI derivatives that can be used in the process of the invention are the ones described in WO 98051269, in particular the a dihydroxyindole being represented by the formula (I):
  • R is chosen in the group consisting of an hydrogen, an alkyl group with 1 to 6 carbon atoms, an hydroxyalkyl group with 1 to 6 carbon atoms, an aminoalkyl group with 1 to 6 carbon atoms, an aryl, and a substituted aryl containing up to three reaction inert substituents;
  • R1 and R2 may be the same or different, and are chosen in the group consisting of hydrogen, alkyl containing from one to six carbon atoms, or, when R2 is H, R1 may represent COOR3, wherein R3 is H or an alkyl having from one to six carbons.
  • compounds as described in EP 441689 can also be used, such as the ones of formula (II)
  • R represents a hydrogen atom, alkyi, alkoxy, hydroxyalkyl, aminoalkyl,
  • R6, R7, R8 denote alkyi, wherein alkyi comprises it from 1 to 8 carbon atoms or an unsubstituted or substituted aryl radical OH, NH 2 , alkyi, alkoxy or N0 2 ;
  • R1 and R2 identical or different, represent CrC 3 alkyi or together form a methylene or ethylene group optionally substituted by one or more Ci-C 3 alkyi, R3 is hydrogen or COOH,
  • R4 and R5 identical or different, represent an hydrogen atom, an hydroxyl group, a methyl or a C 2 -C 6 alkyi.
  • DOPA derivatives as disclosed in EP 58040, in particular, chosen from:
  • R is -H, a branched or unbranched, alkyl or alkenyl group having from 1 to 20 (preferably 1 to 6) carbon atoms, or an amino acid or peptide fragment,
  • Y 1 is -H or -OH, or -CH3 or any other C2 to C6 alkyl group
  • Y 2 is -H or -CH 3 ;
  • R 1 is a branched or unbranched, alkyl or alkenyl group having from 1 to 20 carbon atoms;
  • R1 is an oxygen or a C1 -C3 alkyl group
  • R1 is an oxygen or a C1 -C3 alkyl group
  • R 2 is chosen from -H, alkyl and phenyl
  • X 1 is an NH amide (especially an amino acid or peptide) linkage
  • X 2 is the same or different and is chosen from -H, -OH, -NH 2 or -SH ( ⁇ )
  • X 3 is -OH or OR 1
  • X 4 0 or OR 1
  • n is an integer of from 1 to 3;
  • X 5 is S, O or NH
  • X 6 is H or COOH
  • the substituted DOPA may also be chosen from 3,4-dihydroxyphenylserine, having the structure:
  • methoxytyrosine having the structure:
  • DHICA derivatives As an illustration of such derivatives, one can use
  • R is chosen in the group consisting consisting of an hydrogen, an alkyl group with 1 to 6 carbon atoms, an hydroxyalkyl group with 1 to 6 carbon atoms, an aminoalkyl group with 1 to 6 carbon atoms, an aryl, and a substituted aryl containing up to three reaction inert substituents, COOH, NH 2 .
  • melanin precursors or derivatives thereof are described in the art, such as the products described in WO 93/021898.
  • melt precursor also encompasses polymeric molecules containing a high proportion of melanin precursors as disclosed above that are able to undergo polymeric oxidation.
  • melanin precursors such as the precursors of Mussel Adhesives Proteins.
  • an “oxidizing agent” or “oxidizing molecule” is a compound that is able to provide oxygen to a solution containing melanin precursors and promote polymerization thereof and formation of a melanin macromolecule.
  • Oxidizing agents that can achieve this goal comprise oxygen, hydrogen peroxide, ammonium persulfate, ferric ions, sodium iodide together with hydrogen peroxide, and treatment with a salt of a transition metal cation such as copper sulfate as a catalyst for air oxidation.
  • the oxidizing agent is chosen in the group consisting of oxygen, hydrogen peroxide, ammonium persulfate, and ferric ions.
  • an "immunogenic or immunostimulatory composition” is a composition that is able to generate an immune response in an animal when administered to said animal.
  • said animal is a mammal, but is can also be a bird (such as a chicken, a duck, a goose, a turkey, a quail), in particular when the composition is used in avian livestock.
  • the animal may also be a fish, as the immunogenic composition may be used in fish farming.
  • an immunogenic composition according to the invention is preferably used in mammals.
  • mammals are preferably human beings, but can also be other mammals, when the composition is used in the veterinary field, in particular for inducing immunity in livestocks such as cattle (cows), sheeps, goats or horses, but also for pets such as dogs or cats.
  • the immunogenic composition is thus a composition that contains an antigen and that is able to generate a immune response against such antigen.
  • the generated immune response can be a cellular (T-cell mediated) or a humoral (B- cell mediated, production of antibodies) immune response.
  • the immunogenic composition may also induce both a cellular and a humoral immune response.
  • the cellular immune response can be a CD8 T lymphocytes mediated response (ie cytotoxic response), or a CD4 T lymphocytes mediated response (helper response). It can also combine a cytotoxic and helper cellular immune response.
  • the helpher response may involve Th1 , Th2 or Th17lymphocyt.es (such lymphocytes being able to elicit different cytolkine responses, as is known in the art).
  • the immunogenic composition may allow a better presentation of the antigen present therein, through MHC1 or MHC2 pathways.
  • an “adjuvant” is a substance that has the capacity to modify or enhance the immune response to an antigen.
  • the immune response against the antigen may be higher or different in the presence of the adjuvant than when the adjuvant is not present (that includes when the response is modified, for example when the subset of T cells that are activated in the presence of the adjuvant is different from the subset activated in the absence of the adjuvant).
  • Adjuvants are known in the art and have been widely used in the vaccine field.
  • emulsions either oil-in-water or water-in-oil, such as Freund's Incomplete Adjuvant (IFA) and MF59®
  • PRR Pattern recognition receptors
  • TLR3 Toll-Like Receptor 3
  • RLR RLR
  • RLR RLR-I Like Receptors
  • ligands such as double-stranded RNA (dsRNA), or synthetic analogs of dsRNA, such as poly(l:C)
  • TLR4 ligands such as bacterial lipopolysaccharides (LPS), MPLA (monophosphoryl lipid A), in particular formulated with alum
  • TLR5 ligands such as bacterial flagellin
  • TLR7/8 ligands such as imidazoquinolines (i.e.
  • TLR9 ligands such as oligodeoxynucleotides containing specific CpG motifs (CpG ODNs) or NOD2 (Nucleotide-binding oligomerization domain-containing protein 2) ligands.
  • CpG ODNs CpG ODNs
  • NOD2 Nucleotide-binding oligomerization domain-containing protein 2 ligands.
  • the term ligand above describes preferably an agonist of the receptor, i.e. a substance that binds to the receptor and activates the receptor, in particular for TLR3 and TLR9 receptors.
  • an "antigen" is an antigen is a molecule or a combination of molecules against which it is desired to elicit a immune response in order for the immune system of a living animal to recognize it.
  • antigen may be foreign to the body of the host to which the immune response is sought.
  • the antigen may be a protein expressed by a bacteria or a virus.
  • the antigen may also be a self-antigen, ie a protein that is expressed by cells of the host, such as tumor antigens.
  • Antigens can consist of whole organisms (viruses or bacteria, fungi, protozoa or even cancer cells), killed or not, cells (irradiated or not, genetically modified or not), or subfractions of these organisms/cells like cell extracts or cell lysates. Antigens can also consist of single molecules like proteins, peptides, polysaccharides, lipids, glycolipids, glycopeptides or mixture thereof. Antigens may also be one of the above-cited molecules that has been modified through a chemical modification or stabilisation. In particular, the net charge of the antigen can be modified using adequate substitution of amino acids or chemical modifications of the antigen.
  • An antigen may be a full protein, or any part of a protein, such as an epitope of the protein.
  • the antigen in the context of the present invention may also consist in a synthetic protein or molecule that contains multiple epitopes that are linked together.
  • the antigen may be a protein containing multiple epitopes of the same antigen, these epitopes being specific of a MHC haplotype.
  • MHC genetic
  • the antigen may be a protein containing multiple epitopes obtained from various antigens of the same pathogen (the term pathogen preferably indicate a foreign pathogenic agent such as a bacteria, a virus, a parasite or a fungus, but may also extend to tumour cells).
  • pathogen preferably indicate a foreign pathogenic agent such as a bacteria, a virus, a parasite or a fungus, but may also extend to tumour cells.
  • pathogen preferably indicate a foreign pathogenic agent such as a bacteria, a virus, a parasite or a fungus, but may also extend to tumour cells.
  • the immunostimulatory molecule to obtain a strong immune response against this pathogen.
  • the antigen that can be used with the melanin macromolecule in the disclosed composition is any antigen against which a immune response is searched.
  • This antigen can be a full protein as found in nature, or only part of a protein found in nature.
  • the antigen as intended in the immunogenic composition as herein described can also be a mixture of antigens.
  • the antigen may be a protein, a peptide, a polysaccharide, or a lipid.
  • the antigen may be part (coats, capsules, cell walls, flagella, fimbrae, and toxins) of a bacteria, a virus, or another microorganisms.
  • the antigen may a a more complex molecule such as a lipid combined with a protein and/or a polysaccharide.
  • the antigen as used in the immunogenic composition comprises one or several MHC epitopes.
  • the antigen as used in the immunogenic composition consists in a MHC epitope.
  • the antigen as used in the immunogenic composition consists in a MHC epitope which is flanked, at its N and/or C terminus by a few amino-acids (between 1 and 10, preferably between 1 and 6 amino-acids at one, or both C and N terminal ends).
  • a MHC epitope (or T cell epitope) is presented on the surface of an antigen- presenting cell, where they are bound to MHC molecules.
  • T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 1 1 amino acids in length, whereas MHC class II molecules present longer peptides, 13-17 amino acids in length (https://en.wikipedia.Org/wiki/Epitope#T_cell_epitopes).
  • the MHC epitope may be synthetized in vitro (with or without addition of amino acids at its C and/or N terminal extremities). MHC bound peptides may be extracted from live cells, in particular tumor cells, by any method known in the art such as acid treatment in particular with hydrochloric acid.
  • the antigen comprises one or several B cell epitopes, i.e. part of a protein that is recognized by an antibody, preferably linear epitopes, formed by a continuous sequence of amino acids from the antigen.
  • the antigen as used in the immunogenic composition consists in a B cell epitope.
  • the antigen as used in the immunogenic composition consists in a B cell epitope which is flanked, at its N and/or C terminus by a few amino-acids (between 1 and 10, preferably between 1 and 6 amino-acids at one, or both C and N terminal ends).
  • composition as disclosed herein makes it possible to only use the epitopes that are already known from known antigens (which are thus well characterized), rather than full proteins.
  • epitopes i.e. small antigenic parts
  • the fact to use only epitopes (i.e. small antigenic parts) to elicit a immune response is particularly interesting to limit any adverse effects that could be associated with the use of large size proteins.
  • the antigen may be a synthetic molecule comprising multiple epitopes, separated by stretches of amino acids or any other acceptable linkers such as polyether compounds or other linkers used in dendrimer constructs (Tarn, Proc Natl Acad Sci USA. 1988, 85(15):5409-13; Seelbach et al, Acta Biomater. 2014 10(10):4340-50; Sadler and Tarn, Reviews in Molecular Biotechnology 90, 3- 4, pp195-229; Bolhassani et al, Mol Cancer. 201 1 Jan 7;10:3 ).
  • the multiple epitopes may be epitopes specific for different HLA genotypes (in order to generate a single immunogenic or immunostimulatory composition that able to elicit a immune response against a given antigen or pathogen in a broad population of patients.
  • the epitopes may originate from the same or multiple antigens of the same pathogenic agent, in order to elicit a strong immune response against said pathogenic having the multiple epitopes.
  • the epitopes may originate from different pathogenic agents, in order to elicit a immune response against these various agents at one time, by using the immunogenic composition.
  • the antigen may contain universal T helper epitopes such as pan-DR epitope (PADRE) and Pol 7 n epitopes.
  • PADRE pan-DR epitope
  • Pol 7 n epitopes The literature widely discloses other universal T helper epitopes. Source of the antigens
  • Antigens that can be used in the present invention can be chosen in particular among:
  • Exogenous antigens are generally presented by MHC II molecules.
  • Endogenous antigens (antigens generated within normal cells as a result of normal cell metabolism, or because of viral or intracellular bacterial infection; these antigens are generally presented by MHC I molecules) .
  • Neoantigens such as tumor antigens, such as epitopes derived from viral open reading frames in virus-associated tumors, or other tumor antigens presented by MHC I or MHC II molecules on the surface of tumor cells.
  • Allergens an antigen capable of stimulating a type-l hypersensitivity reaction in atopic individuals through Immunoglobulin E (IgE) responses).
  • tumor antigens As examples of tumor antigens, one can cite alphafetoprotein (AFP) found in germ cell tumors and hepatocellular carcinoma, carcinoembryonic antigen (CEA) found in bowel cancers, CA-125 found in ovarian cancer, MUC-1 found in breast cancer, epithelial tumor antigen (ETA) found in breast cancer, tyrosinase or melanoma-associated antigen (MAGE) found in malignant melanoma, abnormal products of ras, p53 found in various tumors, gp100 (Melanocyte protein PMEL, a type I transmembrane glycoprotein enriched in melanosomes), TRP2 (Tyrosinase- Related Protein 2), EPHA2 (receptor tyrosine kinase, frequently overexpressed in a wide array of advanced cancers such as gliomas), survivin (baculoviral inhibitor of apoptosis repeat-containing 5 or BIRC5, expressed in
  • pathogens from which antigens can be used in the immunogenic composition one can cite any pathogens involved in infectious diseases (virus, bacteria, parasite, mycosis).
  • infectious diseases preferred pathogens are selected from human immune deficiency virus (HIV), hepatitis A and B viruses, hepatitis C virus (HCV), Rous sarcoma virus (RSV), Ebola viruses, Cytomegalovirus, Herpes viruses, Varicella Zoster Virus, Epstein Barr virus (EBV), Influenza virus, Adenoviruses, Rotavirus, Rubeola and rubella viruses, Variola virus, Staphylococcus, Chlamydiae, Mycobacterium tuberculosis, Streptococcus pneumoniae, Bacillus anthracis, Vibrio cholerae, Helicobacter Pilorii, Salmonella, Plasmodium sp.
  • HCV human immune deficiency virus
  • HCV hepatitis A and B viruses
  • HCV
  • P. falciparum P. vivax, etc.
  • Pneumocystis carinii Giardia duodenalis (Giardiose), Schistosoma (Bilharziose), Aspergillus, Cryptococcus, Candida albicans, Listeria monocytogenes, or Toxoplasma gondii.
  • cancer benign or malignant tumors
  • hematological malignancies hematological malignancies
  • allergies autoimmune diseases
  • chronic diseases such as atherosclerosis
  • Alzheimer disease a malignant neoplasm originating from a malignant neoplasm originating from a malignant neoplasm originating from a malignant neoplasm originating from a malignant neoplasm originating from a malignant neoplasm, fibroblasts, and others.
  • the antigen is thus preferably a bacterial or viral antigen (or a polypeptide or polymer (such as the ones usable in dendrimers) containing one or more epitopes isolated from a bacterial or viral antigen).
  • the antigen is a self-antigen (endogenous or neoantigen), in particular a tumor specific antigen (or a polypeptide containing one or more epitopes isolated from such antigens).
  • the antigen is an allergen or a polypeptide containing one or more epitopes isolated from such antigen.
  • the melanin precursors are generally charged.
  • the presence of carboxyl groups in such precursor will provide negative charges.
  • DHICA 5,6- dihydroxyindole-2-carboxylic acid
  • DHI 5,6-dihydroxyindole
  • the antigen presents a neutral charge or a charge that is opposite to the charge of the melanin.
  • Dopa or DHICA as the melanin precursor, one may advantageously use an antigen that is positively charged.
  • the whole charge of the antigen doesn't need to be positive, but that the antigen shall present at least a region that is positively charged. This may be obtained by adding tails of positively charged amino acids to the antigen, but other methods (grafting positive moieties to the antigen) may also be used.
  • the antigen may be neutral or negatively charged.
  • the purpose of this embodiment is to improve the formation of the melanin- antigen complex in the immunostimulatory composition, by allowing the antigen and the melanin precursor to be close to each other through charge attraction (electrostatic attraction) before oxidative polymerization.
  • a vaccine is a composition that is administered to produce or artificially increase immunity to a particular antigen. It is thus undersood that the terms "immunogenic composition”, “immunostimulatory composition” and “vaccine” are synonymous terms.
  • the invention thus relates to an immunostimulatory composition
  • an immunostimulatory composition comprising an antigen and a melanin macromolecule.
  • Said composition can be used as a vaccine as will be discussed below.
  • the antigen and the melanin are complexed to each other.
  • the melanin and the antigen are thus complexed when the two entities are so linked together than they don't migrate separately on thin layer chromatography. In other word, it is not possible to distinguish or separate the two entities in the composition.
  • composition has been obtained by polymerization of the antigen and melanin precursor, without being bound to this theory, it is supposed that the antigen has been trapped within the melanin macromolecule thus obtained.
  • melanin is a macromolecule that is obtained after oxidative polymerization of melanin precursors. It is preferred when the melanin is a soluble melanin in the immunostimulatory composition.
  • a soluble melanin is a melanin that is in the form of particles of small size, ie less than 500nm, preferably less than 250 nm or less than 200 nm.
  • DHICA forms a golden-brown solution (Pawelek, Pigment Cell Res. 1991 Mar;4(2):53-62) and that the composition containing soluble melanin-antigen complex is thus preferably obtained from using DHICA, dopachrome (rather unstable though), cyclodopa, dopaquinone or Dopa as the melanin precursor.
  • composition as disclosed above is susceptible to be obtained after polymerization of melanin precursors in the presence of the antigen.
  • composition is preferably obtained after polymerization, in particular oxidative polymerization, of melanin precursors in the presence of the antigen.
  • the antigen may be present in solution with the melanin precursor, or may be bound to the melanin precursor, in particular by a covalent bound. Such embodiment may be obtained by linking a melanin precursor to the antigen.
  • the antigen is a peptide
  • the composition herein disclosed that is immunogenic, is characterized as being a soluble melanin composition from which the antigen is hardly detectable as a free form in solution, and which is able to induce an immune response against the antigen. It is possible to add free antigens in solution, but the composition as described in the present application is such as it possesses the immunogenic property without such free antigens in solution. In other words, a immune response may be obtained against the antigen even in the absence of free antigen in solution.
  • a composition containing a melanin macromolecule complexed with an antigen, and an antigen in solution is also within the bounds of the present invention.
  • melanin macromolecule may be disassembled by any method known in the art (such as the one disclosed in Schraermeyer and Dohms, Pigment Cell Res. 1996 Oct;9(5):248-54) and that the antigen complexed therein may thus be released, identified and analyzed by any method known in the art such as mass spectrometry.
  • the melanin precursor and the antigen may be incubated, with or without buffer, with an enzyme such as phenylalanine hydroxylase, tyrosinase, mushroom tyrosinase, tyrosine hydroxylase, peroxidase, Phenol-oxidase, Dopachrome tautomerase, DHICA oxidase, DHI oxidase.
  • an enzyme such as phenylalanine hydroxylase, tyrosinase, mushroom tyrosinase, tyrosine hydroxylase, peroxidase, Phenol-oxidase, Dopachrome tautomerase, DHICA oxidase, DHI oxidase.
  • the mixture is also exposed to an oxidizing agent as disclosed above in order to promote the polymerization to melanin.
  • an oxidizing agent as disclosed above in order to promote the polymerization to melanin.
  • the characteristics of the complex may also be modified.
  • the immunostimulatory composition as disclosed may also comprise another immunostimulatory molecule, ie an adjuvant as disclosed above.
  • this adjuvant is selected in the group consisting of TLR3 agonists and TLR9 agonists and in particular when this adjuvant that is further added is chosen among Polyinosinic:polycytidylic acid (poly l:C) and CpG oligonucleotides.
  • the adjuvant can be added with the antigen before initiation of the polymerization of the melanin precursor. In this case, it is possible that it will also be complexed with the antigen, within the melanin/antigen macromolecule.
  • the adjuvant may be added to the melanin-antigen complex immunogenic composition after that polymerization has occurred. In this case, it is postulated that the adjuvant is not complexed with the melanin/antigen macromolecule.
  • the invention also relates to the use of melanin or a melanin precursor for the preparation of an immunostimulatory composition, or a vaccine intended to elicit an immune response against an antigen when administered to an animal (as disclosed above, including human being).
  • the immunostimulatory composition can be used in vitro in presence of live cells (for example macrophages, dendritic cells or lymphocytes), to sensitize them before administration (preferably injection) in humans or animal. The resulting composition will thus elicit a immune response against the antigen in the recipient.
  • live cells for example macrophages, dendritic cells or lymphocytes
  • US 6210662 discloses such principle of forming therapeutic or immunogenic compositions consisting of antigen presenting cells activated by contact with a antigen complex.
  • the antigen-melanin complex is the one obtained according to methods described herein.
  • the melanin precursor is exposed to the antigen and the solution is then submitted to polymerization conditions (exposure to agents such as enzymes or chemicals to induce polymerization) thereby leading to the immunostimulatory composition.
  • the invention also relates to the use of melanin or of a melanin precursor as an adjuvant to increase or elicit an immune response against a target antigen. This is particularly useful when the target antigen is not, by itself, immunogenic (i.e. no immune response is obtained when the antigen is administered).
  • the invention also relates to melanin or a melanin precursor as an immunostimulatory molecule.
  • the melanin or a melanin precursor acts to increase the immune response to an antigen when presented with this antigen.
  • in vivo administration of the melanin precursor and the antigen may lead to in vivo polymerization of the melanin precursor to melanin and to the formation of the immunostimulatory composition disclosed above. This is particularly true when the melanin precursor and the antigen are associated by electrostatic links, when both have an opposite charge.
  • the invention also relates to a complex comprising a melanin macromolecule complexed with an antigen as an immunostimulatory composition.
  • the invention also relates to a complex consisting of a melanin macromolecule complexed with an antigen as an immunostimulatory composition.
  • the invention also relates to melanin or melanin precursor for its use for increasing or eliciting an immune response against a target antigen.
  • the invention also relates to an immunostimulatory composition
  • a melanin and a target antigen for its use as a vaccine to protect an animal against a disease implicating (i.e. involving and/or concerning) cells expressing inside the cells, at their surface, or secreting the target antigen or epitopes thereof.
  • the vaccine may be a prophylactic (i.e. intended to protect the recipient against the development of a disease) or a therapeutic (i.e. intended to help the recipient fight an already present disease) vaccine.
  • the protected animal has been disclosed above, and may be human being.
  • the disease is linked to the target antigen used in the immunostimulatory composition.
  • the antigen or an epitope thereof is expressed or presented by cells of the animal (or by pathogens) during the course of the disease.
  • the disease thus involves or concerns cells expressing the target antigen.
  • Such expression may be secretion of the antigen (as an illustration, the antigen may be a bacterial toxin), or surface expression of the antigen or epitope thereof (the antigen may be a surface protein of a virus, or an tumor-specific antigen or epitope thereof expressed at the surface of tumor cells), or presentation of the antigen or epitope thereof at the surface of cells (such as a MHC presentation of an antigen or epitope thereof by the target cell).
  • the invention also relates to a method for obtaining an immunostimulatory composition comprising the steps of
  • an immunostimulatory composition able to elicit an immune response against the antigen when administered to a patient, or when incubated with cells in vitro (this would prime the cells which can then be administered to a patient or an animal).
  • the antigen used in this method is an antigen against which an immune response is sought in a recipient.
  • Polymerization is induced as indicated above. It is thus preferably an oxidative polymerization. It is preferably induced in vitro but may also be induced in vivo as indicated above.
  • the composition of a) also contains an adjuvant.
  • Said adjuvant is other than a melanin precursor, and is preferably a TLR3 or TLR9 agonist, such as an adjuvant selected in the group consisting of poly l:C and CpG- oligonucleotides.
  • Figure 1 schematic description of the synthesis of eumelanin starting from phenylalanine.
  • Figure 2 CTL response after immunization with ⁇ g of the Ovalbumine epitope SIINFEKL (pOVA, SEQ ID NO: 2) or ⁇ 0[ ⁇ g or the human gp100 epitope KVPRNQDWL (hgp100, SEQ ID NO: 3).
  • C57-BI6 mice were injected twice (day 0 & day 7) with the epitope + CpG-28 (SEQ ID NO: 1 ), the epitope + DOPA (D) + CpG- 28; or [the epitope + DOPA, co incubated for 18 hours (D incub)] + ⁇ 0 ⁇ g CpG-28 (10 ⁇ Dopa for pOVA; 100 ⁇ g Dopa for hgp100) .
  • the immune response was assessed on day 14.
  • Splenocytes were re-stimulated in vitro with the corresponding MHC class l-restricted peptide and the numbers of IFNg-SFCs (Spot forming cells) were measured.
  • FIG. 3 CTL response after 2 immunizations with 1 O ⁇ g of peptide KVPRNQDWL (hgpl OO, SEQ ID NO: 3) or I pg SIINFEKL (pOVA, SEQ ID NO: 2), combined with DOPA ( ⁇ ⁇ for hgpl OO, ⁇ g for pOVA), and incubated with various molar ratio (oxidant/Dopa) of H 2 0 2 for 4 hours, or ammonium persulfate (APS) for 2 hours, respectively.
  • 10 ⁇ g CpG-28 (SEQ ID NO: 1 ) / mouse were added before immunizations.
  • the immune response was assessed on day 14.
  • FIG. 4 CTL response after immunization with ⁇ g of p OVA (SIINFEKL, SEQ ID NO: 2).
  • C57-BI6 mice were injected twice (day 0 & day 7) with peptide + CpG-28 (SEQ ID NO: 1 ), [peptide + DOPA + APS] incubated for 4hours + CpG-28; or [peptide + ⁇ g Dopamine (Dn) + APS] + CpG-28.
  • the immune response was assessed on day 14.
  • FIG. 5 CTL response after immunization with 3.6 ⁇ g or the long OVA peptide (pOVAI, SEQ ID NO: 4).
  • C57-BI6 mice were injected twice (day 0 & day 7) with peptide + CpG-28 (SEQ ID NO: 1 ), or [peptide + 100 ⁇ g Dopamine (Dn)+ APS] + CpG-28.
  • the immune response was assessed on day 14.
  • FIG. 6 CTL response after immunization with 10 ⁇ g of the human gp100 epitope (hgpl OO, SEQ ID NO: 3).
  • C57-BI6 mice were injected twice (day 0 & day 7) with the epitope co-incubated for 18 hours with 100 ⁇ g DOPA at pH 8.5 (Ag then D); or with 100 ⁇ g DOPA previously incubated in the presence of oxygen before the epitope was added (D then Ag).
  • ⁇ g CpG-28 (SEQ ID NO: 1 ) / mouse were added before immunizations. The immune response was assessed on day 14.
  • SII NFEKL SEQ ID NO: 2
  • IFNg-SFCs spot forming cells
  • FIG 8 Thin-layer chromatography (TLC) after a 72-hour incubation at pH 8.5 (Tris buffer). Left: hgp100 (SEQ ID NO: 3). only; middle: hgp100 (1 mg/ml) and Dopa (10mg/ml), co- incubated with 02; right: hgpl OO (1 mg/ml) added after Dopa (10mg/ml) had been incubated with 02. The peptide, trapped into oxidized DOPA, is not seen any more when both Dopa and the peptide are co-incubated.
  • TLC was performed on aluminium foils, coated with a thin layer of silica gel as the stationary phase. After the samples have been loaded, a mixture of 1 -Butanol/acetic acid /H20 (2/1 /1 ) was used as the mobile phase. The TLC plates were then sprayed with ninhydrin reagent)
  • FIG 9 Thin-layer chromatography (TLC) after a 72-hour incubation at pH 8.5 (Tris buffer). Left: hgpl OO (, SEQ ID NO: 3) only; other lanes: hgpl OO (1 mg/ml) incubated with various doses of Dopa (Dopa/hgp100 weight ratios: from 1 /5 to 10/1 ). The peptide, complexed with melanin (oxidized DOPA), is not seen any more when the ratio is over 2. (TLC: similar conditions as Figure 8).
  • FIG. 10 CTL response after immunization with 3.6 ⁇ g of different OVA peptides: SEQ ID NO: 5 (SMLVLLPKSVSGLSQLESI I NFEKLTSWTS, neutral), or SEQ I D NO: 6 (SMLVLLPKKVSGLKQLESII NFEKLTKWTS, positively charged).
  • SEQ ID NO: 5 SMLVLLPKSVSGLSQLESI I NFEKLTSWTS, neutral
  • SEQ I D NO: 6 SMLVLLPKKVSGLKQLESII NFEKLTKWTS, positively charged.
  • C57-BI6 mice were injected twice (day 0 & day 7) with the epitopes co-incubated for 18 hours with 10Oyg DOPA at pH 8.5.
  • 10yg CpG-28 (SEQ ID NO: 1 ) per mouse were added before immunizations. The immune response was assessed on day 14.
  • Figure 1 1 SDS-PAGE (16% polyacrylamide gel) of various preparations: lane MW: molecular weight marker; lane "Ctrl EphA2": control peptide EphA2 alone (SEQ ID NO: 9) ; lane "Filtrate”: filtrate of complex melanin-EphA2 after filtration on a 10kD filter; lane "Retentate”: retentate of complex melanin-EphA2 after filtration on a 10kD filter, resuspension, dissolution and heating in loading buffer containing SDS.
  • Figure 13 Numbers of IFNv-secreting lymphocytes per 10 5 splenocytes after immunization with various formulations.
  • A impact of TLR9-agonist in a specific composition with gp100 (SEQ ID NO: 3) and melanin.
  • B Effect of the ratio of antigen/L-Dopa in the incubation medium to prepare gp100-melanin on the immune response.
  • C comparison of different gp100-melanin compositions (various antigen dosage) with a composition associating gp100 , the classical adjuvant (incomplete Freund's adjuvant, IFA) and a TLR9 agonist.
  • IFA incomplete Freund's adjuvant
  • Figure 14 Number of IFNv-secreting cells per 10 5 cells (splenocytes) upon stimulation with a CD4 or CD8 epitope, after immunization of mice with a synthetic peptide (pOVALs) (SEQ ID NO: 12).) containing both a CD4 and a CD8 ovalbumine epitopes, either alone or within a composition with melanin. Results shown for mice were immunized on day 0 &14 and sacrificed on day 21 (A), or on day 0 & 21 and sacrificed on day 42 (B).
  • pOVALs synthetic peptide
  • Figure 15 Mean of tumor volume over time for different vaccine formulations.
  • epitopes presented by H-2Kb were used (except in example 18 which is also using a mouse MHC-II epitope).
  • mice were immunized twice (on day 1 and day 7) with the different formulations combined to a Toll-like Receptor 9 (TLR-9) agonist (10 ⁇ g of the CpG-28 oligonucleotide, TAAAC GTTATAAC GTTAC G AC GTC AT (SEQ ID NO: 1 )).
  • TLR-9 Toll-like Receptor 9
  • IFNg gamma interferon-secretion Elispot assay, after restimulation of total splenocytes with the relevant MHC class-l epitope (SIINFEKL (SEQ ID NO: 2) for Ovalbumine or KVPRNQDWL (SEQ ID NO: 3) for human gp100)
  • IFNg gamma interferon-secretion Elispot assay
  • Example 1 Incubation of antigen and a melanin precursor in presence of an oxidant induces an immune response
  • Ovalbumine epitope SIINFEKL, SEQ ID NO: 2
  • SAEQ ID NO: 2 Ovalbumine epitope alone, or mixed with " ⁇ ⁇ of DOPA, or mixed with DOPA and further incubated for 18 hours in the presence of oxygen to promote oxidation, were used as vaccine preparations. While the epitope alone did not trigger any significant CD8 immune response, the association with DOPA, especially after incubation, was able to induce IFNg spots.
  • SIINEFKL SEQ ID NO: 2
  • Example 2 The immune response is not dependent on the oxidizing agent used (either chemical or enzymatic oxidation)
  • oxidizing agents such as hydrogen peroxide (H 2 0 2 ) or ammonium persulfate (APS) can be used (Figure 3).
  • the optimal concentration is easily defined.
  • oxidizing agents such as ferric chlorure can also be used and lead to the same results.
  • Example 3 An immune response is observed with other melanin precursor
  • Example 4 Use of a long antigen containing an epitope still makes it possible to have the epitope processed and adequately presented
  • Example 5 Various adjuvants can be used in the composition
  • the used adjuvants were substituted to the CpG-ODN, according to the same protocol than the one disclosed in the Methods above.
  • the SIINFEKL epitope (SEQ ID NO: 2), was combined (or not) to ⁇ ⁇ Dopa, further incubated for 18 hours in the presence of oxygen to promote oxidation, and then used as vaccines in association with 10 ⁇ g CpG-28 (TLR9 agonist), 1 C ⁇ g Polyinosinic:polycytidylic acid (poly l:C) (TLR3 agonist), or mixed to Freud adjuvant or aluminium salts (Alum) (vol/vol 1/1 ).
  • the CD8 immune response at day 14 was significantly higher for the [DOPA- antigen] composition than the one observed for the antigen without DOPA, especially when the TLR3 or TLR9 ligands were used.
  • Example 6 - The immune response comprises a humoral response
  • Ovalbumin protein (1 ⁇ g) was mixed to Dopa (1 ⁇ g) at pH 7.4, incubated for 4 hours with APS (O ⁇ g), and injected subcutaneously with 10 ⁇ g in C57/Bml6 mice on day 0 and day 7.
  • hgp100 epitope 10 ⁇ g was either mixed to 100 ⁇ g DOPA at pH 8.5, then incubated for 18 hours in the presence of oxygen to promote oxidation, or mixed to a solution of DOPA that has been previously incubated in the presence of oxygen to promote oxidation before the epitope was added.
  • Example 8 An immune response can be obtained with various melanin precursor of derivatives
  • L-Dopa is a convenient catechol to use, leading to soluble melanin.
  • melanin precursors can be used.
  • the solution was then incubated for 18 hours in the presence of oxygen to promote oxidation.
  • ⁇ 0[ ⁇ g CpG-28 /mouse were added before subcutaneous immunizations with various melanin precursors .
  • Mice were either immunized on day 0 & 8 and sacrificed on day 14, or immunized once on day 0 and sacrificed on day 8..
  • Example 9 A complex is formed between the polymerized melanin and the antigen
  • TLC Thin-layer chromatography
  • Example 10 An immune response is obtained after polymerization of DOPA covalently linked to the antigen
  • mice were immunized either with ⁇ g of the Ovalbumine epitope (pOVA, SIINFEKL, SEQ ID NO: 2), or with 1 ⁇ g of the epitope synthesized with a DOPA at the beginning (D-SIINFEKL, D-pOVA) or at the end (SIINFEKL-D, pOVA-D) of the peptide. While the epitope alone did not trigger any significant CD8 immune response, the modified peptides, especially the one with a C-terminal DOPA induced strong CTL immune responses (Figure 7).
  • L-DOPA ( ⁇ ⁇ ) was incubated with the hgp100 epitope (KVPRNQDWL, SEQ ID NO: 3), in presence of the CpG-28 oligonucleotide, then incubated for 18 hours in the presence of oxygen to promote oxidation.
  • the CpG-28 oligonucleotide was added after oxidation of L-DOPA and the hgp100 epitope.
  • mice with the resulting compositions were similar, thus indicating that the other adjuvant may be added before or after the oxidation (polymerization) reaction.
  • Example 12 The complexed melanin-antigen composition may be obtained as a soluble melanin solution
  • Dopa (2mg/ml) or Dopamine (2mg/ml) solutions were incubated with or without the pOVA (0,1 mg/ml) at pH 7.4 or 8.5, and with different oxidizing agents (02, ammonium persulfate) for 20 hours. All solutions darkened within a few hours. With Dopamine, large aggregates were seen under light microscopy. Under centrifugation, the dopamine solutions precipitated, and some dark material remained adherent to the tubes.
  • Example 13 The complexed melanin-antigen composition is a colored solution
  • a solution of L-Dopa is mixed with a solution of peptide (weight ratio L-Dopa: epitope between 1 :100 and 1 :1 , preferably between 1 :10 and 1 :2, depending upon the epitopes), and the mixture is then oxidized at pH 8.5 in aerated conditions.
  • the colorless L-Dopa solution turned black to generate synthetic melanin, a process that can be monitored using UV spectroscopy (Fig 12).
  • the kinetics of L-Dopa oxidation can be assessed by the 350/280 nm ratio.
  • a black material is retained in the upper chamber, and could be easily resuspended in a saline solution.
  • the resulting product (containing both melanin and peptides) can be further characterized using Fourier transform infrared spectra (FITR), Nuclear Magnetic Resonnance (NMR) or Transmission electronic microscopy.
  • Example 14 Modifying the antigen charge can improve the immune response and immunogenicitv of the composition
  • the charge of the peptide pOVAI (SEQ ID NO: 4) is negative and its sequence was thus modified to make it neutral (SMLVLLPKSVSGLSQLESIINFEKLTSWTS, SEQ ID NO: 5) or positive (SMLVLLPKKVSGLKQLESIINFEKLTKWTS, SEQ ID NO: 6).
  • Dopa which displays a COO- moiety that is negatively charged
  • the immune response obtained after 2 immunizations was strong with the positively-charged peptide, and intermediate with the neutral peptide ( Figure 10).
  • Adding arginines (R) or lysines (K) to the NH2-terminal end of the peptides enhanced the immune response when compared to unmodified Trp2 (animals were immunized once with formulations consisting of the peptide (10 ⁇ g mouse) co- incubated with L-Dopa (100 ⁇ g mouse), then mixed to CpG-28 ( ⁇ g/mouse). The CD8 immune responses were assessed on day 8).
  • these experiments were carried out in Balb/c mice, which are naturally devoid of melanin.
  • Black pigmentation of the draining inguinal lymph nodes was macroscopically visible on day 2 post-injection in gp100-melanin-injected animals. Fontana-Masson staining confirmed numerous melanin-laden macrophages in the sinuses and, to a lesser extent, in the paracortical areas, which is a T-cell zone.
  • the pattern of melanin distribution was similar at days 2 and 7 post-injection. No melanin was observed in mice that received saline only.
  • L-Dopa A solution of L-Dopa was mixed with an EPHA2 peptide (FSHHNIIRL, SEQ ID NO: 9) at a weight ratio L-Dopa: epitope of 1 :4. The mixture was then oxidized at pH 8.5 in aerated conditions.
  • EPHA2 peptide FSHHNIIRL, SEQ ID NO: 9
  • a synthetic peptide containing both a CD4 (ISQAVHAAHAEINEA, SEQ ID NO: 10) and a CD8 (SIINFEKL, SEQ ID NO: 1 1 ) ovalbumine epitopes was synthetized.
  • This peptide bears the sequence SLKISQAVHAAHAEINEAGRLRGSIINFEKLTKWR, SEQ ID NO: 12).
  • This peptide (1 C ⁇ g/mouse) was mixed to a solution of L-Dopa (4C ⁇ g/mouse), incubated for 18hours in aerated conditions, to generate pOVAs-melanin, and used as vaccine (without any TLR9 agonist or any further adjuvant).
  • mice were immunized either on day 0 &14 and sacrificed on day 21 , or on day 0 & 21 and sacrificed on day 42.
  • Epitope-specific IFNy production by splenocytes was determined after in vitro stimulation with the CD4 or the CD8 epitopes.
  • TLR9 agonists other than CpG-28
  • the gp100 peptide (1 C ⁇ g/mouse) was mixed with L-Dopa (4C ⁇ g/mouse), incubated for 18 hours in aerated conditions, mixed with the various TLR9 agonists CpG-28, ODN-1826 (TCCATGACGTTCCTGACGTT, SEQ ID NO: 13, or ISS (TGACTGTGAACGTTCGAGATGA, SEQ ID NO: 14), then used as vaccine preparations.
  • the magnitude of the immune response was similar for all TLR9 agonists.
  • poly l:C Polyinosinic:polycytidylic acid
  • TLR3 agonist a TLR3 agonist
  • mice were immunized with gp100 (10 ⁇ g mouse) + poly l:C (10 ⁇ g mouse) or gp100 peptide (10 ⁇ g/mouse) mixed with L-Dopa (40 ⁇ g mouse), incubated for 18 hours in aerated conditions, and mixed with poly l:C (10 ⁇ g mouse).
  • poly l:C 10 ⁇ g mouse
  • Example 20 Subcutaneous injections of pOVA30-melanin protect against established syngenic tumors
  • the pOVA30 peptide (SMLVLLPKKVSGLKQLESIINFEKLTKWTS, SEQ ID NO: 15), contains a CD8 epitope (SIINFEKL, SEQ I D NO: 1 1 ) of the ovalbumin protein.
  • pOVA30-melanin was generated by co-incubation of the peptide with L-Dopa in aerated conditions, as described previously.
  • the examples above demonstrate that immunization with a complex of a melanin and an antigen makes it possible to obtain an immune response in a host.
  • This immune response is higher than when the antigen is used alone.
  • the immune response may be potentiated when the charge of the antigen and the charge of the melanin precursor, polymerized in the complex, are adapted to each others (preferably when they are not of the same sign).
  • T-helper and MHC class-l epitopes allow the immunogenic compositions according to the invention to induce significant immune responses without the need for an adjuvant, the T-helper epitopes likely allowing recruitment of the T-helper cells and potentiation of the cytotoxic response linked to the MHC class-l epitopes.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicinal Preparation (AREA)

Abstract

The invention relates to the use of melanin, complexed with an antigen, as a immunostimulatory composition.

Description

IMMUNOSTIMULATORY COMPOSITIONS
The invention is in the field of immunology, in particular in the field of adjuvants, i.e. elements that potentiate the immunogenic property of antigens, and is useful in particular in the field of vaccines, whether prophylactic or therapeutic.
Historical vaccines were based on live attenuated pathogens, whole inactivated organisms, or modified toxins. To limit potential side-effects, recent developments have focused on subunit vaccines which are generally composed of 30-60 amino acids, but can be limited to one epitope as short as 8 amino acids. The use of a small portion of an antigen limits the risk of potential cross-reactivity by focusing the immune response against the desired portion of an antigen. However, subunit vaccines, and especially peptide subunit vaccines, are often poorly immunogenic, due to the lack of pathogen-derived molecules to act as danger signals. Subunit vaccines thus require additional adjuvants to be effective (Fujita et al, Chem Cent J. 201 1 ;5(1 ):48; Azmi et al, Hum Vaccin Immunother. 2014;10(3):778-96).
The mechanisms by which adjuvants exert their immune-enhancing effects are various (Siegrist 2007, Vaccines, Plotkin, Orenstein & Offit, Elsevier; Azmi et al 2014, op. cit), and can rely, among others, on the following activities:
Presentation of the antigens to the immune system in an optimal manner; for example by translocation of antigens to the lymph nodes, by providing physical protection to antigens against degradation and /or a depot effect which grants the antigen a prolonged delivery, or by increasing antigen uptake within immune cells.
Activation the immune system; for example by activating pattern recognition receptors (PRRs) expressed on or within immune cells. Pattern recognition receptors (PRRs) of the innate immune system recognize conserved pathogen-associated molecular patterns and danger associated molecular patterns. Several PRRs have been identified, such as Toll-like receptors (TLRs), nucleotide-binding and oligomerization domain (NOD)-like receptors (NLRs), Retinoic-acid inducible gene (RIG)-like receptors (RLRs), DNA receptors, scavenger receptors, and C-type lectin receptors (CLRs) (Siegrist 2007 op. cit.; Conniot et al, Front Chem 2014;2:105). Activation of PRRs results in the production of proinflammatory cytokines, but also activates antigen- presenting cells (APCs) such as dendritic cells (DCs) and macrophages to trigger an adaptive immune response (Maisonneuve et al, Proc Natl Acad Sci USA. 2014;1 1 1 (34):12294-9).
Some adjuvants activate either the antibody secretion by B-lymphocytes (humoral response), or the cytotoxic T lymphocytes (CTLs; also called CD8 T cells) response (cellular response), or both. B-lymphocytes recognize longer peptides starting at around 15 amino acids, presented on the surface of an antigen presenting cell (APC) by major histocompatibility complex (MHC) class II molecules. Cytotoxic T lymphocytes recognize short peptides of eight to ten amino acid residues, presented on the surface of an APC, or a target cell, by MHC class I molecules. The main processing pathway for MHC class I presentation involves degradation of cytosolic proteins. In some cases, extracellular soluble antigens or peptides, usually presented by MHC class II, are presented by the MHC class I, a process called cross-presentation (Foged et al., Eur J Pharm Sci. 2012 Mar 12;45(4):482-91 ). Licensing of cross-presentation by DCs can be initiated by CD4+ T-cell (CD40:CD40L ligation) or, in a CD4+ T-cell independent way, through ligation of innate PPRs such as the TLRs (mainly TLR3, TLR7/8 or TLR9) (Foged et al., op.cit). Both cellular and humoral immune responses also require T-helper cells (TH-cells; also called CD4 T cells) to activate antigen presenting cell (the so called "second signal"). Therefore, vaccine components usually contain at least two antigenic epitopes: the target antigen that elicits an antigen-specific B cell or CTL response, and a TH epitope. Given the large number of polymorphisms in MHC class II genes in the population, some 'universal' TH epitopes binding a large number of MHC class II have been designed to be included in vaccines (P25, ptt- 30, PADRE, ). TH-cells are further subdivided into lineages (Th1 , Th2, Th17, ...) according to their cytokine profiles and their ability to modulate B and cytotoxic CD8 response. Adjuvants can bias the immune responses towards Th1 or Th2 responses and can also modulate T regulatory Lymphocytes (Treg). For example, aluminium salts (Alum), widely used in human vaccination, induce predominantly a Th2 immune response. On the contrary, combinations with complete Freund's adjuvant (CFA), cationic peptides such as IC31 or polyarginine (Schellack et al, Vaccine 24 (2006) 5461-5472; Mitsui et al, J Invest Dermatol. 2006;126(8):1804- 12), heat-shock protein (Moroi et al, Proc Natl Acad Sci USA. 2000;97(7):3485-90), TLR9 agonists, incorporation of the antigens into ISCOMS (immunostimulating complex) or liposomes (Taneichi et al, J Immunol 2006; 177:2324-2330) can bias the immune response toward a Th1 profile.
Despites all the progress made, several limitations are still faced by modern vaccines. Subunit antigens are often poorly immunogenic. The dose of antigen required to trigger the immunity (usually within the range of 10 to 100μg) might be a limiting factor, especially when antigen is difficult to manufacture, or when demand exceeds production capacity. Moreover, induction of CD8+ responses remains a difficult challenge because extracellular molecules are usually presented by MHC class II and not by MHC class I. Finally, vaccine formulations, such as emulsion, liposomes, fusion molecules can be either unstable or difficult to synthesize, making the cost of manufacturing sometimes prohibitive. The ideal adjuvant should thus be potent to trigger or boost an Ag-specific immune response (both humoral and cellular responses), easy to manufacture, non toxic, and stable.
Catechols (also known as pyrocatechol or o-hydroxyphenols or 1 ,2- dihydroxybenzen) play a major role in life and are involved in various biological processes such as neurotransmission, melanogenesis, marine biology, melanization in insects (Eleftherianos et al, J Innate Immun 201 1 ;3:28-33; Viljakainen, Brief Funct Genomics. 2015;14(6):407-12), or sclerotization of arthropod cuticle (Andersen, Insect Biochem Mol Biol. 2010;40(3):166-78).
Catecholamines are neurotransmettors that are synthesized from L-tyrosine by a series of enzymatic pathways. First, tyrosine hydroxylase removes a hydroxyl group to produce L-DOPA (3,4-dihydroxyphenylalanine). L-DOPA is decarboxylated to form dopamine by L-aromatic amino-acid decarboxylase (LADCC); which is then catabolized to noradrenaline and adrenaline by hydroxylases Dopamine beta-hydroxylase (DB) and Phenylethanolamine-N-methyl- transferase ( PNMT) (Eisenhofer 2003, FASEB J. 2003;17(10):1248-55).
Besides their role as precursors of catecholamines, catechols have the ability to undergo oxidation, generating chemical compounds with strong adhesive properties on substrate/other molecules, either by covalent or non-covalent bounds. Such oxidative process plays a major role in various biological processes such as melanogenesis, marine biology, melanization in insects, or sclerotization of arthropod cuticle.
Melanin synthesis plays a major role in animals to protect them against the harmful and mutagenic ultraviolet light rays. In insects, activation of phenoloxidase (PO) also leads to the formation of melanin around intruding microorganisms, a process named melanization, that allows encapsulation of foreign particles (Eleftherianos, 201 1 , op.c/'i.; Viljakainen 2015, op. cit). In general, melanins are macromolecules formed by oxidative polymerization of phenolic or indolic compounds via a series of enzymatic and non-enzymatic reactions (Slominski et al, Physiol Rev. 2004;84(4):1 155-228). L-Dopa is a well-known precursor of melanin (Figure 1 ). However, melanins are heterogeneous compounds, and 4 types of melanin have been described: (1 ) Eumelanins produced by serial oxidations of L- Dopa and leading mainly to copolymers of Dihydroxyindole carboxylic acid (DHICA) and 5, 6-dihydroxyindole (DHI); (2) Pheomelanins in which L-Dopa undergoes cysteinylation, by conjugation with glutathione or cysteine, leading to polymers containing benzothiazine and benzothiazole; (3) Neuromelanin (NM) which is produced in specific populations of catecholaminergic neurons in the brain; (4) and, mainly found in many fungi and plants, allomelanins or catechol melanins resulting from oxidation or polymerization of various compounds such as di-or tetra-hydroxynaphthalene, homogentisic acid, v-glutarminyl-4- hydroxybenzene, catechols, 6-hydroxy-Dopa, dihydrocaffeic acid, caffeic acid, catechins, leucoanthocyanidins, 3-amino-tyrosine, 4-hydroxyphenylacetic acid or others cathecols (US Patent 6,576,268; Langfelder et al, Fungal Genet Biol. 2003;38(2):143-58, Sugumaran et al, FEBS Lett. 1989;255(2):345-9).
Melanin is thus a broad and generic term for designating a group of natural pigments found in most organisms (arachnids are one of the few groups in which it has not been detected), usually produced by the oxidation of the amino acid tyrosine, followed by polymerization.
Wikipedia (https://en.wikipedia.org/wiki/Melanin) defines melanin as natural pigments (i.e. a colored material), produced by the oxidation of the amino acid tyrosine, followed by polymerization. This oxidation, which is a critical step, is generally mediated by the enzyme tyrosinase, which will convert tyrosine to DOPA.
News Medical Life Science (http://www.news-medical.net/health/What-is- Melanin. aspx) defines melanin as a complex polymer derived from the amino acid tyrosine, by various steps including catalysis of the L-3,4-dihydroxyphenylalanine by tyrosinase.
Melanin is also defined and claimed in EP 313380 as "a major class of broad- spectrum ultraviolet-absorbing organic polymers found naturally in various vegetables (mushrooms), animal species (squid, octopus, etc.) and, very importantly, in the human epidermis. They are formed in the epidermis by the enzymatic conversion of L-tyrosine into L-3,4-dihydro y phenylalanine, commonly referred to as L-dopa. The L-dopa is further converted to a melanin by a biologic pathway which is well described in the literature."
From http://www.skinwhiteningscience.com/melanin_synthesis_pathways.html, one can see that melanin is obtained through a complex process (as reminded in Figure 1 ) that combines both the oxidation of melanin precursors and their subsequent polymerization. This combined process is thus different from the mere polymerization of melanin precursors such as a polytyrosine for instance.
Melanin can be synthetically produced and is sold as such, for instance by Sigma Aldrich, as prepared oxidation of tyrosine with hydrogen peroxide.
(http://www.sigmaaldrich.com/catalog/product/sigma/m8631 ?lang=fr&region=FR
From the above, it results that melanin represents a polymeric pigment known and recognized in the art which cannot be confused with a mere polypeptide of amino-acids that are melanin precursors. In particular, a polytyrosyl, obtained without oxidative polymerization would not be considered as a melanin molecule by a person skilled in the art. Melanin synthesis involves several intermediary compounds, several enzymes and can be modified by pH, presence of cationic metals, temperature.
As intermediary compounds, one could cite: L-phenylalanine, L-tyrosine, L- dopa, dopaquinone, cyclodopa, dopachrome, quinone methide, benzothiazole, benzothiazine, dihydroesculetin, Dihydroxyindole carboxylic acid (DHICA), 5, 6- dihydroxyindole (DHI), dopamine-o-quinone, Dopamine Leukoopaminochrome, dopaminoichrome , norepinephrine, noradenochrome, epinephrine, adenochrome, 3-amino-tyrosine, and others.
As enzymes involved in the synthesis, one could cite: Phenylalanine hydroxylase, tyrosinase (EC 1 .14.18.1 and EC1.10.3.1 ), mushroom tyrosinase, tyrosine hydroxylases, peroxidase, Phenol-oxidase, Dopachrome tautomerase (E.C.5.3.2.3, DCT/Trp2); DHICA oxidase (Trp1 ) DHI oxidase.
Synthesis of melanins and the predominant melanin type are strongly influenced by the presence of cysteine residues (leading to pheomelanin as mentioned above), pH (alcaline pH promoting auto-osxidation of catechol), metal ions (such as CU2+, Ni2+, Fe3+, Fe2+, Co2+ ...) (Palumbo et al, Biochim Biophys Acta. 1987; 13;925(2):203-9; Palumbo et al, Biochim Biophys Acta. 1991 ;1 1 15(1 ):1 -5 ; WO 1995009629 A1 ), and the enzymes added in the incubations. For example, Pawelek (1993, 1995) described a method to produce soluble synthetic melanin by combining dopachrome and an appropriate enzyme, or by incubating 5,6-dihydroxyindole-2-carboxylic acid alone or with 5,6- dihydroxyindole, or with 3-amino-tyrosine (US Patent 5225435; US Patent 53841 16).
In marine biology, Mussel Adhesive Proteins (MAPs) have the ability to form strong adhesive bond with various substrates in wet environment. These adhesive proteins contain an unusually high proportion of L-Dopa, which after oxidative polymerization (thus leading to melanin-like compounds) is largely responsible for their adhesive strengths (Lee et al, Biomacromolecules 2002, 3, 1038-1047; Wang et al, Biomaterials 28 (2007) 3456-3468). Several primary catecholamines, such as Norepinephrine, Dopamine, or Dopa-containing polymers can undergo similar oxidative polymerization that can build up adhesive films on the surfaces of solid materials (Lee, op. cit.; Wang, op.cit.; Guvendiren et al, Adhes. 2009 ; 85(9): 631 - 645; Wei et al, Colloids Surf B Biointerfaces. 2013;1 10:22-8).
In arthropods, cuticular sclerotization is a process closely related to melanization, by which cuticles are stabilized by incorporation of phenolic compounds. Sclerotization mainly involves 3 catechols (N-acetyldopamine (NADA), dehydro-NADA and N-b-alanyldopamine (NBAD)) that are first oxidized to ortho-quinones by tyrosinase or laccase. The corresponding ortho-quinones can be rearranged to para-quinone methides and further oxidized to unsaturated quinoid derivatives and dehydro-benzodioxine derivatives. The ortho-quinones and para- quinone methides are highly reactive compounds and can form adducts by reaction with nucleophilic compounds (such as cysteine, histidine, methionine, lysine, alanine, tyrosine) to give acyldopamines substituted in the 6-position of the aromatic ring (mainly for ortho-quinone) or substituted in the beta-position of the side chain (for para-quinone methides) ( Andersen 2010, op. cit). Some authors raised the hypothesis that melanogenesis can also play a role in innate immunity (Mackintosh et al, J. theor. Biol. (2001 ) 21 1 , 101 -1 13). This hypothesis is mainly supported by the ability of insects to activate phenoloxidase (PO), that leads to the formation of melanin around intruding microorganisms, a process named melanization, that allows encapsulation of foreign particles (Eleftherianos et al, J Innate Immun 201 1 ;3:28-33; Viljakainen 2015, op. cit).
The situation might be the opposite in mammals as it is well recognized that melanin synthesis by Cryptococcus neoformans (but also some species of pathogenic bacteria and helminthes) actually increases its virulence by protecting the fungus against phagocytosis and phagocytic killing by the host (Casadevall et al, 2000, Curr Opin Microbiol. 2000 Aug;3(4):354-8). Synthetic melanin suppresses cytokine production in macrophages stimulated with lipopolysaccharide (Mohagheghpour et al, Cell Immunol. 2000;199(1 ):25-36), although fungal melanin can activate the alternative complement pathway (Rosas et al, Clin Diagn Lab Immunol. 2002;9(1 ):144-8). C57BL/6 mice that differed only in the gene encoding tyrosinase, a key enzyme in the synthesis of melanin, showed no difference in the clinical course of malaria infection (Waisberg et al, PLoS One. 2012;7(1 ):e29493). There is no mention in the literature that L-Dopa or melanin can promote an adaptive immune response such as antibodies or cytotoxic T-Lymphocytes. In particular, immunological studies have revealed that Dopa-containing polymers are poor antigens (Lee et al, Adv Mater. 2009; 21 (4): 431 -434; Wei, 2013, op. cit; Ball et al, J Colloid Interface Sci. 2012 15;386(1 ):366-72).
In a murine model of anterior uveitis, immunization against a bovine, insoluble retinal pigment epithelium (RPE) fraction has been described (Boral et al, Invest Ophthalmol Vis Sci. 1995;36(6):1056-66). Interestingly, the pathogenic antigen, still unknown, is bound to large spindle-shaped mature melanin particles (approximately 2-3μηι long) (Broekhuyse et al, Exp Eye Res. 1992;55(3):401 -1 1 ). However, the melanin appears as a companion during the purification process, as the antigen remains pathogenic even after antigen solubilisation by V8 protease (table 5, Bora 1995), making the role of melanin in the physiopathology of the disease unlikely. Other examples of such association have not been described in the literature. Direct modulation of the immune system by the neurotransmitter dopamine through autocrine/paracrine manner has been suggested. Dopamine shows conflicting effects on the immune system. Dopamine can potentiate the production of Th2 cytokines by human naive CD4 T-cells, of Th1 cytokines by activated CD4 T-cells; or of Th17 cytokines (IL-23) by DCs. Dopamine can inhibit the suppressive activity of regulatory T-cells (T-reg) , favor T-cell migration, but can also inhibit human T-cell proliferation (Sarkar et al, Brain Behav Immun. 2010; 24(4): 525-528; Pacheco et al, Front Immunol. 2014;5:1 17). Altogether, the effects of Dopamine on the immune system are complex and not straightforward. These effects do not directly trigger an antigen- specific immune response, are mediated by DARs and do not require a close vicinity between the antigen and dopamine.
It has also been reported that 5,6-dihydroxyindole-2-carboxylic acid (DHICA)- melanin plays a role in the maintenance of immune hyporesponsiveness to melanosomal proteins via DHICA-mediated antioxidation (Liu et al, Free Radic Biol Med. 201 1 May 1 ;50(9):1 177-85).
Other authors have reported some anti-inflammatory and immunomodulating properties of grape melanin. Inhibitory effects on paw edema and adjuvant induced disease. (Avramidis et al; Arzneimittelforschung. 1998 Jul;48(7):764-71 ). In particular, the authors reported an inhibitory effect of melanin on carrageenin- induced edema, as well as on edemas produced by other phlogistics, and that grape melanin showed potent inhibitory effect on adjuvant induced disease (AID) in rat. The authors indicated that the observed effect may be due to the possible inhibition of the cellular immune responses mediated by lymphocytes subpopulation Th1 (T4+ or T8+) by melanin.
In summary, the role of melanin or its precursors with regards to immunity remains elusive.
Arnon et al (1960 - Biochem. J., 75: 103-109) disclose among others, antigen protein, i.e. gelatin, egg albumin or edestin, bound to polytyrosyl, which is not a melanin I.
Sela et al (Biochem. J., vol. 75, 1 January 1960 (1960-01 -01 ), pages 91 -102) disclose an operating process for obtaining polypeptidyl gelatin. There is no oxidative polymerization and the obtained product does not comprise melanin and cannot be considered as a melanin.
Akagi et al (In: "Bioactive Surfaces", 1 January 201 1 (201 1 -01 -01 ), Springer Berlin Heidelberg, Berlin, Heidelberg, Adv Polym Sci, vol. 247, pages 31 -64) disclose Biodegradable Nanoparticles as Vaccine Adjuvants and Delivery Systems. Polyaminoacid nanoparticles are prepared with tyrosin, but this document does not disclose nor mention melanin or that the polymerization would give melanin as the final product.
US 2004/057958 discloses an immunogenic carrier which can be a polyamino acid polymer. This document never mentions or suggests to use melanin as an immunogen.
Fujita et al (Chemistry Central Journal, Biomed Central Ltd, vol. 5, no. 1 , 23 August 201 1 (201 1 -08-23), page 48) reviews the status of multiple antigen- presenting peptide vaccine systems, using nanoparticles. This document does not mention nor suggest to prepare complexes of melanin and antigens for increasing immunogenicity of the antigen.
Cui et al (Biomacromolecules, vol. 13, no. 8, 13 August 2012 (2012-08-13), pages 2225-2228) describes use of polydopamine films (which are different from melanin) on capsule to perform intracellular drug delivery. The particles are not used to obtain an immunogenic composition.
Cui et al (NANO, vol. 10, no. 05, 1 July 2015 (2015-07-01 ), pages 1530003-1 to 1530003-23) further disclose poly-dopamine capsules. The particles are not used to obtain an immunogenic composition.
Lee et al (Advanced Materials, vol. 21 , no. 4, 26 January 2009 (2009-01 -26), pages 431 -434) disclose that polydopamine films can be bioconjugated to various substrates, but do not indicate that these films display immunogenic properties.
Park et al (ACS Nano, vol. 8, no. 4, 22 April 2014 (2014-04-22), pages 3347- 3356) disclose polydopamine nanoparticles used for carrying drugs. This document does not mention or suggest melanin-antigen complexes as immunogenic compositions.
US 2012/237605 discloses nanoparticules with a polydopamine-based surface, but does not suggest or disclose the use thereof as immunogenic compositions.
Liu et al (Small. 2016 Apr 6;12(13):1744-57) disclose pathogen-mimicking polymeric nanoparticles based on dopamine polymerization as vaccines adjuvants induce robust humoral and cellular immune responses. Antigen is added after formation of the melanin.
The invention is based on the fact that melanin can be used as a potent adjuvant for inducing immunity against an antigen, when administered conjointly with this antigen. It is preferred when the melanin and the antigen are complexed, in particular when the antigen is trapped within the melanin.
Definitions
In the context of the present invention, the following terms have the following meanings:
Melanin
A "melanin" is a pigment being a macromolecule obtained from the oxidative polymerization of precursors related to indole or cathecol. Figure 1 describes the synthesis of one type of melanin (eumelanin). A melanin according to the present invention may be a "natural" melanin that could be found in nature, such as the eumelanin obtained from the polymerization of the precursors as depicted in Figure 1 , a MAPs-like polymer (containing a high proportion of a melanin precursor), or a melanin-like molecule obtained from the polymerization of precursor derivatives such as the ones described below.
There are multiple melanins which are produced by the oxidation of the amino acid tyrosine, followed by polymerization: eumelanin, pheomelanin, and neuromelanin and plant melanins.
A preferred melanin, in the context of the present application, is eumelanin. However, the composition described below and used in the composition of the invention may also use other types of melanins such as pheomelanins, neuromelanins, plant melanins, MAPs-like polymers (obtained from oxidation of polymers containing a high proportion of a melanin precursor such as L-Dopa) which can be considered as melanin-like molecules, as well as non-natural melanins obtained through polymerization of derivatives of melanin precursors.
The first step of the biosynthetic pathway for both eumelanins and pheomelanins is catalysed by tyrosinase that promotes the oxidation of its substrates (Figure 1 ):
Tyrosine→ DOPA→ dopaquinone Dopaquinone can combine with cysteine by two pathways to benzothiazines and pheomelanins
Dopaquinone + cysteine→ 5-S-cysteinyldopa→ benzothiazine intermediate → pheomelanin
Dopaquinone + cysteine→ 2-S-cysteinyldopa→ benzothiazine intermediate
→ pheomelanin
Also, dopaquinone can be converted to leucodopachrome and follow two more pathways to the eumelanins
Dopaquinone→ leucodopachrome→ dopachrome→ 5,6-dihydroxyindole-2- carboxylic acid (DHICA)→ quinone→ eumelanin
Dopaquinone → leucodopachrome → dopachrome → 5,6-dihydroxyindole (DHI)→ quinone→ eumelanin
Melanin Precursor
A "melanin precursor" is a molecule that is used or synthetized during the synthesis of a melanin. In particular, one can cite: L-phenylalanine, L-tyrosine, L- dopa, dopaquinone, cyclodopa, dopachrome, Dihydroxyindole carboxylic acid or 5,6-dihydroxyindole-2carboxylic acid (DHICA), indol 5,6 quinone, 5,6- dihydroxyindole (DHI), dopamine-o-quinone, Dopamine leukodopaminochrome, leukodopachrome (cyclodopa), dopaminochrome, norepinephrine, noradequinone, noradenochrome, epinephrine, epinephrine-o-quinone, adenochrome, 3-amino- tyrosine, 6-hydroxy-Dopa, dihydrocaffeic acid, caffeic acid and others.
L-tyrosine is a preferred precursor, and would require oxidative polymerization. L-dopa is a preferred precursor.
D-dopa is a preferred precursor.
6-hydroxy-Dopa is a preferred precursor.
DHICA is a preferred precursor.
DHI is a preferred precursor.
A mixture of DHICA and DHI is a preferred precu
Dopamine is a preferred precursor.
The term "melanin precursor" further includes derivatives of such precursors and/or polymers containing a high proportion of such precursors (such as in Mussel Adhesives Proteins).
One can choose, in particular :
a chemical compound containing a cathecol moiety HO.
HO'
or its relative ortho-benzoquinone moiety
Figure imgf000013_0001
such as : L-Dopa, D-Dopa, Dopamine, norepinephrine (noradrenaline), epinephrine (adrenaline) , 6-hydroxydopa, catechin, dihydrocaffeic acid, caffeic acid, (3,4-dihydroxyphenylacetic acid) DOPAC; 3,4-Dihydroxymandelic acid, acyldopamines, N-acetyldopamine, dehydro- N-acetyldopamine and N-b- alanyldopamine, dopaquinone, dopamine-o-quinone, norepinephrine-o-quinone, epinephrine-o-quinone.
A particulary prefered material is L-DOPA (L-3,4-dihydroxyphenylalanine), D- DOPA (D-3,4-dihydroxyphenylalanine), 6-hydroxydopa, or substituted derivatives thereof
Figure imgf000013_0002
In wich R1 , R2 and R3 are independently hydrogen -OH, or C1 to C6 alkyl groups.
A precursor of cathecol moiety, such as: phenylalanine, Tyrosine, tryptamine
a chemical compound containing a indole-5,6-diol moiety
Figure imgf000013_0003
or its relative lndoline-5,6-diol moiety
Figure imgf000013_0004
such as: Dopachrome, Dopaminochrome, noradrenochrome, adrenochrome, DHICA, Indol 5,6 quinone, LeukoDopachrome (cycloDopa), Leucodopaminechrome; leuconoradrenochrome, 5,6-dihydroxyindole-2- carboxylique (DHICA), 5,6-dihydroxyindole (DHI)
A particulary preffered material is DHICA.
a chemical compound containing a indole moiety of the formula
Figure imgf000014_0001
in which R1 , R2 and R3 may be the same or different and are independently hydrogen, -OH or C1 to C6 alkyl groups.
Other derivatives are known in the art. One can cite, as an illustration,
6-dihvdroxyindole (DHI) derivatives
Examples of DHI derivatives that can be used in the process of the invention are the ones described in WO 98051269, in particular the a dihydroxyindole being represented by the formula (I):
Figure imgf000014_0002
(I)
where
R is chosen in the group consisting of an hydrogen, an alkyl group with 1 to 6 carbon atoms, an hydroxyalkyl group with 1 to 6 carbon atoms, an aminoalkyl group with 1 to 6 carbon atoms, an aryl, and a substituted aryl containing up to three reaction inert substituents;
R1 and R2, may be the same or different, and are chosen in the group consisting of hydrogen, alkyl containing from one to six carbon atoms, or, when R2 is H, R1 may represent COOR3, wherein R3 is H or an alkyl having from one to six carbons. Alternatively, compounds as described in EP 441689 can also be used, such as the ones of formula (II)
Figure imgf000015_0001
wherein:
R represents a hydrogen atom, alkyi, alkoxy, hydroxyalkyl, aminoalkyl,
SiR6R7R8 wherein R6, R7, R8 denote alkyi, wherein alkyi comprises it from 1 to 8 carbon atoms or an unsubstituted or substituted aryl radical OH, NH2, alkyi, alkoxy or N02;
R1 and R2, identical or different, represent CrC3 alkyi or together form a methylene or ethylene group optionally substituted by one or more Ci-C3 alkyi, R3 is hydrogen or COOH,
R4 and R5, identical or different, represent an hydrogen atom, an hydroxyl group, a methyl or a C2-C6 alkyi.
One can cite, in particular, 5,6-dimethoxyindole, 5,6-methylenedioxyindole and 1 -methyl-5,6-dimethoxyindole.
DOPA derivatives
One can use DOPA derivatives, as disclosed in EP 58040, in particular, chosen from:
(a) mono and/or di-substituted ester and formate derivatives of DOPA having the formula (III):
Figure imgf000015_0002
(HI) where R is -H, a branched or unbranched, alkyl or alkenyl group having from 1 to 20 (preferably 1 to 6) carbon atoms, or an amino acid or peptide fragment,
Y1 is -H or -OH, or -CH3 or any other C2 to C6 alkyl group, and
Y2 is -H or -CH3;
(b) mono and/or di-substituted carbonate derivatives of DOPA having the formula:
Figure imgf000016_0001
where R1 is a branched or unbranched, alkyl or alkenyl group having from 1 to 20 carbon atoms;
(c) mono and/or di-substituted urethane derivatives of DOPA having the formula (V):
Figure imgf000016_0002
wherein R1 is an oxygen or a C1 -C3 alkyl group
(d) mono and/or di-substituted ether derivatives of DOPA having the structure (VI):
Figure imgf000016_0003
wherein R1 is an oxygen or a C1 -C3 alkyl group
(e) mono and/or di-substituted phosphate and/or sulphate derivatives of DOPA having the structure (VII): CO,H
xo
(VII) where one X is -POD HD or -SOD H and the other X is -H, -P03H2 or -S03H;
(f) acetal and ketal derivatives of DOPA having the structure (VIII):
Figure imgf000017_0001
where R2 is chosen from -H, alkyl and phenyl;
(g) cyclic carbonate derivatives of DOPA having the structure (IX):
Figure imgf000017_0002
(h) amino substituted derivatives of DOPA having the structure (X):
Figure imgf000017_0003
where R3 = R1 as disclosed above, or an amino acid residue; (i) carboxylate substituted derivatives of DOPA having the structure (XI): HO . coxk1
Figure imgf000018_0001
where X1 is an NH amide (especially an amino acid or peptide) linkage;
(j) linked amino and carboxylate substituted derivatives of DOPA having the structure (XII):
Figure imgf000018_0002
(XII) where R1 is as described above
(k) structural analogues of DOPA having the structure (XIII):
Figure imgf000018_0003
(XIII) where R3 is chosen from:
(i)
Figure imgf000018_0004
where X2 is the same or different and is chosen from -H, -OH, -NH2 or -SH (ϋ)
Figure imgf000019_0001
(I) structural analogues of DOPA having the structure (XIV):
Figure imgf000019_0002
where
X3 is -OH or OR1
X4 is =0 or OR1
(m) C-homologues of DOPA having the structure (XV):
Figure imgf000019_0003
where n is an integer of from 1 to 3;
(n) short chain and hetero atom analogues of DOPA having the structure (XVI):
Figure imgf000020_0001
where
X5 is S, O or NH and
X6 is H or COOH; and
(o) a glutathione derivative having the structure (XVII):
Figure imgf000020_0002
(XVII)
The substituted DOPA may also be chosen from 3,4-dihydroxyphenylserine, having the structure:
Figure imgf000020_0003
2,4,5,-trihydroxyphenylalanine, having the structure:
Figure imgf000021_0001
6 hydroxy Dopa, having the structure
Figure imgf000021_0002
Another possibility is methoxytyrosine having the structure:
Figure imgf000021_0003
and its isomer 3-hydroxy-4-methoxyphenyl alanine of structure:
Figure imgf000021_0004
Such as described in EP 580409.
DHICA derivatives As an illustration of such derivatives, one can use
Figure imgf000022_0001
where R is chosen in the group consisting consisting of an hydrogen, an alkyl group with 1 to 6 carbon atoms, an hydroxyalkyl group with 1 to 6 carbon atoms, an aminoalkyl group with 1 to 6 carbon atoms, an aryl, and a substituted aryl containing up to three reaction inert substituents, COOH, NH2.
Other melanin precursors or derivatives thereof are described in the art, such as the products described in WO 93/021898.
The term "melanin precursor" also encompasses polymeric molecules containing a high proportion of melanin precursors as disclosed above that are able to undergo polymeric oxidation. As an example, one could cite poly-Dopa peptides, poly-Tyrosine peptides, or more generally any polymers containing a high proportion of melanin precursors (such as the precursors of Mussel Adhesives Proteins).
Oxydizing agent
An "oxidizing agent" or "oxidizing molecule" is a compound that is able to provide oxygen to a solution containing melanin precursors and promote polymerization thereof and formation of a melanin macromolecule.
Oxidizing agents that can achieve this goal comprise oxygen, hydrogen peroxide, ammonium persulfate, ferric ions, sodium iodide together with hydrogen peroxide, and treatment with a salt of a transition metal cation such as copper sulfate as a catalyst for air oxidation.
It is thus preferred when the oxidizing agent is chosen in the group consisting of oxygen, hydrogen peroxide, ammonium persulfate, and ferric ions.
Immunogenic or immunostimulatory composition
An "immunogenic or immunostimulatory composition" is a composition that is able to generate an immune response in an animal when administered to said animal. Preferably, said animal is a mammal, but is can also be a bird (such as a chicken, a duck, a goose, a turkey, a quail), in particular when the composition is used in avian livestock. The animal may also be a fish, as the immunogenic composition may be used in fish farming.
However, an immunogenic composition according to the invention is preferably used in mammals. Such mammals are preferably human beings, but can also be other mammals, when the composition is used in the veterinary field, in particular for inducing immunity in livestocks such as cattle (cows), sheeps, goats or horses, but also for pets such as dogs or cats.
The immunogenic composition is thus a composition that contains an antigen and that is able to generate a immune response against such antigen. The generated immune response can be a cellular (T-cell mediated) or a humoral (B- cell mediated, production of antibodies) immune response. The immunogenic composition may also induce both a cellular and a humoral immune response.
The cellular immune response can be a CD8 T lymphocytes mediated response (ie cytotoxic response), or a CD4 T lymphocytes mediated response (helper response). It can also combine a cytotoxic and helper cellular immune response. The helpher response may involve Th1 , Th2 or Th17lymphocyt.es (such lymphocytes being able to elicit different cytolkine responses, as is known in the art).
The immunogenic composition may allow a better presentation of the antigen present therein, through MHC1 or MHC2 pathways.
Adjuvant
An "adjuvant" is a substance that has the capacity to modify or enhance the immune response to an antigen. In other words, the immune response against the antigen may be higher or different in the presence of the adjuvant than when the adjuvant is not present (that includes when the response is modified, for example when the subset of T cells that are activated in the presence of the adjuvant is different from the subset activated in the absence of the adjuvant). Adjuvants are known in the art and have been widely used in the vaccine field.
One can cite alum, emulsions (either oil-in-water or water-in-oil, such as Freund's Incomplete Adjuvant (IFA) and MF59®), PRR (Pattern recognition receptors) Ligands, TLR3 (Toll-Like Receptor 3) and RLR (RIG-I Like Receptors) ligands such as double-stranded RNA (dsRNA), or synthetic analogs of dsRNA, such as poly(l:C), TLR4 ligands such as bacterial lipopolysaccharides (LPS), MPLA (monophosphoryl lipid A), in particular formulated with alum, TLR5 ligands such as bacterial flagellin, TLR7/8 ligands such as imidazoquinolines (i.e. imiquimod, gardiquimod and R848), TLR9 ligands such as oligodeoxynucleotides containing specific CpG motifs (CpG ODNs) or NOD2 (Nucleotide-binding oligomerization domain-containing protein 2) ligands. The term ligand above describes preferably an agonist of the receptor, i.e. a substance that binds to the receptor and activates the receptor, in particular for TLR3 and TLR9 receptors. Antigen
In the context of the invention, an "antigen" is an antigen is a molecule or a combination of molecules against which it is desired to elicit a immune response in order for the immune system of a living animal to recognize it. Such antigen may be foreign to the body of the host to which the immune response is sought. In this case, the antigen may be a protein expressed by a bacteria or a virus. The antigen may also be a self-antigen, ie a protein that is expressed by cells of the host, such as tumor antigens.
Antigens can consist of whole organisms (viruses or bacteria, fungi, protozoa or even cancer cells), killed or not, cells (irradiated or not, genetically modified or not), or subfractions of these organisms/cells like cell extracts or cell lysates. Antigens can also consist of single molecules like proteins, peptides, polysaccharides, lipids, glycolipids, glycopeptides or mixture thereof. Antigens may also be one of the above-cited molecules that has been modified through a chemical modification or stabilisation. In particular, the net charge of the antigen can be modified using adequate substitution of amino acids or chemical modifications of the antigen.
An antigen may be a full protein, or any part of a protein, such as an epitope of the protein. The antigen, in the context of the present invention may also consist in a synthetic protein or molecule that contains multiple epitopes that are linked together.
In particular, the antigen may be a protein containing multiple epitopes of the same antigen, these epitopes being specific of a MHC haplotype. In this case, one can use a unique immunostimulatory molecule as described herein to obtain a immune response in in different genetic (MHC) context.
In another embodiment, the antigen may be a protein containing multiple epitopes obtained from various antigens of the same pathogen (the term pathogen preferably indicate a foreign pathogenic agent such as a bacteria, a virus, a parasite or a fungus, but may also extend to tumour cells). In this case, one can use the immunostimulatory molecule to obtain a strong immune response against this pathogen.
The antigen that can be used with the melanin macromolecule in the disclosed composition is any antigen against which a immune response is searched.
This antigen can be a full protein as found in nature, or only part of a protein found in nature.
The antigen as intended in the immunogenic composition as herein described, can also be a mixture of antigens.
The antigen may be a protein, a peptide, a polysaccharide, or a lipid. The antigen may be part (coats, capsules, cell walls, flagella, fimbrae, and toxins) of a bacteria, a virus, or another microorganisms. The antigen may a a more complex molecule such as a lipid combined with a protein and/or a polysaccharide.
Epitopes
In a particular embodiment, the antigen as used in the immunogenic composition comprises one or several MHC epitopes.
In a particular embodiment, the antigen as used in the immunogenic composition consists in a MHC epitope.
In another embodiment, the antigen as used in the immunogenic composition consists in a MHC epitope which is flanked, at its N and/or C terminus by a few amino-acids (between 1 and 10, preferably between 1 and 6 amino-acids at one, or both C and N terminal ends).
A MHC epitope (or T cell epitope) is presented on the surface of an antigen- presenting cell, where they are bound to MHC molecules. T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 1 1 amino acids in length, whereas MHC class II molecules present longer peptides, 13-17 amino acids in length (https://en.wikipedia.Org/wiki/Epitope#T_cell_epitopes).
The MHC epitope may be synthetized in vitro (with or without addition of amino acids at its C and/or N terminal extremities). MHC bound peptides may be extracted from live cells, in particular tumor cells, by any method known in the art such as acid treatment in particular with hydrochloric acid. In another embodiment, the antigen comprises one or several B cell epitopes, i.e. part of a protein that is recognized by an antibody, preferably linear epitopes, formed by a continuous sequence of amino acids from the antigen.
In a particular embodiment, the antigen as used in the immunogenic composition consists in a B cell epitope.
In another embodiment, the antigen as used in the immunogenic composition consists in a B cell epitope which is flanked, at its N and/or C terminus by a few amino-acids (between 1 and 10, preferably between 1 and 6 amino-acids at one, or both C and N terminal ends).
Different methods in the literature, relating to epitope mapping, make it possible to identify T cell or B cell epitopes from a given antigen.
However, the composition as disclosed herein makes it possible to only use the epitopes that are already known from known antigens (which are thus well characterized), rather than full proteins. The fact to use only epitopes (i.e. small antigenic parts) to elicit a immune response is particularly interesting to limit any adverse effects that could be associated with the use of large size proteins.
Other synthetic antigens
In particular, the antigen may be a synthetic molecule comprising multiple epitopes, separated by stretches of amino acids or any other acceptable linkers such as polyether compounds or other linkers used in dendrimer constructs (Tarn, Proc Natl Acad Sci USA. 1988, 85(15):5409-13; Seelbach et al, Acta Biomater. 2014 10(10):4340-50; Sadler and Tarn, Reviews in Molecular Biotechnology 90, 3- 4, pp195-229; Bolhassani et al, Mol Cancer. 201 1 Jan 7;10:3 ).
The multiple epitopes may be epitopes specific for different HLA genotypes (in order to generate a single immunogenic or immunostimulatory composition that able to elicit a immune response against a given antigen or pathogen in a broad population of patients.
In another embodiment, the epitopes may originate from the same or multiple antigens of the same pathogenic agent, in order to elicit a strong immune response against said pathogenic having the multiple epitopes.
In another embodiment, the epitopes may originate from different pathogenic agents, in order to elicit a immune response against these various agents at one time, by using the immunogenic composition. The antigen may contain universal T helper epitopes such as pan-DR epitope (PADRE) and Pol7n epitopes. The literature widely discloses other universal T helper epitopes. Source of the antigens
Antigens that can be used in the present invention can be chosen in particular among:
Exogenous antigens (antigens that have entered the body from the outside, for example by inhalation, ingestion or injection; these antigens are generally presented by MHC II molecules).
Endogenous antigens (antigens generated within normal cells as a result of normal cell metabolism, or because of viral or intracellular bacterial infection; these antigens are generally presented by MHC I molecules) . Neoantigens (such as tumor antigens, such as epitopes derived from viral open reading frames in virus-associated tumors, or other tumor antigens presented by MHC I or MHC II molecules on the surface of tumor cells. - Allergens (an antigen capable of stimulating a type-l hypersensitivity reaction in atopic individuals through Immunoglobulin E (IgE) responses). As examples of tumor antigens, one can cite alphafetoprotein (AFP) found in germ cell tumors and hepatocellular carcinoma, carcinoembryonic antigen (CEA) found in bowel cancers, CA-125 found in ovarian cancer, MUC-1 found in breast cancer, epithelial tumor antigen (ETA) found in breast cancer, tyrosinase or melanoma-associated antigen (MAGE) found in malignant melanoma, abnormal products of ras, p53 found in various tumors, gp100 (Melanocyte protein PMEL, a type I transmembrane glycoprotein enriched in melanosomes), TRP2 (Tyrosinase- Related Protein 2), EPHA2 (receptor tyrosine kinase, frequently overexpressed in a wide array of advanced cancers such as gliomas), survivin (baculoviral inhibitor of apoptosis repeat-containing 5 or BIRC5, expressed in particular in breast and lung cancer), EGFRvlll (epidermal growth factor receptor mutant, expressed in particular in glioblastomas).
As examples of pathogens from which antigens can be used in the immunogenic composition, one can cite any pathogens involved in infectious diseases (virus, bacteria, parasite, mycosis). For infectious diseases, preferred pathogens are selected from human immune deficiency virus (HIV), hepatitis A and B viruses, hepatitis C virus (HCV), Rous sarcoma virus (RSV), Ebola viruses, Cytomegalovirus, Herpes viruses, Varicella Zoster Virus, Epstein Barr virus (EBV), Influenza virus, Adenoviruses, Rotavirus, Rubeola and rubella viruses, Variola virus, Staphylococcus, Chlamydiae, Mycobacterium tuberculosis, Streptococcus pneumoniae, Bacillus anthracis, Vibrio cholerae, Helicobacter Pilorii, Salmonella, Plasmodium sp. (P. falciparum, P. vivax, etc.), Pneumocystis carinii, Giardia duodenalis (Giardiose), Schistosoma (Bilharziose), Aspergillus, Cryptococcus, Candida albicans, Listeria monocytogenes, or Toxoplasma gondii.
As examples of diseases which can benefit from immunizations with an appropriate antigen one can cite: cancer (benign or malignant tumors); hematological malignancies, allergies, autoimmune diseases, chronic diseases such as atherosclerosis, or Alzheimer disease.
The antigen is thus preferably a bacterial or viral antigen (or a polypeptide or polymer (such as the ones usable in dendrimers) containing one or more epitopes isolated from a bacterial or viral antigen).
In another embodiment, the antigen is a self-antigen (endogenous or neoantigen), in particular a tumor specific antigen (or a polypeptide containing one or more epitopes isolated from such antigens).
In another embodiment, the antigen is an allergen or a polypeptide containing one or more epitopes isolated from such antigen.
Modification of the antigens
The melanin precursors are generally charged. In particular, the presence of carboxyl groups in such precursor will provide negative charges. Thus DHICA (5,6- dihydroxyindole-2-carboxylic acid) is negatively charged. A contrario, other precursors such as DHI (5,6-dihydroxyindole) are neutral or positively charged.
In order to improve the immunostimulatory property of the composition as disclosed, it is thus preferred when the antigen presents a neutral charge or a charge that is opposite to the charge of the melanin. Thus, when using Dopa or DHICA as the melanin precursor, one may advantageously use an antigen that is positively charged. In this embodiment though, it is important to note that the whole charge of the antigen doesn't need to be positive, but that the antigen shall present at least a region that is positively charged. This may be obtained by adding tails of positively charged amino acids to the antigen, but other methods (grafting positive moieties to the antigen) may also be used.
When dopamine or DHI are used, the antigen may be neutral or negatively charged.
The purpose of this embodiment is to improve the formation of the melanin- antigen complex in the immunostimulatory composition, by allowing the antigen and the melanin precursor to be close to each other through charge attraction (electrostatic attraction) before oxidative polymerization. Vaccine
In the context of the invention, a vaccine is a composition that is administered to produce or artificially increase immunity to a particular antigen. It is thus undersood that the terms "immunogenic composition", "immunostimulatory composition" and "vaccine" are synonymous terms.
Detailed Description of the invention
The invention thus relates to an immunostimulatory composition comprising an antigen and a melanin macromolecule. Said composition can be used as a vaccine as will be discussed below.
It is preferred when the antigen and the melanin are complexed to each other. One can easily test that the antigen is complexed with the melanin by performing a thin layer chromatography of the composition and verifying that the antigen is not detectable, or that the majority (more than 50 %, more preferably 60 %, more preferably 70 %, more preferably 80 %, or more than 90 %) of the antigen initially present in the composition has disappeared. The melanin and the antigen are thus complexed when the two entities are so linked together than they don't migrate separately on thin layer chromatography. In other word, it is not possible to distinguish or separate the two entities in the composition. Other methods can be used to verify that the antigen and the melanin are complexed, such as HPLC or polyacrylamide gels. It is to be noted that the percentage of the antigen that is complexed with the melanin depends on the quantity of the melanin precursor present before polymerization thereof. In particular, if the antigen is in large excess as compared to the precursor, there will be a low percentage of the antigen complexed with the melanin macromolecule. In any case, a quantitative analysis method such as HPLC makes it possible to determine that antigen has been complexed within the formed melanin and may be used in the context of the present application.
When the composition has been obtained by polymerization of the antigen and melanin precursor, without being bound to this theory, it is supposed that the antigen has been trapped within the melanin macromolecule thus obtained.
As indicated above, melanin is a macromolecule that is obtained after oxidative polymerization of melanin precursors. It is preferred when the melanin is a soluble melanin in the immunostimulatory composition. A soluble melanin is a melanin that is in the form of particles of small size, ie less than 500nm, preferably less than 250 nm or less than 200 nm.
It is possible to obtain a soluble melanin composition by filtration of the composition obtained after polymerization with a filter having adapted size of pores.
It is to be noted that, in the presence of oxygen, DHI spontaneously forms a black precipitate, whereas DHICA forms a golden-brown solution (Pawelek, Pigment Cell Res. 1991 Mar;4(2):53-62) and that the composition containing soluble melanin-antigen complex is thus preferably obtained from using DHICA, dopachrome (rather unstable though), cyclodopa, dopaquinone or Dopa as the melanin precursor.
Obtaining the immunogenic composition
The composition as disclosed above is susceptible to be obtained after polymerization of melanin precursors in the presence of the antigen.
The composition is preferably obtained after polymerization, in particular oxidative polymerization, of melanin precursors in the presence of the antigen.
The antigen may be present in solution with the melanin precursor, or may be bound to the melanin precursor, in particular by a covalent bound. Such embodiment may be obtained by linking a melanin precursor to the antigen. When the antigen is a peptide, it is, in particular, possible to bind the melanin precursor to the N- or C-terminal of the peptide. It is particularly easy to do so when the melanin precursor is tyrosine or Dopa.
As indicated above, the composition herein disclosed, that is immunogenic, is characterized as being a soluble melanin composition from which the antigen is hardly detectable as a free form in solution, and which is able to induce an immune response against the antigen. It is possible to add free antigens in solution, but the composition as described in the present application is such as it possesses the immunogenic property without such free antigens in solution. In other words, a immune response may be obtained against the antigen even in the absence of free antigen in solution. Thus, a composition containing a melanin macromolecule complexed with an antigen, and an antigen in solution is also within the bounds of the present invention.
One can note that the melanin macromolecule may be disassembled by any method known in the art (such as the one disclosed in Schraermeyer and Dohms, Pigment Cell Res. 1996 Oct;9(5):248-54) and that the antigen complexed therein may thus be released, identified and analyzed by any method known in the art such as mass spectrometry.
Polymerization of melanin precursors in the presence of the antigen is perfomed by methods disclosed in the art.
In particular, the melanin precursor and the antigen may be incubated, with or without buffer, with an enzyme such as phenylalanine hydroxylase, tyrosinase, mushroom tyrosinase, tyrosine hydroxylase, peroxidase, Phenol-oxidase, Dopachrome tautomerase, DHICA oxidase, DHI oxidase. The choice of the enzyme will be made by the person skilled in the art depending on the nature of the precursor present in solution with the antigen before polymerization.
The mixture is also exposed to an oxidizing agent as disclosed above in order to promote the polymerization to melanin. When this polymerization is made in the presence of the antigen, it is postulated that the macromolecule thus formed has entrapped the antigen, and/or that a complex between the antigen and the melanin has been formed. Such complex may or may not comprise covalent links between the antigen and the melanin.
When the charge of the antigen is modified, the characteristics of the complex may also be modified.
Generally speaking, several points may be optimized on an antigen-by-antigen basis. Among others, the person skilled in the art may optimize various parameters such as the ratio of cathecol (melanin precursor)/antigen; the degree of oxidation of the cathecol (in particular by optimization of the type of oxidant, pH, buffer, or length of incubation), or the temperature of reaction. The immunostimulatory composition as disclosed may also comprise another immunostimulatory molecule, ie an adjuvant as disclosed above.
It is preferred when this adjuvant is selected in the group consisting of TLR3 agonists and TLR9 agonists and in particular when this adjuvant that is further added is chosen among Polyinosinic:polycytidylic acid (poly l:C) and CpG oligonucleotides.
The adjuvant can be added with the antigen before initiation of the polymerization of the melanin precursor. In this case, it is possible that it will also be complexed with the antigen, within the melanin/antigen macromolecule.
Alternatively, the adjuvant may be added to the melanin-antigen complex immunogenic composition after that polymerization has occurred. In this case, it is postulated that the adjuvant is not complexed with the melanin/antigen macromolecule.
Use of the immunogenic composition
The invention also relates to the use of melanin or a melanin precursor for the preparation of an immunostimulatory composition, or a vaccine intended to elicit an immune response against an antigen when administered to an animal (as disclosed above, including human being). Alternatively, the immunostimulatory composition can be used in vitro in presence of live cells (for example macrophages, dendritic cells or lymphocytes), to sensitize them before administration (preferably injection) in humans or animal. The resulting composition will thus elicit a immune response against the antigen in the recipient. In particular, US 6210662 discloses such principle of forming therapeutic or immunogenic compositions consisting of antigen presenting cells activated by contact with a antigen complex. In the present case, the antigen-melanin complex is the one obtained according to methods described herein.
The melanin precursor is exposed to the antigen and the solution is then submitted to polymerization conditions (exposure to agents such as enzymes or chemicals to induce polymerization) thereby leading to the immunostimulatory composition. The invention also relates to the use of melanin or of a melanin precursor as an adjuvant to increase or elicit an immune response against a target antigen. This is particularly useful when the target antigen is not, by itself, immunogenic (i.e. no immune response is obtained when the antigen is administered).
The invention also relates to melanin or a melanin precursor as an immunostimulatory molecule. In particular, the melanin or a melanin precursor acts to increase the immune response to an antigen when presented with this antigen. It is to be noted that in vivo administration of the melanin precursor and the antigen may lead to in vivo polymerization of the melanin precursor to melanin and to the formation of the immunostimulatory composition disclosed above. This is particularly true when the melanin precursor and the antigen are associated by electrostatic links, when both have an opposite charge.
The invention also relates to a complex comprising a melanin macromolecule complexed with an antigen as an immunostimulatory composition.
The invention also relates to a complex consisting of a melanin macromolecule complexed with an antigen as an immunostimulatory composition.
The invention also relates to melanin or melanin precursor for its use for increasing or eliciting an immune response against a target antigen.
The invention also relates to an immunostimulatory composition comprising a melanin and a target antigen for its use as a vaccine to protect an animal against a disease implicating (i.e. involving and/or concerning) cells expressing inside the cells, at their surface, or secreting the target antigen or epitopes thereof.
The vaccine may be a prophylactic (i.e. intended to protect the recipient against the development of a disease) or a therapeutic (i.e. intended to help the recipient fight an already present disease) vaccine.
The protected animal has been disclosed above, and may be human being.
The disease is linked to the target antigen used in the immunostimulatory composition. In consequence, the antigen or an epitope thereof is expressed or presented by cells of the animal (or by pathogens) during the course of the disease. The disease thus involves or concerns cells expressing the target antigen. Such expression may be secretion of the antigen (as an illustration, the antigen may be a bacterial toxin), or surface expression of the antigen or epitope thereof (the antigen may be a surface protein of a virus, or an tumor-specific antigen or epitope thereof expressed at the surface of tumor cells), or presentation of the antigen or epitope thereof at the surface of cells (such as a MHC presentation of an antigen or epitope thereof by the target cell).
The invention also relates to a method for obtaining an immunostimulatory composition comprising the steps of
a) Providing a composition containing melanin precursors and an antigen b) inducing polymerization of the melanin precursor so as to form a melanin- antigen complex
thereby obtaining an immunostimulatory composition able to elicit an immune response against the antigen when administered to a patient, or when incubated with cells in vitro (this would prime the cells which can then be administered to a patient or an animal).
The antigen used in this method is an antigen against which an immune response is sought in a recipient.
Polymerization is induced as indicated above. It is thus preferably an oxidative polymerization. It is preferably induced in vitro but may also be induced in vivo as indicated above.
In a specific embodiment, the composition of a) also contains an adjuvant. Said adjuvant is other than a melanin precursor, and is preferably a TLR3 or TLR9 agonist, such as an adjuvant selected in the group consisting of poly l:C and CpG- oligonucleotides.
Description of the Figures
Figure 1 : schematic description of the synthesis of eumelanin starting from phenylalanine.
Figure 2: CTL response after immunization with ^g of the Ovalbumine epitope SIINFEKL (pOVA, SEQ ID NO: 2) or ^ 0[^g or the human gp100 epitope KVPRNQDWL (hgp100, SEQ ID NO: 3). C57-BI6 mice were injected twice (day 0 & day 7) with the epitope + CpG-28 (SEQ ID NO: 1 ), the epitope + DOPA (D) + CpG- 28; or [the epitope + DOPA, co incubated for 18 hours (D incub)] + ^ 0\^g CpG-28 (10μς Dopa for pOVA; 100μg Dopa for hgp100) . The immune response was assessed on day 14. Splenocytes were re-stimulated in vitro with the corresponding MHC class l-restricted peptide and the numbers of IFNg-SFCs (Spot forming cells) were measured. (Representative experiment with n=4 mice/group). Figure 3: CTL response after 2 immunizations with 1 Oμg of peptide KVPRNQDWL (hgpl OO, SEQ ID NO: 3) or I pg SIINFEKL (pOVA, SEQ ID NO: 2), combined with DOPA (Ι ΟΟμς for hgpl OO, ^g for pOVA), and incubated with various molar ratio (oxidant/Dopa) of H202 for 4 hours, or ammonium persulfate (APS) for 2 hours, respectively. In each formulation, 10μg CpG-28 (SEQ ID NO: 1 ) / mouse were added before immunizations. The immune response was assessed on day 14. Splenocytes were re-stimulated in vitro with the corresponding MHC class I- restricted peptide and the numbers of IFNg-SFCs (Spot forming cells) were measured. (n=4 mice/group).
Figure 4: CTL response after immunization with ^g of p OVA (SIINFEKL, SEQ ID NO: 2). C57-BI6 mice were injected twice (day 0 & day 7) with peptide + CpG-28 (SEQ ID NO: 1 ), [peptide +
Figure imgf000035_0001
DOPA + APS] incubated for 4hours + CpG-28; or [peptide + ^g Dopamine (Dn) + APS] + CpG-28. The immune response was assessed on day 14. Splenocytes were re-stimulated in vitro with the corresponding MHC class l-restricted epitope SIINFEKL and the numbers of IFNg- SFCs (Spot forming cells) were measured. (Representative experiment with n=4 mice/group).
Figure 5: CTL response after immunization with 3.6 μg or the long OVA peptide (pOVAI, SEQ ID NO: 4). C57-BI6 mice were injected twice (day 0 & day 7) with peptide + CpG-28 (SEQ ID NO: 1 ), or [peptide + 100μg Dopamine (Dn)+ APS] + CpG-28. The immune response was assessed on day 14. Splenocytes were re- stimulated in vitro with the corresponding MHC class l-restricted epitope SIINFEKL and the numbers of IFNg-SFCs (Spot forming cells) were measured. (Representative experiment with n=4 mice/group).
Figure 6: CTL response after immunization with 10μg of the human gp100 epitope (hgpl OO, SEQ ID NO: 3). C57-BI6 mice were injected twice (day 0 & day 7) with the epitope co-incubated for 18 hours with 100μg DOPA at pH 8.5 (Ag then D); or with 100μg DOPA previously incubated in the presence of oxygen before the epitope was added (D then Ag). In each formulation, ^g CpG-28 (SEQ ID NO: 1 ) / mouse were added before immunizations. The immune response was assessed on day 14. Splenocytes were re-stimulated in vitro with the corresponding MHC class l-restricted peptide and the numbers of IFNg-SFCs (Spot forming cells) were measured. (Representative experiment with n=4 mice/group).
Figure 7: CTL response after immunization with ^g of the Ovalbumine epitope (SIINFEKL=pOVA, SEQ ID NO: 2), or with 1 μg of the epitope synthesized with a DOPA at the beginning (D-pOVA) or at the end (pOVA-D) of the peptide. C57-BI6 mice were injected twice (day 0 & day 7) with the peptides + 1 C^g CpG-28 (SEQ I D NO: 1 ). The immune response was assessed on day 14. Splenocytes were re- stimulated in vitro with the SII NFEKL (SEQ ID NO: 2) peptide and the numbers of IFNg-SFCs (Spot forming cells) were measured. (n=4 mice/group).
Figure 8: Thin-layer chromatography (TLC) after a 72-hour incubation at pH 8.5 (Tris buffer). Left: hgp100 (SEQ ID NO: 3). only; middle: hgp100 (1 mg/ml) and Dopa (10mg/ml), co- incubated with 02; right: hgpl OO (1 mg/ml) added after Dopa (10mg/ml) had been incubated with 02. The peptide, trapped into oxidized DOPA, is not seen any more when both Dopa and the peptide are co-incubated. (TLC was performed on aluminium foils, coated with a thin layer of silica gel as the stationary phase. After the samples have been loaded, a mixture of 1 -Butanol/acetic acid /H20 (2/1 /1 ) was used as the mobile phase. The TLC plates were then sprayed with ninhydrin reagent)
Figure 9: Thin-layer chromatography (TLC) after a 72-hour incubation at pH 8.5 (Tris buffer). Left: hgpl OO (, SEQ ID NO: 3) only; other lanes: hgpl OO (1 mg/ml) incubated with various doses of Dopa (Dopa/hgp100 weight ratios: from 1 /5 to 10/1 ). The peptide, complexed with melanin (oxidized DOPA), is not seen any more when the ratio is over 2. (TLC: similar conditions as Figure 8).
Figure 10: CTL response after immunization with 3.6 μg of different OVA peptides: SEQ ID NO: 5 (SMLVLLPKSVSGLSQLESI I NFEKLTSWTS, neutral), or SEQ I D NO: 6 (SMLVLLPKKVSGLKQLESII NFEKLTKWTS, positively charged). C57-BI6 mice were injected twice (day 0 & day 7) with the epitopes co-incubated for 18 hours with 10Oyg DOPA at pH 8.5. In each formulation, 10yg CpG-28 (SEQ ID NO: 1 ) per mouse were added before immunizations. The immune response was assessed on day 14. Splenocytes were re-stimulated in vitro with the corresponding MHC class l-restricted epitope SI I NFEKL and the numbers of IFNg- SFCs (Spot forming cells) were measured. (n=4 mice/group).
Figure 1 1 : SDS-PAGE (16% polyacrylamide gel) of various preparations: lane MW: molecular weight marker; lane "Ctrl EphA2": control peptide EphA2 alone (SEQ ID NO: 9) ; lane "Filtrate": filtrate of complex melanin-EphA2 after filtration on a 10kD filter; lane "Retentate": retentate of complex melanin-EphA2 after filtration on a 10kD filter, resuspension, dissolution and heating in loading buffer containing SDS. (Melanin-EphA2 was obtained by co-incubating EphA2 peptide with L-Dopa (weight ration 1 :10) in arerated conditions) Figure 12: Physico-chemical characteristics of gp100-bound melanin:UV-visible spectrum (Evolution over time during synthesis). UV visible spectra were obtained using a JASCO V630 spectrophotometer (JASCO, Lisses, France). The solution of polymerizing L-Dopa was diluted 1/20, and spectra were recorded using 1 cm path length quartz cuvette after different incubation times.
Figure 13: Numbers of IFNv-secreting lymphocytes per 105 splenocytes after immunization with various formulations. A. impact of TLR9-agonist in a specific composition with gp100 (SEQ ID NO: 3) and melanin. B. Effect of the ratio of antigen/L-Dopa in the incubation medium to prepare gp100-melanin on the immune response. C. comparison of different gp100-melanin compositions (various antigen dosage) with a composition associating gp100 , the classical adjuvant (incomplete Freund's adjuvant, IFA) and a TLR9 agonist.
Figure 14: Number of IFNv-secreting cells per 105 cells (splenocytes) upon stimulation with a CD4 or CD8 epitope, after immunization of mice with a synthetic peptide (pOVALs) (SEQ ID NO: 12).) containing both a CD4 and a CD8 ovalbumine epitopes, either alone or within a composition with melanin. Results shown for mice were immunized on day 0 &14 and sacrificed on day 21 (A), or on day 0 & 21 and sacrificed on day 42 (B).
Figure 15: Mean of tumor volume over time for different vaccine formulations.
Examples
Methods
In all examples, epitopes presented by H-2Kb (mouse MHC I) were used (except in example 18 which is also using a mouse MHC-II epitope).
C57-BI6, 5-week old, mice were immunized twice (on day 1 and day 7) with the different formulations combined to a Toll-like Receptor 9 (TLR-9) agonist (10 μg of the CpG-28 oligonucleotide, TAAAC GTTATAAC GTTAC G AC GTC AT (SEQ ID NO: 1 )). After 2 immunizations, the CD8+ immune response was evaluated on day 14 using a gamma interferon (IFNg)-secretion Elispot assay, after restimulation of total splenocytes with the relevant MHC class-l epitope (SIINFEKL (SEQ ID NO: 2) for Ovalbumine or KVPRNQDWL (SEQ ID NO: 3) for human gp100)
Example 1 - Incubation of antigen and a melanin precursor in presence of an oxidant induces an immune response The Ovalbumine epitope (SIINFEKL, SEQ ID NO: 2) alone, or mixed with "Ι Ομς of DOPA, or mixed with DOPA and further incubated for 18 hours in the presence of oxygen to promote oxidation, were used as vaccine preparations. While the epitope alone did not trigger any significant CD8 immune response, the association with DOPA, especially after incubation, was able to induce IFNg spots.
Similar data were obtained with the poorly immunogenic human gp100 epitope (KVPRNQDWL, SEQ ID NO: 3). Very small amounts of epitope can be used.
These results are shown on Figure 2.
In particular, in this model, as little as 10ng of SIINEFKL (SEQ ID NO: 2) was sufficient to detect an immune response (data not shown).
Example 2 - The immune response is not dependent on the oxidizing agent used (either chemical or enzymatic oxidation)
Other oxidizing agents such as hydrogen peroxide (H202) or ammonium persulfate (APS) can be used (Figure 3).
In each case, depending on the antigen and the oxidant used, the optimal concentration is easily defined.
As previously described, a CTL response was seen without addition of any oxidant, but the efficacy of the vaccine was generally enhanced by oxidation, the optimal molar ratio of oxidant Dopa being around 1 / 4.
Other oxidizing agents such as ferric chlorure can also be used and lead to the same results.
As shown in Table 1 , enzymatic oxidation with mushroom tyrosinase also led to the obtention of a strong immune response.
Figure imgf000038_0001
Figure imgf000039_0001
Table 1
Example 3 - An immune response is observed with other melanin precursor
This example demonstrates that Dopamine can be used instead of DOPA (Figure 4). In this experiment, 1 μg DOPA or 1 μg Dopamine were mixed to 1 μg SIINFEKL (pOVA, SEQ ID NO: 2), incubated 4 hours with the ammonium persulfate (APS) oxidant and then used as a vaccine preparations in association with 1 C^g CpG-28.
Example 4 - Use of a long antigen containing an epitope still makes it possible to have the epitope processed and adequately presented
Experiments were conducted to show that other antigens, such as a long peptide, can induce a CTL response with the same procedures. The long OVA peptide (SMLVLLPDEVSGLEQLESIINFEKLTEWTS (SEQ ID NO: 4)), containing the SIINFEKL epitope (SEQ ID NO: 2), was tested, either alone, or combined to Dopamine and incubated 4 hours with APS and then used as a vaccine preparation in association with 10μg CpG-28. Only the preparation containing Dopamine triggered an immune response (Figure 5).
Example 5 - Various adjuvants can be used in the composition
In this experiment, it was shown that various adjuvants can be advantageously added to the formulation [Antigen+Dopa].
In this experiment, the used adjuvants were substituted to the CpG-ODN, according to the same protocol than the one disclosed in the Methods above. The SIINFEKL epitope (SEQ ID NO: 2), was combined (or not) to Ι ΟΟμς Dopa, further incubated for 18 hours in the presence of oxygen to promote oxidation, and then used as vaccines in association with 10μg CpG-28 (TLR9 agonist), 1 C^g Polyinosinic:polycytidylic acid (poly l:C) (TLR3 agonist), or mixed to Freud adjuvant or aluminium salts (Alum) (vol/vol 1/1 ).
The CD8 immune response at day 14 was significantly higher for the [DOPA- antigen] composition than the one observed for the antigen without DOPA, especially when the TLR3 or TLR9 ligands were used. Example 6 - The immune response comprises a humoral response
Immunization with a composition melanin/antigen induces a humoral response (circulating antibodies).
Ovalbumin protein (1 μg) was mixed to Dopa (1 μg) at pH 7.4, incubated for 4 hours with APS (O^g), and injected subcutaneously with 10μg in C57/Bml6 mice on day 0 and day 7.
At day 14, significant titers of anti-ovalbumine antibodies of both lgG1 (1/8000) and lgG2b (1/5250) subtypes were seen, showing a mixed Th1 and Th2 immune response. Example 7 - formation of the complex through co-incubation is favourable
It was shown that the co-incubation of the antigen and the catechol moiety during its oxidation makes it possible to potentiate the trigerred immunity.
10 μg of the hgp100 epitope (KVPRNQDWL, SEQ ID NO: 3), was either mixed to 100μg DOPA at pH 8.5, then incubated for 18 hours in the presence of oxygen to promote oxidation, or mixed to a solution of DOPA that has been previously incubated in the presence of oxygen to promote oxidation before the epitope was added.
A significant CD8 immune response was seen when the epitope was co-incubated with DOPA (Figure 6).
Example 8: An immune response can be obtained with various melanin precursor of derivatives
L-Dopa is a convenient catechol to use, leading to soluble melanin. However other melanin precursors can be used. In this experiment, 10 μg of the hgp100 epitope (KVPRNQDWL, SEQ ID NO: 3), were mixed with either
Figure imgf000041_0001
^ 00\^g L-Tyrosine, HO
Ι ΟΟμς 3-(4-Hydroxyphenyl)propionic acid,
Figure imgf000041_0002
Ι ΟΟμς 6-Hydroxy-DOP 100 Dih dro caffeic,
Figure imgf000041_0003
Figure imgf000041_0004
50[ g DHI+50 g DHICA, or
- "l OO g HICA,
Figure imgf000041_0005
at pH 8.5 in Tris buffer.
The solution was then incubated for 18 hours in the presence of oxygen to promote oxidation.
In each formulations, ^ 0[^g CpG-28 /mouse were added before subcutaneous immunizations with various melanin precursors . Mice were either immunized on day 0 & 8 and sacrificed on day 14, or immunized once on day 0 and sacrificed on day 8..
A significant CD8 immune response was seen, especially when the epitope was co-incubated with Dopa (L-Dopa ou D-Dopa), or 6-hydroxydopa, or di- hydroxynaphtalene. Immune responses were also seen, with a reduced magnitude, with Dopamine and Boc-Dopa (N-(tert-Butyloxycarbonyl)-L-dopa). The presence of an amino-group on the side chain, and of 2 hydroxyl-moieties on the phenolic ring of the melanin precursor appeared very favorable for biological activity and is thus preferred. Example 9: A complex is formed between the polymerized melanin and the antigen In vitro experiments with Thin-layer chromatography (TLC) support the hypothesis that the incubation of the peptide while the catechol is being oxidized modifies the characteristic of the final formulation and that a complex is formed between the two entities (Figure 8).
Free peptide was seen on TLC only when hgp100 is added after Dopa had been oxidized, but not when Dopa and hgp100 are co-incubated with the oxidizing agent.
It is to be noted that the stability of the peptide in presence of the oxidizing agent was checked and that disparition of the peptide is thus not due to the oxidizing agent.
Using Thin-layer chromatography (TLC), it is possible to easily and routinely define the minimal dosage of catechol required for the loading of a certain amount of peptide. For example, with hgp100, a Dopa/peptide weight ration above 2 is favourable (Figure 9).
Example 10 - An immune response is obtained after polymerization of DOPA covalently linked to the antigen
Mice were immunized either with ^g of the Ovalbumine epitope (pOVA, SIINFEKL, SEQ ID NO: 2), or with 1 μg of the epitope synthesized with a DOPA at the beginning (D-SIINFEKL, D-pOVA) or at the end (SIINFEKL-D, pOVA-D) of the peptide. While the epitope alone did not trigger any significant CD8 immune response, the modified peptides, especially the one with a C-terminal DOPA induced strong CTL immune responses (Figure 7).
Exemple 11 - The other adjuvant may be added before or after oxidation
L-DOPA (Ι ΟΟμς) was incubated with the hgp100 epitope (KVPRNQDWL, SEQ ID NO: 3), in presence of the CpG-28 oligonucleotide, then incubated for 18 hours in the presence of oxygen to promote oxidation. Alternatively, the CpG-28 oligonucleotide was added after oxidation of L-DOPA and the hgp100 epitope.
The immune responses obtained after immunization of the mice with the resulting compositions were similar, thus indicating that the other adjuvant may be added before or after the oxidation (polymerization) reaction.
Example 12 - The complexed melanin-antigen composition may be obtained as a soluble melanin solution
Dopa (2mg/ml) or Dopamine (2mg/ml) solutions were incubated with or without the pOVA (0,1 mg/ml) at pH 7.4 or 8.5, and with different oxidizing agents (02, ammonium persulfate) for 20 hours. All solutions darkened within a few hours. With Dopamine, large aggregates were seen under light microscopy. Under centrifugation, the dopamine solutions precipitated, and some dark material remained adherent to the tubes.
On the contrary, in some conditions (for example when incubated with oxygen at pH8.5), the Dopa solutions did not precipitate, even after centrifugation (16 OOOg for 30 minutes) and was not adherent to the tubes. These Dopa solutions remained stable for several weeks, and no aggregates can be seen with light microscopy. This solution can be filtered through a 0.2μηι filter, but not through a 100 kDalton- cut off filter (approx. 0.01 m).
In conclusion, although both compounds can be successfully used in vaccines formulations, their characteristics differed. Without being bound to this theory, this may be due to a different percentage of DHI and DHICA in each formulation.
Using various percentages of DOPA and Dopamine in the starting composition, (especially according to the antigen characteristics and especially the charge of the antigen) can advantageously lead to various galenic formulations.
Example 13 - The complexed melanin-antigen composition is a colored solution To prepare the formulations, it is preferred when a solution of L-Dopa is mixed with a solution of peptide (weight ratio L-Dopa: epitope between 1 :100 and 1 :1 , preferably between 1 :10 and 1 :2, depending upon the epitopes), and the mixture is then oxidized at pH 8.5 in aerated conditions.
Under these conditions, the colorless L-Dopa solution turned black to generate synthetic melanin, a process that can be monitored using UV spectroscopy (Fig 12). The kinetics of L-Dopa oxidation, can be assessed by the 350/280 nm ratio. Under these conditions, when filtered through a 10-kDa filter, a black material is retained in the upper chamber, and could be easily resuspended in a saline solution. The resulting product (containing both melanin and peptides) can be further characterized using Fourier transform infrared spectra (FITR), Nuclear Magnetic Resonnance (NMR) or Transmission electronic microscopy.
Example 14 - Modifying the antigen charge can improve the immune response and immunogenicitv of the composition
The charge of the peptide pOVAI (SEQ ID NO: 4) is negative and its sequence was thus modified to make it neutral (SMLVLLPKSVSGLSQLESIINFEKLTSWTS, SEQ ID NO: 5) or positive (SMLVLLPKKVSGLKQLESIINFEKLTKWTS, SEQ ID NO: 6). When these peptides were used with Dopa (which displays a COO- moiety that is negatively charged) as the melanin precursor, the immune response obtained after 2 immunizations was strong with the positively-charged peptide, and intermediate with the neutral peptide (Figure 10).
The results obtained after immunization with these peptides and Dopamine (which is positively charged at physiological pH) as the melanin precursor were opposite (i.e. the highest immune response was observed with SEQ ID NO:4 (negatively charged peptide) and the lowest one with SEQ ID NO: 6 (positively charged) whereas the response with SEQ ID NO: 5 was intermediate).
Altogether, these results indicate that it is favourable to modify the antigen in order for its charge not to be the same than the one of the resulting melanin.
Similar data were obtained with the MHC I epitope of Trp2 (VYDFFVWL, SEQ ID NO: 7), which does not contain any positively charged amino-acids.
Adding arginines (R) or lysines (K) to the NH2-terminal end of the peptides enhanced the immune response when compared to unmodified Trp2 (animals were immunized once with formulations consisting of the peptide (10μg mouse) co- incubated with L-Dopa (100μg mouse), then mixed to CpG-28 (^g/mouse). The CD8 immune responses were assessed on day 8).
Similar data were obtained with a viral epitope in Balb/c mice (gPr73: SFAVATTAL, SEQ ID NO: 8). Adding a Lysine at the NH2-terminal end significantly enhanced the immune response. In both cases, if a glutamate (E) was added next to the lysine, the efficacy was reduced (Table 2).
Figure imgf000045_0001
Table 2
Example 15 - Distribution of melanin in draining lymph nodes
Ten (10) [Jig of the hgp100 epitope (KVPRNQDWL, SEQ ID NO: 3) were mixed to 100μg DOPA at pH 8.5, then incubated for 18 hours in the presence of oxygen to promote oxidation and generate gp100-bound melanin (gp100-melanin).
To assess the distribution of this formulation in vivo, mice were injected subcutaneously with [gp100-melanin + CpG-28] or saline, and sacrificed on days 2 or 7 (n=3/group). To avoid any bias caused by natural melanin, these experiments were carried out in Balb/c mice, which are naturally devoid of melanin. Black pigmentation of the draining inguinal lymph nodes was macroscopically visible on day 2 post-injection in gp100-melanin-injected animals. Fontana-Masson staining confirmed numerous melanin-laden macrophages in the sinuses and, to a lesser extent, in the paracortical areas, which is a T-cell zone. The pattern of melanin distribution was similar at days 2 and 7 post-injection. No melanin was observed in mice that received saline only. These results show that the vaccine formulation effectively reached the draining lymph nodes in vivo.
This finding is consistent with the fact that induction of antigen-specific immunity relies on the direct interaction of DCs with naive T cells that occur in the T-cell zone of lymph nodes.
Example 16 - Improvement of the vaccine composition
Free gp100 peptide and gp100-melanin were used as vaccine preparations alone or mixed with the TLR9 agonist CpG-28 (CpG) (n=8 mice/group). When combined with CpG, gp100-melanin, but not gp100, induced a significant number of IFNv-secreting lymphocytes (p<0.001 ) (Fig. 13A).
If the gp100 epitope was added in the vaccine formulation after L-Dopa had been oxidized instead of before, a reduction in the CTL response was observed (p<0.01 ).
Significant immunity was obtained with a weight ratio of L-Dopa:epitope starting at 1 :1 , with the best response observed at a ratio of 4:1 (Fig. 13B). The minimal dose of the gp100 epitope required to induce CTLs was 0.5 μg (p<0.01 , when compared to the lowest concentration tested) (Fig. 3c). At both 10 and 50μg of the gp100 epitope, our vaccine formulation compared favorably (p<0.01 ) with the combination of incomplete Freund's adjuvant (I FA) and a TLR9 agonist, a combination that is commonly used to trigger CTL responses (Fig. 13C).
Example 17 - Complex melanin-antigen
Evidence for inclusion of the peptide within melanin was obtained.
A solution of L-Dopa was mixed with an EPHA2 peptide (FSHHNIIRL, SEQ ID NO: 9) at a weight ratio L-Dopa: epitope of 1 :4. The mixture was then oxidized at pH 8.5 in aerated conditions.
When this preparation was filtered on a 10kD filter, the melanin was retained in the filter and no peptide could detected in the filtrate (Figure 1 1 , lane Filtrate), suggesting that the EPHA2 peptide was bound to melanin. Indeed, when this retentate was resuspended, dissolved and heated in a loading buffer containing a strong detergent (SDS), the EPHA2 peptide got dissociated from melanin, and can be individualized on SDS-page (16% polyacrylamide gel) (Figure 1 1 , lane Retentate).
Example 18 - Analysis of the immune response
The ability of our formulation to trigger a CD4 immune response (MHC class II epitopes) was assessed.
For this purpose, a synthetic peptide (pOVALs) containing both a CD4 (ISQAVHAAHAEINEA, SEQ ID NO: 10) and a CD8 (SIINFEKL, SEQ ID NO: 1 1 ) ovalbumine epitopes was synthetized. This peptide bears the sequence SLKISQAVHAAHAEINEAGRLRGSIINFEKLTKWR, SEQ ID NO: 12). This peptide (1 C^g/mouse) was mixed to a solution of L-Dopa (4C^g/mouse), incubated for 18hours in aerated conditions, to generate pOVAs-melanin, and used as vaccine (without any TLR9 agonist or any further adjuvant).
Mice were immunized either on day 0 &14 and sacrificed on day 21 , or on day 0 & 21 and sacrificed on day 42.
Epitope-specific IFNy production by splenocytes was determined after in vitro stimulation with the CD4 or the CD8 epitopes.
Formulation with melanin triggered a significant CD4 immune response, in both cases. Moreover, a CD8 immune response was also seen, showing that adjunction of a TLR9 agonist to the formulation is not needed (Figure 14).
Example 19 - Use of various adjuvants
The ability of well-described TLR9 agonists, other than CpG-28, to trigger and improve the immune response in mice with the melanin / antigen complex was assessed.
The gp100 peptide (1 C^g/mouse) was mixed with L-Dopa (4C^g/mouse), incubated for 18 hours in aerated conditions, mixed with the various TLR9 agonists CpG-28, ODN-1826 (TCCATGACGTTCCTGACGTT, SEQ ID NO: 13, or ISS (TGACTGTGAACGTTCGAGATGA, SEQ ID NO: 14), then used as vaccine preparations.
The magnitude of the immune response was similar for all TLR9 agonists.
Figure imgf000047_0001
Table 3
The efficacy of poly l:C (poly l:C= Polyinosinic:polycytidylic acid), a TLR3 agonist, was also assessed.
C57BL/6 mice were immunized with gp100 (10μg mouse) + poly l:C (10μg mouse) or gp100 peptide (10^g/mouse) mixed with L-Dopa (40μg mouse), incubated for 18 hours in aerated conditions, and mixed with poly l:C (10μg mouse). Similarly to what was seen with TLR9 agonists, when combined to poly l:C, the melanin formation was superior the free peptide (mean number of IFNv-secreting lymphocytes +/-SD: 20+/- 18 vs 1 +/-1 , respectively, p=0.02). Example 20 - Subcutaneous injections of pOVA30-melanin protect against established syngenic tumors
It was next investigated whether these CD8+ T-cells were functional in vivo.
Ovalbumin-transfected cells (E.G7-OVA) were injected subcutaneously into C57BL/6 mice, and the mice (n=10/group) were immunized on days 4 and 18 with [melanin + CpG-28], [pOVA30-melanin + CpG-28], [pOVA30 + CpG-28]. All of the mice developed measurable tumors.
The pOVA30 peptide (SMLVLLPKKVSGLKQLESIINFEKLTKWTS, SEQ ID NO: 15), contains a CD8 epitope (SIINFEKL, SEQ I D NO: 1 1 ) of the ovalbumin protein. pOVA30-melanin was generated by co-incubation of the peptide with L-Dopa in aerated conditions, as described previously.
A significant decrease in the tumor growth compared with that in the control groups was observed only after immunization with [pOVA30-melanin + CpG-28] (p<0.001 ) (Fig. 15). Complete tumor regression occurred in 2/10 mice. Discussion and comments
The examples above demonstrate that immunization with a complex of a melanin and an antigen makes it possible to obtain an immune response in a host. This immune response is higher than when the antigen is used alone. The immune response may be potentiated when the charge of the antigen and the charge of the melanin precursor, polymerized in the complex, are adapted to each others (preferably when they are not of the same sign).
It is also to be noted that most peptides used in these experiments are containing single MHC epitopes. Consequently, an adjuvant was usually preferred for an optimal immune response to be seen.
However, it was also shown that combining T-helper and MHC class-l epitopes allows the immunogenic compositions according to the invention to induce significant immune responses without the need for an adjuvant, the T-helper epitopes likely allowing recruitment of the T-helper cells and potentiation of the cytotoxic response linked to the MHC class-l epitopes.

Claims

Claims
An immunostimulatory composition comprising a melanin macromolecule complexed with an antigen.
The immunostimulatory composition of claim 1 , wherein the melanin is a soluble melanin.
3. The immunostimulatory composition of claim 1 or 2, which is susceptible to be obtained by polymerizing melanin precursors in the presence of the antigen.
4. The immunostimulatory composition of claim 3, wherein polymerization is performed by exposing the melanin precursors and the antigen to an oxidizing agent.
5. The immunostimulatory composition of claim 3 or 4, wherein the antigen and the melanin precursor are covalenty linked prior to polymerization. 6. The immunostimulatory composition of claim 3 or 4, wherein the antigen and the melanin precursor are not covalenty linked prior to polymerization.
The immunostimulatory composition of any one of claims 3 to 6, wherein the melanin precursor is chosen in the group consisting of L-dopa, L-tyrosine, D- dopa, 6-hydroxy-Dopa, dopaquinone, cyclodopa, dopachrome, DHICA, DHI, dopamine-o-quinone, dopamine, leukodopaminochrome and dopaminochrome.
The immunostimulatory composition of any one of claims 1 to 7, which also comprises an adjuvant.
9. The immunostimulatory composition of claim 8, wherein the adjuvant is complexed with the melanin macromolecule complexed with an antigen.
10. The immunostimulatory composition of claim 8, wherein the adjuvant is not complexed with the melanin macromolecule complexed with an antigen.
1 1 . The immunostimulatory composition of any one of claims 8 to 10, wherein the adjuvant is selected in the group consisting of alum, emulsions PRR ligands,
TLR3 and RLR ligands, TLR4 ligands, TLR5 ligands, TLR7/8 ligands, TLR9 ligands, in particular poly l:C and CpG ODNs.
12. The immunostimulatory composition of any one of claims 1 to 1 1 , wherein the antigen comprises at least one epitope chosen in the group consisting of
MHC epitopes and B-cell epitopes.
13. Use of melanin or a melanin precursor for the preparation of an immunostimulatory composition intended to elicit an immune response against an antigen when administered to a host.
14. Melanin or melanin precursor for its use for increasing or eliciting an immune response against a target antigen in vivo or in vitro. 15. Immunostimulatory composition comprising a melanin and a target antigen for its use as a vaccine to protect an animal against a disease implicating cells expressing the target antigen.
16. A method for obtaining an immunostimulatory composition comprising the steps of
a) Providing a composition containing melanin precursor and an antigen
b) Inducing polymerization of the melanin precursor
thereby obtaining an immunostimulatory composition able to elicit a immune response against the antigen when administered to a patient, or when incubated with cells in vitro.
17. The method of claim 16, wherein the polymerization is an oxidative polymerization.
18. The method of claim 16 or 17, wherein the antigen and the melanin precursor in the composition of step a) are covalenty bound.
19. The method of claim 16 or 17, wherein the antigen and the melanin precursor in the composition of step a) are not covalenty bound.
20. The method of any one of claims 16 to 19, wherein the melanin precursor is chosen in the group consisting of L-dopa, L-tyrosine, D-dopa, 6-hydroxy- Dopa, dopaquinone, cyclodopa, dopachrome, DHICA, DHI, dopamine-o- quinone, dopamine, leukodopaminochrome and dopaminochrome.
21 . The method of any one of claims 16 to 20, wherein the composition of a) also contains an adjuvant.
22. The method of any one of claims 16 to 20, wherein an adjuvant is added to the composition obtained after step b).
PCT/EP2016/078794 2015-11-27 2016-11-25 Immunostimulatory compositions Ceased WO2017089529A1 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
LTEP16801468.6T LT3380120T (en) 2015-11-27 2016-11-25 Immunostimulatory compositions
KR1020187018135A KR102448132B1 (en) 2015-11-27 2016-11-25 Immunostimulatory composition
US15/778,929 US10857227B2 (en) 2015-11-27 2016-11-25 Immunostimulatory compositions
BR112018010692A BR112018010692A8 (en) 2015-11-27 2016-11-25 immunostimulatory compositions, uses of melanin or a melanin precursor and method for obtaining an immunostimulatory composition
EP16801468.6A EP3380120B1 (en) 2015-11-27 2016-11-25 Immunostimulatory compositions
RU2018123170A RU2732118C2 (en) 2015-11-27 2016-11-25 Immunostimulating compositions
SI201631266T SI3380120T1 (en) 2015-11-27 2016-11-25 Immunostimulatory compositions
PL16801468T PL3380120T3 (en) 2015-11-27 2016-11-25 Immunostimulatory compositions
JP2018546753A JP7033539B2 (en) 2015-11-27 2016-11-25 Immunostimulatory composition
HRP20211085TT HRP20211085T1 (en) 2015-11-27 2016-11-25 IMMUNOSTIMULATION PREPARATIONS
DK16801468.6T DK3380120T3 (en) 2015-11-27 2016-11-25 IMMUNE STIMULATING COMPOSITIONS
CA3005930A CA3005930C (en) 2015-11-27 2016-11-25 Immunostimulatory compositions
CN201680074969.0A CN108601826B (en) 2015-11-27 2016-11-25 Immunostimulatory compositions
AU2016360902A AU2016360902B2 (en) 2015-11-27 2016-11-25 Immunostimulatory compositions
ES16801468T ES2877552T3 (en) 2015-11-27 2016-11-25 Immunostimulating compositions
IL259575A IL259575B (en) 2015-11-27 2018-05-24 Immunostimulatory compositions
US17/089,172 US11904014B2 (en) 2015-11-27 2020-11-04 Immunostimulatory compositions

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP15306887.9 2015-11-27
EP15306887.9A EP3173098A1 (en) 2015-11-27 2015-11-27 Immunostimulatory compositions

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/778,929 A-371-Of-International US10857227B2 (en) 2015-11-27 2016-11-25 Immunostimulatory compositions
US17/089,172 Continuation US11904014B2 (en) 2015-11-27 2020-11-04 Immunostimulatory compositions

Publications (1)

Publication Number Publication Date
WO2017089529A1 true WO2017089529A1 (en) 2017-06-01

Family

ID=55024030

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2016/078794 Ceased WO2017089529A1 (en) 2015-11-27 2016-11-25 Immunostimulatory compositions

Country Status (19)

Country Link
US (2) US10857227B2 (en)
EP (2) EP3173098A1 (en)
JP (1) JP7033539B2 (en)
KR (1) KR102448132B1 (en)
CN (1) CN108601826B (en)
AU (1) AU2016360902B2 (en)
BR (1) BR112018010692A8 (en)
CA (1) CA3005930C (en)
DK (1) DK3380120T3 (en)
ES (1) ES2877552T3 (en)
HR (1) HRP20211085T1 (en)
HU (1) HUE055517T2 (en)
IL (1) IL259575B (en)
LT (1) LT3380120T (en)
PL (1) PL3380120T3 (en)
PT (1) PT3380120T (en)
RU (1) RU2732118C2 (en)
SI (1) SI3380120T1 (en)
WO (1) WO2017089529A1 (en)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111246879A (en) * 2017-10-25 2020-06-05 北卡罗来纳州大学 Skin applicator for cancer photoimmunotherapy
EP3868401A1 (en) 2020-02-21 2021-08-25 Assistance Publique Hôpitaux de Paris Optimization of peptide-melanin binding
EP4382121A1 (en) 2022-12-07 2024-06-12 Altevax Vaccines against ptprz1-positive tumors
EP4420677A1 (en) 2023-02-22 2024-08-28 Altevax Vaccines against tert-positive tumors
US12403189B2 (en) 2020-10-20 2025-09-02 Longhorn Vaccines And Diagnostics, Llc Immunogenic antigens

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3173098A1 (en) * 2015-11-27 2017-05-31 Assistance Publique-Hopitaux De Paris Immunostimulatory compositions
CN112826928A (en) * 2020-11-20 2021-05-25 郑州大学 A CD40-targeted dendritic cell nano-vaccine and its construction method
CN115969974B (en) * 2022-12-29 2024-05-28 重庆医科大学附属第二医院 Isomelanopic bionic nanoparticles and preparation method thereof and application thereof in photothermal immunotherapy of glioblastoma in situ

Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0058040A1 (en) 1981-02-09 1982-08-18 Vladimir Furman Installation for the transportation of bulk material between a shore and an offshore naval vessel
EP0313380A1 (en) 1987-10-23 1989-04-26 Advanced Polymer Systems, Inc. Synthetic melanin aggregates
EP0441689A1 (en) 1990-02-05 1991-08-14 L'oreal Process for enzymatic preparation of melanin pigment and its use in cosmetics
US5225435A (en) 1990-05-18 1993-07-06 Yale University Soluble melanin
WO1993021898A1 (en) 1992-04-29 1993-11-11 Bristol-Myers Squibb Company Hair dyeing compositions comprised of 5,6-dihydroxyindole and a chlorite oxidant and methods of dyeing therewith
EP0580409A2 (en) 1992-07-20 1994-01-26 Unilever Plc Cosmetic composition containing DOPA derivatives
US5384116A (en) 1990-05-18 1995-01-24 Yale University Synthetic melanin as a sunscreen and tanning agent
WO1995009629A1 (en) 1993-10-01 1995-04-13 Yale University Synthetic melanin
WO1998051269A1 (en) 1997-05-16 1998-11-19 Bristol-Myers Squibb Company Dyeing hair with melanin precursors in the presence of iodate and peroxide
US6210662B1 (en) 1995-12-28 2001-04-03 Dendreon Corporation Immunostimulatory composition
US6576268B2 (en) 1998-08-13 2003-06-10 Jan Kerestes, Jr. Biologically active fraction of vegetable melanin, process for its production and its use
US20040057958A1 (en) 2002-05-17 2004-03-25 Waggoner David W. Immunogenicity-enhancing carriers and compositions thereof and methods of using the same
US20120237605A1 (en) 2011-03-15 2012-09-20 Messersmith Phillip B Multifunctional Metal Nanoparticles Having A Polydopamine-Based Surface and Methods of Making and Using the Same

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5210076A (en) 1988-09-13 1993-05-11 Berliner David L Methods of treating Parkinson's disease using melanin
WO2000040262A1 (en) 1999-01-05 2000-07-13 The Flinders University Of South Australia Novel agents and methods for treatment and diagnosis of ocular disorders
WO2006015115A2 (en) 2004-07-30 2006-02-09 University Of Mississippi Potent immunostimulatory extracts from microalgae
US20090142362A1 (en) * 2006-11-06 2009-06-04 Avant Immunotherapeutics, Inc. Peptide-based vaccine compositions to endogenous cholesteryl ester transfer protein (CETP)
WO2012129047A1 (en) 2011-03-18 2012-09-27 Albert Einstein College Of Medicine Of Yeshiva University Oral administration of melanin for protection against radiation
EP3173098A1 (en) * 2015-11-27 2017-05-31 Assistance Publique-Hopitaux De Paris Immunostimulatory compositions

Patent Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0058040A1 (en) 1981-02-09 1982-08-18 Vladimir Furman Installation for the transportation of bulk material between a shore and an offshore naval vessel
EP0313380A1 (en) 1987-10-23 1989-04-26 Advanced Polymer Systems, Inc. Synthetic melanin aggregates
EP0441689A1 (en) 1990-02-05 1991-08-14 L'oreal Process for enzymatic preparation of melanin pigment and its use in cosmetics
US5384116A (en) 1990-05-18 1995-01-24 Yale University Synthetic melanin as a sunscreen and tanning agent
US5225435A (en) 1990-05-18 1993-07-06 Yale University Soluble melanin
WO1993021898A1 (en) 1992-04-29 1993-11-11 Bristol-Myers Squibb Company Hair dyeing compositions comprised of 5,6-dihydroxyindole and a chlorite oxidant and methods of dyeing therewith
EP0580409A2 (en) 1992-07-20 1994-01-26 Unilever Plc Cosmetic composition containing DOPA derivatives
WO1995009629A1 (en) 1993-10-01 1995-04-13 Yale University Synthetic melanin
US6210662B1 (en) 1995-12-28 2001-04-03 Dendreon Corporation Immunostimulatory composition
WO1998051269A1 (en) 1997-05-16 1998-11-19 Bristol-Myers Squibb Company Dyeing hair with melanin precursors in the presence of iodate and peroxide
US6576268B2 (en) 1998-08-13 2003-06-10 Jan Kerestes, Jr. Biologically active fraction of vegetable melanin, process for its production and its use
US20040057958A1 (en) 2002-05-17 2004-03-25 Waggoner David W. Immunogenicity-enhancing carriers and compositions thereof and methods of using the same
US20120237605A1 (en) 2011-03-15 2012-09-20 Messersmith Phillip B Multifunctional Metal Nanoparticles Having A Polydopamine-Based Surface and Methods of Making and Using the Same

Non-Patent Citations (60)

* Cited by examiner, † Cited by third party
Title
"Bioactive Surfaces", vol. 247, 1 January 2011, SPRINGER BERLIN HEIDELBERG, Berlin, Heidelberg, ISBN: 978-3-64-220155-4, ISSN: 0065-3195, article TAKAMI AKAGI ET AL: "Biodegradable Nanoparticles as Vaccine Adjuvants and Delivery Systems: Regulation of Immune Responses by Nanoparticle-Based Vaccine", pages: 31 - 64, XP055215260, DOI: 10.1007/12_2011_150 *
AKAGI ET AL.: "Adv Polym Sci", vol. 247, 1 January 2011, SPRINGER BERLIN HEIDELBERG, article "Bioactive Surfaces", pages: 31 - 64
ANDERSEN, INSECT BIOCHEM MOL BIOL., vol. 40, no. 3, 2010, pages 166 - 78
ARNON ET AL., BIOCHEM. J., vol. 75, 1960, pages 103 - 109
AVRAMIDIS ET AL., ARZNEIMITTELFORSCHUNG, vol. 48, no. 7, July 1998 (1998-07-01), pages 764 - 71
AZMI ET AL., HUM VACCIN IMMUNOTHER., vol. 10, no. 3, 2014, pages 778 - 96
BALL ET AL., J COLLOID INTERFACE SCI., vol. 386, no. 1, 15 December 2011 (2011-12-15), pages 366 - 72
BOLHASSANI ET AL., MOL CANCER., vol. 10, 7 January 2011 (2011-01-07), pages 3
BORAL ET AL., INVEST OPHTHALMOL VIS SCI., vol. 36, no. 6, 1995, pages 1056 - 66
BROEKHUYSE ET AL., EXP EYE RES., vol. 55, no. 3, 1992, pages 401 - 11
CASADEVALL ET AL., CURR OPIN MICROBIOL., vol. 3, no. 4, August 2000 (2000-08-01), pages 354 - 8
CONNIOT ET AL., FRONT CHEM, vol. 2, 2014, pages 105
CUI ET AL., BIOMACROMOLECULES, vol. 13, no. 8, 13 August 2012 (2012-08-13), pages 2225 - 2228
CUI ET AL., NANO, vol. 10, no. 05, 1 July 2015 (2015-07-01), pages 1530003 - 1,1530003-23
EISENHOFER, FASEB J, vol. 17, no. 10, 2003, pages 1248 - 55
ELEFTHERIANOS ET AL., J INNATE IMMUN, vol. 3, 2011, pages 28 - 33
FOGED ET AL., EUR J PHARM SCI., vol. 45, no. 4, 12 March 2012 (2012-03-12), pages 482 - 91
FUJITA ET AL., CHEM CENT J, vol. 5, no. 1, 2011, pages 48
FUJITA ET AL.: "Chemistry Central Journal", vol. 5, 23 August 2011, BIOMED CENTRAL LTD, pages: 48
GUVENDIREN ET AL., ADHES, vol. 85, no. 9, 2009, pages 631 - 645
HAESHIN LEE ET AL: "FACILE CONJUGATION OF BIOMOLECULES ONTO SURFACE ADHESIVE PROTEIN INSPIRED COATINGS", ADVANCED MATERIALS, WILEY - V C H VERLAG GMBH & CO. KGAA, DE, vol. 21, no. 4, 26 January 2009 (2009-01-26), pages 431 - 434, XP002664003, ISSN: 0935-9648, [retrieved on 20081125], DOI: 10.1002/ADMA.200801222 *
JIWEI CUI ET AL: "Immobilization and Intracellular Delivery of an Anticancer Drug Using Mussel-Inspired Polydopamine Capsules", BIOMACROMOLECULES, vol. 13, no. 8, 13 August 2012 (2012-08-13), US, pages 2225 - 2228, XP055260822, ISSN: 1525-7797, DOI: 10.1021/bm300835r *
JOONYOUNG PARK ET AL: "Polydopamine-Based Simple and Versatile Surface Modification of Polymeric Nano Drug Carriers", ACS NANO, vol. 8, no. 4, 22 April 2014 (2014-04-22), US, pages 3347 - 3356, XP055281188, ISSN: 1936-0851, DOI: 10.1021/nn405809c *
LANGFELDER ET AL., FUNGAL GENET BIOL., vol. 38, no. 2, 2003, pages 143 - 58
LEE ET AL., ADV MATER., vol. 21, no. 4, 2009, pages 431 - 434
LEE ET AL., ADVANCED MATERIALS, vol. 21, no. 4, 26 January 2009 (2009-01-26), pages 431 - 434
LEE ET AL., BIOMACROMOLECULES, vol. 3, 2002, pages 1038 - 1047
LIU ET AL., FREE RADIC BIOL MED., vol. 50, no. 9, 1 May 2011 (2011-05-01), pages 1177 - 85
LIU ET AL., SMALL, vol. 12, no. 13, 6 April 2016 (2016-04-06), pages 1744 - 57
M. SELA ET AL: "Studies on the Chemical Basis of the Antigenicity of Proteins 1. ANTIGENICITY OF POLYPEPTIDYL GELATINS", BIOCHEM. J., vol. 75, 1 January 1960 (1960-01-01), pages 91 - 102, XP055261301 *
MACKINTOSH ET AL., J. THEOR. BIOL., vol. 211, 2001, pages 101 - 113
MAISONNEUVE ET AL., PROC NATL ACAD SCI USA., vol. 111, no. 34, 2014, pages 12294 - 9
MITSUI ET AL., J INVEST DERMATOL., vol. 126, no. 8, 2006, pages 1804 - 12
MOHAGHEGHPOUR ET AL., CELL IMMUNOL., vol. 199, no. 1, 2000, pages 25 - 36
MOROI ET AL., PROC NATL ACAD SCI USA., vol. 97, no. 7, 2000, pages 3485 - 90
PACHECO ET AL., FRONT IMMUNOL., vol. 5, 2014, pages 117
PALUMBO ET AL., BIOCHIM BIOPHYS ACTA, vol. 1115, no. 1, 1991, pages 1 - 5
PALUMBO ET AL., BIOCHIM BIOPHYS ACTA, vol. 925, no. 2, 13 December 1986 (1986-12-13), pages 203 - 9
PARK ET AL., ACS NANO, vol. 8, no. 4, 22 April 2014 (2014-04-22), pages 3347 - 3356
PAWELEK, PIGMENT CELL RES., vol. 4, no. 2, March 1991 (1991-03-01), pages 53 - 62
QI LIU ET AL: "Pathogen-Mimicking Polymeric Nanoparticles based on Dopamine Polymerization as Vaccines Adjuvants Induce Robust Humoral and Cellular Immune Responses", SMALL, 1 February 2016 (2016-02-01), DE, pages n/a - n/a, XP055260724, ISSN: 1613-6810, DOI: 10.1002/smll.201503662 *
ROSAS ET AL., CLIN DIAGN LAB IMMUNOL., vol. 9, no. 1, 2002, pages 144 - 8
RUTH ARNON ET AL: "Studies on the chemical basis of the antigenicity of proteins. 2. Antigenic specificity of polytyrosyl gelatins", BIOCHEMICAL JOURNAL, vol. 75, no. 1, 1 April 1960 (1960-04-01), GB, pages 103 - 109, XP055261072, ISSN: 0264-6021, DOI: 10.1042/bj0750103 *
SADLER; TAM, REVIEWS IN MOLECULAR BIOTECHNOLOGY, vol. 90, no. 3-4, pages 195 - 229
SARKAR ET AL., BRAIN BEHAV IMMUN., vol. 24, no. 4, 2010, pages 525 - 528
SCHELLACK ET AL., VACCINE, vol. 24, 2006, pages 5461 - 5472
SCHRAERMEYER; DOHMS, PIGMENT CELL RES., vol. 9, no. 5, October 1996 (1996-10-01), pages 248 - 54
SEELBACH ET AL., ACTA BIOMATER., vol. 10, no. 10, 2014, pages 4340 - 50
SELA ET AL., BIOCHEM. J., vol. 75, 1 January 1960 (1960-01-01), pages 91 - 102
SIEGRIST: "Vaccines", 2007, ELSEVIER
SLOMINSKI ET AL., PHYSIOL REV, vol. 84, no. 4, 2004, pages 1155 - 228
SUGUMARAN ET AL., FEBS LETT, vol. 255, no. 2, 1989, pages 345 - 9
TAM, PROC NATL ACAD SCI USA., vol. 85, no. 15, 1988, pages 5409 - 13
TANEICHI ET AL., J IMMUNOL, vol. 177, 2006, pages 2324 - 2330
VILJAKAINEN, BRIEF FUNCT GENOMICS, vol. 14, no. 6, 2015, pages 407 - 12
WAISBERG ET AL., PLOS ONE, vol. 7, no. 1, 2012, pages E29493
WANG ET AL., BIOMATERIALS, vol. 28, 2007, pages 3456 - 3468
WEI ET AL., COLLOIDS SURF B BIOINTERFACES, vol. 110, 2013, pages 22 - 8
XINYU CUI ET AL: "Polydopamine used as Hollow Capsule and Core-Shell Structures for Multiple Applications", NANO, vol. 10, no. 05, 1 July 2015 (2015-07-01), SG, pages 1530003, XP055260886, ISSN: 1793-2920, DOI: 10.1142/S1793292015300030 *
YOSHIO FUJITA ET AL: "Current status of multiple antigen-presenting peptide vaccine systems: Application of organic and inorganic nanoparticles", CHEMISTRY CENTRAL JOURNAL, BIOMED CENTRAL LTD, LO, vol. 5, no. 1, 23 August 2011 (2011-08-23), pages 48, XP021109507, ISSN: 1752-153X, DOI: 10.1186/1752-153X-5-48 *

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111246879A (en) * 2017-10-25 2020-06-05 北卡罗来纳州大学 Skin applicator for cancer photoimmunotherapy
EP3700563A4 (en) * 2017-10-25 2021-08-18 North Carolina State University SKIN APPLICATOR FOR USE IN CANCER PHOTOIMMUNOTHERAPY
CN111246879B (en) * 2017-10-25 2023-12-29 北卡罗来纳州大学 Skin applicator for cancer photoimmunotherapy
US11865178B2 (en) 2017-10-25 2024-01-09 North Carolina State University Dermal applicator for use in cancer photoimmunotherapy
EP3868401A1 (en) 2020-02-21 2021-08-25 Assistance Publique Hôpitaux de Paris Optimization of peptide-melanin binding
WO2021165306A1 (en) 2020-02-21 2021-08-26 Assistance Publique - Hôpitaux De Paris Optimization of peptide-melanin binding
US20230084978A1 (en) * 2020-02-21 2023-03-16 Assitance Publique - Hôpitaux De Paris Optimization of peptide-melanin binding
US12403189B2 (en) 2020-10-20 2025-09-02 Longhorn Vaccines And Diagnostics, Llc Immunogenic antigens
EP4382121A1 (en) 2022-12-07 2024-06-12 Altevax Vaccines against ptprz1-positive tumors
WO2024121210A1 (en) 2022-12-07 2024-06-13 Altevax Vaccines against protein tyrosine phosphatase receptor type z1 (ptprz1) -positive tumors
EP4420677A1 (en) 2023-02-22 2024-08-28 Altevax Vaccines against tert-positive tumors
WO2024175622A1 (en) 2023-02-22 2024-08-29 Altevax Vaccines against tert-positive tumors

Also Published As

Publication number Publication date
EP3173098A1 (en) 2017-05-31
RU2732118C2 (en) 2020-09-11
AU2016360902A1 (en) 2018-06-21
CA3005930C (en) 2022-11-01
LT3380120T (en) 2021-08-10
HRP20211085T1 (en) 2021-10-01
RU2018123170A (en) 2019-12-27
BR112018010692A2 (en) 2018-11-13
US11904014B2 (en) 2024-02-20
US20180333483A1 (en) 2018-11-22
RU2018123170A3 (en) 2020-03-04
EP3380120B1 (en) 2021-04-21
DK3380120T3 (en) 2021-07-12
CN108601826B (en) 2021-10-26
BR112018010692A8 (en) 2019-02-26
CA3005930A1 (en) 2017-06-01
JP2018535271A (en) 2018-11-29
PL3380120T3 (en) 2021-12-13
IL259575B (en) 2021-07-29
ES2877552T3 (en) 2021-11-17
IL259575A (en) 2018-07-31
US10857227B2 (en) 2020-12-08
CN108601826A (en) 2018-09-28
SI3380120T1 (en) 2021-11-30
HUE055517T2 (en) 2021-12-28
US20210060156A1 (en) 2021-03-04
EP3380120A1 (en) 2018-10-03
PT3380120T (en) 2021-06-24
JP7033539B2 (en) 2022-03-10
KR20180082593A (en) 2018-07-18
AU2016360902B2 (en) 2023-03-09
KR102448132B1 (en) 2022-09-27

Similar Documents

Publication Publication Date Title
US11904014B2 (en) Immunostimulatory compositions
Rad-Malekshahi et al. Self-assembling peptide epitopes as novel platform for anticancer vaccination
US20090285901A1 (en) Polyamino acid for use as adjuvant
CN105873585A (en) Compound and method for vaccination and immunisation
Kapadia et al. Extending antigen release from particulate vaccines results in enhanced antitumor immune response
Cao et al. Photosensitizer-induced self-assembly of antigens as nanovaccines for cancer immunotherapy
US20230084978A1 (en) Optimization of peptide-melanin binding
Stahl et al. Enzyme-triggered antigen release enhances cross-presentation by dendritic cells
HK1261561B (en) Immunostimulatory compositions
HK1261561A1 (en) Immunostimulatory compositions
Yin et al. Vaccine adjuvant platform and fluorescence imaging of amphiphilic γ-PGA-IMQ-LA-FL conjugates
JP2026502065A (en) Vaccine for receptor-type protein tyrosine phosphatase Z1 (PTPRZ1)-positive tumors
Yin et al. Vaccine adjuvant platform and fluorescence imaging of amphiphilic c-PGA-IMQ-LA-FL conjugates1
US20170042989A1 (en) Photosensitized trypanosomatids and vaccine compositions thereof
JP2026507024A (en) Vaccine for TERT-positive tumors
Cuzzubbo et al. Applications of Melanin and Melanin-Like Nanoparticles in Cancer Therapy: A Review of Recent Advances. Cancers 2021, 13, 1463

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16801468

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3005930

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 259575

Country of ref document: IL

Ref document number: 15778929

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 2018546753

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112018010692

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2016360902

Country of ref document: AU

Date of ref document: 20161125

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20187018135

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020187018135

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2016801468

Country of ref document: EP

Ref document number: 2018123170

Country of ref document: RU

ENP Entry into the national phase

Ref document number: 112018010692

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20180525